5DL7A

Crystal structure of acinetobacter baumannii occab3
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
402
structure length
402
Chain Sequence
IADSKAELTLRNFYFDRDYKKDPYPYTAARDWAQGLIFKGQSGYTEGTVGFGVDVLAMAGFNLMGSRADDYARSGLLPVNTDNSRDDYYGKIGITGKAKFRKNELFVGDLVPQLPTIFSSPARLFPQTYRGIRFVSNEIPNLQLEGFYVDEVRQRDSIRYTDVGTDNINHRFNKAATTDSFYTLGGSYQLKDYRLRAYHAELKDIYQQQFLGFNGKQPLNDQLNFLSDVRFFNSEETGSKKIGEVDNRHISGLFGLNYQNHTVSLGYMQSFGSTGLPFLSGTESPVVLDFMSSDYSNKDEKVYSIRYEYDFKNARIGDVSLNGLRFMTRYAKGEDIDLLQYGDQRFKEDSLEFDLGYKIPEGKLKGLGMRARFSHYRNDMPTNMTFHSANETRLNVDYTFKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Porin
publication title Structural Insights into Outer Membrane Permeability of Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii ab307-0294
molecule tags Membrane protein
total genus 115
structure length 402
sequence length 402
ec nomenclature
pdb deposition date 2015-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 5dl7A00
4D5UA 1BT9A 3POXA 3NSGA 3UPGA 4RJWA 1H6S1 3SZVA 2J1NA 4LSFA 1PRNA 2QTKA 2XE3A 1OPFA 2PORA 3HWBA 8PRNA 1GFOA 1HXUA 3SYSA 1GFPA 1GFMA 3T0SA 1E54A 2O4VA 2ZLDA 2Y0LA 2Y0HA 3SYBA 4AUIA 4C69X 4LSIA 3VY9X 2FGQX 3POQA 2XG6A 4KR8A 4FRTA 3VZTX 3PRNA 5FVNA 4GCQA 3T24A 1OSMA 4KR4A 1HXTA 7PRNA 1BH3A 4D64A 6PRNA 2XE5A 3A2SX 4JFBA 5DL5A 2K4TA 3O0EA 3PORA 4FSOA 3EMNX 3FYXA 3VY8X 5DL6A 1PHOA 4GCPA 2PRNA 2Y0KA 1GFNA 5JDPA 3HW9A 4FT6A 4GCSA 4FOZA 5PRNA 1GFQA 5DL8A 3SY7A 3UU2A 3JTYA 4FRXA 2ZFGA 1HXXA 2OMFA 2XE2A 4KRAA 2XE1A 3WI4A 4BUMX 3SY9A 2J4UP 4LSHA 4RJXA 3T20A 3VZUX 2ODJA 4LSEA 2FGRA 4FSPA 3K19A 5DL7A 3SZDA 4FMSA 3VZWX 4D65A 2Y2XA 1MPFA 3POUA 3WI5A
chains in the Genus database with same CATH superfamily
