3PORA

Porin conformation in the absence of calcium; refined structure at 2.5 angstroms resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
301
structure length
301
Chain Sequence
EVKLSGDARMGVMYNGDDWNFSSRSRVLFTMSGTTDSGLEFGASFKAHESVGAETGEDGTVFLSGAFGKIEMGDALGASEALFGDLYEVGYTDLDDRGGNDIPYLTGDERLTAEDNPVLLYTYSAGAFSVAASMSDGKVGETSEDDAQEMAVAAAYTFGNYTVGLGYEKIDSPDTALMADMEQLELAAIAKFGATNVKAYYADGELDRDFARAVFDLTPVAAAATAVDHKAYGLSVDSTFGATTVGGYVQVLDIDTIDDVTYYGLGASYDLGGGASIVGGIADNDLPNSDMVADLGVKFKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORIN
publication title Porin conformation in the absence of calcium. Refined structure at 2.5 A resolution.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Integral membrane protein porin
total genus 70
structure length 301
sequence length 301
ec nomenclature
pdb deposition date 1992-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13609 Porin_4 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3porA00
1GFMA 3SY7A 7PRNA 2J4UP 5PRNA 4D64A 1BT9A 2XE2A 5DL5A 4LSEA 2XG6A 3POUA 2XE5A 3POQA 3SZDA 4LSHA 2FGQX 4JFBA 2Y0HA 1HXTA 4FMSA 3VZWX 1BH3A 1GFPA 3HW9A 3SZVA 3VZUX 5DL7A 1E54A 1H6S1 3FYXA 4RJXA 2ODJA 2Y0LA 4FSPA 1MPFA 4FT6A 3T20A 3UU2A 3POXA 2PORA 1PRNA 1GFNA 4FRTA 5DL6A 4KRAA 1GFOA 4RJWA 5JDPA 2ZFGA 2O4VA 3SYSA 2Y2XA 3PORA 3JTYA 1HXXA 3EMNX 3WI4A 4FSOA 8PRNA 3NSGA 3O0EA 4AUIA 2K4TA 4FRXA 2FGRA 3A2SX 2XE1A 3WI5A 2OMFA 1HXUA 3K19A 4D5UA 2ZLDA 1GFQA 1OPFA 3T24A 2Y0KA 2QTKA 4D65A 4KR4A 4LSFA 3VY9X 3HWBA 5DL8A 6PRNA 3T0SA 1PHOA 3PRNA 4KR8A 3SYBA 4C69X 1OSMA 4GCSA 2J1NA 4GCQA 4FOZA 2PRNA 3VY8X 4LSIA 2XE3A 4GCPA 3SY9A 3VZTX 4BUMX 3UPGA 5FVNA
chains in the Genus database with same CATH superfamily
2X27X 3LK2A 4FESA 4O3ZA 1GFMA 2KC0A 2XTRA 1S5LO 3SY7A 7PRNA 4PR7A 1QJ8A 3LK3A 2J4UP 3LK41 5PRNA 3UAQA 4D64A 1BT9A 2K0LA 3DWNA 4AFKA 2XE2A 4Z3TA 2YNKA 5DL5A 3VE2A 4LSEA 4AYID 2XG6A 4N74A 3AA1B 2F1VA 5AFUK 3POUA 4IL6O 4B61A 2XE5A 3POQA 3SZDA 4LSHA 2FGQX 4JFBA 2X9KA 2Y0HA 4O3WA 1THQA 3HOLA 2M06A 4E1SA 2R4OA 2Y7SA 3LK42 4QQ1A 1HXTA 4AKMA 2F1TA 5IYUA 4FMSA 3VZWX 4AYEC 1BH3A 5EE2A 4C4VB 1GFPA 5B66O 3AAAB 4N59A 1T16A 3AA6B 3AAEB 1BXWA 3HW9A 3SZVA 5KAIO 2N2MA 1T1LA 2R88A 3DWOX 3QRCA 1Q9FA 4U9CA 5DL7A 5GTIO 4G76A 1E54A 5ADXK 2LFUA 3TZGA 4AYDC 1H6S1 3V8UA 3FYXA 3GP6A 4RJXA 