1P4TA

Crystal structure of neisserial surface protein a (nspa)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
155
structure length
155
Chain Sequence
EGASGFYVQADAAHAKASSSLGSAKGFSPRISAGYRINDLRFAVDYTRYKNYKAPSTDFKLYSIGASAIYDFDTQSPVKPYLGARLSLNRASVDLGGSDSFSQTSIGLGVLTGVSYAVTPNVDLDAGYRYNYIGKVNTVKNVRSGELSAGVRVKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords outer membrane protein NspA
publication title Crystal structure of Neisserial Surface Protein A (NspA), a conserved outer membrane protein with vaccine potential
pubmed doi rcsb
source organism Neisseria meningitidis
total genus 40
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2003-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02462 Opacity Opacity family porin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1p4tA00
1MM4A 3GP6A 2F1VA 1Q9FA 3QRAA 2GE4A 2M07A 2JMMA 2N2MA 1THQA 2N2LA 1G90A 1QJ9A 2LHFA 3QRCA 4RLCA 1Q9GA 1P4TA 2K0LA 1BXWA 4PUXA 2ERVA 1QJ8A 1QJPA 2MHLA 3G7GA 3C5OA 2F1TA 2X27X 1MM5A 1ORMA 2MNHA 2M06A
chains in the Genus database with same CATH superfamily
3LK2B 4XNKA 4AUIA 3AA6A 2XTRA 2XE1A 1OSMA 4FT6A 3TZGA 4O3XB 2PORA 3DA4A 5G26A 3GP6A 2O4VA 1HXXA 2F1VA 1Q9FA 2XMXA 3PGUA 4O3WA 3NSGA 3VE2A 4AZLA 2IWWA 1T1LA 2AXTO 3PF1A 2N2MA 5T5FA 1THQA 1ZHTA 2WVPA 5AFUL 4G76A 1GFMA 2XE2A 4K3CA 4UB8O 3T20A 2OMFA 3POUA 3QRCA 4LSIA 3HW9A 3JCUO 5GTHO 5H2FO 2Y7SA 3PGRA 2KZ7B 1BXWA 5G38A 1GFOA 4U9CA 4JFBA 2ERVA 3A0BO 5DL7A 4CTDA 2KXPB 1QJPA 3VE1A 3HOEA 3VY8X 5GV0A 2R88A 2Y0LA 2X27X 8PRNA 1GFQA 1ZHYA 1ORMA 2ZFGA 4FESA 4RJWA 2R4NA 4FRXA 4FZMA 4D65A 2XE5A 3A0HO 3LK3B 4AKRA 4FRTA 4GF4A 4RJXA 4O4XA 3HOLA 2IWVA 1ZHWA 4AYNA 4PJ0O 7PRNA 1IZNB 2JMMA 1ZHZA 4IL6O 4PR7A 5IYUA 3VZUX 3PRNA 3AA0A 4AYEC 4AYID 3EMNX 4KR4A 3DZMA 4LSHA 5FVNA 4FMSA 2LHFA 4C00A 5KAIO 2JQYA 3AAEB 3KZIO 2X9KA 4F4BA 4FOZA 4K3BA 1HXUA 4C4VB 1BT9A 5PRNA 5ADXK 3T0SA 3WI5A 1H6S1 4PUXA 3A2SX 2KC0A 1QJ8A 2Y2XA 2MHLA 4N74A 4N75A 3AA6B 3G7GA 3C5OA 3SZVA 3AAAA 3VZTX 2F1TA 2WJQA 3AA7A 3WI4A 3VZWX 4FQEA 4BUMX 4E1SA 3NJTA 