1P4TA

Crystal structure of neisserial surface protein a (nspa)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
155
structure length
155
Chain Sequence
b'EGASGFYVQADAAHAKASSSLGSAKGFSPRISAGYRINDLRFAVDYTRYKNYKAPSTDFKLYSIGASAIYDFDTQSPVKPYLGARLSLNRASVDLGGSDSFSQTSIGLGVLTGVSYAVTPNVDLDAGYRYNYIGKVNTVKNVRSGELSAGVRVKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords outer membrane protein NspA
publication title Crystal structure of Neisserial Surface Protein A (NspA), a conserved outer membrane protein with vaccine potential
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Membrane protein
total genus 40
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2003-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02462 Opacity Opacity family porin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1p4tA00
3G7GA 2M06A 2K0LA 1ORMA 1QJ9A 2JMMA 2M07A 4PUXA 1Q9GA 2F1VA 2X27X 1P4TA 2ERVA 1Q9FA 2GE4A 1BXWA 2MHLA 2N2LA 1MM5A 1MM4A 1THQA 3QRAA 2MNHA 3GP6A 3C5OA 4RLCA 2F1TA 2N2MA 1QJPA 3QRCA 2LHFA 1G90A 1QJ8A
chains in the Genus database with same CATH superfamily
2XE1A 3O0EA 4AUIA 2XE5A 2JMMA 2R4LA 5H2FO 6PRNA 4FZNA 2F1VA 4C4VB 2R8AA 2J1NA 2YNKA 2PRNA 2AXTO 1PRNA 1ZHYA 4N74A 2Y2XA 3PRNA 4N75A 5GTHO 4PJ0O 3JCUO 4IL6O 5G26A 2Y0HA 2R89A 3PGRA 4GHBA 4O3ZA 3TZGA 4AZLA 4Z3TA 1MM5A 2Y0KA 3QRAA 4E1SA 3LK3A 3C5OA 3HOEA 4RLCA 5DL6A 3POUA 1GFQA 3NSGA 1YS5A 4GCQA 4D65A 3DWNA 3WU2O 3AAAA 8PRNA 2K4TA 3HWBA 4FSOA 3G7GA 5PRNA 4C69X 3AA0A 2R88A 5D5DA 3POQA 5GTIO 2KZ7A 2K0LA 2XE2A 3BRYA 3LK3B 3DZMA 4JFBA 4XNKA 3T0SA 5FVNA 5G3AA 1Q9GA 2IWVA 1IZNB 2XE3A 2YPVA 1P4TA 3DA3A 3KZIO 3A2SX 3PF1A 4FRXA 4FOZA 3AA7A 3POXA 4FT6A 1BXWA 3VE2A 2MHLA 4O3YA 2N2LA 3LK42 2Y0LA 4LSFA 2QTKA 4FZLA 4RL9A 1MM4A 1THQA 2X9KA 2ZFGA 2ZLDA 2KZ7B 1E54A 2MNHA 4KRAA 3SZVA 4AFKA 3VY8X 4F4BA 5KAIO 3DA4A 2J4UP 4B61A 4AKRA 1PHOA 2F1CX 3K19A 4N59A 5DL8A 1OPFA 2N2MA 4O4XA 4GCSA 1QJPA 3VZUX 3RBHA 4G76A 3T24A 3AA7B 2JQYA 3LK2A 3PGUA 4D64A 2LFUA 3EMNX 2Y7SA 5B66O 2XG6A 3HW9A 2M06A 5EE2A 2XTQA 4O4UA 