1P4TA

Crystal structure of neisserial surface protein a (nspa)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
155
structure length
155
Chain Sequence
EGASGFYVQADAAHAKASSSLGSAKGFSPRISAGYRINDLRFAVDYTRYKNYKAPSTDFKLYSIGASAIYDFDTQSPVKPYLGARLSLNRASVDLGGSDSFSQTSIGLGVLTGVSYAVTPNVDLDAGYRYNYIGKVNTVKNVRSGELSAGVRVKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords outer membrane protein NspA
publication title Crystal structure of Neisserial Surface Protein A (NspA), a conserved outer membrane protein with vaccine potential
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Membrane protein
total genus 40
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2003-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02462 Opacity Opacity family porin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1p4tA00
2M07A 3QRCA 1Q9GA 2N2MA 2GE4A 1MM4A 1P4TA 3C5OA 1QJ8A 2LHFA 2M06A 1G90A 2X27X 2K0LA 3GP6A 4RLCA 3QRAA 1QJ9A 1THQA 2N2LA 2JMMA 1BXWA 2ERVA 3G7GA 4PUXA 2F1TA 2MNHA 1ORMA 2F1VA 1QJPA 1Q9FA 1MM5A 2MHLA
chains in the Genus database with same CATH superfamily
4FT6A 4LSFA 3AA0B 2J4UP 1PRNA 2Y0LA 2IWVA 2R4OA 2GE4A 3JTYA 1MM4A 1ZHYA 1ZHWA 2XE2A 3A0BO 3PF1A 2XTRA 3PGSA 3C5OA 2R88A 3EMNX 4RJWA 2X9KA 4O3ZA 1G90A 1H6S1 3VZTX 4C00A 2KC0A 4GCPA 2XG6A 2QTKA 3LK3A 5G39A 5PRNA 4C69X 2FGRA 3VY8X 2PORA 5KAIO 4GCQA 4B61A 3FYXA 5ADXL 3A0HO 1ZHZA 4RL9A 2N2LA 3DZMA 2JMMA 4G75A 2ERVA 2W81C 5GV0A 5IYUA 4LSEA 3BS0A 2XTQA 4AYMC 4XNKA 1ZHXA 3NJTA 2F1TA 4K3BA 1IZNB 2K4TA 4FRXA 4LSIA 4AUIA 4AZLA 4C4VB 2WVPA 4G76A 3POQA 4O4UA 4D5UA 2F1VA 2ODJA 3AA7A 3AA1B 4FESA 3UU2A 3VE1A 5AFUK 3LK42 1MM5A 1YS5A 2MHLA 2ZFGA 3PQSA 6PRNA 2KXPB 4O3WA 2Y7SA 3SY7A 3WU2O 3UAQA 4PJ0O 3WI5A 2JQYA 4O49A 2IWWA 4Z3TA 1BH3A 3AAAB 4KR8A 4AYEC 1S5LO 3GP6A 3T0SA 1T1LA 4GCSA 3K19A 3DWNA 3SYSA 3QRAA 1HXTA 3HW9A 3VY9X 3O0EA 1QJ9A 1THQA 4QQ1A 3PQUA 4FSOA 5DL8A 3AA6B 3G7GA 1GFNA 1GFQA 4O3YA 5DL5A 4AKRB 3BRYA 4PUXA 3SY9A 2KDYA 2YPVA 3DWOX 3POXA 4BUMX 3WI4A 4FMSA 2R4PA 4AYID 8PRNA 4C4VA 1IZNA 2R4NA 5DL6A 