5DL7A

Crystal structure of acinetobacter baumannii occab3
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
402
structure length
402
Chain Sequence
b'IADSKAELTLRNFYFDRDYKKDPYPYTAARDWAQGLIFKGQSGYTEGTVGFGVDVLAMAGFNLMGSRADDYARSGLLPVNTDNSRDDYYGKIGITGKAKFRKNELFVGDLVPQLPTIFSSPARLFPQTYRGIRFVSNEIPNLQLEGFYVDEVRQRDSIRYTDVGTDNINHRFNKAATTDSFYTLGGSYQLKDYRLRAYHAELKDIYQQQFLGFNGKQPLNDQLNFLSDVRFFNSEETGSKKIGEVDNRHISGLFGLNYQNHTVSLGYMQSFGSTGLPFLSGTESPVVLDFMSSDYSNKDEKVYSIRYEYDFKNARIGDVSLNGLRFMTRYAKGEDIDLLQYGDQRFKEDSLEFDLGYKIPEGKLKGLGMRARFSHYRNDMPTNMTFHSANETRLNVDYTFKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Porin
publication title Structural Insights into Outer Membrane Permeability of Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii ab307-0294
molecule tags Membrane protein
total genus 115
structure length 402
sequence length 402
ec nomenclature
pdb deposition date 2015-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 5dl7A00
5FVNA 1E54A 3K19A 3O0EA 1HXXA 4LSIA 3VZUX 2Y2XA 1OSMA 3T0SA 2XE3A 2PRNA 5DL8A 2ODJA 3SY9A 3JTYA 7PRNA 2XE1A 4FRTA 3WI5A 4FSPA 5DL6A 3A2SX 5PRNA 3SY7A 3FYXA 3VZWX 3HWBA 5JDPA 3UPGA 6PRNA 4D65A 1GFMA 3VY8X 4D64A 2J1NA 4LSFA 4FT6A 2XG6A 3VY9X 4JFBA 3PORA 2ZLDA 2QTKA 4GCPA 1PRNA 3VZTX 2PORA 4KRAA 4FRXA 3PRNA 4FSOA 3SZVA 3HW9A 3T20A 1PHOA 1HXTA 1HXUA 2XE5A 4KR8A 4AUIA 4D5UA 2OMFA 2FGQX 1GFNA 2K4TA 3NSGA 1GFPA 1GFQA 4BUMX 1MPFA 4C69X 4KR4A 4RJXA 1H6S1 4GCSA 1BT9A 2O4VA 2Y0KA 3POQA 3SZDA 4LSEA 5DL5A 8PRNA 3POUA 3WI4A 4FOZA 4RJWA 2Y0LA 3T24A 1OPFA 1GFOA 3EMNX 2ZFGA 4FMSA 3SYSA 3POXA 2Y0HA 2J4UP 2XE2A 3SYBA 4GCQA 3UU2A 5DL7A 1BH3A 2FGRA 4LSHA
chains in the Genus database with same CATH superfamily