5E79O 4U9CA 2KC0A 3A0BO 3VZTX 4FZMA 5DL5A 2M07A 3AA1A 4PUXA 5IYUA 1H6S1 3VE1A 4AKRB 2FGRA 2X27X 4FRTA 4RLBA 4FQEA 3SYBA 4AYDC 1S5LO 2KDYA 3VZWX 2R4OA 4LSEA 1BH3A 2GE4A 2W80C 2PORA 4UB6O 4D5UA 3LK2B 2XMXA 4RJXA 4AYNA 4BUMX 1HXXA 4AYMC 5AFUK 1MPFA 1GFOA 2ODJA 3AAAB 4O3XB 4O3WA 4RJWA 4C00A 4LSIA 3AA0B 3UAQA 3WI4A 3AAEA 3GP6A 3WI5A 4C4VA 3AA1B 3PQSA 5T5FA 2F1TA 5KAFO 4O49A 4JCHA 4FUVA 3HOLA 4PR7A 4XNLA 4AKMA 2O4VA 2XTRA 2WJRA 3QRCA 4N58A 3T20A 2LHFA 1GFPA 3SZDA 2W81C 3KVDD 3BS0A 1BT9A 3SY9A 4FMSA 2KXPA 3AA6A 4K3CA 2IWWA 2FGQX 7PRNA 3JTYA 2WVPA 4GCPA 1ORMA 1QJ9A 3AAEB 4KR4A 5AFUL 4KR8A 2WJQA 2ERVA 1GFMA 1Q9FA 3PGSA 1ZHWA 3DWOX 5DL7A 4GF4A 3V8UA 3VY9X 3PORA 5ADXL 2R4PA 2R4NA 3BRZA 4UB8O 3UPGA 2KXPB 5JDPA 3AA6B 1OSMA 1HXUA 1T16A 3NJTA 4FESA 5G38A 4CTDA 1GFNA 1IZNA 1HXTA 1T1LA 3PQUA 4LSHA 4QQ1A 3SY7A 5ADXK 5GV0A 5TISO 3FYXA 3LK41 3UU2A 4AYEC 1ZHTA 3A0HO 4AYID 5B5EO 1G90A 4E1TA 4K3BA 1ZHXA 2OMFA 4FSPA 4G75A 1ZHZA 3SYSA 1QJ8A 5G39A
chains in the Genus database with same CATH topology
2XE1A 3O0EA 4AUIA 2XE5A 2JMMA 6PRNA 4FZNA 2F1VA 2J1NA 2YNKA 2PRNA 1PRNA 1ZHYA 2Y2XA 3PRNA 5G26A 2Y0HA 4GHBA 4O3ZA 3TZGA 4AZLA 4Z3TA 1MM5A 2Y0KA 3QRAA 4E1SA 3LK3A 3C5OA 3HOEA 4RLCA 5DL6A 3POUA 1GFQA 3NSGA 1YS5A 4GCQA 4D65A 3AAAA 8PRNA 2K4TA 3HWBA 4FSOA 3G7GA 5PRNA 4C69X 3AA0A 5D5DA 3POQA 3VZWX 2KZ7A 2K0LA 2XE2A 3LK3B 4XNKA 4JFBA 3T0SA 5FVNA 1Q9GA 1IZNB 2XE3A 2YPVA 1P4TA 3DA3A 3A2SX 4FRXA 4FOZA 3AA7A 3POXA 4FT6A 1BXWA 3VE2A 2MHLA 4O3YA 2N2LA 3LK42 2Y0LA 4LSFA 2QTKA 4FZLA 4RL9A 1MM4A 1THQA 2ZFGA 2ZLDA 2KZ7B 1E54A 2MNHA 4KRAA 3SZVA 4AFKA 3VY8X 4F4BA 2J4UP 3DA4A 4B61A 4AKRA 1PHOA 3K19A 4N59A 5DL8A 1OPFA 2N2MA 4O4XA 4GCSA 1QJPA 3VZUX 3RBHA 4G76A 3T24A 3AA7B 3LK2A 4D64A 2LFUA 3EMNX 2Y7SA 2XG6A 3HW9A 2M06A 5EE2A 2XTQA 4O4UA 4U9CA 2KC0A 3VZTX 4FZMA 5DL5A 2M07A 3AA1A 4PUXA 5IYUA 1H6S1 3VE1A 4AKRB 2FGRA 2X27X 4FRTA 4RLBA 4AYDC 3SYBA 2KDYA 4LSEA 1BH3A 2GE4A 2W80C 2PORA 4D5UA 3LK2B 2XMXA 4RJXA 4AYNA 4BUMX 1HXXA 4AYMC 5AFUK 1MPFA 1GFOA 2ODJA 3AAAB 4O3XB 4O3WA 4RJWA 4LSIA 3AA0B 3UAQA 3WI4A 