5DL7A

Crystal structure of acinetobacter baumannii occab3
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
402
structure length
402
Chain Sequence
IADSKAELTLRNFYFDRDYKKDPYPYTAARDWAQGLIFKGQSGYTEGTVGFGVDVLAMAGFNLMGSRADDYARSGLLPVNTDNSRDDYYGKIGITGKAKFRKNELFVGDLVPQLPTIFSSPARLFPQTYRGIRFVSNEIPNLQLEGFYVDEVRQRDSIRYTDVGTDNINHRFNKAATTDSFYTLGGSYQLKDYRLRAYHAELKDIYQQQFLGFNGKQPLNDQLNFLSDVRFFNSEETGSKKIGEVDNRHISGLFGLNYQNHTVSLGYMQSFGSTGLPFLSGTESPVVLDFMSSDYSNKDEKVYSIRYEYDFKNARIGDVSLNGLRFMTRYAKGEDIDLLQYGDQRFKEDSLEFDLGYKIPEGKLKGLGMRARFSHYRNDMPTNMTFHSANETRLNVDYTFKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Porin
publication title Structural Insights into Outer Membrane Permeability of Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii ab307-0294
total genus 115
structure length 402
sequence length 402
ec nomenclature
pdb deposition date 2015-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 5dl7A00
4FOZA 8PRNA 3SZVA 5DL7A 2XG6A 3WI5A 4KRAA 3WI4A 4BUMX 1GFOA 3SZDA 1HXTA 4GCPA 3PORA 3K19A 4GCSA 3A2SX 2ODJA 1OSMA 2ZFGA 3POUA 2K4TA 3HWBA 5DL6A 6PRNA 4LSIA 3T24A 1OPFA 4FMSA 3PRNA 3JTYA 4FSOA 4D65A 4FRTA 5DL5A 2FGRA 4FRXA 2XE1A 4KR8A 2XE5A 2ZLDA 2OMFA 3UU2A 4GCQA 1PRNA 3T0SA 4D5UA 5JDPA 4LSHA 3SYSA 1BT9A 1MPFA 3T20A 4LSEA 2Y2XA 2J1NA 4KR4A 2PRNA 3VZUX 5DL8A 3FYXA 4AUIA 1HXXA 2QTKA 2XE3A 3EMNX 3NSGA 4C69X 3SYBA 4RJXA 2Y0KA 3VZTX 2J4UP 4FSPA 3SY9A 4FT6A 1GFMA 1BH3A 3VZWX 5PRNA 3VY8X 4LSFA 1HXUA 2XE2A 5FVNA 1H6S1 4JFBA 2FGQX 2PORA 3POQA 1E54A 3VY9X 3SY7A 2Y0LA 3UPGA 2Y0HA 4RJWA 1GFNA 4D64A 1GFPA 1GFQA 3HW9A 7PRNA 1PHOA 3POXA 3O0EA 2O4VA
chains in the Genus database with same CATH superfamily