2F1VA 5FVNA 1E54A 3K19A 3PF1A 3QRAA 5T5FA 3V8UA 2KDYA 2XMXA 3O0EA 5D5DA 4FZLA 4QQ1A 1HXXA 3AA7A 4LSIA 4AYMC 3KVDD 4AYNA 4GF4A 2R88A 3VZUX 2Y2XA 4AYEC 1OSMA 1T1LA 5IYUA 3AA0B 3T0SA 5AFUL 2KZ7B 2M07A 3AAAA 2AXTO 2N2MA 2XE3A 5EE2A 1QJ9A 2PRNA 5DL8A 2XTRA 2XTQA 3VE1A 2KXPA 4FZMA 1ZHWA 2ODJA 4E1TA 4UB8O 3SY9A 4PJ0O 2R4NA 4N58A 4FESA 5TISO 5G39A 3JTYA 5G38A 5B5EO 3QRCA 3AAEA 7PRNA 5ADXK 2WJRA 2XE1A 4FRTA 4O3XB 5GV0A 1THQA 5AFUK 2IWWA 1G90A 4G76A 3WI5A 4XNKA 2YNKA 4FSPA 4AYID 1S5LO 2GE4A 5DL6A 3A2SX 5PRNA 3SY7A 3HOLA 3AAEB 3FYXA 4FQEA 3DWNA 3HWBA 3VZWX 1ZHTA 3BRYA 3NJTA 5KAFO 5JDPA 3UPGA 6PRNA 4D65A 1QJPA 3A0BO 3PGRA 4G75A 4F4BA 1GFMA 3VY8X 4O3YA 4D64A 4C4VB 3AA6A 1ZHXA 3PGSA 3C5OA 3UAQA 2N2LA 3GP6A 2J1NA 3JCUO 2JQYA 3AA7B 3DZMA 3PGUA 4FT6A 4LSFA 4JCHA 3PQUA 5G3AA 2XG6A 3VY9X 3A0HO 1BXWA 4E1SA 5GTIO 4JFBA 1QJ8A 3AAAB 1Q9FA 4RLBA 3PORA 3AA6B 2ZLDA 2QTKA 4GCPA 5KAIO 2ERVA 4FUVA 3LK2A 1ZHZA 2KXPB 1PRNA 2W81C 4N59A 3VZTX 1IZNA 2PORA 1MM5A 4FZNA 4KRAA 4AKRA 2R89A 3PRNA 4FRXA 4O3WA 4XNLA 4FSOA 3SZVA 1ORMA 2X9KA 3HW9A 1T16A 1YS5A 2R4LA 4N74A 2Y7SA 3T20A 4PR7A 4AKMA 4RL9A 1ZHYA 3TZGA 1PHOA 4RLCA 1HXTA 1HXUA 2R4PA 1IZNB 2XE5A 3HOEA 2OMFA 4KR8A 2FGQX 4AUIA 1GFNA 4D5UA 2IWVA 2K4TA 4UB6O 5E79O 2YPVA 1GFPA 1GFQA 3NSGA 4AYDC 3BS0A 4BUMX 2WJQA 5B66O 4O4XA 4B61A 3PQSA 2X27X 3KZIO 1MPFA 3AA1A 4C69X 5GTHO 2JMMA 3AA0A 2KZ7A 3G7GA 3LK41 2MNHA 2KC0A 2R4OA 2M06A 4KR4A 4C00A 2W80C 3LK3A 1H6S1 4RJXA 4C4VA 1P4TA 2WVPA 1BT9A 2F1TA 4GCSA 4AZLA 4Z3TA 1MM4A 2O4VA 2Y0KA 3AA1B 3WU2O 3POQA 2R8AA 3SZDA 5ADXL 4LSEA 5DL5A 8PRNA 3POUA 3WI4A 4FOZA 3LK3B 4PUXA 4O4UA 3LK2B 4RJWA 2LFUA 2Y0LA 3BRZA 4CTDA 3T24A 2MHLA 1OPFA 4AFKA 4AKRB 1GFOA 3LK42 3EMNX 4K3BA 2ZFGA 4FMSA 4K3CA 3SYSA 4IL6O 3VE2A 3DWOX 3POXA 2Y0HA 4O49A 2J4UP 5G26A 4U9CA 2XE2A 3DA4A 4GHBA 5H2FO 3RBHA 3DA3A 1Q9GA 2F1CX 4O3ZA 3SYBA 4GCQA 2LHFA 4N75A 3UU2A 5DL7A 2K0LA 1BH3A 2FGRA 4LSHA
chains in the Genus database with same CATH topology
