3PORA

Porin conformation in the absence of calcium; refined structure at 2.5 angstroms resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
301
structure length
301
Chain Sequence
EVKLSGDARMGVMYNGDDWNFSSRSRVLFTMSGTTDSGLEFGASFKAHESVGAETGEDGTVFLSGAFGKIEMGDALGASEALFGDLYEVGYTDLDDRGGNDIPYLTGDERLTAEDNPVLLYTYSAGAFSVAASMSDGKVGETSEDDAQEMAVAAAYTFGNYTVGLGYEKIDSPDTALMADMEQLELAAIAKFGATNVKAYYADGELDRDFARAVFDLTPVAAAATAVDHKAYGLSVDSTFGATTVGGYVQVLDIDTIDDVTYYGLGASYDLGGGASIVGGIADNDLPNSDMVADLGVKFKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Integral membrane protein porin
molecule keywords PORIN
publication title Porin conformation in the absence of calcium. Refined structure at 2.5 A resolution.
pubmed doi rcsb
source organism Rhodobacter capsulatus
total genus 70
structure length 301
sequence length 301
ec nomenclature
pdb deposition date 1992-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13609 Porin_4 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3porA00
4JFBA 1BT9A 3T0SA 4FT6A 4D5UA 2Y0LA 3SZVA 5DL8A 4BUMX 3VZWX 2XE2A 4FMSA 3SY7A 1OPFA 3VZTX 4LSFA 5DL7A 2J4UP 1PHOA 3SYSA 4LSIA 3T24A 2ODJA 2ZFGA 1H6S1 4KR8A 1MPFA 1GFNA 2Y2XA 7PRNA 4FOZA 4RJWA 1GFOA 4FSPA 1E54A 2OMFA 3POUA 2FGQX 2QTKA 5FVNA 5PRNA 2Y0KA 3UU2A 4C69X 2FGRA 4RJXA 1HXUA 4FRTA 3HWBA 2XE1A 4AUIA 8PRNA 3SZDA 2PRNA 1HXXA 3EMNX 2K4TA 5JDPA 2Y0HA 3VY8X 3VZUX 1PRNA 3POXA 4D64A 1HXTA 3PRNA 2J1NA 2XG6A 2XE3A 4LSHA 3SYBA 3K19A 4FRXA 2O4VA 4KR4A 2XE5A 2PORA 3WI5A 1GFPA 5DL6A 3O0EA 1GFQA 4GCQA 3POQA 4D65A 4GCPA 3UPGA 4FSOA 3T20A 4KRAA 1GFMA 3PORA 4GCSA 3FYXA 3NSGA 3VY9X 1BH3A 3JTYA 5DL5A 2ZLDA 3WI4A 3SY9A 3HW9A 6PRNA 4LSEA 1OSMA 3A2SX
chains in the Genus database with same CATH superfamily
