5G26A

Unveiling the mechanism behind the in-meso crystallization of membrane proteins
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
241
structure length
241
Chain Sequence
HYGTAEVNLQSGNNFDGSSLDFLLPFYDSEKMLAFGQVGARYIDSRFTANLGAGQRFFLPANMLGYNVFIDQDFSGDNTRLGIGGEYWRDYFKSSVNGYFRMSGWHESYNKKDYDERPANGFDIRFNGYLPSYPALGAKLIYEQYYGDNVALFNSDKLQSNPGAATVGVNYTPIPLVTMGIDYRHGTGNENDLLYSMQFRYQFDKSWSQQIEPQYVNELRTLSGSRYDLVQRNNNIILEYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords INTIMIN
publication title The Nanoscience Behind the Art of in-Meso Crystallization of Membrane Proteins.
pubmed doi rcsb
source organism Escherichia coli
total genus 69
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2016-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.160 Mainly Beta Beta Barrel Porin Porin 5g26A00
5G26A 4E1TA 4E1SA
chains in the Genus database with same CATH superfamily
3QRAA 2MHLA 2QTKA 2R88A 2M06A 3DZMA 3AAAB 3K19A 4FQEA 3BRYA 4FZNA 3WI4A 1GFNA 4AUIA 4AYDC 1BH3A 2FGRA 3PGRA 4N74A 5G39A 3A2SX 3SY7A 1MPFA 1IZNB 2GE4A 3BS0A 3POXA 1S5LO 4JFBA 3UAQA 3HOEA 4B61A 3LK41 5ADXL 3T20A 4FSOA 1E54A 4KR4A 3SY9A 1Q9GA 3C5OA 2R4NA 4FZLA 4AFKA 1QJPA 5G3AA 7PRNA 2XMXA 3KZIO 5JDPA 1THQA 5IYUA 4AYNA 5B66O 3PGSA 5G26A 4AYID 1BT9A 1T16A 3BRZA 3POUA 5PRNA 2XE1A 2Y0LA 3PRNA 3SYBA 3GP6A 4LSFA 5B5EO 2IWWA 1H6S1 4O49A 3AAAA 5KAIO 3WI5A 3V8UA 3NSGA 3WU2O 4GHBA 1G90A 1HXXA 4AYEC 2N2MA 5AFUL 1GFOA 1PHOA 4O4UA 1HXTA 2AXTO 4N59A 4GCQA 3LK42 2O4VA 3RBHA 1ZHZA 4LSIA 3LK2B 4RJWA 3TZGA 4AKMA 5GTHO 3VZUX 4O4XA 2MNHA 4FRTA 4JCHA 4U9CA 4G75A 3POQA 1ZHXA 2X9KA 2XTQA 2Y0KA 4XNLA 1MM5A 4RL9A 5KAFO 3AA0A 3UPGA 2ERVA 2J1NA 2KDYA 3QRCA 4FRXA 1GFQA 1GFPA 3AAEA 4C4VA 2OMFA 4LSHA 4E1SA 2ZLDA 3AA0B 4G76A 4D64A 4FSPA 3T24A 1QJ9A 5GV0A 2F1VA 3AAEB 4E1TA 4C4VB 1YS5A 4N58A 2XE5A 6PRNA 3VY9X 3HW9A 3HOLA 4FT6A 4O3YA 4D5UA 4IL6O 3LK2A 5E79O 2YNKA 3SYSA 2XTRA 1ZHWA 3AA7A 1ZHTA 3PQUA 4AKRB 4RLCA 2N2LA 