1MM4A 2ODJA 3PGRA 4UB6O 4F4BA 2Y0LA 3VE1A 4FSPA 4PUXA 4UB8O 1G90A 1ZHXA 1Q9GA 1MPFA 4FZMA 4FT6A 3T20A 4C4VA 3AA7A 3AA0B 3UU2A 3AAAA 3POXA 4XNKA 3WU2O 2PORA 3BRYA 3AA6A 4O4UA 3AAEA 1PRNA 1GFNA 4FRTA 4AYNA 5DL6A 4KRAA 1GFOA 3RBHA 2MNHA 4FQEA 4RJWA 4O3YA 5JDPA 5D5DA 5GTHO 2LHFA 2ZFGA 2O4VA 3SYSA 2Y2XA 1MM5A 2KXPB 3VZUX 1ORMA 5GV0A 2WVPA 3JTYA 1HXXA 3EMNX 3PORA 2GE4A 3PGSA 4FSOA 3WI4A 3NSGA 5KAFO 3O0EA 8PRNA 4AYMC 3AA1A 5G38A 4AUIA 2K4TA 2KZ7B 2R4PA 3PQUA 3JCUO 3QRAA 4RLBA 4FRXA 3BRZA 1ZHYA 2FGRA 3A2SX 4JCHA 4E1TA 2XE1A 4G75A 5E79O 5G3AA 2W81C 1ZHWA 4GF4A 3WI5A 4GHBA 2WJRA 1QJ9A 1ZHTA 2OMFA 1HXUA 3PF1A 1YS5A 3K19A 3DA4A 1QJPA 2KXPA 5G39A 5AFUL 3A0BO 4N58A 5TISO 2ZLDA 1GFQA 4D5UA 2IWWA 1OPFA 3T24A 2IWVA 2F1CX 2Y0KA 2KZ7A 2QTKA 2AXTO 3KVDD 4K3CA 4D65A 2KDYA 2JQYA 4KR4A 2W80C 4K3BA 2R4LA 4LSFA 1IZNB 3VY9X 3HWBA 5DL8A 6PRNA 3T0SA 2R8AA 1PHOA 3PGUA 3PRNA 4KR8A 2JMMA 3DA3A 5T5FA 4AKRB 4RL9A 1ZHZA 4O3XB 2XTQA 3AA0A 3C5OA 2R4NA 3G7GA 1OSMA 3LK2B 4FZNA 3KZIO 4GCSA 4C69X 5B5EO 2ERVA 2J1NA 2YPVA 5G26A 5ADXL 5H2FO 4GCQA 2MHLA 3LK3B 4PJ0O 4FUVA 2N2LA 4FOZA 2PRNA 2M07A 3VY8X 2WJQA 2XMXA 3PQSA 4LSIA 1P4TA 4N75A 3DZMA 3BS0A 3NJTA 4XNLA 2XE3A 3SYBA 3AA7B 3A0HO 4CTDA 1IZNA 4GCPA 4O49A 3SY9A 4RLCA 4C00A 3HOEA 3VZTX 4O4XA 4AKRA 4AZLA 2R89A 4BUMX 4FZLA 3UPGA 5FVNA
chains in the Genus database with same CATH topology
2X27X 3LK2A 4FESA 4O3ZA 1GFMA 2KC0A 2XTRA 3SY7A 7PRNA 1QJ8A 3LK3A 2J4UP 3LK41 5PRNA 3UAQA 4D64A 1BT9A 2K0LA 4AFKA 4Z3TA 2XE2A 2YNKA 5DL5A 3VE2A 4LSEA 4AYID 2XG6A 5AFUK 3AA1B 2F1VA 3POUA 4B61A 2XE5A 3POQA 3SZDA 4LSHA 2FGQX 4JFBA 2Y0HA 4O3WA 1THQA 3HOLA 2M06A 4E1SA 2Y7SA 3LK42 4QQ1A 1HXTA 4AKMA 2F1TA 5IYUA 4FMSA 3VZWX 4AYEC 1BH3A 5EE2A 1GFPA 3AAAB 4N59A 3AA6B 3AAEB 1BXWA 3HW9A 3SZVA 2N2MA 4U9CA 3QRCA 3VZUX 1Q9FA 5DL7A 5ADXK 4G76A 1E54A 2LFUA 3TZGA 4AYDC 1H6S1 3V8UA 3FYXA 3GP6A 4RJXA 1MM4A 2ODJA 4F4BA 2Y0LA 3VE1A 4FSPA 4PUXA 1G90A 1ZHXA 1Q9GA 1MPFA 4FZMA 4FT6A 3T20A 3AA7A 3AA0B 3UU2A 3AAAA 3POXA 4XNKA 2PORA 3AA6A 4O4UA 3AAEA 1PRNA 1GFNA 4FRTA 4AYNA 5DL6A 4KRAA 1GFOA 3RBHA 2MNHA 4RJWA 4O3YA 5JDPA 5D5DA 2LHFA 2ZFGA 2O4VA 3SYSA 2Y2XA 1MM5A 2KXPB 1ORMA 5GV0A 3PORA 3JTYA 1HXXA 3EMNX 3WI4A 2GE4A 4FSOA 8PRNA 3NSGA 3O0EA 4AYMC 3AA1A 4AUIA 2K4TA 2KZ7B 3PQUA 3QRAA 4RLBA 4FRXA 1ZHYA 2FGRA 3A2SX 4JCHA 4E1TA 2XE1A 