2M06A 4B61A 3AA1A 1PHOA 1MM4A 4RL9A 4AYDC 5JDPA 4C69X 4FSOA 3SYBA 4GHBA 4FSPA 3O0EA 4FZLA 3QRAA 2YNKA 4AFKA 2J4UP 2R4LA 2GE4A 1OPFA 3DWOX 4FZNA 4LSFA 2M07A 3FYXA 3PQUA 5G39A 1ZHXA 2N2LA 4FUVA 5KAFO 4UB6O 4D64A 1QJ9A 2F1CX 2Y0HA 1GFPA 3BS0A 3UU2A 3V8UA 2XG6A 1Q9GA 2Y0KA 2YPVA 2K0LA 3AA7B 1HXTA 3K19A 3LK42 3WU2O 2LFUA 2R4PA 3JTYA 1YS5A 5D5DA 2R4OA 4Z3TA 2W81C 4E1TA 2KZ7A 4GCSA 4O49A 1GFNA 3KVDD 5ADXL 2WJRA 4AKRB 3BRZA 2XE3A 2QTKA 3POXA 3SY9A 2KXPA 5B66O 2R89A 3PORA 4GCPA 2K4TA 4QQ1A 3SYSA 2ZLDA 5AFUK 3SZDA 2KDYA 3AA0B 3PGSA 5G3AA 1T16A 2R8AA 2J1NA 3LK2A 4KR8A 4N59A 3LK3A 4O3YA 6PRNA 5EE2A 4LSEA 3LK41 4G75A 4D5UA 5DL8A 3UAQA 2ODJA 1G90A 2PRNA 3HWBA 4O3ZA 4RLBA 3T24A 2FGQX 3BRYA 1IZNA 4RLCA 3PQSA 5E79O 1P4TA 5TISO 3RBHA 4JCHA 2FGRA 1S5LO 3AAAB 5DL5A 4XNLA 5B5EO 1BH3A 3VY9X 2XTQA 1MPFA 3AAEA 3UPGA 4O4UA 1E54A 3DWNA 3POQA 5GTIO 3DA3A 2W80C 4GCQA 3AA1B 5DL6A 4AYMC 1PRNA 4C4VA 4N58A 4AKMA 3SY7A 4KRAA 1MM5A 2MNHA
chains in the Genus database with same CATH topology
3LK2B 4XNKA 4AUIA 3AA6A 2XTRA 2XE1A 1OSMA 4FT6A 3TZGA 4O3XB 2PORA 3DA4A 5G26A 3GP6A 2O4VA 1HXXA 2F1VA 1Q9FA 2XMXA 4O3WA 3VE2A 3NSGA 4AZLA 2N2MA 5T5FA 1THQA 1ZHTA 5AFUL 4G76A 1GFMA 2XE2A 3T20A 2OMFA 3POUA 3QRCA 4LSIA 3HW9A 2Y7SA 2KZ7B 1BXWA 1GFOA 4U9CA 4JFBA 2ERVA 5DL7A 2KXPB 1QJPA 3VE1A 3HOEA 3VY8X 5GV0A 2Y0LA 2X27X 8PRNA 1GFQA 1ZHYA 1ORMA 2ZFGA 4FESA 4RJWA 4FRXA 4FZMA 4D65A 2XE5A 3LK3B 4AKRA 4FRTA 4GF4A 4RJXA 4O4XA 3HOLA 1ZHWA 4AYNA 7PRNA 1IZNB 2JMMA 1ZHZA 5IYUA 3VZUX 3PRNA 3AA0A 4AYEC 4AYID 3EMNX 4KR4A 5FVNA 4LSHA 4FMSA 2LHFA 3AAEB 4F4BA 4FOZA 1HXUA 5ADXK 1BT9A 5PRNA 3T0SA 3WI5A 1H6S1 4PUXA 3A2SX 2KC0A 1QJ8A 2Y2XA 2MHLA 3AA6B 3G7GA 3C5OA 3SZVA 3AAAA 2F1TA 3AA7A 3WI4A 3VZWX 4BUMX 4E1SA 2M06A 4B61A 3AA1A 1PHOA 1MM4A 4RL9A 4AYDC 5JDPA 4C69X 4FSOA 3SYBA 4GHBA 4FSPA 3O0EA 4FZLA 3QRAA 2YNKA 4AFKA 2J4UP 2GE4A 1OPFA 4FZNA 4LSFA 2M07A 3FYXA 3PQUA 1ZHXA 2N2LA 4FUVA 4D64A 1QJ9A 2Y0HA 1GFPA 3UU2A 3V8UA 2XG6A 1Q9GA 2Y0KA 2YPVA 2K0LA 3AA7B 1HXTA 3K19A 3LK42 2LFUA 3JTYA 1YS5A 5D5DA 4Z3TA 2W81C 