3VY8X 4O3ZA 3JCUO 1MM4A 2K4TA 2R89A 8PRNA 3DWNA 3AA7B 3VE1A 2W80C 4C00A 4D65A 2R4LA 3A0HO 2WJQA 4RLBA 4LSEA 5DL6A 2XE3A 2XG6A 4UB8O 4XNKA 5FVNA 3SZVA 4AZLA 4RJXA 1T1LA 2KXPA 4F4BA 3JTYA 1ORMA 1ZHYA 2M07A 2R4OA 2Y7SA 3A0BO 5TISO 3VZTX 2F1CX 2J4UP 1HXUA 3UU2A 4BUMX 2XE2A 2YPVA 4QQ1A 2KXPB 4O3XB 4O3WA 4PJ0O 4KRAA 2LFUA 3PGUA 1QJ8A 4C69X 3DA3A 4PUXA 4PR7A 5GTIO 2JQYA 3T0SA 4CTDA 5H2FO 2KZ7A 4AYMC 4FUVA 1OPFA 5DL8A 4GCSA 2F1TA 2PRNA 3AA1A 2R8AA 2W81C 3NJTA 3PQSA 3KVDD 2KZ7B 2ZFGA 4KR8A 1GFMA 5DL5A 4UB6O 3VZWX 1BXWA 2WVPA 2Y2XA 3O0EA 3EMNX 4K3BA 3G7GA 1PRNA 2K0LA 5D5DA 3AA6A 4GF4A 3AA1B 1OSMA 3VE2A 2R4PA 2WJRA 1Q9FA 3DA4A 2IWVA 4K3CA 4FMSA 1P4TA 3DWOX 4GCPA 2PORA 5AFUK 3SZDA 3LK3A 3PF1A 2X27X 3FYXA 4FESA 5DL7A 4Z3TA 3AA6B 4AKRA 4N75A 5EE2A 5G38A 4FOZA 2JMMA 5T5FA 2ODJA 2Y0HA 3HWBA 2FGQX 3PORA 2LHFA 4FZMA 3LK3B 5ADXK 1IZNA 2KC0A
chains in the Genus database with same CATH topology
3QRAA 2MHLA 2QTKA 3K19A 2M06A 3WI4A 3AAAB 4AUIA 4AYDC 4FZNA 1GFNA 1BH3A 2FGRA 3A2SX 3SY7A 1MPFA 1IZNB 2GE4A 3POXA 4JFBA 5ADXL 3UAQA 3T20A 3HOEA 4B61A 3LK41 4FSOA 1E54A 4KR4A 3SY9A 1Q9GA 3C5OA 4FZLA 4AFKA 1QJPA 7PRNA 2XMXA 5JDPA 1THQA 5IYUA 4AYNA 5G26A 4AYID 1BT9A 3POUA 5PRNA 2XE1A 2Y0LA 3PRNA 3SYBA 3GP6A 4LSFA 1H6S1 4O49A 3AAAA 3WI5A 3V8UA 3NSGA 1G90A 4GHBA 1HXXA 4AYEC 2N2MA 5AFUL 1GFOA 1PHOA 4O4UA 1HXTA 4N59A 4GCQA 3LK42 2O4VA 3RBHA 1ZHZA 4LSIA 3LK2B 4RJWA 3TZGA 4AKMA 3VZUX 4O4XA 2MNHA 4FRTA 4JCHA 4U9CA 4G75A 3POQA 2XTQA 1ZHXA 4XNLA 2Y0KA 1MM5A 4RL9A 3AA0A 2ERVA 2J1NA 2KDYA 3QRCA 4FRXA 1GFQA 1GFPA 3AAEA 2OMFA 4LSHA 4E1SA 2ZLDA 3AA0B 4G76A 4D64A 4FSPA 3T24A 1QJ9A 5GV0A 2F1VA 3AAEB 4E1TA 1YS5A 4N58A 2XE5A 6PRNA 3VY9X 3HW9A 3HOLA 4FT6A 4O3YA 4D5UA 3LK2A 2YNKA 3SYSA 2XTRA 1ZHWA 3AA7A 1ZHTA 3PQUA 4AKRB 4RLCA 2N2LA 3VY8X 4O3ZA 1MM4A 2K4TA 8PRNA 3AA7B 3VE1A 2W80C 4D65A 4RLBA 4LSEA 5DL6A 2XE3A 2XG6A 4XNKA 5FVNA 3SZVA 4AZLA 4RJXA 2KXPA 4F4BA 3JTYA 1ORMA 1ZHYA 2M07A 2Y7SA 3VZTX 2J4UP 1HXUA 