4U9CA 4AKMA 4PR7A 5E79O 3AAEA 3AA1A 4F4BA 3QRCA 4D64A 2N2MA 2R8AA 2Y0HA 3PORA 2J1NA 3DA3A 4O3XB 3VZUX 2KXPA 4XNLA 1P4TA 5G26A 3VE2A 1OPFA 3KVDD 2Y2XA 2F1CX 2LHFA 3AA0A 4UB8O 5D5DA 4FRTA 4RJXA 3LK41 2Y0KA 2OMFA 1BT9A 4N58A 3AAAA 3SYBA 1MPFA 1HXXA 2XE3A 3BRZA 5G3AA 5AFUL 5FVNA 1BXWA 1GFPA 5T5FA 3SZDA 4O4XA 3TZGA 3NSGA 2KZ7B 5G38A 3POUA 4AYDC 3LK2B 3T20A 3UPGA 3AA7B 4FZNA 4FUVA 4RLBA 2MNHA 2XE1A 1ORMA 3RBHA 4GF4A 2FGQX 2YNKA 3KZIO 4KRAA 5B5EO 4N75A 4K3CA 1QJPA 1Q9FA 3T24A 4E1TA 7PRNA 4D65A 1GFMA 4FQEA 2PRNA 2ZLDA 4LSHA 4FZMA 4JCHA 2M07A 5DL7A 1Q9GA 3HOLA 1ZHTA 1HXUA 4FOZA 4KR4A 3VZWX 4AFKA 5GTHO 3PGRA 3DA4A 2R4LA 1QJ8A 3LK3B 2XMXA 4AYNA 3V8UA 2M06A 1OSMA 2WJQA 3A2SX 3PGUA 3PRNA 4IL6O 2X27X 2O4VA 2W80C 4E1SA 2K0LA 3HWBA 2R89A 4FZLA 4RLCA 4N59A 4JFBA 4CTDA 3JCUO 2WJRA 1PHOA 5KAFO 4FSPA 5H2FO 4GHBA 5B66O 1T16A 4UB6O 3SZVA 2KZ7A 1E54A 3AA6A 3AAEB 3LK2A 4N74A 2LFUA 4AKRA 2AXTO 1GFOA 3HOEA 2XE5A 5ADXK 5GTIO 5TISO 5EE2A 5JDPA
chains in the Genus database with same CATH topology
4FT6A 4LSFA 3AA0B 2J4UP 1PRNA 2Y0LA 3JTYA 2GE4A 1MM4A 1ZHYA 1ZHWA 2XE2A 4RJWA 2XTRA 3C5OA 3EMNX 4O3ZA 1G90A 1H6S1 3VZTX 2KC0A 4GCPA 2XG6A 2QTKA 3LK3A 5PRNA 4C69X 2FGRA 3VY8X 2PORA 4GCQA 4B61A 3FYXA 5ADXL 1ZHZA 4RL9A 2N2LA 5GV0A 2JMMA 4G75A 2ERVA 2W81C 5IYUA 4LSEA 2XTQA 4AYMC 4XNKA 1ZHXA 2F1TA 4LSIA 1IZNB 2K4TA 4FRXA 4AUIA 4AZLA 4G76A 3POQA 4O4UA 4D5UA 2F1VA 2ODJA 3AA7A 3AA1B 4FESA 3UU2A 3VE1A 5AFUK 3LK42 1MM5A 1YS5A 2MHLA 2ZFGA 3PQSA 6PRNA 2KXPB 4O3WA 2Y7SA 3SY7A 3UAQA 3WI5A 4O49A 4Z3TA 1BH3A 3AAAB 4KR8A 4AYEC 3GP6A 3T0SA 4GCSA 3K19A 3SYSA 3QRAA 1HXTA 3HW9A 3VY9X 3O0EA 1QJ9A 1THQA 4QQ1A 3PQUA 4FSOA 5DL8A 3AA6B 3G7GA 1GFNA 1GFQA 4O3YA 5DL5A 4AKRB 3SY9A 4PUXA 2KDYA 2YPVA 3POXA 4BUMX 3WI4A 4FMSA 4AYID 8PRNA 1IZNA 5DL6A 4U9CA 4AKMA 3AAEA 3AA1A 4F4BA 3QRCA 4D64A 2N2MA 2Y0HA 3PORA 2J1NA 3DA3A 4O3XB 3VZUX 2KXPA 4XNLA 1P4TA 5G26A 3VE2A 1OPFA 3KVDD 2Y2XA 3AA0A 2LHFA 5D5DA 4FRTA 4RJXA 3LK41 2Y0KA 2OMFA 1BT9A 4N58A 3AAAA 3SYBA 1MPFA 1HXXA 2XE3A 5AFUL 5FVNA 1BXWA 1GFPA 5T5FA 4O4XA 3TZGA 