4E1TA 2KZ7A 4GCSA 4O49A 1GFNA 3KVDD 5ADXL 4AKRB 2XE3A 2QTKA 3POXA 3SY9A 2KXPA 3PORA 4GCPA 2K4TA 4QQ1A 3SYSA 2ZLDA 5AFUK 3SZDA 2KDYA 3AA0B 2J1NA 3LK2A 4KR8A 4N59A 3LK3A 4O3YA 6PRNA 5EE2A 4LSEA 3LK41 4G75A 4D5UA 5DL8A 3UAQA 2ODJA 1G90A 2PRNA 3HWBA 4O3ZA 4RLBA 3T24A 2FGQX 4RLCA 1IZNA 3RBHA 3PQSA 3VY9X 1P4TA 3VZTX 4JCHA 2FGRA 3AAAB 5DL5A 4XNLA 1BH3A 2XTQA 1MPFA 3AAEA 3UPGA 4O4UA 1E54A 3POQA 3DA3A 2W80C 4GCQA 3AA1B 5DL6A 4AYMC 1PRNA 4N58A 4AKMA 3SY7A 4KRAA 1MM5A 2MNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MM4 A;  3GP6 A;  2F1V A;  1Q9F A;  3QRA A;  2GE4 A;  2M07 A;  2JMM A;  2N2M A;  1THQ A;  2N2L A;  1G90 A;  1QJ9 A;  2LHF A;  3QRC A;  4RLC A;  1Q9G A;  1P4T A;  2K0L A;  1BXW A;  4PUX A;  2ERV A;  1QJ8 A;  1QJP A;  2MHL A;  3G7G A;  3C5O A;  2F1T A;  2X27 X;  1MM5 A;  1ORM A;  2MNH A;  2M06 A; 
#chains in the Genus database with same CATH topology
 3LK2 B;  4XNK A;  4AUI A;  3AA6 A;  2XTR A;  2XE1 A;  1OSM A;  4FT6 A;  3TZG A;  4O3X B;  2POR A;  3DA4 A;  5G26 A;  3GP6 A;  2O4V A;  1HXX A;  2F1V A;  1Q9F A;  2XMX A;  3PGU A;  4O3W A;  3NSG A;  3VE2 A;  4AZL A;  2IWW A;  1T1L A;  2AXT O;  3PF1 A;  2N2M A;  5T5F A;  1THQ A;  1ZHT A;  2WVP A;  5AFU L;  4G76 A;  1GFM A;  2XE2 A;  4K3C A;  4UB8 O;  3T20 A;  2OMF A;  3POU A;  3QRC A;  4LSI A;  3HW9 A;  3JCU O;  5GTH O;  5H2F O;  2Y7S A;  3PGR A;  2KZ7 B;  1BXW A;  5G38 A;  1GFO A;  4U9C A;  4JFB A;  2ERV A;  3A0B O;  5DL7 A;  4CTD A;  2KXP B;  1QJP A;  3VE1 A;  3HOE A;  3VY8 X;  5GV0 A;  2R88 A;  2Y0L A;  2X27 X;  8PRN A;  1GFQ A;  1ZHY A;  1ORM A;  2ZFG A;  4FES A;  4RJW A;  2R4N A;  4FRX A;  4FZM A;  4D65 A;  2XE5 A;  3A0H O;  3LK3 B;  4AKR A;  4FRT A;  4GF4 A;  4RJX A;  4O4X A;  3HOL A;  2IWV A;  1ZHW A;  4AYN A;  4PJ0 O;  7PRN A;  1IZN B;  2JMM A;  1ZHZ A;  4IL6 O;  4PR7 A;  5IYU A;  3VZU X;  3PRN A;  3AA0 A;  4AYE C;  4AYI D;  3EMN X;  4KR4 A;  3DZM A;  4LSH A;  5FVN A;  4FMS A;  2LHF A;  4C00 A;  5KAI O;  2JQY A;  3AAE B;  3KZI O;  2X9K A;  4F4B A;  4FOZ A;  4K3B A;  1HXU A;  4C4V