1P4TA

Crystal structure of neisserial surface protein a (nspa)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
155
structure length
155
Chain Sequence
EGASGFYVQADAAHAKASSSLGSAKGFSPRISAGYRINDLRFAVDYTRYKNYKAPSTDFKLYSIGASAIYDFDTQSPVKPYLGARLSLNRASVDLGGSDSFSQTSIGLGVLTGVSYAVTPNVDLDAGYRYNYIGKVNTVKNVRSGELSAGVRVKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Neisserial Surface Protein A (NspA), a conserved outer membrane protein with vaccine potential
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Membrane protein
molecule keywords outer membrane protein NspA
total genus 40
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2003-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02462 Opacity Opacity family porin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1p4tA00
2GE4A 1BXWA 2JMMA 2N2MA 1QJ8A 4RLCA 3QRAA 2ERVA 2X27X 1Q9FA 2MHLA 1MM5A 1QJPA 1THQA 2F1VA 2M07A 3C5OA 1G90A 3G7GA 2MNHA 2N2LA 1MM4A 2F1TA 2M06A 2LHFA 3GP6A 4PUXA 1ORMA 1P4TA 2K0LA 1Q9GA 1QJ9A 3QRCA
chains in the Genus database with same CATH superfamily
3AAEB 2W80C 4N59A 2GE4A 4IL6O 4N75A 4AKRB 2KXPA 4C4VB 5G38A 5AFUL 4AYNA 4FUVA 2Y0LA 3EMNX 2X27X 4D5UA 3T20A 1ZHTA 1GFNA 2K4TA 1Q9FA 2XTRA 3KZIO 4KR4A 3O0EA 4B61A 2WJQA 2Y7SA 4UB8O 4CTDA 5GTHO 3UU2A 2FGRA 3WU2O 1PHOA 2M07A 1HXXA 2OMFA 3PORA 4D64A 2Y2XA 1ZHXA 2XTQA 4RJXA 3AA7A 3PQUA 4AYMC 2LHFA 4UB6O 4KRAA 3AAAB 3HW9A 3PGRA 2PORA 5PRNA 2K0LA 4AUIA 2JQYA 4O4XA 4K3CA 1E54A 3TZGA 3HOEA 2IWVA 1OSMA 5DL8A 5B66O 3DA4A 4O3WA 5KAFO 5G26A 5TISO 2XE1A 3K19A 4RJWA 3LK41 5AFUK 2J1NA 3DWNA 1BH3A 3AA0B 4QQ1A 2ZFGA 4FZNA 2AXTO 3POXA 4FT6A 3PRNA 2MHLA 1QJPA 2QTKA 2KC0A 3A0HO 4GF4A 3AA6B 1THQA 3DWOX 5EE2A 3NJTA 4LSHA 4O3YA 2R4LA 2YPVA 1HXUA 3BRZA 3JTYA 2R4NA 4FESA 4AYEC 3SYBA 1GFMA 5E79O 5GV0A 2YNKA 2MNHA 3SY9A 4AYID 3LK42 2KXPB 4C4VA 2O4VA 3LK2A 2R89A 4C69X 4FRXA 3POQA 4GHBA 4FMSA 4LSFA 1GFQA 3DZMA 3LK3B 3BRYA 4JCHA 5JDPA 3VY9X 2FGQX 2WJRA 4FQEA 3WI4A 2R8AA 1YS5A 3LK3A 5H2FO 2Y0HA 4LSEA 3V8UA 2KDYA 2LFUA 4XNLA 5G39A 3A2SX 