2KXPB 1Q9GA 2LFUA 2R4NA 5AFUL 4C4VA 4CTDA 2KZ7B 4D5UA 3LK2A 1BT9A 1ZHWA 3DA3A 4IL6O 4FUVA 2KDYA 3BRZA 4O49A 4RL9A 4F4BA 3VE1A 2XTQA 5KAIO 4AKMA 3POXA 3NSGA 3VE2A 1Q9FA 3LK41 3UPGA 2LHFA 4RJWA 3DA4A 4XNKA 1QJPA 4Z3TA 2KC0A 4AKRA 5B66O 2ERVA 5ADXL 2WVPA 1IZNA 1H6S1 3SZVA 2J1NA 4LSFA 1PRNA 2QTKA 2XE3A 5G26A 1OPFA 1G90A 3GP6A 2PORA 1P4TA 3HWBA 4O3ZA 8PRNA 1GFOA 1HXUA 3AA1B 3G7GA 3SYSA 2R4PA 3HOEA 4AYDC 1ZHXA 3V8UA 5D5DA 3AA7B 3QRAA 4RLCA 5GTHO 1GFPA 1ZHTA 1GFMA 1T16A 1E54A 2R88A 3AA6B 2W81C 3LK42 2O4VA 2ZLDA 4PJ0O 4G75A 1YS5A 4B61A 2YNKA 2Y0LA 4C4VB 1S5LO 5G39A 2R89A 2Y0HA 3LK2B 3SYBA 4JCHA 5KAFO 3RBHA 2N2MA 4N58A 4RLBA 3KZIO 3BRYA 4LSIA 3T0SA 4AUIA 3AAAA 2YPVA 2FGQX 3LK3A 3NJTA 3POQA 4N59A 3VY9X 3C5OA 4FESA 2XG6A 1THQA 3AAEA 4KR8A 4FRTA 3VZTX 1ORMA 4C69X 3PRNA 4GHBA 4UB6O 5H2FO 5FVNA 4GCQA 3BS0A 3T24A 4G76A 5AFUK 1IZNB 5G3AA 1OSMA 2F1TA 4KR4A 1T1LA 1HXTA 7PRNA 1MM5A 2M07A 4E1SA 5G38A 1BH3A 4D64A 4K3CA 6PRNA 2IWWA 4PUXA 2F1VA 2XE5A 3A0BO 3A2SX 4JFBA 4QQ1A 5DL5A 4N74A 2K4TA 1BXWA 2M06A 1QJ9A 4N75A 5E79O 5GTIO 3PF1A 3O0EA 2Y7SA 3DZMA 3PORA 2AXTO 5EE2A 4K3BA 5GV0A 4FSOA 3WI5A 3EMNX 4FZMA 5ADXK 2JMMA 4FZNA 3FYXA 3VY8X 5DL6A 3DWOX 1PHOA 3UAQA 4FQEA 2K0LA 3A0HO 3DWNA 4GCPA 4O4XA 2MHLA 2PRNA 3LK3B 3AA1A 4GF4A 5IYUA 3KVDD 4FZLA 2Y0KA 2R8AA 2X27X 3AAEB 1GFNA 3AA0A 2KXPA 3HW9A 3PGRA 4FT6A 4GCSA 4AKRB 4FOZA 4E1TA 3HOLA 2KZ7A 3PQSA 5PRNA 2N2LA 3PQUA 4AZLA 1GFQA 2WJRA 4AYID 4AYNA 5DL8A 5JDPA 1ZHZA 3SY7A 3UU2A 4AYMC 1QJ8A 2XTRA 3TZGA 2WJQA 4O3XB 3JTYA 4FRXA 2ZFGA 1HXXA 2OMFA 2XE2A 4KRAA 2XE1A 3WI4A 4BUMX 3SY9A 4O3WA 2J4UP 2X9KA 3JCUO 4LSHA 4RJXA 5T5FA 3T20A 2R4LA 2W80C 3VZUX 3PGUA 4O4UA 3WU2O 2XMXA 4C00A 4PR7A 2MNHA 2ODJA 4AFKA 4LSEA 2R4OA 3QRCA 2FGRA 4FSPA 2F1CX 2GE4A 1MM4A 3K19A 4FMSA 5DL7A 3AAAB 5TISO 4XNLA 3SZDA 4UB8O 5B5EO 3VZWX 4AYEC 2IWVA 4O3YA 2JQYA 3AA7A 4D65A 1ZHYA 3PGSA 4U9CA 2Y2XA 1MPFA 3POUA 3AA6A 3AA0B
chains in the Genus database with same CATH topology