4AKMA 4JFBA 1BT9A 1G90A 3QRCA 3T0SA 4FT6A 1ZHYA 3NJTA 1YS5A 4D5UA 1T1LA 1IZNA 2Y0LA 4AYID 2Y7SA 3SZVA 5DL8A 1T16A 4N75A 4BUMX 2KXPA 3BS0A 4RLBA 3TZGA 3AAEA 3VZWX 4PR7A 2R8AA 2XE2A 3PGUA 4C00A 4FZLA 4FMSA 4UB8O 2JQYA 2XTRA 5KAFO 2X9KA 3SY7A 5GTIO 1OPFA 4N58A 3LK2A 4LSFA 3PF1A 5DL7A 3AA0A 2M07A 2KZ7B 3BRZA 4IL6O 2J4UP 1PHOA 4XNLA 3SYSA 1ORMA 4LSIA 4PJ0O 5ADXK 3T24A 3HOLA 5ADXL 2ODJA 3AA7B 4B61A 3PQSA 3VZTX 3PGSA 5KAIO 3DA4A 2ZFGA 2R4LA 1H6S1 4KR8A 2XMXA 1QJPA 1MPFA 3QRAA 5T5FA 1P4TA 4AZLA 1GFNA 2LFUA 3VE2A 2Y2XA 7PRNA 4C4VB 4FOZA 4FQEA 4RJWA 1GFOA 4O3WA 4FSPA 1E54A 4O3YA 3AAAB 2OMFA 4O3ZA 3GP6A 2KC0A 3AA1B 2KZ7A 3POUA 5B66O 1S5LO 2FGQX 2W81C 2QTKA 5FVNA 5PRNA 2Y0KA 3UU2A 4C69X 2FGRA 4RJXA 4N74A 1ZHWA 4RLCA 2F1CX 3KVDD 3V8UA 4E1SA 4PUXA 2MHLA 4RL9A 1HXUA 2W80C 4FRTA 3DZMA 3HWBA 2XE1A 3BRYA 4AUIA 1THQA 3SZDA 2PRNA 4F4BA 2R4NA 3PQUA 4G76A 1HXXA 4C4VA 2AXTO 2R4PA 3EMNX 3A0BO 5B5EO 2KDYA 4QQ1A 2K4TA 3DA3A 2Y0HA 5JDPA 2R4OA 3PGRA 3VY8X 1PRNA 3VZUX 1ZHTA 2WJRA 3POXA 4D64A 1ZHZA 2X27X 4O49A 1HXTA 3PRNA 1QJ9A 4AKRB 2J1NA 2F1TA 2XG6A 3JCUO 5G39A 5GV0A 2XE3A 3WU2O 4LSHA 4E1TA 4AYDC 4JCHA 3SYBA 3UAQA 2WVPA 2YNKA 3AAEB 3K19A 4GHBA 5AFUK 3AA6B 5IYUA 5AFUL 1MM5A 2K0LA 4FRXA 3HOEA 4FUVA 2O4VA 1ZHXA 4N59A 3KZIO 3AA0B 4KR4A 4UB6O 2WJQA 2PORA 2M06A 2F1VA 2XE5A 3AA7A 3WI5A 4CTDA 4AYNA 1GFPA 5DL6A 1MM4A 3O0EA 3C5OA 4U9CA 1GFQA 2JMMA 3POQA 4GCQA 4O3XB 4O4XA 5G38A 4D65A 3LK3B 1BXWA 4GCPA 5G3AA 4GF4A 4FSOA 4AYMC 3UPGA 3T20A 2IWWA 1Q9FA 3DWOX 1GFMA 3PORA 4KRAA 2N2MA 4FESA 4GCSA 5GTHO 8PRNA 3RBHA 3LK41 3AAAA 3FYXA 3NSGA 4G75A 4AKRA 4K3CA 2MNHA 4FZMA 1IZNB 2XTQA 3A0HO 1Q9GA 4FZNA 5TISO 3AA1A 4O4UA 3VY9X 2N2LA 3AA6A 5E79O 5EE2A 2ERVA 1BH3A 2KXPB 4AFKA 3JTYA 5H2FO 2YPVA 2R89A 1QJ8A 3G7GA 2ZLDA 4K3BA 5DL5A 5G26A 3DWNA 3VE1A 2IWVA 3SY9A 3WI4A 3LK2B 4XNKA 2LHFA 2R88A 3HW9A 5D5DA 2GE4A 6PRNA 4LSEA 3LK3A 1OSMA 4Z3TA 3LK42 3A2SX 4AYEC
chains in the Genus database with same CATH topology