4N58A 8PRNA 3QRAA 2ERVA 1T1LA 4O49A 3T24A 5D5DA 4AYDC 4O3ZA 1GFPA 1ZHYA 5IYUA 1MM5A 2R4OA 5DL6A 2XE2A 5B5EO 1GFOA 2WVPA 2R88A 4BUMX 4FZMA 3AA6A 5GTIO 4O3XB 1HXTA 3PQSA 3LK2B 5FVNA 3A0BO 2KZ7A 3AAAA 3BS0A 1G90A 2XE3A 4G76A 5ADXL 1H6S1 1MPFA 3AA0A 3G7GA 3HOLA 4AFKA 2F1TA 3VZWX 4C00A 4Z3TA 3UAQA 3GP6A 1ZHWA 2R4PA 6PRNA 1BT9A 1IZNA 1ORMA 1ZHZA 2X9KA 3AAEA 3SY7A 4AKRA 1Q9GA 4KR8A 3T0SA 2PRNA 2W81C 3NSGA 3SZVA 3PF1A 3RBHA 4XNKA 4FSOA 5KAIO 1PRNA 1IZNB 3POUA 2XE5A 1BXWA 4G75A 2JMMA 2N2MA 2ODJA 4FOZA 1QJ8A 4FSPA 4GCSA 1T16A 4O4UA 5G3AA 1S5LO 4RLCA 3VE2A 4JFBA 4RL9A 4K3BA 3VZUX 4D65A 3HWBA 5T5FA 2KZ7B 3AA1A 4E1TA 1OPFA 3UPGA 2XMXA 3PGSA 3SYSA 2F1VA 2F1CX 4U9CA 4N74A 3FYXA 4AZLA 3AA7B 4PR7A 3VZTX 7PRNA 2IWWA 3C5OA 3JCUO 3DA3A 4GCQA 4F4BA 5DL5A 2N2LA 1MM4A 2J4UP 4GCPA 2M06A 5DL7A 3KVDD 3VE1A 4AKMA 4E1SA 2Y0KA 4FRTA 4PUXA 4RLBA 3WI5A 4PJ0O 4LSIA 2ZLDA 1P4TA 3PGUA 3SZDA 1QJ9A 3QRCA 3VY8X 5ADXK 2XG6A 3AA1B 4FZLA
chains in the Genus database with same CATH topology
3AAEB 2W80C 4AKRB 2GE4A 2KXPA 5AFUL 4AYNA 4FUVA 2Y0LA 3EMNX 2X27X 4D5UA 3T20A 1ZHTA 1GFNA 2K4TA 1Q9FA 2XTRA 4KR4A 3O0EA 4B61A 2Y7SA 3UU2A 2FGRA 1PHOA 2M07A 1HXXA 2OMFA 3PORA 4D64A 2Y2XA 1ZHXA 2XTQA 4RJXA 3AA7A 3PQUA 4AYMC 2LHFA 4KRAA 3AAAB 3HW9A 2PORA 5PRNA 2K0LA 4AUIA 4O4XA 1E54A 3TZGA 3HOEA 5DL8A 1OSMA 3DA4A 4O3WA 5AFUK 5G26A 2XE1A 3K19A 4RJWA 3LK41 2J1NA 1BH3A 3AA0B 4QQ1A 2ZFGA 4FZNA 3POXA 4FT6A 3PRNA 2MHLA 1QJPA 2QTKA 2KC0A 4GF4A 3AA6B 1THQA 5EE2A 4LSHA 4O3YA 2YPVA 1HXUA 3JTYA 4AYEC 4FESA 3SYBA 1GFMA 5GV0A 2YNKA 2MNHA 3SY9A 4AYID 3LK42 2KXPB 2O4VA 3LK2A 4C69X 4FRXA 3POQA 4GHBA 4FMSA 4LSFA 1GFQA 3LK3B 4JCHA 5JDPA 3VY9X 2FGQX 3WI4A 1YS5A 3LK3A 2Y0HA 4LSEA 3V8UA 2KDYA 2LFUA 4XNLA 8PRNA 3A2SX 4N58A 3QRAA 2ERVA 4O49A 3T24A 5D5DA 4AYDC 4O3ZA 1GFPA 1ZHYA 5IYUA 1MM5A 5DL6A 2XE2A 1GFOA 4BUMX 4FZMA 3AA6A 4O3XB 1HXTA 3PQSA 3LK2B 5FVNA 3AAAA 2KZ7A 1G90A 2XE3A 4G76A 5ADXL 1H6S1 1MPFA 3AA0A 3G7GA 3HOLA 4AFKA 2F1TA 3VZWX 4Z3TA 3UAQA 3GP6A 1ZHWA 6PRNA 1BT9A 1IZNA 1ORMA 1ZHZA 3AAEA 3SY7A 4AKRA 1Q9GA 