3UU2A 4BUMX 2XE2A 2YPVA 4QQ1A 2KXPB 4O3XB 4O3WA 4KRAA 2LFUA 1QJ8A 4C69X 3DA3A 4PUXA 3T0SA 2KZ7A 4AYMC 4FUVA 1OPFA 5DL8A 4GCSA 2F1TA 2PRNA 3AA1A 3PQSA 2W81C 3KVDD 2KZ7B 2ZFGA 4KR8A 1GFMA 5DL5A 3VZWX 1BXWA 2Y2XA 3O0EA 3EMNX 3G7GA 1PRNA 2K0LA 5D5DA 3AA6A 4GF4A 3AA1B 1OSMA 3VE2A 1Q9FA 3DA4A 4FMSA 1P4TA 4GCPA 5AFUK 2PORA 3UPGA 3SZDA 3LK3A 4FESA 2X27X 3FYXA 5DL7A 4Z3TA 3AA6B 4AKRA 5EE2A 5T5FA 4FOZA 2JMMA 2ODJA 2Y0HA 3HWBA 2FGQX 3PORA 2LHFA 4FZMA 3LK3B 5ADXK 1IZNA 2KC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G26 A;  4E1T A;  4E1S A; 
#chains in the Genus database with same CATH topology
 3QRA A;  2MHL A;  2QTK A;  2R88 A;  2M06 A;  3DZM A;  3AAA B;  3K19 A;  4FQE A;  3BRY A;  4FZN A;  3WI4 A;  1GFN A;  4AUI A;  4AYD C;  1BH3 A;  2FGR A;  3PGR A;  4N74 A;  5G39 A;  3A2S X;  3SY7 A;  1MPF A;  1IZN B;  2GE4 A;  3BS0 A;  3POX A;  1S5L O;  4JFB A;  3UAQ A;  3HOE A;  4B61 A;  3LK4 1;  5ADX L;  3T20 A;  4FSO A;  1E54 A;  4KR4 A;  3SY9 A;  1Q9G A;  3C5O A;  2R4N A;  4FZL A;  4AFK A;  1QJP A;  5G3A A;  7PRN A;  2XMX A;  3KZI O;  5JDP A;  1THQ A;  5IYU A;  4AYN A;  5B66 O;  3PGS A;  5G26 A;  4AYI D;  1BT9 A;  1T16 A;  3BRZ A;  3POU A;  5PRN A;  2XE1 A;  2Y0L A;  3PRN A;  3SYB A;  3GP6 A;  4LSF A;  5B5E O;  2IWW A;  1H6S 1;  4O49 A;  3AAA A;  5KAI O;  3WI5 A;  3V8U A;  3NSG A;  3WU2 O;  4GHB A;  1G90 A;  1HXX A;  4AYE C;  2N2M A;  5AFU L;  1GFO A;  1PHO A;  4O4U A;  1HXT A;  2AXT O;  4N59 A;  4GCQ A;  3LK4 2;  2O4V A;  3RBH A;  1ZHZ A;  4LSI A;  3LK2 B;  4RJW A;  3TZG A;  4AKM A;  5GTH O;  3VZU X;  4O4X A;  2MNH A;  4FRT A;  4JCH A;  4U9C A;  4G75 A;  3POQ A;  1ZHX A;  2X9K A;  2XTQ A;  2Y0K A;  4XNL A;  1MM5 A;  4RL9 A;  5KAF O;  3AA0 A;  3UPG A;  2ERV A;  2J1N A;  2KDY A;  3QRC A;  4FRX A;  1GFQ A;  1GFP A;  3AAE A;  4C4V A;  2OMF A;  4LSH A;  4E1S A;  2ZLD A;  3AA0 B;  4G76 A;  4D64 A;  4FSP A;  3T24 A;  1QJ9 A;  5GV0 A;  2F1V A;  3AAE B;  4E1T A;  4C4V