2KXPB 1Q9GA 2LFUA 5AFUL 2KZ7B 4D5UA 3LK2A 1BT9A 1ZHWA 3DA3A 4FUVA 2KDYA 4O49A 4RL9A 4F4BA 3VE1A 2XTQA 4AKMA 3POXA 3NSGA 3VE2A 1Q9FA 3LK41 3UPGA 2LHFA 4RJWA 3DA4A 4XNKA 1QJPA 4Z3TA 2KC0A 4AKRA 5ADXL 2ERVA 1IZNA 1H6S1 3SZVA 2J1NA 4LSFA 1PRNA 2QTKA 2XE3A 5G26A 1OPFA 1G90A 3GP6A 2PORA 1P4TA 3HWBA 4O3ZA 8PRNA 1GFOA 1HXUA 3AA1B 3G7GA 3SYSA 3HOEA 4AYDC 1ZHXA 3V8UA 5D5DA 3AA7B 3QRAA 4RLCA 1GFPA 1ZHTA 1GFMA 3AA6B 1E54A 3T0SA 4B61A 2W81C 3LK42 2O4VA 2ZLDA 4G75A 1YS5A 2YNKA 2Y0LA 2Y0HA 3LK2B 3SYBA 4JCHA 3RBHA 2N2MA 4N58A 4RLBA 4LSIA 4AUIA 4C69X 3AAAA 2YPVA 2FGQX 3LK3A 3POQA 4N59A 3VY9X 3C5OA 4FESA 2XG6A 1THQA 3AAEA 4KR8A 4FRTA 3VZTX 1ORMA 3PRNA 4GHBA 5FVNA 4GCQA 3T24A 4G76A 5AFUK 1IZNB 1OSMA 2F1TA 4KR4A 1HXTA 7PRNA 1MM5A 2M07A 4E1SA 1BH3A 4D64A 6PRNA 4PUXA 2F1VA 2XE5A 3A2SX 4JFBA 4QQ1A 5DL5A 2K4TA 1BXWA 2M06A 1QJ9A 3O0EA 2Y7SA 5EE2A 3PORA 5GV0A 4FSOA 3WI5A 3EMNX 4FZMA 5ADXK 2JMMA 4FZNA 3FYXA 3VY8X 5DL6A 1PHOA 3UAQA 2K0LA 4GCPA 4O4XA 2MHLA 2PRNA 3LK3B 3AA1A 4GF4A 5IYUA 3KVDD 4FZLA 2Y0KA 2X27X 3AAEB 1GFNA 3AA0A 2KXPA 3HW9A 4FT6A 4GCSA 4AKRB 4E1TA 4FOZA 5JDPA 3HOLA 2KZ7A 3PQSA 5PRNA 2N2LA 3PQUA 4AZLA 1GFQA 4AYNA 4AYID 5DL8A 1ZHZA 3SY7A 3UU2A 4AYMC 1QJ8A 2XTRA 3TZGA 4O3XB 3JTYA 4FRXA 2ZFGA 1HXXA 2XE2A 2OMFA 4KRAA 2XE1A 3WI4A 4BUMX 3SY9A 4O3WA 2J4UP 4LSHA 4RJXA 5T5FA 3T20A 2W80C 3VZUX 4O4UA 2XMXA 2MNHA 2ODJA 4AFKA 4LSEA 3QRCA 2FGRA 4FSPA 2GE4A 3K19A 1MM4A 4FMSA 5DL7A 3SZDA 3AAAB 4XNLA 3VZWX 4AYEC 4O3YA 3AA7A 4D65A 1ZHYA 4U9CA 2Y2XA 1MPFA 3POUA 3AA6A 3AA0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D5U A;  1BT9 A;  3POX A;  3NSG A;  3UPG A;  4RJW A;  1H6S 1;  3SZV A;  2J1N A;  4LSF A;  1PRN A;  2QTK A;  2XE3 A;  1OPF A;  2POR A;  3HWB A;  8PRN A;  1GFO A;  1HXU A;  3SYS A;  1GFP A;  1GFM A;  3T0S A;  1E54 A;  2O4V A;  2ZLD A;  2Y0L A;  2Y0H A;  3SYB A;  4AUI A;  4C69 X;  4LSI A;  3VY9 X;  2FGQ X;  3POQ A;  2XG6 A;  4KR8 A;  4FRT A;  3VZT X;  3PRN A;  5FVN A;  4GCQ A;  3T24 A;  1OSM A;  4KR4 A;  1HXT A;  7PRN A;  1BH3 A;  4D64 A;  6PRN A;  2XE5 A;  3A2S X;  4JFB A;  5DL5 A;  2K4T A;  3O0E A;  3POR A;  