3NSGA 2KZ7B 3T20A 3POUA 4AYDC 3LK2B 3AA7B 4FZNA 4FUVA 4RLBA 2MNHA 2XE1A 1ORMA 3RBHA 4GF4A 2FGQX 2YNKA 4KRAA 1QJPA 1Q9FA 3T24A 4E1TA 7PRNA 4D65A 1GFMA 2PRNA 2ZLDA 4LSHA 4FZMA 4JCHA 2M07A 5DL7A 1Q9GA 3HOLA 1ZHTA 1HXUA 4FOZA 4KR4A 3VZWX 4AFKA 3DA4A 1QJ8A 3LK3B 2XMXA 4AYNA 3V8UA 2M06A 1OSMA 3A2SX 3PRNA 3SZDA 4E1SA 3UPGA 2X27X 2O4VA 2W80C 2K0LA 3HWBA 4FZLA 4RLCA 4N59A 4JFBA 1PHOA 4FSPA 4GHBA 3SZVA 2KZ7A 1E54A 3AA6A 3AAEB 3LK2A 2LFUA 4AKRA 1GFOA 3HOEA 2XE5A 5ADXK 5EE2A 5JDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M07 A;  3QRC A;  1Q9G A;  2N2M A;  2GE4 A;  1MM4 A;  1P4T A;  3C5O A;  1QJ8 A;  2LHF A;  2M06 A;  1G90 A;  2X27 X;  2K0L A;  3GP6 A;  4RLC A;  3QRA A;  1QJ9 A;  1THQ A;  2N2L A;  2JMM A;  1BXW A;  2ERV A;  3G7G A;  4PUX A;  2F1T A;  2MNH A;  1ORM A;  2F1V A;  1QJP A;  1Q9F A;  1MM5 A;  2MHL A; 
#chains in the Genus database with same CATH topology
 4FT6 A;  4LSF A;  3AA0 B;  2J4U P;  1PRN A;  2Y0L A;  2IWV A;  2R4O A;  2GE4 A;  3JTY A;  1MM4 A;  1ZHY A;  1ZHW A;  2XE2 A;  3A0B O;  3PF1 A;  2XTR A;  3PGS A;  3C5O A;  2R88 A;  3EMN X;  4RJW A;  2X9K A;  4O3Z A;  1G90 A;  1H6S 1;  3VZT X;  4C00 A;  2KC0 A;  4GCP A;  2XG6 A;  2QTK A;  3LK3 A;  5G39 A;  5PRN A;  4C69 X;  2FGR A;  3VY8 X;  2POR A;  5KAI O;  4GCQ A;  4B61 A;  3FYX A;  5ADX L;  3A0H O;  1ZHZ A;  4RL9 A;  2N2L A;  3DZM A;  2JMM A;  4G75 A;  2ERV A;  2W81 C;  5GV0 A;  5IYU A;  4LSE A;  3BS0 A;  2XTQ A;  4AYM C;  4XNK A;  1ZHX A;  3NJT A;  2F1T A;  4K3B A;  1IZN B;  2K4T A;  4FRX A;  4LSI A;  4AUI A;  4AZL A;  4C4V B;  2WVP A;  4G76 A;  3POQ A;  4O4U A;  4D5U A;  2F1V A;  2ODJ A;  3AA7 A;  3AA1 B;  4FES A;  3UU2 A;  3VE1 A;  5AFU K;  3LK4 2;  1MM5 A;  1YS5 A;  2MHL A;  2ZFG A;  3PQS A;  6PRN A;  2KXP B;  4O3W A;  2Y7S A;  3SY7 A;  3WU2 O;  3UAQ A;  4PJ0 O;  3WI5 A;  2JQY A;  4O49 A;  2IWW A;  4Z3T A;  1BH3 A;  3AAA B;  4KR8 A;  4AYE C;  1S5L O;  3GP6 A;  3T0S A;  1T1L A;  4GCS A;  3K19 A;  3DWN A;  3SYS A;  3QRA A;  1HXT A;  3HW9 A;  3VY9 X;  3O0E A;  1QJ9 A;  1THQ A;  