B;  1YS5 A;  4N58 A;  2XE5 A;  6PRN A;  3VY9 X;  3HW9 A;  3HOL A;  4FT6 A;  4O3Y A;  4D5U A;  4IL6 O;  3LK2 A;  5E79 O;  2YNK A;  3SYS A;  2XTR A;  1ZHW A;  3AA7 A;  1ZHT A;  3PQU A;  4AKR B;  4RLC A;  2N2L A;  3VY8 X;  4O3Z A;  3JCU O;  1MM4 A;  2K4T A;  2R89 A;  8PRN A;  3DWN A;  3AA7 B;  3VE1 A;  2W80 C;  4C00 A;  4D65 A;  2R4L A;  3A0H O;  2WJQ A;  4RLB A;  4LSE A;  5DL6 A;  2XE3 A;  2XG6 A;  4UB8 O;  4XNK A;  5FVN A;  3SZV A;  4AZL A;  4RJX A;  1T1L A;  2KXP A;  4F4B A;  3JTY A;  1ORM A;  1ZHY A;  2M07 A;  2R4O A;  2Y7S A;  3A0B O;  5TIS O;  3VZT X;  2F1C X;  2J4U P;  1HXU A;  3UU2 A;  4BUM X;  2XE2 A;  2YPV A;  4QQ1 A;  2KXP B;  4O3X B;  4O3W A;  4PJ0 O;  4KRA A;  2LFU A;  3PGU A;  1QJ8 A;  4C69 X;  3DA3 A;  4PUX A;  4PR7 A;  5GTI O;  2JQY A;  3T0S A;  4CTD A;  5H2F O;  2KZ7 A;  4AYM C;  4FUV A;  1OPF A;  5DL8 A;  4GCS A;  2F1T A;  2PRN A;  3AA1 A;  2R8A A;  2W81 C;  3NJT A;  3PQS A;  3KVD D;  2KZ7 B;  2ZFG A;  4KR8 A;  1GFM A;  5DL5 A;  4UB6 O;  3VZW X;  1BXW A;  2WVP A;  2Y2X A;  3O0E A;  3EMN X;  4K3B A;  3G7G A;  1PRN A;  2K0L A;  5D5D A;  3AA6 A;  4GF4 A;  3AA1 B;  1OSM A;  3VE2 A;  2R4P A;  2WJR A;  1Q9F A;  3DA4 A;  2IWV A;  4K3C A;  4FMS A;  1P4T A;  3DWO X;  4GCP A;  2POR A;  5AFU K;  3SZD A;  3LK3 A;  3PF1 A;  2X27 X;  3FYX A;  4FES A;  5DL7 A;  4Z3T A;  3AA6 B;  4AKR A;  4N75 A;  5EE2 A;  5G38 A;  4FOZ A;  2JMM A;  5T5F A;  2ODJ A;  2Y0H A;  3HWB A;  2FGQ X;  3POR A;  2LHF A;  4FZM A;  3LK3 B;  5ADX K;  1IZN A;  2KC0 A; 
#chains in the Genus database with same CATH homology
 3QRA A;  2MHL A;  2QTK A;  3K19 A;  2M06 A;  3WI4 A;  3AAA B;  4AUI A;  4AYD C;  4FZN A;  1GFN A;  1BH3 A;  2FGR A;  3A2S X;  3SY7 A;  1MPF A;  1IZN B;  2GE4 A;  3POX A;  4JFB A;  5ADX L;  3UAQ A;  3T20 A;  3HOE A;  4B61 A;  3LK4 1;  4FSO A;  1E54 A;  4KR4 A;  3SY9 A;  1Q9G A;  3C5O A;  4FZL A;  4AFK A;  1QJP A;  7PRN A;  2XMX A;  5JDP A;  1THQ A;  5IYU A;  4AYN