4AKMA 4JFBA 1BT9A 3QRCA 3T0SA 4FT6A 1ZHYA 4D5UA 1YS5A 1IZNA 2Y0LA 4AYID 2Y7SA 3SZVA 5DL8A 4BUMX 2KXPA 4RLBA 3TZGA 3AAEA 3VZWX 2XE2A 4FZLA 4FMSA 2XTRA 3SY7A 1G90A 1OPFA 4N58A 3LK2A 4LSFA 5DL7A 3VZTX 3AA0A 2M07A 2KZ7B 2J4UP 1PHOA 4XNLA 3SYSA 1ORMA 4LSIA 5ADXK 3T24A 3HOLA 5ADXL 2ODJA 3AA7B 4B61A 3PQSA 3DA4A 2ZFGA 1H6S1 4KR8A 2XMXA 1QJPA 1MPFA 3QRAA 5T5FA 1P4TA 4AZLA 1GFNA 2LFUA 3VE2A 2Y2XA 7PRNA 4FOZA 4RJWA 1GFOA 4O3WA 4FSPA 1E54A 4O3YA 3AAAB 2OMFA 4O3ZA 3GP6A 2KC0A 3AA1B 2KZ7A 3POUA 2FGQX 2W81C 2QTKA 5FVNA 5PRNA 2Y0KA 3UU2A 4C69X 2FGRA 4RJXA 1ZHWA 4RLCA 3KVDD 3V8UA 4E1SA 4PUXA 2MHLA 4RL9A 1HXUA 2W80C 4FRTA 3HWBA 2XE1A 4AUIA 4F4BA 1THQA 3SZDA 2PRNA 8PRNA 3PQUA 4G76A 1HXXA 3EMNX 2KDYA 4QQ1A 2K4TA 3DA3A 2Y0HA 5JDPA 3VY8X 3VZUX 1PRNA 1ZHTA 3POXA 4D64A 1ZHZA 2X27X 4O49A 1HXTA 3PRNA 1QJ9A 4AKRB 2J1NA 2F1TA 2XG6A 5GV0A 2XE3A 4E1TA 4LSHA 4AYDC 4JCHA 3SYBA 3UAQA 2YNKA 3AAEB 3K19A 4GHBA 5AFUK 3AA6B 5IYUA 5AFUL 1MM5A 2K0LA 4FRXA 3HOEA 4FUVA 2O4VA 1ZHXA 4N59A 3AA0B 4KR4A 2XE5A 2PORA 2M06A 2F1VA 3WI5A 3AA7A 4AYNA 1GFPA 5DL6A 1MM4A 3O0EA 3C5OA 4U9CA 1GFQA 2JMMA 3POQA 4GCQA 4O3XB 4O4XA 4D65A 3LK3B 1BXWA 4GCPA 3UPGA 4GF4A 4FSOA 4AYMC 3T20A 1Q9FA 4KRAA 1GFMA 3PORA 2N2MA 4FESA 4GCSA 3RBHA 3LK41 3AAAA 3FYXA 3NSGA 4G75A 4AKRA 2MNHA 4FZMA 1IZNB 2XTQA 1Q9GA 4FZNA 3AA1A 4O4UA 3VY9X 2N2LA 3AA6A 5EE2A 2ERVA 1BH3A 2KXPB 4AFKA 3JTYA 2YPVA 3G7GA 1QJ8A 5DL5A 2ZLDA 5G26A 3VE1A 3WI4A 3SY9A 3LK2B 4XNKA 2LHFA 3HW9A 5D5DA 2GE4A 6PRNA 4LSEA 3LK3A 1OSMA 4Z3TA 3LK42 3A2SX 4AYEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JFB A;  1BT9 A;  3T0S A;  4FT6 A;  4D5U A;  2Y0L A;  3SZV A;  5DL8 A;  4BUM X;  3VZW X;  2XE2 A;  4FMS A;  3SY7 A;  1OPF A;  3VZT X;  4LSF A;  5DL7 A;  2J4U P;  1PHO A;  3SYS A;  4LSI A;  3T24 A;  2ODJ A;  2ZFG A;  1H6S 1;  4KR8 A;  1MPF A;  1GFN A;  2Y2X A;  7PRN A;  4FOZ A;  4RJW A;  1GFO A;  4FSP A;  1E54 A;  2OMF A;  3POU A;  2FGQ X;  2QTK A;  5FVN A;  5PRN A;  2Y0K A;  3UU2 A;  4C69 X;  2FGR A;  4RJX A;  1HXU A;  4FRT A;  3HWB A;  2XE1 A;  4AUI A;  8PRN A;  3SZD A;  2PRN A;  1HXX A;  