4QQ1 A;  3PQU A;  4FSO A;  5DL8 A;  3AA6 B;  3G7G A;  1GFN A;  1GFQ A;  4O3Y A;  5DL5 A;  4AKR B;  3BRY A;  4PUX A;  3SY9 A;  2KDY A;  2YPV A;  3DWO X;  3POX A;  4BUM X;  3WI4 A;  4FMS A;  2R4P A;  4AYI D;  8PRN A;  4C4V A;  1IZN A;  2R4N A;  5DL6 A;  4U9C A;  4AKM A;  4PR7 A;  5E79 O;  3AAE A;  3AA1 A;  4F4B A;  3QRC A;  4D64 A;  2N2M A;  2R8A A;  2Y0H A;  3POR A;  2J1N A;  3DA3 A;  4O3X B;  3VZU X;  2KXP A;  4XNL A;  1P4T A;  5G26 A;  3VE2 A;  1OPF A;  3KVD D;  2Y2X A;  2F1C X;  2LHF A;  3AA0 A;  4UB8 O;  5D5D A;  4FRT A;  4RJX A;  3LK4 1;  2Y0K A;  2OMF A;  1BT9 A;  4N58 A;  3AAA A;  3SYB A;  1MPF A;  1HXX A;  2XE3 A;  3BRZ A;  5G3A A;  5AFU L;  5FVN A;  1BXW A;  1GFP A;  5T5F A;  3SZD A;  4O4X A;  3TZG A;  3NSG A;  2KZ7 B;  5G38 A;  3POU A;  4AYD C;  3LK2 B;  3T20 A;  3UPG A;  3AA7 B;  4FZN A;  4FUV A;  4RLB A;  2MNH A;  2XE1 A;  1ORM A;  3RBH A;  4GF4 A;  2FGQ X;  2YNK A;  3KZI O;  4KRA A;  5B5E O;  4N75 A;  4K3C A;  1QJP A;  1Q9F A;  3T24 A;  4E1T A;  7PRN A;  4D65 A;  1GFM A;  4FQE A;  2PRN A;  2ZLD A;  4LSH A;  4FZM A;  4JCH A;  2M07 A;  5DL7 A;  1Q9G A;  3HOL A;  1ZHT A;  1HXU A;  4FOZ A;  4KR4 A;  3VZW X;  4AFK A;  5GTH O;  3PGR A;  3DA4 A;  2R4L A;  1QJ8 A;  3LK3 B;  2XMX A;  4AYN A;  3V8U A;  2M06 A;  1OSM A;  2WJQ A;  3A2S X;  3PGU A;  3PRN A;  4IL6 O;  2X27 X;  2O4V A;  2W80 C;  4E1S A;  2K0L A;  3HWB A;  2R89 A;  4FZL A;  4RLC A;  4N59 A;  4JFB A;  4CTD A;  3JCU O;  2WJR A;  1PHO A;  5KAF O;  4FSP A;  5H2F O;  4GHB A;  5B66 O;  1T16 A;  4UB6 O;  3SZV A;  2KZ7 A;  1E54 A;  3AA6 A;  3AAE B;  3LK2 A;  4N74 A;  2LFU A;  4AKR A;  2AXT O;  1GFO A;  3HOE A;  2XE5 A;  5ADX K;  5GTI O;  5TIS O;  5EE2 A;  5JDP A; 
#chains in the Genus database with same CATH homology
