5G26A

Unveiling the mechanism behind the in-meso crystallization of membrane proteins
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
241
structure length
241
Chain Sequence
HYGTAEVNLQSGNNFDGSSLDFLLPFYDSEKMLAFGQVGARYIDSRFTANLGAGQRFFLPANMLGYNVFIDQDFSGDNTRLGIGGEYWRDYFKSSVNGYFRMSGWHESYNKKDYDERPANGFDIRFNGYLPSYPALGAKLIYEQYYGDNVALFNSDKLQSNPGAATVGVNYTPIPLVTMGIDYRHGTGNENDLLYSMQFRYQFDKSWSQQIEPQYVNELRTLSGSRYDLVQRNNNIILEYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTIMIN
publication title The Nanoscience Behind the Art of in-Meso Crystallization of Membrane Proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 69
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2016-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.160 Mainly Beta Beta Barrel Porin Porin 5g26A00
4E1SA 5G26A 4E1TA
chains in the Genus database with same CATH superfamily
1ZHWA 4O4XA 1PRNA 3PQUA 5H2FO 4FUVA 2K4TA 3PGSA 2WVPA 3NJTA 4JCHA 3AA6A 2ODJA 3LK2A 4FSPA 2XTQA 5GTIO 2QTKA 3TZGA 4FRTA 4O3YA 4E1TA 5DL5A 5G38A 5E79O 3GP6A 5DL8A 4O49A 2F1CX 4D65A 4RJWA 1IZNB 4PR7A 3SZVA 2LHFA 3HW9A 5KAFO 4FSOA 3T24A 3WI4A 4D5UA 4N74A 3LK3A 4BUMX 1GFPA 3DWNA 2R89A 3SY7A 3G7GA 2FGQX 4IL6O 3EMNX 3UAQA 3AA7A 3WU2O 4AYMC 4FT6A 8PRNA 2JQYA 7PRNA 2KXPB 2Y2XA 5D5DA 2R8AA 1T1LA 4AKRB 4LSFA 2N2MA 3JTYA 2ZLDA 4C4VA 2MNHA 1QJ8A 5AFUL 4KRAA 3AAAB 3C5OA 2N2LA 3AA1A 3PORA 4LSHA 3VE1A 4FMSA 3AA0B 4LSIA 4QQ1A 2F1VA 2OMFA 1YS5A 4GCSA 4C69X 3SYSA 2YNKA 3WI5A 3HOLA 1MPFA 2J1NA 4KR8A 4B61A 4O3ZA 2M07A 4FZLA 2XTRA 4GHBA 5IYUA 3KZIO 5DL7A 2AXTO 1G90A 2IWWA 3VZTX 1E54A 4AFKA 4E1SA 2WJRA 4AYEC 3AA6B 2R4LA 3LK2B 3DZMA 3T0SA 3LK42 1GFQA 1GFNA 3POXA 3HWBA 4FOZA 4AYNA 4U9CA 2KZ7A 5ADXK 3UPGA 4XNLA 3PGRA 4F4BA 3BS0A 2Y7SA 3PGUA 3PRNA 4O3XB 4CTDA 5GV0A 2R4OA 3LK3B 3A0HO 3QRAA 3BRZA 3UU2A 4D64A 2ERVA 2O4VA 4K3CA 3A2SX 3AA7B 2J4UP 1ZHXA 2W81C 2PORA 5B5EO 3AAEA 2XE1A 4G76A 2F1TA 2M06A 2R4NA 3NSGA 3PQSA 1MM4A 4N59A 4O3WA 1P4TA 1HXXA 2W80C 3BRYA 4K3BA 4C4VB 1BT9A 5EE2A 2FGRA 2R88A 2MHLA 3AA1B 1QJ9A 1OPFA 1S5LO 4LSEA 1H6S1 