2F1VA 5FVNA 1E54A 3K19A 5T5FA 3QRAA 3V8UA 2KDYA 2XMXA 3O0EA 5D5DA 4FZLA 4QQ1A 1HXXA 3AA7A 4LSIA 4AYMC 3KVDD 4AYNA 4GF4A 3VZUX 2Y2XA 4AYEC 1OSMA 5IYUA 3AA0B 3T0SA 5AFUL 2KZ7B 2M07A 3AAAA 2N2MA 2XE3A 5EE2A 1QJ9A 2PRNA 5DL8A 2XTRA 2XTQA 3VE1A 2KXPA 4FZMA 1ZHWA 2ODJA 4E1TA 3SY9A 4N58A 4FESA 3JTYA 3QRCA 3AAEA 7PRNA 5ADXK 2XE1A 4FRTA 4O3XB 5GV0A 1THQA 5AFUK 1G90A 4G76A 3WI5A 4XNKA 2YNKA 4FSPA 4AYID 2GE4A 5DL6A 3A2SX 5PRNA 3SY7A 3HOLA 3AAEB 3FYXA 3VZWX 3HWBA 1ZHTA 5JDPA 3UPGA 6PRNA 4D65A 1QJPA 4G75A 4F4BA 1GFMA 3VY8X 4O3YA 4D64A 3AA6A 1ZHXA 3C5OA 3UAQA 2N2LA 3GP6A 2J1NA 4LSFA 3AA7B 4FT6A 4JCHA 3PQUA 2XG6A 3VY9X 1BXWA 4E1SA 4JFBA 1QJ8A 3AAAB 1Q9FA 4RLBA 3PORA 3AA6B 2ZLDA 2QTKA 4GCPA 2ERVA 4FUVA 3LK2A 1ZHZA 2KXPB 2W81C 1PRNA 4N59A 3VZTX 1IZNA 2PORA 1MM5A 4FZNA 4KRAA 4AKRA 4FRXA 3PRNA 4O3WA 4XNLA 4FSOA 3SZVA 1ORMA 3HW9A 1YS5A 2Y7SA 3T20A 4AKMA 4RL9A 1ZHYA 3TZGA 1PHOA 4RLCA 1HXTA 1HXUA 2XE5A 1IZNB 3HOEA 4KR8A 2OMFA 4AUIA 2FGQX 4D5UA 1GFNA 2K4TA 4AYDC 2YPVA 1GFPA 1GFQA 3NSGA 4BUMX 4O4XA 4B61A 3PQSA 2X27X 1MPFA 3AA1A 4C69X 2JMMA 3AA0A 2KZ7A 3G7GA 3LK41 2MNHA 2KC0A 4KR4A 2M06A 2W80C 3LK3A 1H6S1 4RJXA 1P4TA 4GCSA 1BT9A 2F1TA 4AZLA 4Z3TA 1MM4A 2O4VA 2Y0KA 3AA1B 5ADXL 3POQA 3SZDA 4LSEA 5DL5A 8PRNA 3POUA 3WI4A 4FOZA 3LK3B 4PUXA 4O4UA 3LK2B 4RJWA 2LFUA 2Y0LA 3T24A 2MHLA 1OPFA 4AFKA 4AKRB 1GFOA 3LK42 3EMNX 2ZFGA 4FMSA 3SYSA 3VE2A 4O49A 3POXA 2Y0HA 2J4UP 5G26A 4U9CA 2XE2A 3DA4A 4GHBA 3RBHA 3DA3A 1Q9GA 4O3ZA 3SYBA 4GCQA 2LHFA 3UU2A 5DL7A 2K0LA 1BH3A 2FGRA 4LSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FVN A;  1E54 A;  3K19 A;  3O0E A;  1HXX A;  4LSI A;  3VZU X;  2Y2X A;  1OSM A;  3T0S A;  2XE3 A;  2PRN A;  5DL8 A;  2ODJ A;  3SY9 A;  3JTY A;  7PRN A;  2XE1 A;  4FRT A;  3WI5 A;  4FSP A;  5DL6 A;  3A2S X;  5PRN A;  3SY7 A;  3FYX A;  3VZW X;  3HWB A;  5JDP A;  3UPG A;  6PRN A;  4D65 A;  1GFM A;  3VY8 X;  4D64 A;  2J1N A;  4LSF A;  4FT6 A;  2XG6 A;  3VY9 X;  4JFB A;  3POR A;  2ZLD A;  2QTK A;  4GCP A;  1PRN A;  3VZT X;  2POR A;  4KRA A;  4FRX A;  3PRN A;  4FSO A;  3SZV A;  3HW9 A;  3T20 A;  1PHO A;  1HXT A;  