4FOZA 3QRCA 8PRNA 3SZVA 5D5DA 5ADXK 3LK41 2R4OA 4FESA 3WU2O 5DL7A 2R4LA 2KZ7B 1QJ9A 2XG6A 4FUVA 3UAQA 3WI5A 4KRAA 3WI4A 4BUMX 1GFOA 1Q9GA 3SZDA 4RLCA 3DWNA 1HXTA 4GCPA 1ZHTA 3A0HO 1IZNA 1ZHWA 3KZIO 3PORA 3K19A 3AA7B 4GCSA 4O3ZA 5G38A 3VE2A 5GTHO 2AXTO 3A2SX 3AA1B 3PF1A 2ODJA 1G90A 2KC0A 1OSMA 2ERVA 2ZFGA 3POUA 3PQSA 2K4TA 3HWBA 4N59A 3BS0A 5DL6A 5G26A 3V8UA 5KAFO 6PRNA 3LK42 4LSIA 5H2FO 2JQYA 3T24A 2GE4A 3BRYA 4RL9A 1OPFA 1S5LO 3PGUA 3AAAB 3QRAA 4FMSA 2R8AA 3PRNA 4FZLA 2F1CX 3JTYA 4PJ0O 4O4XA 5T5FA 2R4NA 3PGRA 2W80C 3NJTA 4FSOA 4N75A 5B66O 3AA6B 3DA3A 2KZ7A 1ZHZA 3G7GA 4D65A 5TISO 5ADXL 4AKMA 4FRTA 1YS5A 5DL5A 5B5EO 2R4PA 3AAEB 2FGRA 4O4UA 1ZHXA 4O3WA 4U9CA 4FRXA 2XE1A 1MM5A 4KR8A 5E79O 2XE5A 2WJRA 2ZLDA 3DWOX 3JCUO 4CTDA 3LK3A 3AA7A 4E1TA 2OMFA 4C00A 3UU2A 4GCQA 4AYID 1PRNA 4QQ1A 3T0SA 4D5UA 5JDPA 4LSHA 3SYSA 1BT9A 3DZMA 1MPFA 2X27X 4AFKA 1ZHYA 4LSEA 4AYEC 3HOEA 4AYMC 3T20A 4K3BA 2Y2XA 2JMMA 5GV0A 4FZNA 2R89A 4AKRA 5KAIO 2J1NA 4PR7A 4KR4A 1BXWA 2LFUA 2PRNA 4GF4A 3AA0B 2KDYA 3LK2A 3AAAA 5DL8A 5GTIO 3FYXA 2KXPA 4RLBA 4N74A 3VZUX 4AUIA 3PQUA 4Z3TA 1HXXA 2IWWA 1THQA 4B61A 2YPVA 3AA6A 2QTKA 2XE3A 3EMNX 4G75A 2F1TA 3KVDD 3C5OA 3NSGA 2MHLA 1QJ8A 4GHBA 4UB6O 2F1VA 1QJPA 4O3YA 4AYNA 4C69X 3SYBA 2N2LA 2Y0KA 4RJXA 3VZTX 4E1SA 2J4UP 1Q9FA 3BRZA 4FSPA 4FT6A 2XTQA 3SY9A 1P4TA 2W81C 4PUXA 3A0BO 1GFMA 3AA1A 2YNKA 1BH3A 4IL6O 3VZWX 4XNKA 5G39A 2MNHA 5PRNA 4O3XB 3VY8X 4LSFA 2WVPA 2R88A 1ORMA 1HXUA 3RBHA 2XE2A 5FVNA 1H6S1 4F4BA 4FZMA 3AA0A 2X9KA 4JFBA 1MM4A 2FGQX 5IYUA 2K0LA 1IZNB 3PGSA 3HOLA 4G76A 5AFUK 4C4VB 1T16A 2PORA 3LK3B 3POQA 1E54A 4FQEA 5AFUL 3VY9X 5G3AA 3SY7A 1T1LA 2XTRA 3AAEA 4N58A 2Y0LA 5EE2A 2M07A 2WJQA 3GP6A 3TZGA 4AYDC 4C4VA 2Y0HA 3UPGA 4RJWA 2N2MA 2Y7SA 1GFNA 4O49A 2XMXA 4D64A 1GFPA 2M06A 1GFQA 3HW9A 3VE1A 4AKRB 4UB8O 2LHFA 7PRNA 4XNLA 1PHOA 2IWVA 3DA4A 3POXA 4JCHA 3O0EA 4K3CA 3LK2B 2O4VA 4AZLA 2KXPB
chains in the Genus database with same CATH topology