A;  5G26 A;  4AYI D;  1BT9 A;  3POU A;  5PRN A;  2XE1 A;  2Y0L A;  3PRN A;  3SYB A;  3GP6 A;  4LSF A;  1H6S 1;  4O49 A;  3AAA A;  3WI5 A;  3V8U A;  3NSG A;  1G90 A;  4GHB A;  1HXX A;  4AYE C;  2N2M A;  5AFU L;  1GFO A;  1PHO A;  4O4U A;  1HXT A;  4N59 A;  4GCQ A;  3LK4 2;  2O4V A;  3RBH A;  1ZHZ A;  4LSI A;  3LK2 B;  4RJW A;  3TZG A;  4AKM A;  3VZU X;  4O4X A;  2MNH A;  4FRT A;  4JCH A;  4U9C A;  4G75 A;  3POQ A;  2XTQ A;  1ZHX A;  4XNL A;  2Y0K A;  1MM5 A;  4RL9 A;  3AA0 A;  2ERV A;  2J1N A;  2KDY A;  3QRC A;  4FRX A;  1GFQ A;  1GFP A;  3AAE A;  2OMF A;  4LSH A;  4E1S A;  2ZLD A;  3AA0 B;  4G76 A;  4D64 A;  4FSP A;  3T24 A;  1QJ9 A;  5GV0 A;  2F1V A;  3AAE B;  4E1T A;  1YS5 A;  4N58 A;  2XE5 A;  6PRN A;  3VY9 X;  3HW9 A;  3HOL A;  4FT6 A;  4O3Y A;  4D5U A;  3LK2 A;  2YNK A;  3SYS A;  2XTR A;  1ZHW A;  3AA7 A;  1ZHT A;  3PQU A;  4AKR B;  4RLC A;  2N2L A;  3VY8 X;  4O3Z A;  1MM4 A;  2K4T A;  8PRN A;  3AA7 B;  3VE1 A;  2W80 C;  4D65 A;  4RLB A;  4LSE A;  5DL6 A;  2XE3 A;  2XG6 A;  4XNK A;  5FVN A;  3SZV A;  4AZL A;  4RJX A;  2KXP A;  4F4B A;  3JTY A;  1ORM A;  1ZHY A;  2M07 A;  2Y7S A;  3VZT X;  2J4U P;  1HXU A;  3UU2 A;  4BUM X;  2XE2 A;  2YPV A;  4QQ1 A;  2KXP B;  4O3X B;  4O3W A;  4KRA A;  2LFU A;  1QJ8 A;  4C69 X;  3DA3 A;  4PUX A;  3T0S A;  2KZ7 A;  4AYM C;  4FUV A;  1OPF A;  5DL8 A;  4GCS A;  2F1T A;  2PRN A;  3AA1 A;  3PQS A;  2W81 C;  3KVD D;  2KZ7 B;  2ZFG A;  4KR8 A;  1GFM A;  5DL5 A;  3VZW X;  1BXW A;  2Y2X A;  3O0E A;  3EMN X;  3G7G A;  1PRN A;  2K0L A;  5D5D A;  3AA6 A;  4GF4 A;  3AA1 B;  1OSM A;  3VE2 A;  1Q9F A;  3DA4 A;  4FMS A;  1P4T A;  4GCP A;  5AFU K;  2POR A;  3UPG A;  3SZD A;  3LK3 A;  4FES A;  2X27 X;  3FYX A;  5DL7 A;  4Z3T A;  3AA6 B;  4AKR A;  5EE2 A;  5T5F A;  4FOZ A;  2JMM A;  2ODJ A;  2Y0H A;  3HWB A;  2FGQ X;  3POR A;  2LHF A;  4FZM A;  3LK3 B;  5ADX K;  1IZN A;  2KC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...