4G75A 2W81C 1ZHWA 4GF4A 3WI5A 4GHBA 1QJ9A 1ZHTA 2OMFA 1HXUA 1YS5A 3K19A 3DA4A 1QJPA 2KXPA 5AFUL 4N58A 4D5UA 2ZLDA 1GFQA 1OPFA 3T24A 2Y0KA 2KZ7A 2QTKA 3KVDD 4D65A 2KDYA 4KR4A 2W80C 4LSFA 3VY9X 1IZNB 3HWBA 5DL8A 6PRNA 3T0SA 1PHOA 4AKRB 3PRNA 4KR8A 2JMMA 3DA3A 5T5FA 4RL9A 1ZHZA 4O3XB 2XTQA 3AA0A 3C5OA 3G7GA 3SYBA 1OSMA 3LK2B 4FZNA 4GCSA 4C69X 2ERVA 2J1NA 2YPVA 5G26A 5ADXL 4GCQA 2MHLA 3LK3B 4FUVA 2N2LA 4FOZA 2PRNA 2M07A 3VY8X 4LSIA 2XMXA 3PQSA 1P4TA 4XNLA 2XE3A 3AA7B 1IZNA 4GCPA 4O49A 3SY9A 4RLCA 3HOEA 3VZTX 4O4XA 4AKRA 4AZLA 4BUMX 4FZLA 3UPGA 5FVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GFM A;  3SY7 A;  7PRN A;  2J4U P;  5PRN A;  4D64 A;  1BT9 A;  2XE2 A;  5DL5 A;  4LSE A;  2XG6 A;  3POU A;  2XE5 A;  3POQ A;  3SZD A;  4LSH A;  2FGQ X;  4JFB A;  2Y0H A;  1HXT A;  4FMS A;  3VZW X;  1BH3 A;  1GFP A;  3HW9 A;  3SZV A;  3VZU X;  5DL7 A;  1E54 A;  1H6S 1;  3FYX A;  4RJX A;  2ODJ A;  2Y0L A;  4FSP A;  1MPF A;  4FT6 A;  3T20 A;  3UU2 A;  3POX A;  2POR A;  1PRN A;  1GFN A;  4FRT A;  5DL6 A;  4KRA A;  1GFO A;  4RJW A;  5JDP A;  2ZFG A;  2O4V A;  3SYS A;  2Y2X A;  3POR A;  3JTY A;  1HXX A;  3EMN X;  3WI4 A;  4FSO A;  8PRN A;  3NSG A;  3O0E A;  4AUI A;  2K4T A;  4FRX A;  2FGR A;  3A2S X;  2XE1 A;  3WI5 A;  2OMF A;  1HXU A;  3K19 A;  4D5U A;  2ZLD A;  1GFQ A;  1OPF A;  3T24 A;  2Y0K A;  2QTK A;  4D65 A;  4KR4 A;  4LSF A;  3VY9 X;  3HWB A;  5DL8 A;  6PRN A;  3T0S A;  1PHO A;  3PRN A;  4KR8 A;  3SYB A;  4C69 X;  1OSM A;  4GCS A;  2J1N A;  4GCQ A;  4FOZ A;  2PRN A;  3VY8 X;  4LSI A;  2XE3 A;  4GCP A;  3SY9 A;  3VZT X;  4BUM X;  3UPG A;  5FVN A; 
#chains in the Genus database with same CATH topology
 2X27 X;  3LK2 A;  4FES A;  4O3Z A;  1GFM A;  2KC0 A;  2XTR A;  1S5L O;  3SY7 A;  7PRN A;  4PR7 A;  1QJ8 A;  3LK3 A;  2J4U P;  3LK4 1;  5PRN A;  3UAQ A;  4D64 A;  1BT9 A;  2K0L A;  3DWN A;  4AFK A;  2XE2 A;  4Z3T A;  2YNK A;  5DL5 A;  3VE2 A;  4LSE A;  4AYI D;  2XG6 A;  4N74 A;  3AA1 B;  2F1V A;  5AFU K;  3POU A;  4IL6 O;  4B61 A;  2XE5 A;  3POQ A;  3SZD A;  4LSH A;  2FGQ X;  4JFB A;  2X9K A;  2Y0H A;  4O3W A;  1THQ A;  3HOL A;  2M06 A;  4E1S A;  2R4O A;  2Y7S A;  3LK4 2;  4QQ1 A;  1HXT A;  4AKM A;  2F1T A;  5IYU A;  4FMS A;  3VZW X;  4AYE C;  1BH3 A;  5EE2 A;  4C4V B;  1GFP A;  5B66 O;  3AAA