4FOZA 3QRCA 8PRNA 3SZVA 5D5DA 5ADXK 3LK41 4FESA 5DL7A 2KZ7B 1QJ9A 2XG6A 4FUVA 3UAQA 3WI5A 4KRAA 3WI4A 4BUMX 1GFOA 1Q9GA 3SZDA 4RLCA 1HXTA 4GCPA 1ZHTA 1IZNA 1ZHWA 4O3ZA 3PORA 3K19A 3AA7B 4GCSA 3VE2A 3A2SX 3AA1B 1G90A 2ODJA 2KC0A 1OSMA 2ERVA 2ZFGA 3POUA 3PQSA 2K4TA 3HWBA 4N59A 5DL6A 5G26A 3V8UA 6PRNA 3LK42 4LSIA 3T24A 2GE4A 4RL9A 1OPFA 3QRAA 3AAAB 4FMSA 3PRNA 4FZLA 3JTYA 5T5FA 4O4XA 4FSOA 2W80C 3AA6B 3DA3A 2KZ7A 1ZHZA 3G7GA 4D65A 5ADXL 4AKMA 4FRTA 1YS5A 5DL5A 3AAEB 2FGRA 4O4UA 1ZHXA 4O3WA 4U9CA 4FRXA 2XE1A 1MM5A 4KR8A 2XE5A 2ZLDA 4E1TA 3LK3A 3AA7A 2OMFA 3UU2A 4GCQA 4AYID 1PRNA 4QQ1A 3T0SA 4D5UA 5JDPA 4LSHA 3SYSA 1BT9A 1MPFA 2X27X 4AFKA 1ZHYA 4LSEA 4AYEC 3HOEA 4AYMC 3T20A 2Y2XA 2JMMA 5GV0A 4FZNA 4AKRA 2J1NA 4KR4A 1BXWA 2LFUA 2PRNA 4GF4A 3AA0B 2KDYA 3LK2A 3AAAA 5DL8A 3VZUX 3FYXA 2KXPA 4RLBA 4AUIA 4Z3TA 3PQUA 1HXXA 1THQA 4B61A 2YPVA 3AA6A 2QTKA 2XE3A 3EMNX 4G75A 2F1TA 3KVDD 3C5OA 3NSGA 2MHLA 1QJ8A 4GHBA 2F1VA 1QJPA 4O3YA 4AYNA 4C69X 3SYBA 2N2LA 2Y0KA 4RJXA 3VZTX 4E1SA 2J4UP 1Q9FA 4FSPA 3SY9A 4FT6A 2XTQA 1P4TA 2W81C 4PUXA 3AA1A 1GFMA 2YNKA 1BH3A 3VZWX 4XNKA 2MNHA 5PRNA 4O3XB 3VY8X 4LSFA 1ORMA 1HXUA 3RBHA 2XE2A 5FVNA 1H6S1 4F4BA 4FZMA 3AA0A 4JFBA 1MM4A 2FGQX 5IYUA 2K0LA 1IZNB 3HOLA 4G76A 5AFUK 2PORA 3LK3B 3POQA 1E54A 3VY9X 3SY7A 2XTRA 3AAEA 4N58A 2Y0LA 5EE2A 2M07A 3GP6A 5AFUL 3TZGA 4AYDC 3UPGA 2Y0HA 4RJWA 2N2MA 2Y7SA 1GFNA 4O49A 2XMXA 4D64A 1GFPA 2M06A 1GFQA 3HW9A 3VE1A 4AKRB 2LHFA 7PRNA 4XNLA 1PHOA 4JCHA 3DA4A 3POXA 3O0EA 3LK2B 2O4VA 4AZLA 2KXPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FOZ A;  8PRN A;  3SZV A;  5DL7 A;  2XG6 A;  3WI5 A;  4KRA A;  3WI4 A;  4BUM X;  1GFO A;  3SZD A;  1HXT A;  4GCP A;  3POR A;  3K19 A;  4GCS A;  3A2S X;  2ODJ A;  1OSM A;  2ZFG A;  3POU A;  2K4T A;  3HWB A;  5DL6 A;  6PRN A;  4LSI A;  3T24 A;  1OPF A;  4FMS A;  3PRN A;  3JTY A;  4FSO A;  4D65 A;  4FRT A;  5DL5 A;  2FGR A;  4FRX A;  2XE1 A;  4KR8 A;  2XE5 A;  2ZLD A;  2OMF A;  3UU2 A;  4GCQ A;  1PRN A;  3T0S A;  4D5U A;  5JDP A;  4LSH A;  3SYS A;  1BT9 A;  1MPF A;  3T20 A;  4LSE A;  2Y2X A;  2J1N A;  4KR4 A;  2PRN A;  3VZU