3EMN X;  2K4T A;  5JDP A;  2Y0H A;  3VY8 X;  3VZU X;  1PRN A;  3POX A;  4D64 A;  1HXT A;  3PRN A;  2J1N A;  2XG6 A;  2XE3 A;  4LSH A;  3SYB A;  3K19 A;  4FRX A;  2O4V A;  4KR4 A;  2XE5 A;  2POR A;  3WI5 A;  1GFP A;  5DL6 A;  3O0E A;  1GFQ A;  4GCQ A;  3POQ A;  4D65 A;  4GCP A;  3UPG A;  4FSO A;  3T20 A;  4KRA A;  1GFM A;  3POR A;  4GCS A;  3FYX A;  3NSG A;  3VY9 X;  1BH3 A;  3JTY A;  5DL5 A;  2ZLD A;  3WI4 A;  3SY9 A;  3HW9 A;  6PRN A;  4LSE A;  1OSM A;  3A2S X; 
#chains in the Genus database with same CATH topology
 4AKM A;  4JFB A;  1BT9 A;  1G90 A;  3QRC A;  3T0S A;  4FT6 A;  1ZHY A;  3NJT A;  1YS5 A;  4D5U A;  1T1L A;  1IZN A;  2Y0L A;  4AYI D;  2Y7S A;  3SZV A;  5DL8 A;  1T16 A;  4N75 A;  4BUM X;  2KXP A;  3BS0 A;  4RLB A;  3TZG A;  3AAE A;  3VZW X;  4PR7 A;  2R8A A;  2XE2 A;  3PGU A;  4C00 A;  4FZL A;  4FMS A;  4UB8 O;  2JQY A;  2XTR A;  5KAF O;  2X9K A;  3SY7 A;  5GTI O;  1OPF A;  4N58 A;  3LK2 A;  4LSF A;  3PF1 A;  5DL7 A;  3AA0 A;  2M07 A;  2KZ7 B;  3BRZ A;  4IL6 O;  2J4U P;  1PHO A;  4XNL A;  3SYS A;  1ORM A;  4LSI A;  4PJ0 O;  5ADX K;  3T24 A;  3HOL A;  5ADX L;  2ODJ A;  3AA7 B;  4B61 A;  3PQS A;  3VZT X;  3PGS A;  5KAI O;  3DA4 A;  2ZFG A;  2R4L A;  1H6S 1;  4KR8 A;  2XMX A;  1QJP A;  1MPF A;  3QRA A;  5T5F A;  1P4T A;  4AZL A;  1GFN A;  2LFU A;  3VE2 A;  2Y2X A;  7PRN A;  4C4V B;  4FOZ A;  4FQE A;  4RJW A;  1GFO A;  4O3W A;  4FSP A;  1E54 A;  4O3Y A;  3AAA B;  2OMF A;  4O3Z A;  3GP6 A;  2KC0 A;  3AA1 B;  2KZ7 A;  3POU A;  5B66 O;  1S5L O;  2FGQ X;  2W81 C;  2QTK A;  5FVN A;  5PRN A;  2Y0K A;  3UU2 A;  4C69 X;  2FGR A;  4RJX A;  4N74 A;  1ZHW A;  4RLC A;  2F1C X;  3KVD D;  3V8U A;  4E1S A;  4PUX A;  2MHL A;  4RL9 A;  1HXU A;  2W80 C;  4FRT A;  3DZM A;  3HWB A;  2XE1 A;  3BRY A;  4AUI A;  1THQ A;  3SZD A;  2PRN A;  4F4B A;  2R4N A;  3PQU A;  4G76 A;  1HXX A;  4C4V A;  2AXT O;  2R4P A;  3EMN X;  3A0B O;  5B5E O;  2KDY