1HXU A;  2XE5 A;  4KR8 A;  4AUI A;  4D5U A;  2OMF A;  2FGQ X;  1GFN A;  2K4T A;  3NSG A;  1GFP A;  1GFQ A;  4BUM X;  1MPF A;  4C69 X;  4KR4 A;  4RJX A;  1H6S 1;  4GCS A;  1BT9 A;  2O4V A;  2Y0K A;  3POQ A;  3SZD A;  4LSE A;  5DL5 A;  8PRN A;  3POU A;  3WI4 A;  4FOZ A;  4RJW A;  2Y0L A;  3T24 A;  1OPF A;  1GFO A;  3EMN X;  2ZFG A;  4FMS A;  3SYS A;  3POX A;  2Y0H A;  2J4U P;  2XE2 A;  3SYB A;  4GCQ A;  3UU2 A;  5DL7 A;  1BH3 A;  2FGR A;  4LSH A; 
#chains in the Genus database with same CATH topology
 2F1V A;  5FVN A;  1E54 A;  3K19 A;  3PF1 A;  3QRA A;  5T5F A;  3V8U A;  2KDY A;  2XMX A;  3O0E A;  5D5D A;  4FZL A;  4QQ1 A;  1HXX A;  3AA7 A;  4LSI A;  4AYM C;  3KVD D;  4AYN A;  4GF4 A;  2R88 A;  3VZU X;  2Y2X A;  4AYE C;  1OSM A;  1T1L A;  5IYU A;  3AA0 B;  3T0S A;  5AFU L;  2KZ7 B;  2M07 A;  3AAA A;  2AXT O;  2N2M A;  2XE3 A;  5EE2 A;  1QJ9 A;  2PRN A;  5DL8 A;  2XTR A;  2XTQ A;  3VE1 A;  2KXP A;  4FZM A;  1ZHW A;  2ODJ A;  4E1T A;  4UB8 O;  3SY9 A;  4PJ0 O;  2R4N A;  4N58 A;  4FES A;  5TIS O;  5G39 A;  3JTY A;  5G38 A;  5B5E O;  3QRC A;  3AAE A;  7PRN A;  5ADX K;  2WJR A;  2XE1 A;  4FRT A;  4O3X B;  5GV0 A;  1THQ A;  5AFU K;  2IWW A;  1G90 A;  4G76 A;  3WI5 A;  4XNK A;  2YNK A;  4FSP A;  4AYI D;  1S5L O;  2GE4 A;  5DL6 A;  3A2S X;  5PRN A;  3SY7 A;  3HOL A;  3AAE B;  3FYX A;  4FQE A;  3DWN A;  3HWB A;  3VZW X;  1ZHT A;  3BRY A;  3NJT A;  5KAF O;  5JDP A;  3UPG A;  6PRN A;  4D65 A;  1QJP A;  3A0B O;  3PGR A;  4G75 A;  4F4B A;  1GFM A;  3VY8 X;  4O3Y A;  4D64 A;  4C4V B;  3AA6 A;  1ZHX A;  3PGS A;  3C5O A;  3UAQ A;  2N2L A;  3GP6 A;  2J1N A;  3JCU O;  2JQY A;  3AA7 B;  3DZM A;  3PGU A;  4FT6 A;  4LSF A;  4JCH A;  3PQU A;  5G3A A;  2XG6 A;  3VY9 X;  3A0H O;  1BXW A;  4E1S A;  5GTI O;  4JFB A;  1QJ8 A;  3AAA B;  1Q9F A;  4RLB A;  3POR A;  3AA6 B;  2ZLD A;  2QTK A;  4GCP A;  5KAI O;  2ERV A;  4FUV A;  3LK2 A;  1ZHZ A;  2KXP