 4FT6 A;  4LSF A;  3AA0 B;  2J4U P;  1PRN A;  2Y0L A;  3JTY A;  2GE4 A;  1MM4 A;  1ZHY A;  1ZHW A;  2XE2 A;  4RJW A;  2XTR A;  3C5O A;  3EMN X;  4O3Z A;  1G90 A;  1H6S 1;  3VZT X;  2KC0 A;  4GCP A;  2XG6 A;  2QTK A;  3LK3 A;  5PRN A;  4C69 X;  2FGR A;  3VY8 X;  2POR A;  4GCQ A;  4B61 A;  3FYX A;  5ADX L;  1ZHZ A;  4RL9 A;  2N2L A;  5GV0 A;  2JMM A;  4G75 A;  2ERV A;  2W81 C;  5IYU A;  4LSE A;  2XTQ A;  4AYM C;  4XNK A;  1ZHX A;  2F1T A;  4LSI A;  1IZN B;  2K4T A;  4FRX A;  4AUI A;  4AZL A;  4G76 A;  3POQ A;  4O4U A;  4D5U A;  2F1V A;  2ODJ A;  3AA7 A;  3AA1 B;  4FES A;  3UU2 A;  3VE1 A;  5AFU K;  3LK4 2;  1MM5 A;  1YS5 A;  2MHL A;  2ZFG A;  3PQS A;  6PRN A;  2KXP B;  4O3W A;  2Y7S A;  3SY7 A;  3UAQ A;  3WI5 A;  4O49 A;  4Z3T A;  1BH3 A;  3AAA B;  4KR8 A;  4AYE C;  3GP6 A;  3T0S A;  4GCS A;  3K19 A;  3SYS A;  3QRA A;  1HXT A;  3HW9 A;  3VY9 X;  3O0E A;  1QJ9 A;  1THQ A;  4QQ1 A;  3PQU A;  4FSO A;  5DL8 A;  3AA6 B;  3G7G A;  1GFN A;  1GFQ A;  4O3Y A;  5DL5 A;  4AKR B;  3SY9 A;  4PUX A;  2KDY A;  2YPV A;  3POX A;  4BUM X;  3WI4 A;  4FMS A;  4AYI D;  8PRN A;  1IZN A;  5DL6 A;  4U9C A;  4AKM A;  3AAE A;  3AA1 A;  4F4B A;  3QRC A;  4D64 A;  2N2M A;  2Y0H A;  3POR A;  2J1N A;  3DA3 A;  4O3X B;  3VZU X;  2KXP A;  4XNL A;  1P4T A;  5G26 A;  3VE2 A;  1OPF A;  3KVD D;  2Y2X A;  3AA0 A;  2LHF A;  5D5D A;  4FRT A;  4RJX A;  3LK4 1;  2Y0K A;  2OMF A;  1BT9 A;  4N58 A;  3AAA A;  3SYB A;  1MPF A;  1HXX A;  2XE3 A;  5AFU L;  5FVN A;  1BXW A;  1GFP A;  5T5F A;  4O4X A;  3TZG A;  3NSG A;  2KZ7 B;  3T20 A;  3POU A;  4AYD C;  3LK2 B;  3AA7 B;  4FZN A;  4FUV A;  4RLB A;  2MNH A;  2XE1 A;  1ORM A;  3RBH A;  4GF4 A;  2FGQ X;  2YNK A;  4KRA A;  1QJP A;  1Q9F A;  3T24 A;  4E1T A;  7PRN A;  4D65 A;  1GFM A;  2PRN A;  2ZLD A;  4LSH A;  4FZM A;  4JCH A;  2M07 A;  5DL7 A;  1Q9G A;  3HOL A;  1ZHT A;  1HXU A;  4FOZ A;  4KR4 A;  3VZW X;  4AFK A;  3DA4 A;  1QJ8 A;  3LK3 B;  2XMX A;  4AYN A;  3V8U A;  2M06 A;  1OSM A;  3A2S X;  3PRN A;  3SZD A;  4E1S A;  3UPG A;  2X27 X;  2O4V A;  2W80 C;  2K0L A;  3HWB A;  4FZL A;  4RLC A;  4N59 A;  4JFB A;  1PHO A;  4FSP A;  4GHB A;  3SZV A;  2KZ7 A;  1E54 A;  3AA6 A;  3AAE B;  3LK2 A;  2LFU A;  4AKR A;  1GFO A;  3HOE A;  2XE5 A;  5ADX K;  5EE2 A;  5JDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...