3AAEA 3GP6A 3WI5A 3AA1B 3PQSA 5T5FA 2F1TA 4O49A 4JCHA 4FUVA 3HOLA 4XNLA 4AKMA 2O4VA 2XTRA 3QRCA 4N58A 3T20A 2LHFA 1GFPA 3SZDA 2W81C 3KVDD 3SY9A 1BT9A 4FMSA 2KXPA 3AA6A 2FGQX 7PRNA 3JTYA 4GCPA 1ORMA 1QJ9A 3AAEB 4KR4A 5AFUL 4KR8A 2ERVA 1GFMA 1Q9FA 5DL7A 1ZHWA 3VY9X 3V8UA 4GF4A 5ADXL 3PORA 3UPGA 2KXPB 5JDPA 3AA6B 1OSMA 1HXUA 4FESA 1GFNA 1IZNA 1HXTA 3PQUA 4LSHA 4QQ1A 3SY7A 5ADXK 5GV0A 3FYXA 3LK41 3UU2A 4AYEC 1ZHTA 4AYID 1G90A 4E1TA 1ZHXA 2OMFA 4FSPA 4G75A 1ZHZA 3SYSA 1QJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G7G A;  2M06 A;  2K0L A;  1ORM A;  1QJ9 A;  2JMM A;  2M07 A;  4PUX A;  1Q9G A;  2F1V A;  2X27 X;  1P4T A;  2ERV A;  1Q9F A;  2GE4 A;  1BXW A;  2MHL A;  2N2L A;  1MM5 A;  1MM4 A;  1THQ A;  3QRA A;  2MNH A;  3GP6 A;  3C5O A;  4RLC A;  2F1T A;  2N2M A;  1QJP A;  3QRC A;  2LHF A;  1G90 A;  1QJ8 A; 
#chains in the Genus database with same CATH topology
 2XE1 A;  3O0E A;  4AUI A;  2XE5 A;  2JMM A;  2R4L A;  5H2F O;  6PRN A;  4FZN A;  2F1V A;  4C4V B;  2R8A A;  2J1N A;  2YNK A;  2PRN A;  2AXT O;  1PRN A;  1ZHY A;  4N74 A;  2Y2X A;  3PRN A;  4N75 A;  5GTH O;  4PJ0 O;  3JCU O;  4IL6 O;  5G26 A;  2Y0H A;  2R89 A;  3PGR A;  4GHB A;  4O3Z A;  3TZG A;  4AZL A;  4Z3T A;  1MM5 A;  2Y0K A;  3QRA A;  4E1S A;  3LK3 A;  3C5O A;  3HOE A;  4RLC A;  5DL6 A;  3POU A;  1GFQ A;  3NSG A;  1YS5 A;  4GCQ A;  4D65 A;  3DWN A;  3WU2 O;  3AAA A;  8PRN A;  2K4T A;  3HWB A;  4FSO A;  3G7G A;  5PRN A;  4C69 X;  3AA0 A;  2R88 A;  5D5D A;  3POQ A;  5GTI O;  2KZ7 A;  2K0L A;  2XE2 A;  3BRY A;  3LK3 B;  3DZM A;  4JFB A;  4XNK A;  3T0S A;  5FVN A;  5G3A A;  1Q9G A;  2IWV A;  1IZN B;  2XE3 A;  2YPV A;  1P4T A;  3DA3 A;  3KZI O;  3A2S X;  3PF1 A;  4FRX A;  4FOZ A;  3AA7 A;  3POX A;  4FT6 A;  1BXW A;  3VE2 A;  2MHL A;  4O3Y A;  2N2L A;  3LK4 2;  2Y0L A;  4LSF A;  2QTK A;  4FZL A;  4RL9 A;  1MM4 A;  1THQ A;  2X9K A;  2ZFG A;  2ZLD A;  2KZ7 B;  1E54 A;  2MNH A;  4KRA A;  3SZV A;  4AFK A;  3VY8 X;  4F4B A;  5KAI O;  3DA4 A;  2J4U P;  4B61 A;  4AKR A;  1PHO A;  2F1C X;  