B;  1PRN A;  2W81 C;  4N59 A;  3VZT X;  1IZN A;  2POR A;  1MM5 A;  4FZN A;  4KRA A;  4AKR A;  2R89 A;  3PRN A;  4FRX A;  4O3W A;  4XNL A;  4FSO A;  3SZV A;  1ORM A;  2X9K A;  3HW9 A;  1T16 A;  1YS5 A;  2R4L A;  4N74 A;  2Y7S A;  3T20 A;  4PR7 A;  4AKM A;  4RL9 A;  1ZHY A;  3TZG A;  1PHO A;  4RLC A;  1HXT A;  1HXU A;  2R4P A;  1IZN B;  2XE5 A;  3HOE A;  2OMF A;  4KR8 A;  2FGQ X;  4AUI A;  1GFN A;  4D5U A;  2IWV A;  2K4T A;  4UB6 O;  5E79 O;  2YPV A;  1GFP A;  1GFQ A;  3NSG A;  4AYD C;  3BS0 A;  4BUM X;  2WJQ A;  5B66 O;  4O4X A;  4B61 A;  3PQS A;  2X27 X;  3KZI O;  1MPF A;  3AA1 A;  4C69 X;  5GTH O;  2JMM A;  3AA0 A;  2KZ7 A;  3G7G A;  3LK4 1;  2MNH A;  2KC0 A;  2R4O A;  2M06 A;  4KR4 A;  4C00 A;  2W80 C;  3LK3 A;  1H6S 1;  4RJX A;  4C4V A;  1P4T A;  2WVP A;  1BT9 A;  2F1T A;  4GCS A;  4AZL A;  4Z3T A;  1MM4 A;  2O4V A;  2Y0K A;  3AA1 B;  3WU2 O;  3POQ A;  2R8A A;  3SZD A;  5ADX L;  4LSE A;  5DL5 A;  8PRN A;  3POU A;  3WI4 A;  4FOZ A;  3LK3 B;  4PUX A;  4O4U A;  3LK2 B;  4RJW A;  2LFU A;  2Y0L A;  3BRZ A;  4CTD A;  3T24 A;  2MHL A;  1OPF A;  4AFK A;  4AKR B;  1GFO A;  3LK4 2;  3EMN X;  4K3B A;  2ZFG A;  4FMS A;  4K3C A;  3SYS A;  4IL6 O;  3VE2 A;  3DWO X;  3POX A;  2Y0H A;  4O49 A;  2J4U P;  5G26 A;  4U9C A;  2XE2 A;  3DA4 A;  4GHB A;  5H2F O;  3RBH A;  3DA3 A;  1Q9G A;  2F1C X;  4O3Z A;  3SYB A;  4GCQ A;  2LHF A;  4N75 A;  3UU2 A;  5DL7 A;  2K0L A;  1BH3 A;  2FGR A;  4LSH A; 
#chains in the Genus database with same CATH homology
 2F1V A;  5FVN A;  1E54 A;  3K19 A;  5T5F A;  3QRA A;  3V8U A;  2KDY A;  2XMX A;  3O0E A;  5D5D A;  4FZL A;  4QQ1 A;  1HXX A;  3AA7 A;  4LSI A;  4AYM C;  3KVD D;  4AYN A;  4GF4 A;  3VZU X;  2Y2X A;  4AYE C;  1OSM A;  5IYU A;  3AA0 B;  3T0S A;  5AFU L;  2KZ7 B;  2M07 A;  3AAA A;  2N2M A;  2XE3 A;  5EE2 A;  1QJ9 A;  2PRN A;  5DL8 A;  2XTR A;  2XTQ A;  3VE1 A;  2KXP A;  4FZM A;  1ZHW A;  2ODJ A;  