B;  4N59 A;  1T16 A;  3AA6 B;  3AAE B;  1BXW A;  3HW9 A;  3SZV A;  5KAI O;  2N2M A;  1T1L A;  2R88 A;  3DWO X;  3QRC A;  1Q9F A;  4U9C A;  5DL7 A;  5GTI O;  4G76 A;  1E54 A;  5ADX K;  2LFU A;  3TZG A;  4AYD C;  1H6S 1;  3V8U A;  3FYX A;  3GP6 A;  4RJX A;  1MM4 A;  2ODJ A;  3PGR A;  4UB6 O;  4F4B A;  2Y0L A;  3VE1 A;  4FSP A;  4PUX A;  4UB8 O;  1G90 A;  1ZHX A;  1Q9G A;  1MPF A;  4FZM A;  4FT6 A;  3T20 A;  4C4V A;  3AA7 A;  3AA0 B;  3UU2 A;  3AAA A;  3POX A;  4XNK A;  3WU2 O;  2POR A;  3BRY A;  3AA6 A;  4O4U A;  3AAE A;  1PRN A;  1GFN A;  4FRT A;  4AYN A;  5DL6 A;  4KRA A;  1GFO A;  3RBH A;  2MNH A;  4FQE A;  4RJW A;  4O3Y A;  5JDP A;  5D5D A;  5GTH O;  2LHF A;  2ZFG A;  2O4V A;  3SYS A;  2Y2X A;  1MM5 A;  2KXP B;  3VZU X;  1ORM A;  5GV0 A;  2WVP A;  3JTY A;  1HXX A;  3EMN X;  3POR A;  2GE4 A;  3PGS A;  4FSO A;  3WI4 A;  3NSG A;  5KAF O;  3O0E A;  8PRN A;  4AYM C;  3AA1 A;  5G38 A;  4AUI A;  2K4T A;  2KZ7 B;  2R4P A;  3PQU A;  3JCU O;  3QRA A;  4RLB A;  4FRX A;  3BRZ A;  1ZHY A;  2FGR A;  3A2S X;  4JCH A;  4E1T A;  2XE1 A;  4G75 A;  5E79 O;  5G3A A;  2W81 C;  1ZHW A;  4GF4 A;  3WI5 A;  4GHB A;  2WJR A;  1QJ9 A;  1ZHT A;  2OMF A;  1HXU A;  3PF1 A;  1YS5 A;  3K19 A;  3DA4 A;  1QJP A;  2KXP A;  5G39 A;  5AFU L;  3A0B O;  4N58 A;  5TIS O;  2ZLD A;  1GFQ A;  4D5U A;  2IWW A;  1OPF A;  3T24 A;  2IWV A;  2F1C X;  2Y0K A;  2KZ7 A;  2QTK A;  2AXT O;  3KVD D;  4K3C A;  4D65 A;  2KDY A;  2JQY A;  4KR4 A;  2W80 C;  4K3B A;  2R4L A;  4LSF A;  1IZN B;  3VY9 X;  3HWB A;  5DL8 A;  6PRN A;  3T0S A;  2R8A A;  1PHO A;  3PGU A;  3PRN A;  4KR8 A;  2JMM A;  3DA3 A;  5T5F A;  4AKR B;  4RL9 A;  1ZHZ A;  4O3X B;  2XTQ A;  3AA0 A;  3C5O A;  2R4N A;  3G7G A;  1OSM A;  3LK2 B;  4FZN A;  3KZI O;  4GCS A;  4C69 X;  5B5E O;  2ERV A;  2J1N A;  2YPV A;  5G26 A;  5ADX L;  5H2F O;  4GCQ A;  2MHL A;  3LK3 B;  4PJ0 O;  4FUV A;  2N2L A;  4FOZ A;  2PRN A;  2M07 A;  3VY8 X;  2WJQ A;  2XMX A;  3PQS A;  4LSI A;  1P4T A;  4N75 A;  3DZM A;  3BS0 A;  3NJT A;  4XNL A;  2XE3 A;  3SYB A;  3AA7 B;  3A0H O;  4CTD A;  1IZN A;  4GCP A;  4O49 A;  3SY9 A;  4RLC A;  4C00 A;  3HOE A;  3VZT X;  4O4X A;  4AKR A;  4AZL A;  2R89 A;  4BUM X;  4FZL A;  3UPG A;  5FVN A; 
#chains in the Genus database with same CATH homology