3K19 A;  4N59 A;  5DL8 A;  1OPF A;  2N2M A;  4O4X A;  4GCS A;  1QJP A;  3VZU X;  3RBH A;  4G76 A;  3T24 A;  3AA7 B;  2JQY A;  3LK2 A;  3PGU A;  4D64 A;  2LFU A;  3EMN X;  2Y7S A;  5B66 O;  2XG6 A;  3HW9 A;  2M06 A;  5EE2 A;  2XTQ A;  4O4U A;  5E79 O;  4U9C A;  2KC0 A;  3A0B O;  3VZT X;  4FZM A;  5DL5 A;  2M07 A;  3AA1 A;  4PUX A;  5IYU A;  1H6S 1;  3VE1 A;  4AKR B;  2FGR A;  2X27 X;  4FRT A;  4RLB A;  4FQE A;  3SYB A;  4AYD C;  1S5L O;  2KDY A;  3VZW X;  2R4O A;  4LSE A;  1BH3 A;  2GE4 A;  2W80 C;  2POR A;  4UB6 O;  4D5U A;  3LK2 B;  2XMX A;  4RJX A;  4AYN A;  4BUM X;  1HXX A;  4AYM C;  5AFU K;  1MPF A;  1GFO A;  2ODJ A;  3AAA B;  4O3X B;  4O3W A;  4RJW A;  4C00 A;  4LSI A;  3AA0 B;  3UAQ A;  3WI4 A;  3AAE A;  3GP6 A;  3WI5 A;  4C4V A;  3AA1 B;  3PQS A;  5T5F A;  2F1T A;  5KAF O;  4O49 A;  4JCH A;  4FUV A;  3HOL A;  4PR7 A;  4XNL A;  4AKM A;  2O4V A;  2XTR A;  2WJR A;  3QRC A;  4N58 A;  3T20 A;  2LHF A;  1GFP A;  3SZD A;  2W81 C;  3KVD D;  3BS0 A;  1BT9 A;  3SY9 A;  4FMS A;  2KXP A;  3AA6 A;  4K3C A;  2IWW A;  2FGQ X;  7PRN A;  3JTY A;  2WVP A;  4GCP A;  1ORM A;  1QJ9 A;  3AAE B;  4KR4 A;  5AFU L;  4KR8 A;  2WJQ A;  2ERV A;  1GFM A;  1Q9F A;  3PGS A;  1ZHW A;  3DWO X;  5DL7 A;  4GF4 A;  3V8U A;  3VY9 X;  3POR A;  5ADX L;  2R4P A;  2R4N A;  3BRZ A;  4UB8 O;  3UPG A;  2KXP B;  5JDP A;  3AA6 B;  1OSM A;  1HXU A;  1T16 A;  3NJT A;  4FES A;  5G38 A;  4CTD A;  1GFN A;  1IZN A;  1HXT A;  1T1L A;  3PQU A;  4LSH A;  4QQ1 A;  3SY7 A;  5ADX K;  5GV0 A;  5TIS O;  3FYX A;  3LK4 1;  3UU2 A;  4AYE C;  1ZHT A;  3A0H O;  4AYI D;  5B5E O;  1G90 A;  4E1T A;  4K3B A;  1ZHX A;  2OMF A;  4FSP A;  4G75 A;  1ZHZ A;  3SYS A;  1QJ8 A;  5G39 A; 
#chains in the Genus database with same CATH homology