4KR8A 3T0SA 2PRNA 2W81C 3NSGA 3SZVA 3RBHA 4XNKA 4FSOA 1PRNA 1IZNB 3POUA 2XE5A 1BXWA 4G75A 2JMMA 2N2MA 2ODJA 4FOZA 1QJ8A 4FSPA 4GCSA 4N59A 4O4UA 4RLCA 3VE2A 3VZUX 4JFBA 4RL9A 4D65A 3HWBA 5T5FA 2KZ7B 3AA1A 4E1TA 1OPFA 3UPGA 2XMXA 3SYSA 2F1VA 4U9CA 3FYXA 4AZLA 3AA7B 3VZTX 7PRNA 3C5OA 3DA3A 4GCQA 4F4BA 5DL5A 2N2LA 1MM4A 2J4UP 4GCPA 2M06A 5DL7A 3KVDD 3VE1A 4AKMA 4E1SA 2Y0KA 4FRTA 4PUXA 4RLBA 3WI5A 4LSIA 2ZLDA 1P4TA 3SZDA 1QJ9A 3QRCA 3VY8X 5ADXK 2XG6A 3AA1B 4FZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GE4 A;  1BXW A;  2JMM A;  2N2M A;  1QJ8 A;  4RLC A;  3QRA A;  2ERV A;  2X27 X;  1Q9F A;  2MHL A;  1MM5 A;  1QJP A;  1THQ A;  2F1V A;  2M07 A;  3C5O A;  1G90 A;  3G7G A;  2MNH A;  2N2L A;  1MM4 A;  2F1T A;  2M06 A;  2LHF A;  3GP6 A;  4PUX A;  1ORM A;  1P4T A;  2K0L A;  1Q9G A;  1QJ9 A;  3QRC A; 
#chains in the Genus database with same CATH topology
 3AAE B;  2W80 C;  4N59 A;  2GE4 A;  4IL6 O;  4N75 A;  4AKR B;  2KXP A;  4C4V B;  5G38 A;  5AFU L;  4AYN A;  4FUV A;  2Y0L A;  3EMN X;  2X27 X;  4D5U A;  3T20 A;  1ZHT A;  1GFN A;  2K4T A;  1Q9F A;  2XTR A;  3KZI O;  4KR4 A;  3O0E A;  4B61 A;  2WJQ A;  2Y7S A;  4UB8 O;  4CTD A;  5GTH O;  3UU2 A;  2FGR A;  3WU2 O;  1PHO A;  2M07 A;  1HXX A;  2OMF A;  3POR A;  4D64 A;  2Y2X A;  1ZHX A;  2XTQ A;  4RJX A;  3AA7 A;  3PQU A;  4AYM C;  2LHF A;  4UB6 O;  4KRA A;  3AAA B;  3HW9 A;  3PGR A;  2POR A;  5PRN A;  2K0L A;  4AUI A;  2JQY A;  4O4X A;  4K3C A;  1E54 A;  3TZG A;  3HOE A;  2IWV A;  1OSM A;  5DL8 A;  5B66 O;  3DA4 A;  4O3W A;  5KAF O;  5G26 A;  5TIS O;  2XE1 A;  3K19 A;  4RJW A;  3LK4 1;  5AFU K;  2J1N A;  3DWN A;  1BH3 A;  3AA0 B;  4QQ1 A;  2ZFG A;  4FZN A;  2AXT O;  3POX A;  4FT6 A;  3PRN A;  2MHL A;  1QJP A;  2QTK A;  2KC0 A;  3A0H O;  4GF4 A;  3AA6 B;  1THQ A;  3DWO X;  5EE2 A;  3NJT A;  4LSH A;  4O3Y A;  2R4L A;  2YPV A;  1HXU A;  3BRZ A;  3JTY A;  2R4N A;  4FES A;  4AYE C;  3SYB A;  1GFM A;  5E79 O;  5GV0 A;  2YNK A;  2MNH A;  3SY9 A;  4AYI D;  3LK4 2;  2KXP B;  4C4V A;  2O4V A;  3LK2 A;  