4FSO A;  3EMN X;  3FYX A;  3VY8 X;  5DL6 A;  1PHO A;  4GCP A;  2PRN A;  2Y0K A;  1GFN A;  5JDP A;  3HW9 A;  4FT6 A;  4GCS A;  4FOZ A;  5PRN A;  1GFQ A;  5DL8 A;  3SY7 A;  3UU2 A;  3JTY A;  4FRX A;  2ZFG A;  1HXX A;  2OMF A;  2XE2 A;  4KRA A;  2XE1 A;  3WI4 A;  4BUM X;  3SY9 A;  2J4U P;  4LSH A;  4RJX A;  3T20 A;  3VZU X;  2ODJ A;  4LSE A;  2FGR A;  4FSP A;  3K19 A;  5DL7 A;  3SZD A;  4FMS A;  3VZW X;  4D65 A;  2Y2X A;  1MPF A;  3POU A;  3WI5 A; 
#chains in the Genus database with same CATH topology
 2KXP B;  1Q9G A;  2LFU A;  2R4N A;  5AFU L;  4C4V A;  4CTD A;  2KZ7 B;  4D5U A;  3LK2 A;  1BT9 A;  1ZHW A;  3DA3 A;  4IL6 O;  4FUV A;  2KDY A;  3BRZ A;  4O49 A;  4RL9 A;  4F4B A;  3VE1 A;  2XTQ A;  5KAI O;  4AKM A;  3POX A;  3NSG A;  3VE2 A;  1Q9F A;  3LK4 1;  3UPG A;  2LHF A;  4RJW A;  3DA4 A;  4XNK A;  1QJP A;  4Z3T A;  2KC0 A;  4AKR A;  5B66 O;  2ERV A;  5ADX L;  2WVP A;  1IZN A;  1H6S 1;  3SZV A;  2J1N A;  4LSF A;  1PRN A;  2QTK A;  2XE3 A;  5G26 A;  1OPF A;  1G90 A;  3GP6 A;  2POR A;  1P4T A;  3HWB A;  4O3Z A;  8PRN A;  1GFO A;  1HXU A;  3AA1 B;  3G7G A;  3SYS A;  2R4P A;  3HOE A;  4AYD C;  1ZHX A;  3V8U A;  5D5D A;  3AA7 B;  3QRA A;  4RLC A;  5GTH O;  1GFP A;  1ZHT A;  1GFM A;  1T16 A;  1E54 A;  2R88 A;  3AA6 B;  2W81 C;  3LK4 2;  2O4V A;  2ZLD A;  4PJ0 O;  4G75 A;  1YS5 A;  4B61 A;  2YNK A;  2Y0L A;  4C4V B;  1S5L O;  5G39 A;  2R89 A;  2Y0H A;  3LK2 B;  3SYB A;  4JCH A;  5KAF O;  3RBH A;  2N2M A;  4N58 A;  4RLB A;  3KZI O;  3BRY A;  4LSI A;  3T0S A;  4AUI A;  3AAA A;  2YPV A;  2FGQ X;  3LK3 A;  3NJT A;  3POQ A;  4N59 A;  3VY9 X;  3C5O A;  4FES A;  2XG6 A;  1THQ A;  3AAE A;  4KR8 A;  4FRT A;  3VZT X;  1ORM A;  4C69 X;  3PRN A;  4GHB A;  4UB6 O;  5H2F O;  5FVN A;  4GCQ A;  3BS0 A;  3T24 A;  4G76 A;  5AFU K;  1IZN B;  5G3A A;  1OSM A;  2F1T A;  4KR4 A;  1T1L A;  1HXT A;  7PRN A;  1MM5 A;  2M07 A;  4E1S A;  5G38 A;  1BH3 