X;  5DL8 A;  3FYX A;  4AUI A;  1HXX A;  2QTK A;  2XE3 A;  3EMN X;  3NSG A;  4C69 X;  3SYB A;  4RJX A;  2Y0K A;  3VZT X;  2J4U P;  4FSP A;  3SY9 A;  4FT6 A;  1GFM A;  1BH3 A;  3VZW X;  5PRN A;  3VY8 X;  4LSF A;  1HXU A;  2XE2 A;  5FVN A;  1H6S 1;  4JFB A;  2FGQ X;  2POR A;  3POQ A;  1E54 A;  3VY9 X;  3SY7 A;  2Y0L A;  3UPG A;  2Y0H A;  4RJW A;  1GFN A;  4D64 A;  1GFP A;  1GFQ A;  3HW9 A;  7PRN A;  1PHO A;  3POX A;  3O0E A;  2O4V A; 
#chains in the Genus database with same CATH topology
 4FOZ A;  3QRC A;  8PRN A;  3SZV A;  5D5D A;  5ADX K;  3LK4 1;  2R4O A;  4FES A;  3WU2 O;  5DL7 A;  2R4L A;  2KZ7 B;  1QJ9 A;  2XG6 A;  4FUV A;  3UAQ A;  3WI5 A;  4KRA A;  3WI4 A;  4BUM X;  1GFO A;  1Q9G A;  3SZD A;  4RLC A;  3DWN A;  1HXT A;  4GCP A;  1ZHT A;  3A0H O;  1IZN A;  1ZHW A;  3KZI O;  3POR A;  3K19 A;  3AA7 B;  4GCS A;  4O3Z A;  5G38 A;  3VE2 A;  5GTH O;  2AXT O;  3A2S X;  3AA1 B;  3PF1 A;  2ODJ A;  1G90 A;  2KC0 A;  1OSM A;  2ERV A;  2ZFG A;  3POU A;  3PQS A;  2K4T A;  3HWB A;  4N59 A;  3BS0 A;  5DL6 A;  5G26 A;  3V8U A;  5KAF O;  6PRN A;  3LK4 2;  4LSI A;  5H2F O;  2JQY A;  3T24 A;  2GE4 A;  3BRY A;  4RL9 A;  1OPF A;  1S5L O;  3PGU A;  3AAA B;  3QRA A;  4FMS A;  2R8A A;  3PRN A;  4FZL A;  2F1C X;  3JTY A;  4PJ0 O;  4O4X A;  5T5F A;  2R4N A;  3PGR A;  2W80 C;  3NJT A;  4FSO A;  4N75 A;  5B66 O;  3AA6 B;  3DA3 A;  2KZ7 A;  1ZHZ A;  3G7G A;  4D65 A;  5TIS O;  5ADX L;  4AKM A;  4FRT A;  1YS5 A;  5DL5 A;  5B5E O;  2R4P A;  3AAE B;  2FGR A;  4O4U A;  1ZHX A;  4O3W A;  4U9C A;  4FRX A;  2XE1 A;  1MM5 A;  4KR8 A;  5E79 O;  2XE5 A;  2WJR A;  2ZLD A;  3DWO X;  3JCU O;  4CTD A;  3LK3 A;  3AA7 A;  4E1T A;  2OMF A;  4C00 A;  3UU2 A;  4GCQ A;  4AYI D;  1PRN A;  4QQ1 A;  3T0S A;  4D5U A;  5JDP A;  4LSH A;  3SYS A;  1BT9 A;  3DZM A;  1MPF A;  2X27 X;  4AFK A;  1ZHY A;  4LSE A;  4AYE C;  3HOE A;  4AYM C;  3T20 A;  4K3B A;  2Y2X A;  2JMM