2R89 A;  4C69 X;  4FRX A;  3POQ A;  4GHB A;  4FMS A;  4LSF A;  1GFQ A;  3DZM A;  3LK3 B;  3BRY A;  4JCH A;  5JDP A;  3VY9 X;  2FGQ X;  2WJR A;  4FQE A;  3WI4 A;  2R8A A;  1YS5 A;  3LK3 A;  5H2F O;  2Y0H A;  4LSE A;  3V8U A;  2KDY A;  2LFU A;  4XNL A;  5G39 A;  3A2S X;  4N58 A;  8PRN A;  3QRA A;  2ERV A;  1T1L A;  4O49 A;  3T24 A;  5D5D A;  4AYD C;  4O3Z A;  1GFP A;  1ZHY A;  5IYU A;  1MM5 A;  2R4O A;  5DL6 A;  2XE2 A;  5B5E O;  1GFO A;  2WVP A;  2R88 A;  4BUM X;  4FZM A;  3AA6 A;  5GTI O;  4O3X B;  1HXT A;  3PQS A;  3LK2 B;  5FVN A;  3A0B O;  2KZ7 A;  3AAA A;  3BS0 A;  1G90 A;  2XE3 A;  4G76 A;  5ADX L;  1H6S 1;  1MPF A;  3AA0 A;  3G7G A;  3HOL A;  4AFK A;  2F1T A;  3VZW X;  4C00 A;  4Z3T A;  3UAQ A;  3GP6 A;  1ZHW A;  2R4P A;  6PRN A;  1BT9 A;  1IZN A;  1ORM A;  1ZHZ A;  2X9K A;  3AAE A;  3SY7 A;  4AKR A;  1Q9G A;  4KR8 A;  3T0S A;  2PRN A;  2W81 C;  3NSG A;  3SZV A;  3PF1 A;  3RBH A;  4XNK A;  4FSO A;  5KAI O;  1PRN A;  1IZN B;  3POU A;  2XE5 A;  1BXW A;  4G75 A;  2JMM A;  2N2M A;  2ODJ A;  4FOZ A;  1QJ8 A;  4FSP A;  4GCS A;  1T16 A;  4O4U A;  5G3A A;  1S5L O;  4RLC A;  3VE2 A;  4JFB A;  4RL9 A;  4K3B A;  3VZU X;  4D65 A;  3HWB A;  5T5F A;  2KZ7 B;  3AA1 A;  4E1T A;  1OPF A;  3UPG A;  2XMX A;  3PGS A;  3SYS A;  2F1V A;  2F1C X;  4U9C A;  4N74 A;  3FYX A;  4AZL A;  3AA7 B;  4PR7 A;  3VZT X;  7PRN A;  2IWW A;  3C5O A;  3JCU O;  3DA3 A;  4GCQ A;  4F4B A;  5DL5 A;  2N2L A;  1MM4 A;  2J4U P;  4GCP A;  2M06 A;  5DL7 A;  3KVD D;  3VE1 A;  4AKM A;  4E1S A;  2Y0K A;  4FRT A;  4PUX A;  4RLB A;  3WI5 A;  4PJ0 O;  4LSI A;  2ZLD A;  1P4T A;  3PGU A;  3SZD A;  1QJ9 A;  3QRC A;  3VY8 X;  5ADX K;  2XG6 A;  3AA1 B;  4FZL A; 
#chains in the Genus database with same CATH homology