 2XE1 A;  3O0E A;  4AUI A;  2XE5 A;  2JMM A;  6PRN A;  4FZN A;  2F1V A;  2J1N A;  2YNK A;  2PRN A;  1PRN A;  1ZHY A;  2Y2X A;  3PRN A;  5G26 A;  2Y0H A;  4GHB A;  4O3Z A;  3TZG A;  4AZL A;  4Z3T A;  1MM5 A;  2Y0K A;  3QRA A;  4E1S A;  3LK3 A;  3C5O A;  3HOE A;  4RLC A;  5DL6 A;  3POU A;  1GFQ A;  3NSG A;  1YS5 A;  4GCQ A;  4D65 A;  3AAA A;  8PRN A;  2K4T A;  3HWB A;  4FSO A;  3G7G A;  5PRN A;  4C69 X;  3AA0 A;  5D5D A;  3POQ A;  3VZW X;  2KZ7 A;  2K0L A;  2XE2 A;  3LK3 B;  4XNK A;  4JFB A;  3T0S A;  5FVN A;  1Q9G A;  1IZN B;  2XE3 A;  2YPV A;  1P4T A;  3DA3 A;  3A2S X;  4FRX A;  4FOZ A;  3AA7 A;  3POX A;  4FT6 A;  1BXW A;  3VE2 A;  2MHL A;  4O3Y A;  2N2L A;  3LK4 2;  2Y0L A;  4LSF A;  2QTK A;  4FZL A;  4RL9 A;  1MM4 A;  1THQ A;  2ZFG A;  2ZLD A;  2KZ7 B;  1E54 A;  2MNH A;  4KRA A;  3SZV A;  4AFK A;  3VY8 X;  4F4B A;  2J4U P;  3DA4 A;  4B61 A;  4AKR A;  1PHO A;  3K19 A;  4N59 A;  5DL8 A;  1OPF A;  2N2M A;  4O4X A;  4GCS A;  1QJP A;  3VZU X;  3RBH A;  4G76 A;  3T24 A;  3AA7 B;  3LK2 A;  4D64 A;  2LFU A;  3EMN X;  2Y7S A;  2XG6 A;  3HW9 A;  2M06 A;  5EE2 A;  2XTQ A;  4O4U A;  4U9C A;  2KC0 A;  3VZT X;  4FZM A;  5DL5 A;  2M07 A;  3AA1 A;  4PUX A;  5IYU A;  1H6S 1;  3VE1 A;  4AKR B;  2FGR A;  2X27 X;  4FRT A;  4RLB A;  4AYD C;  3SYB A;  2KDY A;  4LSE A;  1BH3 A;  2GE4 A;  2W80 C;  2POR A;  4D5U A;  3LK2 B;  2XMX A;  4RJX A;  4AYN A;  4BUM X;  1HXX A;  4AYM C;  5AFU K;  1MPF A;  1GFO A;  2ODJ A;  3AAA B;  4O3X B;  4O3W A;  4RJW A;  4LSI A;  3AA0 B;  3UAQ A;  3WI4 A;  3AAE A;  3GP6 A;  3WI5 A;  3AA1 B;  3PQS A;  5T5F A;  2F1T A;  4O49 A;  4JCH A;  4FUV A;  3HOL A;  4XNL A;  4AKM A;  2O4V A;  2XTR A;  3QRC A;  4N58 A;  3T20 A;  2LHF A;  1GFP A;  3SZD A;  2W81 C;  3KVD D;  3SY9 A;  1BT9 A;  4FMS A;  2KXP A;  3AA6 A;  2FGQ X;  7PRN A;  3JTY A;  4GCP A;  1ORM A;  1QJ9 A;  3AAE B;  4KR4 A;  5AFU L;  4KR8 A;  2ERV A;  1GFM A;  1Q9F A;  5DL7 A;  1ZHW A;  3VY9 X;  3V8U A;  4GF4 A;  5ADX L;  3POR A;  3UPG A;  2KXP B;  5JDP A;  3AA6 B;  1OSM A;  1HXU A;  4FES A;  1GFN A;  1IZN A;  1HXT A;  3PQU A;  4LSH A;  4QQ1 A;  3SY7 A;  5ADX K;  5GV0 A;  3FYX A;  3LK4 1;  3UU2 A;  4AYE C;  1ZHT A;  4AYI D;  1G90 A;  4E1T A;  1ZHX A;  2OMF A;  4FSP A;  4G75 A;  1ZHZ A;  3SYS A;  1QJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...