 2X27 X;  3LK2 A;  4FES A;  4O3Z A;  1GFM A;  2KC0 A;  2XTR A;  3SY7 A;  7PRN A;  1QJ8 A;  3LK3 A;  2J4U P;  3LK4 1;  5PRN A;  3UAQ A;  4D64 A;  1BT9 A;  2K0L A;  4AFK A;  4Z3T A;  2XE2 A;  2YNK A;  5DL5 A;  3VE2 A;  4LSE A;  4AYI D;  2XG6 A;  5AFU K;  3AA1 B;  2F1V A;  3POU A;  4B61 A;  2XE5 A;  3POQ A;  3SZD A;  4LSH A;  2FGQ X;  4JFB A;  2Y0H A;  4O3W A;  1THQ A;  3HOL A;  2M06 A;  4E1S A;  2Y7S A;  3LK4 2;  4QQ1 A;  1HXT A;  4AKM A;  2F1T A;  5IYU A;  4FMS A;  3VZW X;  4AYE C;  1BH3 A;  5EE2 A;  1GFP A;  3AAA B;  4N59 A;  3AA6 B;  3AAE B;  1BXW A;  3HW9 A;  3SZV A;  2N2M A;  4U9C A;  3QRC A;  3VZU X;  1Q9F A;  5DL7 A;  5ADX K;  4G76 A;  1E54 A;  2LFU A;  3TZG A;  4AYD C;  1H6S 1;  3V8U A;  3FYX A;  3GP6 A;  4RJX A;  1MM4 A;  2ODJ A;  4F4B A;  2Y0L A;  3VE1 A;  4FSP A;  4PUX A;  1G90 A;  1ZHX A;  1Q9G A;  1MPF A;  4FZM A;  4FT6 A;  3T20 A;  3AA7 A;  3AA0 B;  3UU2 A;  3AAA A;  3POX A;  4XNK A;  2POR A;  3AA6 A;  4O4U A;  3AAE A;  1PRN A;  1GFN A;  4FRT A;  4AYN A;  5DL6 A;  4KRA A;  1GFO A;  3RBH A;  2MNH A;  4RJW A;  4O3Y A;  5JDP A;  5D5D A;  2LHF A;  2ZFG A;  2O4V A;  3SYS A;  2Y2X A;  1MM5 A;  2KXP B;  1ORM A;  5GV0 A;  3POR A;  3JTY A;  1HXX A;  3EMN X;  3WI4 A;  2GE4 A;  4FSO A;  8PRN A;  3NSG A;  3O0E A;  4AYM C;  3AA1 A;  4AUI A;  2K4T A;  2KZ7 B;  3PQU A;  3QRA A;  4RLB A;  4FRX A;  1ZHY A;  2FGR A;  3A2S X;  4JCH A;  4E1T A;  2XE1 A;  4G75 A;  2W81 C;  1ZHW A;  4GF4 A;  3WI5 A;  4GHB A;  1QJ9 A;  1ZHT A;  2OMF A;  1HXU A;  1YS5 A;  3K19 A;  3DA4 A;  1QJP A;  2KXP A;  5AFU L;  4N58 A;  4D5U A;  2ZLD A;  1GFQ A;  1OPF A;  3T24 A;  2Y0K A;  2KZ7 A;  2QTK A;  3KVD D;  4D65 A;  2KDY A;  4KR4 A;  2W80 C;  4LSF A;  3VY9 X;  1IZN B;  3HWB A;  5DL8 A;  6PRN A;  3T0S A;  1PHO A;  4AKR B;  3PRN A;  4KR8 A;  2JMM A;  3DA3 A;  5T5F A;  4RL9 A;  1ZHZ A;  4O3X B;  2XTQ A;  3AA0 A;  3C5O A;  3G7G A;  3SYB A;  1OSM A;  3LK2 B;  4FZN A;  4GCS A;  4C69 X;  2ERV A;  2J1N A;  2YPV A;  5G26 A;  5ADX L;  4GCQ A;  2MHL A;  3LK3 B;  4FUV A;  2N2L A;  4FOZ A;  2PRN A;  2M07 A;  3VY8 X;  4LSI A;  2XMX A;  3PQS A;  1P4T A;  4XNL A;  2XE3 A;  3AA7 B;  1IZN A;  4GCP A;  4O49 A;  3SY9 A;  4RLC A;  3HOE A;  3VZT X;  4O4X A;  4AKR A;  4AZL A;  4BUM X;  4FZL A;  3UPG A;  5FVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...