A;  4D64 A;  4K3C A;  6PRN A;  2IWW A;  4PUX A;  2F1V A;  2XE5 A;  3A0B O;  3A2S X;  4JFB A;  4QQ1 A;  5DL5 A;  4N74 A;  2K4T A;  1BXW A;  2M06 A;  1QJ9 A;  4N75 A;  5E79 O;  5GTI O;  3PF1 A;  3O0E A;  2Y7S A;  3DZM A;  3POR A;  2AXT O;  5EE2 A;  4K3B A;  5GV0 A;  4FSO A;  3WI5 A;  3EMN X;  4FZM A;  5ADX K;  2JMM A;  4FZN A;  3FYX A;  3VY8 X;  5DL6 A;  3DWO X;  1PHO A;  3UAQ A;  4FQE A;  2K0L A;  3A0H O;  3DWN A;  4GCP A;  4O4X A;  2MHL A;  2PRN A;  3LK3 B;  3AA1 A;  4GF4 A;  5IYU A;  3KVD D;  4FZL A;  2Y0K A;  2R8A A;  2X27 X;  3AAE B;  1GFN A;  3AA0 A;  2KXP A;  3HW9 A;  3PGR A;  4FT6 A;  4GCS A;  4AKR B;  4FOZ A;  4E1T A;  3HOL A;  2KZ7 A;  3PQS A;  5PRN A;  2N2L A;  3PQU A;  4AZL A;  1GFQ A;  2WJR A;  4AYI D;  4AYN A;  5DL8 A;  5JDP A;  1ZHZ A;  3SY7 A;  3UU2 A;  4AYM C;  1QJ8 A;  2XTR A;  3TZG A;  2WJQ A;  4O3X B;  3JTY A;  4FRX A;  2ZFG A;  1HXX A;  2OMF A;  2XE2 A;  4KRA A;  2XE1 A;  3WI4 A;  4BUM X;  3SY9 A;  4O3W A;  2J4U P;  2X9K A;  3JCU O;  4LSH A;  4RJX A;  5T5F A;  3T20 A;  2R4L A;  2W80 C;  3VZU X;  3PGU A;  4O4U A;  3WU2 O;  2XMX A;  4C00 A;  4PR7 A;  2MNH A;  2ODJ A;  4AFK A;  4LSE A;  2R4O A;  3QRC A;  2FGR A;  4FSP A;  2F1C X;  2GE4 A;  1MM4 A;  3K19 A;  4FMS A;  5DL7 A;  3AAA B;  5TIS O;  4XNL A;  3SZD A;  4UB8 O;  5B5E O;  3VZW X;  4AYE C;  2IWV A;  4O3Y A;  2JQY A;  3AA7 A;  4D65 A;  1ZHY A;  3PGS A;  4U9C A;  2Y2X A;  1MPF A;  3POU A;  3AA6 A;  3AA0 B; 
#chains in the Genus database with same CATH homology
 2KXP B;  1Q9G A;  2LFU A;  5AFU L;  2KZ7 B;  4D5U A;  3LK2 A;  1BT9 A;  1ZHW A;  3DA3 A;  4FUV A;  2KDY A;  4O49 A;  4RL9 A;  4F4B A;  3VE1 A;  2XTQ A;  4AKM A;  3POX A;  3NSG A;  3VE2 A;  1Q9F A;  3LK4 1;  3UPG A;  2LHF A;  4RJW A;  3DA4 A;  4XNK A;  1QJP A;  4Z3T A;  2KC0 A;  4AKR A;  5ADX L;  2ERV A;  1IZN A;  1H6S 1;  3SZV A;  2J1N A;  4LSF A;  1PRN A;  2QTK A;  2XE3 A;  5G26 A;  1OPF A;  