A;  5GV0 A;  4FZN A;  2R89 A;  4AKR A;  5KAI O;  2J1N A;  4PR7 A;  4KR4 A;  1BXW A;  2LFU A;  2PRN A;  4GF4 A;  3AA0 B;  2KDY A;  3LK2 A;  3AAA A;  5DL8 A;  5GTI O;  3FYX A;  2KXP A;  4RLB A;  4N74 A;  3VZU X;  4AUI A;  3PQU A;  4Z3T A;  1HXX A;  2IWW A;  1THQ A;  4B61 A;  2YPV A;  3AA6 A;  2QTK A;  2XE3 A;  3EMN X;  4G75 A;  2F1T A;  3KVD D;  3C5O A;  3NSG A;  2MHL A;  1QJ8 A;  4GHB A;  4UB6 O;  2F1V A;  1QJP A;  4O3Y A;  4AYN A;  4C69 X;  3SYB A;  2N2L A;  2Y0K A;  4RJX A;  3VZT X;  4E1S A;  2J4U P;  1Q9F A;  3BRZ A;  4FSP A;  4FT6 A;  2XTQ A;  3SY9 A;  1P4T A;  2W81 C;  4PUX A;  3A0B O;  1GFM A;  3AA1 A;  2YNK A;  1BH3 A;  4IL6 O;  3VZW X;  4XNK A;  5G39 A;  2MNH A;  5PRN A;  4O3X B;  3VY8 X;  4LSF A;  2WVP A;  2R88 A;  1ORM A;  1HXU A;  3RBH A;  2XE2 A;  5FVN A;  1H6S 1;  4F4B A;  4FZM A;  3AA0 A;  2X9K A;  4JFB A;  1MM4 A;  2FGQ X;  5IYU A;  2K0L A;  1IZN B;  3PGS A;  3HOL A;  4G76 A;  5AFU K;  4C4V B;  1T16 A;  2POR A;  3LK3 B;  3POQ A;  1E54 A;  4FQE A;  5AFU L;  3VY9 X;  5G3A A;  3SY7 A;  1T1L A;  2XTR A;  3AAE A;  4N58 A;  2Y0L A;  5EE2 A;  2M07 A;  2WJQ A;  3GP6 A;  3TZG A;  4AYD C;  4C4V A;  2Y0H A;  3UPG A;  4RJW A;  2N2M A;  2Y7S A;  1GFN A;  4O49 A;  2XMX A;  4D64 A;  1GFP A;  2M06 A;  1GFQ A;  3HW9 A;  3VE1 A;  4AKR B;  4UB8 O;  2LHF A;  7PRN A;  4XNL A;  1PHO A;  2IWV A;  3DA4 A;  3POX A;  4JCH A;  3O0E A;  4K3C A;  3LK2 B;  2O4V A;  4AZL A;  2KXP B; 
#chains in the Genus database with same CATH homology
 4FOZ A;  3QRC A;  8PRN A;  3SZV A;  5D5D A;  5ADX K;  3LK4 1;  4FES A;  5DL7 A;  2KZ7 B;  1QJ9 A;  2XG6 A;  4FUV A;  3UAQ A;  3WI5 A;  4KRA A;  3WI4 A;  4BUM X;  1GFO A;  1Q9G A;  3SZD A;  4RLC A;  1HXT A;  4GCP A;  1ZHT A;  1IZN A;  1ZHW A;  4O3Z A;  3POR A;  3K19 A;  3AA7 B;  4GCS A;  3VE2 A;  3A2S X;  3AA1 B;  1G90 A;  2ODJ A;  2KC0 A;  1OSM A;  2ERV A;  2ZFG A;  3POU A;  3PQS A;  2K4T A;  3HWB