A;  4QQ1 A;  2K4T A;  3DA3 A;  2Y0H A;  5JDP A;  2R4O A;  3PGR A;  3VY8 X;  1PRN A;  3VZU X;  1ZHT A;  2WJR A;  3POX A;  4D64 A;  1ZHZ A;  2X27 X;  4O49 A;  1HXT A;  3PRN A;  1QJ9 A;  4AKR B;  2J1N A;  2F1T A;  2XG6 A;  3JCU O;  5G39 A;  5GV0 A;  2XE3 A;  3WU2 O;  4LSH A;  4E1T A;  4AYD C;  4JCH A;  3SYB A;  3UAQ A;  2WVP A;  2YNK A;  3AAE B;  3K19 A;  4GHB A;  5AFU K;  3AA6 B;  5IYU A;  5AFU L;  1MM5 A;  2K0L A;  4FRX A;  3HOE A;  4FUV A;  2O4V A;  1ZHX A;  4N59 A;  3KZI O;  3AA0 B;  4KR4 A;  4UB6 O;  2WJQ A;  2POR A;  2M06 A;  2F1V A;  2XE5 A;  3AA7 A;  3WI5 A;  4CTD A;  4AYN A;  1GFP A;  5DL6 A;  1MM4 A;  3O0E A;  3C5O A;  4U9C A;  1GFQ A;  2JMM A;  3POQ A;  4GCQ A;  4O3X B;  4O4X A;  5G38 A;  4D65 A;  3LK3 B;  1BXW A;  4GCP A;  5G3A A;  4GF4 A;  4FSO A;  4AYM C;  3UPG A;  3T20 A;  2IWW A;  1Q9F A;  3DWO X;  1GFM A;  3POR A;  4KRA A;  2N2M A;  4FES A;  4GCS A;  5GTH O;  8PRN A;  3RBH A;  3LK4 1;  3AAA A;  3FYX A;  3NSG A;  4G75 A;  4AKR A;  4K3C A;  2MNH A;  4FZM A;  1IZN B;  2XTQ A;  3A0H O;  1Q9G A;  4FZN A;  5TIS O;  3AA1 A;  4O4U A;  3VY9 X;  2N2L A;  3AA6 A;  5E79 O;  5EE2 A;  2ERV A;  1BH3 A;  2KXP B;  4AFK A;  3JTY A;  5H2F O;  2YPV A;  2R89 A;  1QJ8 A;  3G7G A;  2ZLD A;  4K3B A;  5DL5 A;  5G26 A;  3DWN A;  3VE1 A;  2IWV A;  3SY9 A;  3WI4 A;  3LK2 B;  4XNK A;  2LHF A;  2R88 A;  3HW9 A;  5D5D A;  2GE4 A;  6PRN A;  4LSE A;  3LK3 A;  1OSM A;  4Z3T A;  3LK4 2;  3A2S X;  4AYE C; 
#chains in the Genus database with same CATH homology
 4AKM A;  4JFB A;  1BT9 A;  3QRC A;  3T0S A;  4FT6 A;  1ZHY A;  4D5U A;  1YS5 A;  1IZN A;  2Y0L A;  4AYI D;  2Y7S A;  3SZV A;  5DL8 A;  4BUM X;  2KXP A;  4RLB A;  3TZG A;  3AAE A;  3VZW X;  2XE2 A;  4FZL A;  4FMS A;  2XTR A;  3SY7 A;  1G90 A;  1OPF A;  4N58 A;  3LK2 A;  4LSF A;  5DL7 A;  3VZT X;  3AA0 A;  2M07 A;  2KZ7 B;  2J4U P;  1PHO A;  4XNL A;  3SYS A;  1ORM A;  4LSI A;  5ADX K;  3T24 