B;  1BT9 A;  5PRN A;  5ADX K;  3T0S A;  3WI5 A;  1H6S 1;  4PUX A;  3A2S X;  2KC0 A;  1QJ8 A;  2Y2X A;  2MHL A;  4N74 A;  4N75 A;  3AA6 B;  3G7G A;  3C5O A;  3SZV A;  3AAA A;  3VZT X;  2F1T A;  2WJQ A;  3AA7 A;  3WI4 A;  3VZW X;  4FQE A;  4BUM X;  4E1S A;  3NJT A;  2M06 A;  4B61 A;  3AA1 A;  1PHO A;  1MM4 A;  4RL9 A;  4AYD C;  5JDP A;  4C69 X;  4FSO A;  3SYB A;  4GHB A;  4FSP A;  3O0E A;  4FZL A;  3QRA A;  2YNK A;  4AFK A;  2J4U P;  2R4L A;  2GE4 A;  1OPF A;  3DWO X;  4FZN A;  4LSF A;  2M07 A;  3FYX A;  3PQU A;  5G39 A;  1ZHX A;  2N2L A;  4FUV A;  5KAF O;  4UB6 O;  4D64 A;  1QJ9 A;  2F1C X;  2Y0H A;  1GFP A;  3BS0 A;  3UU2 A;  3V8U A;  2XG6 A;  1Q9G A;  2Y0K A;  2YPV A;  2K0L A;  3AA7 B;  1HXT A;  3K19 A;  3LK4 2;  3WU2 O;  2LFU A;  2R4P A;  3JTY A;  1YS5 A;  5D5D A;  2R4O A;  4Z3T A;  2W81 C;  4E1T A;  2KZ7 A;  4GCS A;  4O49 A;  1GFN A;  3KVD D;  5ADX L;  2WJR A;  4AKR B;  3BRZ A;  2XE3 A;  2QTK A;  3POX A;  3SY9 A;  2KXP A;  5B66 O;  2R89 A;  3POR A;  4GCP A;  2K4T A;  4QQ1 A;  3SYS A;  2ZLD A;  5AFU K;  3SZD A;  2KDY A;  3AA0 B;  3PGS A;  5G3A A;  1T16 A;  2R8A A;  2J1N A;  3LK2 A;  4KR8 A;  4N59 A;  3LK3 A;  4O3Y A;  6PRN A;  5EE2 A;  4LSE A;  3LK4 1;  4G75 A;  4D5U A;  5DL8 A;  3UAQ A;  2ODJ A;  1G90 A;  2PRN A;  3HWB A;  4O3Z A;  4RLB A;  3T24 A;  2FGQ X;  3BRY A;  1IZN A;  4RLC A;  3PQS A;  5E79 O;  1P4T A;  5TIS O;  3RBH A;  4JCH A;  2FGR A;  1S5L O;  3AAA B;  5DL5 A;  4XNL A;  5B5E O;  1BH3 A;  3VY9 X;  2XTQ A;  1MPF A;  3AAE A;  3UPG A;  4O4U A;  1E54 A;  3DWN A;  3POQ A;  5GTI O;  3DA3 A;  2W80 C;  4GCQ A;  3AA1 B;  5DL6 A;  4AYM C;  1PRN A;  4C4V A;  4N58 A;  4AKM A;  3SY7 A;  4KRA A;  1MM5 A;  2MNH A; 
#chains in the Genus database with same CATH homology