A;  4N59 A;  5DL6 A;  5G26 A;  3V8U A;  6PRN A;  3LK4 2;  4LSI A;  3T24 A;  2GE4 A;  4RL9 A;  1OPF A;  3QRA A;  3AAA B;  4FMS A;  3PRN A;  4FZL A;  3JTY A;  5T5F A;  4O4X A;  4FSO A;  2W80 C;  3AA6 B;  3DA3 A;  2KZ7 A;  1ZHZ A;  3G7G A;  4D65 A;  5ADX L;  4AKM A;  4FRT A;  1YS5 A;  5DL5 A;  3AAE B;  2FGR A;  4O4U A;  1ZHX A;  4O3W A;  4U9C A;  4FRX A;  2XE1 A;  1MM5 A;  4KR8 A;  2XE5 A;  2ZLD A;  4E1T A;  3LK3 A;  3AA7 A;  2OMF A;  3UU2 A;  4GCQ A;  4AYI D;  1PRN A;  4QQ1 A;  3T0S A;  4D5U A;  5JDP A;  4LSH A;  3SYS A;  1BT9 A;  1MPF A;  2X27 X;  4AFK A;  1ZHY A;  4LSE A;  4AYE C;  3HOE A;  4AYM C;  3T20 A;  2Y2X A;  2JMM A;  5GV0 A;  4FZN A;  4AKR A;  2J1N A;  4KR4 A;  1BXW A;  2LFU A;  2PRN A;  4GF4 A;  3AA0 B;  2KDY A;  3LK2 A;  3AAA A;  5DL8 A;  3VZU X;  3FYX A;  2KXP A;  4RLB A;  4AUI A;  4Z3T A;  3PQU A;  1HXX A;  1THQ A;  4B61 A;  2YPV A;  3AA6 A;  2QTK A;  2XE3 A;  3EMN X;  4G75 A;  2F1T A;  3KVD D;  3C5O A;  3NSG A;  2MHL A;  1QJ8 A;  4GHB A;  2F1V A;  1QJP A;  4O3Y A;  4AYN A;  4C69 X;  3SYB A;  2N2L A;  2Y0K A;  4RJX A;  3VZT X;  4E1S A;  2J4U P;  1Q9F A;  4FSP A;  3SY9 A;  4FT6 A;  2XTQ A;  1P4T A;  2W81 C;  4PUX A;  3AA1 A;  1GFM A;  2YNK A;  1BH3 A;  3VZW X;  4XNK A;  2MNH A;  5PRN A;  4O3X B;  3VY8 X;  4LSF A;  1ORM A;  1HXU A;  3RBH A;  2XE2 A;  5FVN A;  1H6S 1;  4F4B A;  4FZM A;  3AA0 A;  4JFB A;  1MM4 A;  2FGQ X;  5IYU A;  2K0L A;  1IZN B;  3HOL A;  4G76 A;  5AFU K;  2POR A;  3LK3 B;  3POQ A;  1E54 A;  3VY9 X;  3SY7 A;  2XTR A;  3AAE A;  4N58 A;  2Y0L A;  5EE2 A;  2M07 A;  3GP6 A;  5AFU L;  3TZG A;  4AYD C;  3UPG A;  2Y0H A;  4RJW A;  2N2M A;  2Y7S A;  1GFN A;  4O49 A;  2XMX A;  4D64 A;  1GFP A;  2M06 A;  1GFQ A;  3HW9 A;  3VE1 A;  4AKR B;  2LHF A;  7PRN A;  4XNL A;  1PHO A;  4JCH A;  3DA4 A;  3POX A;  3O0E A;  3LK2 B;  2O4V A;  4AZL A;  2KXP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...