4E1T A;  3SY9 A;  4N58 A;  4FES A;  3JTY A;  3QRC A;  3AAE A;  7PRN A;  5ADX K;  2XE1 A;  4FRT A;  4O3X B;  5GV0 A;  1THQ A;  5AFU K;  1G90 A;  4G76 A;  3WI5 A;  4XNK A;  2YNK A;  4FSP A;  4AYI D;  2GE4 A;  5DL6 A;  3A2S X;  5PRN A;  3SY7 A;  3HOL A;  3AAE B;  3FYX A;  3VZW X;  3HWB A;  1ZHT A;  5JDP A;  3UPG A;  6PRN A;  4D65 A;  1QJP A;  4G75 A;  4F4B A;  1GFM A;  3VY8 X;  4O3Y A;  4D64 A;  3AA6 A;  1ZHX A;  3C5O A;  3UAQ A;  2N2L A;  3GP6 A;  2J1N A;  4LSF A;  3AA7 B;  4FT6 A;  4JCH A;  3PQU A;  2XG6 A;  3VY9 X;  1BXW A;  4E1S A;  4JFB A;  1QJ8 A;  3AAA B;  1Q9F A;  4RLB A;  3POR A;  3AA6 B;  2ZLD A;  2QTK A;  4GCP A;  2ERV A;  4FUV A;  3LK2 A;  1ZHZ A;  2KXP B;  2W81 C;  1PRN A;  4N59 A;  3VZT X;  1IZN A;  2POR A;  1MM5 A;  4FZN A;  4KRA A;  4AKR A;  4FRX A;  3PRN A;  4O3W A;  4XNL A;  4FSO A;  3SZV A;  1ORM A;  3HW9 A;  1YS5 A;  2Y7S A;  3T20 A;  4AKM A;  4RL9 A;  1ZHY A;  3TZG A;  1PHO A;  4RLC A;  1HXT A;  1HXU A;  2XE5 A;  1IZN B;  3HOE A;  4KR8 A;  2OMF A;  4AUI A;  2FGQ X;  4D5U A;  1GFN A;  2K4T A;  4AYD C;  2YPV A;  1GFP A;  1GFQ A;  3NSG A;  4BUM X;  4O4X A;  4B61 A;  3PQS A;  2X27 X;  1MPF A;  3AA1 A;  4C69 X;  2JMM A;  3AA0 A;  2KZ7 A;  3G7G A;  3LK4 1;  2MNH A;  2KC0 A;  4KR4 A;  2M06 A;  2W80 C;  3LK3 A;  1H6S 1;  4RJX A;  1P4T A;  4GCS A;  1BT9 A;  2F1T A;  4AZL A;  4Z3T A;  1MM4 A;  2O4V A;  2Y0K A;  3AA1 B;  5ADX L;  3POQ A;  3SZD A;  4LSE A;  5DL5 A;  8PRN A;  3POU A;  3WI4 A;  4FOZ A;  3LK3 B;  4PUX A;  4O4U A;  3LK2 B;  4RJW A;  2LFU A;  2Y0L A;  3T24 A;  2MHL A;  1OPF A;  4AFK A;  4AKR B;  1GFO A;  3LK4 2;  3EMN X;  2ZFG A;  4FMS A;  3SYS A;  3VE2 A;  4O49 A;  3POX A;  2Y0H A;  2J4U P;  5G26 A;  4U9C A;  2XE2 A;  3DA4 A;  4GHB A;  3RBH A;  3DA3 A;  1Q9G A;  4O3Z A;  3SYB A;  4GCQ A;  2LHF A;  3UU2 A;  5DL7 A;  2K0L A;  1BH3 A;  2FGR A;  4LSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...