A;  3HOL A;  5ADX L;  2ODJ A;  3AA7 B;  4B61 A;  3PQS A;  3DA4 A;  2ZFG A;  1H6S 1;  4KR8 A;  2XMX A;  1QJP A;  1MPF A;  3QRA A;  5T5F A;  1P4T A;  4AZL A;  1GFN A;  2LFU A;  3VE2 A;  2Y2X A;  7PRN A;  4FOZ A;  4RJW A;  1GFO A;  4O3W A;  4FSP A;  1E54 A;  4O3Y A;  3AAA B;  2OMF A;  4O3Z A;  3GP6 A;  2KC0 A;  3AA1 B;  2KZ7 A;  3POU A;  2FGQ X;  2W81 C;  2QTK A;  5FVN A;  5PRN A;  2Y0K A;  3UU2 A;  4C69 X;  2FGR A;  4RJX A;  1ZHW A;  4RLC A;  3KVD D;  3V8U A;  4E1S A;  4PUX A;  2MHL A;  4RL9 A;  1HXU A;  2W80 C;  4FRT A;  3HWB A;  2XE1 A;  4AUI A;  4F4B A;  1THQ A;  3SZD A;  2PRN A;  8PRN A;  3PQU A;  4G76 A;  1HXX A;  3EMN X;  2KDY A;  4QQ1 A;  2K4T A;  3DA3 A;  2Y0H A;  5JDP A;  3VY8 X;  3VZU X;  1PRN A;  1ZHT A;  3POX A;  4D64 A;  1ZHZ A;  2X27 X;  4O49 A;  1HXT A;  3PRN A;  1QJ9 A;  4AKR B;  2J1N A;  2F1T A;  2XG6 A;  5GV0 A;  2XE3 A;  4E1T A;  4LSH A;  4AYD C;  4JCH A;  3SYB A;  3UAQ A;  2YNK A;  3AAE B;  3K19 A;  4GHB A;  5AFU K;  3AA6 B;  5IYU A;  5AFU L;  1MM5 A;  2K0L A;  4FRX A;  3HOE A;  4FUV A;  2O4V A;  1ZHX A;  4N59 A;  3AA0 B;  4KR4 A;  2XE5 A;  2POR A;  2M06 A;  2F1V A;  3WI5 A;  3AA7 A;  4AYN A;  1GFP A;  5DL6 A;  1MM4 A;  3O0E A;  3C5O A;  4U9C A;  1GFQ A;  2JMM A;  3POQ A;  4GCQ A;  4O3X B;  4O4X A;  4D65 A;  3LK3 B;  1BXW A;  4GCP A;  3UPG A;  4GF4 A;  4FSO A;  4AYM C;  3T20 A;  1Q9F A;  4KRA A;  1GFM A;  3POR A;  2N2M A;  4FES A;  4GCS A;  3RBH A;  3LK4 1;  3AAA A;  3FYX A;  3NSG A;  4G75 A;  4AKR A;  2MNH A;  4FZM A;  1IZN B;  2XTQ A;  1Q9G A;  4FZN A;  3AA1 A;  4O4U A;  3VY9 X;  2N2L A;  3AA6 A;  5EE2 A;  2ERV A;  1BH3 A;  2KXP B;  4AFK A;  3JTY A;  2YPV A;  3G7G A;  1QJ8 A;  5DL5 A;  2ZLD A;  5G26 A;  3VE1 A;  3WI4 A;  3SY9 A;  3LK2 B;  4XNK A;  2LHF A;  3HW9 A;  5D5D A;  2GE4 A;  6PRN A;  4LSE A;  3LK3 A;  1OSM A;  4Z3T A;  3LK4 2;  3A2S X;  4AYE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...