 3AAE B;  2W80 C;  4AKR B;  2GE4 A;  2KXP A;  5AFU L;  4AYN A;  4FUV A;  2Y0L A;  3EMN X;  2X27 X;  4D5U A;  3T20 A;  1ZHT A;  1GFN A;  2K4T A;  1Q9F A;  2XTR A;  4KR4 A;  3O0E A;  4B61 A;  2Y7S A;  3UU2 A;  2FGR A;  1PHO A;  2M07 A;  1HXX A;  2OMF A;  3POR A;  4D64 A;  2Y2X A;  1ZHX A;  2XTQ A;  4RJX A;  3AA7 A;  3PQU A;  4AYM C;  2LHF A;  4KRA A;  3AAA B;  3HW9 A;  2POR A;  5PRN A;  2K0L A;  4AUI A;  4O4X A;  1E54 A;  3TZG A;  3HOE A;  5DL8 A;  1OSM A;  3DA4 A;  4O3W A;  5AFU K;  5G26 A;  2XE1 A;  3K19 A;  4RJW A;  3LK4 1;  2J1N A;  1BH3 A;  3AA0 B;  4QQ1 A;  2ZFG A;  4FZN A;  3POX A;  4FT6 A;  3PRN A;  2MHL A;  1QJP A;  2QTK A;  2KC0 A;  4GF4 A;  3AA6 B;  1THQ A;  5EE2 A;  4LSH A;  4O3Y A;  2YPV A;  1HXU A;  3JTY A;  4AYE C;  4FES A;  3SYB A;  1GFM A;  5GV0 A;  2YNK A;  2MNH A;  3SY9 A;  4AYI D;  3LK4 2;  2KXP B;  2O4V A;  3LK2 A;  4C69 X;  4FRX A;  3POQ A;  4GHB A;  4FMS A;  4LSF A;  1GFQ A;  3LK3 B;  4JCH A;  5JDP A;  3VY9 X;  2FGQ X;  3WI4 A;  1YS5 A;  3LK3 A;  2Y0H A;  4LSE A;  3V8U A;  2KDY A;  2LFU A;  4XNL A;  8PRN A;  3A2S X;  4N58 A;  3QRA A;  2ERV A;  4O49 A;  3T24 A;  5D5D A;  4AYD C;  4O3Z A;  1GFP A;  1ZHY A;  5IYU A;  1MM5 A;  5DL6 A;  2XE2 A;  1GFO A;  4BUM X;  4FZM A;  3AA6 A;  4O3X B;  1HXT A;  3PQS A;  3LK2 B;  5FVN A;  3AAA A;  2KZ7 A;  1G90 A;  2XE3 A;  4G76 A;  5ADX L;  1H6S 1;  1MPF A;  3AA0 A;  3G7G A;  3HOL A;  4AFK A;  2F1T A;  3VZW X;  4Z3T A;  3UAQ A;  3GP6 A;  1ZHW A;  6PRN A;  1BT9 A;  1IZN A;  1ORM A;  1ZHZ A;  3AAE A;  3SY7 A;  4AKR A;  1Q9G A;  4KR8 A;  3T0S A;  2PRN A;  2W81 C;  3NSG A;  3SZV A;  3RBH A;  4XNK A;  4FSO A;  1PRN A;  1IZN B;  3POU A;  2XE5 A;  1BXW A;  4G75 A;  2JMM A;  2N2M A;  2ODJ A;  4FOZ A;  1QJ8 A;  4FSP A;  4GCS A;  4N59 A;  4O4U A;  4RLC A;  3VE2 A;  3VZU X;  4JFB A;  4RL9 A;  4D65 A;  3HWB A;  5T5F A;  2KZ7 B;  3AA1 A;  4E1T A;  1OPF A;  3UPG A;  2XMX A;  3SYS A;  2F1V A;  4U9C A;  3FYX A;  4AZL A;  3AA7 B;  3VZT X;  7PRN A;  3C5O A;  3DA3 A;  4GCQ A;  4F4B A;  5DL5 A;  2N2L A;  1MM4 A;  2J4U P;  4GCP A;  2M06 A;  5DL7 A;  3KVD D;  3VE1 A;  4AKM A;  4E1S A;  2Y0K A;  4FRT A;  4PUX A;  4RLB A;  3WI5 A;  4LSI A;  2ZLD A;  1P4T A;  3SZD A;  1QJ9 A;  3QRC A;  3VY8 X;  5ADX K;  2XG6 A;  3AA1 B;  4FZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...