 3LK2 B;  4XNK A;  4AUI A;  3AA6 A;  2XTR A;  2XE1 A;  1OSM A;  4FT6 A;  3TZG A;  4O3X B;  2POR A;  3DA4 A;  5G26 A;  3GP6 A;  2O4V A;  1HXX A;  2F1V A;  1Q9F A;  2XMX A;  4O3W A;  3VE2 A;  3NSG A;  4AZL A;  2N2M A;  5T5F A;  1THQ A;  1ZHT A;  5AFU L;  4G76 A;  1GFM A;  2XE2 A;  3T20 A;  2OMF A;  3POU A;  3QRC A;  4LSI A;  3HW9 A;  2Y7S A;  2KZ7 B;  1BXW A;  1GFO A;  4U9C A;  4JFB A;  2ERV A;  5DL7 A;  2KXP B;  1QJP A;  3VE1 A;  3HOE A;  3VY8 X;  5GV0 A;  2Y0L A;  2X27 X;  8PRN A;  1GFQ A;  1ZHY A;  1ORM A;  2ZFG A;  4FES A;  4RJW A;  4FRX A;  4FZM A;  4D65 A;  2XE5 A;  3LK3 B;  4AKR A;  4FRT A;  4GF4 A;  4RJX A;  4O4X A;  3HOL A;  1ZHW A;  4AYN A;  7PRN A;  1IZN B;  2JMM A;  1ZHZ A;  5IYU A;  3VZU X;  3PRN A;  3AA0 A;  4AYE C;  4AYI D;  3EMN X;  4KR4 A;  5FVN A;  4LSH A;  4FMS A;  2LHF A;  3AAE B;  4F4B A;  4FOZ A;  1HXU A;  5ADX K;  1BT9 A;  5PRN A;  3T0S A;  3WI5 A;  1H6S 1;  4PUX A;  3A2S X;  2KC0 A;  1QJ8 A;  2Y2X A;  2MHL A;  3AA6 B;  3G7G A;  3C5O A;  3SZV A;  3AAA A;  2F1T A;  3AA7 A;  3WI4 A;  3VZW X;  4BUM X;  4E1S A;  2M06 A;  4B61 A;  3AA1 A;  1PHO A;  1MM4 A;  4RL9 A;  4AYD C;  5JDP A;  4C69 X;  4FSO A;  3SYB A;  4GHB A;  4FSP A;  3O0E A;  4FZL A;  3QRA A;  2YNK A;  4AFK A;  2J4U P;  2GE4 A;  1OPF A;  4FZN A;  4LSF A;  2M07 A;  3FYX A;  3PQU A;  1ZHX A;  2N2L A;  4FUV A;  4D64 A;  1QJ9 A;  2Y0H A;  1GFP A;  3UU2 A;  3V8U A;  2XG6 A;  1Q9G A;  2Y0K A;  2YPV A;  2K0L A;  3AA7 B;  1HXT A;  3K19 A;  3LK4 2;  2LFU A;  3JTY A;  1YS5 A;  5D5D A;  4Z3T A;  2W81 C;  4E1T A;  2KZ7 A;  4GCS A;  4O49 A;  1GFN A;  3KVD D;  5ADX L;  4AKR B;  2XE3 A;  2QTK A;  3POX A;  3SY9 A;  2KXP A;  3POR A;  4GCP A;  2K4T A;  4QQ1 A;  3SYS A;  2ZLD A;  5AFU K;  3SZD A;  2KDY A;  3AA0 B;  2J1N A;  3LK2 A;  4KR8 A;  4N59 A;  3LK3 A;  4O3Y A;  6PRN A;  5EE2 A;  4LSE A;  3LK4 1;  4G75 A;  4D5U A;  5DL8 A;  3UAQ A;  2ODJ A;  1G90 A;  2PRN A;  3HWB A;  4O3Z A;  4RLB A;  3T24 A;  2FGQ X;  4RLC A;  1IZN A;  3RBH A;  3PQS A;  3VY9 X;  1P4T A;  3VZT X;  4JCH A;  2FGR A;  3AAA B;  5DL5 A;  4XNL A;  1BH3 A;  2XTQ A;  1MPF A;  3AAE A;  3UPG A;  4O4U A;  1E54 A;  3POQ A;  3DA3 A;  2W80 C;  4GCQ A;  3AA1 B;  5DL6 A;  4AYM C;  1PRN A;  4N58 A;  4AKM A;  3SY7 A;  4KRA A;  1MM5 A;  2MNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...