1G90 A;  3GP6 A;  2POR A;  1P4T A;  3HWB A;  4O3Z A;  8PRN A;  1GFO A;  1HXU A;  3AA1 B;  3G7G A;  3SYS A;  3HOE A;  4AYD C;  1ZHX A;  3V8U A;  5D5D A;  3AA7 B;  3QRA A;  4RLC A;  1GFP A;  1ZHT A;  1GFM A;  3AA6 B;  1E54 A;  3T0S A;  4B61 A;  2W81 C;  3LK4 2;  2O4V A;  2ZLD A;  4G75 A;  1YS5 A;  2YNK A;  2Y0L A;  2Y0H A;  3LK2 B;  3SYB A;  4JCH A;  3RBH A;  2N2M A;  4N58 A;  4RLB A;  4LSI A;  4AUI A;  4C69 X;  3AAA A;  2YPV A;  2FGQ X;  3LK3 A;  3POQ A;  4N59 A;  3VY9 X;  3C5O A;  4FES A;  2XG6 A;  1THQ A;  3AAE A;  4KR8 A;  4FRT A;  3VZT X;  1ORM A;  3PRN A;  4GHB A;  5FVN A;  4GCQ A;  3T24 A;  4G76 A;  5AFU K;  1IZN B;  1OSM A;  2F1T A;  4KR4 A;  1HXT A;  7PRN A;  1MM5 A;  2M07 A;  4E1S A;  1BH3 A;  4D64 A;  6PRN A;  4PUX A;  2F1V A;  2XE5 A;  3A2S X;  4JFB A;  4QQ1 A;  5DL5 A;  2K4T A;  1BXW A;  2M06 A;  1QJ9 A;  3O0E A;  2Y7S A;  5EE2 A;  3POR A;  5GV0 A;  4FSO A;  3WI5 A;  3EMN X;  4FZM A;  5ADX K;  2JMM A;  4FZN A;  3FYX A;  3VY8 X;  5DL6 A;  1PHO A;  3UAQ A;  2K0L A;  4GCP A;  4O4X A;  2MHL A;  2PRN A;  3LK3 B;  3AA1 A;  4GF4 A;  5IYU A;  3KVD D;  4FZL A;  2Y0K A;  2X27 X;  3AAE B;  1GFN A;  3AA0 A;  2KXP A;  3HW9 A;  4FT6 A;  4GCS A;  4AKR B;  4E1T A;  4FOZ A;  5JDP A;  3HOL A;  2KZ7 A;  3PQS A;  5PRN A;  2N2L A;  3PQU A;  4AZL A;  1GFQ A;  4AYN A;  4AYI D;  5DL8 A;  1ZHZ A;  3SY7 A;  3UU2 A;  4AYM C;  1QJ8 A;  2XTR A;  3TZG A;  4O3X B;  3JTY A;  4FRX A;  2ZFG A;  1HXX A;  2XE2 A;  2OMF A;  4KRA A;  2XE1 A;  3WI4 A;  4BUM X;  3SY9 A;  4O3W A;  2J4U P;  4LSH A;  4RJX A;  5T5F A;  3T20 A;  2W80 C;  3VZU X;  4O4U A;  2XMX A;  2MNH A;  2ODJ A;  4AFK A;  4LSE A;  3QRC A;  2FGR A;  4FSP A;  2GE4 A;  3K19 A;  1MM4 A;  4FMS A;  5DL7 A;  3SZD A;  3AAA B;  4XNL A;  3VZW X;  4AYE C;  4O3Y A;  3AA7 A;  4D65 A;  1ZHY A;  4U9C A;  2Y2X A;  1MPF A;  3POU A;  3AA6 A;  3AA0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...