2Y0KA 3O0EA 5DL6A 5G26A 4XNKA 1GFOA 3VY9X 3DA4A 5G39A 1OSMA 3SZDA 4AZLA 4C00A 2IWVA 4RLCA 4RL9A 4RLBA 5G3AA 5PRNA 3T20A 1PHOA 2LFUA 4GCQA 3VZUX 2YPVA 2KDYA 3VY8X 2R4PA 3VZWX 1MM5A 1QJPA 4N58A 4G75A 1Q9GA 4GCPA 6PRNA 1Q9FA 3POQA 2K0LA 5T5FA 2XE3A 2ZFGA 4UB8O 4AUIA 3VE2A 3V8UA 4AYDC 2GE4A 2KZ7B 3DA3A 2XMXA 2XE5A 3JCUO 5KAIO 2Y0LA 4Z3TA 1IZNA 3RBHA 4UB6O 4FQEA 5ADXL 2XE2A 3HOEA 4JFBA 2WJQA 5FVNA 2JMMA 2XG6A 3SYBA 4AKMA 1HXTA 3A0BO 2PRNA 2X9KA 3KVDD 4AYID 2KXPA 3AAEB 1THQA 5AFUK 2KC0A 4AKRA 2Y0HA 1GFMA 5TISO 2X27X 4KR4A 4RJXA 3AAAA 1ZHTA 5GTHO 3FYXA 1ZHYA 4GF4A 1BXWA 3AA0A 1ZHZA 3K19A 3LK41 1BH3A 3POUA 1T16A 4FZMA 4O4UA 5B66O 3DWOX 4FZNA 4N75A 3PF1A 5JDPA 3QRCA 1ORMA 4FESA 4PUXA 4FRXA 1HXUA 3SY9A 4PJ0O
chains in the Genus database with same CATH topology
1ZHWA 4O4XA 1PRNA 3PQUA 4FUVA 2K4TA 4JCHA 3AA6A 2ODJA 3LK2A 4FSPA 2XTQA 2QTKA 3TZGA 4FRTA 4O3YA 4E1TA 5DL5A 3GP6A 5DL8A 4O49A 4D65A 4RJWA 1IZNB 3T24A 3SZVA 2LHFA 3HW9A 3WI4A 4FSOA 4D5UA 3LK3A 4BUMX 1GFPA 4E1SA 3SY7A 4AYMC 3G7GA 2FGQX 3UAQA 3EMNX 3AA7A 8PRNA 4FT6A 7PRNA 2KXPB 2Y2XA 5D5DA 4AKRB 4LSFA 2N2MA 3JTYA 2ZLDA 5AFUL 2MNHA 1QJ8A 4KRAA 3AAAB 3C5OA 2N2LA 3AA1A 3PORA 4LSHA 3VE1A 4FMSA 3AA0B 4LSIA 4QQ1A 2F1VA 2OMFA 1YS5A 4GCSA 4C69X 3SYSA 2YNKA 3WI5A 3HOLA 1MPFA 2J1NA 4KR8A 4B61A 4O3ZA 2M07A 4FZLA 2XTRA 4GHBA 5IYUA 1G90A 5DL7A 3VZTX 1E54A 4AFKA 4AYEC 3AA6B 3LK2B 3T0SA 3LK42 1GFQA 1GFNA 3POXA 3HWBA 4FOZA 4AYNA 4U9CA 2KZ7A 5ADXK 3UPGA 4XNLA 4F4BA 5GV0A 2Y7SA 3PRNA 4O3XB 3LK3B 4D64A 3QRAA 3UU2A 2ERVA 2O4VA 2J4UP 3A2SX 3AA7B 1ZHXA 2W81C 2PORA 3AAEA 2XE1A 4G76A 2F1TA 2M06A 3PQSA 3NSGA 4N59A 1MM4A 4O3WA 1P4TA 1HXXA 2W80C 1BT9A 5EE2A 2FGRA 2MHLA 3AA1B 1QJ9A 1OPFA 4LSEA 5G26A 1H6S1 2Y0KA 3O0EA 5DL6A 4XNKA 1GFOA 3VY9X 3DA4A 3SZDA 1OSMA 4AZLA 4RLCA 4RL9A 4RLBA 5PRNA 3T20A 1PHOA 2LFUA 4GCQA 3VZUX 2YPVA 2KDYA 3VY8X 3VZWX 1MM5A 1QJPA 4N58A 4G75A 1Q9GA 4GCPA 6PRNA 1Q9FA 3POQA 2K0LA 5T5FA 2XE3A 2ZFGA 4AUIA 3VE2A 3V8UA 4AYDC 2GE4A 2KZ7B 3DA3A 2XMXA 2XE5A 4Z3TA 2Y0LA 1IZNA 3RBHA 5ADXL 2XE2A 3HOEA 4JFBA 5FVNA 2JMMA 2XG6A 3SYBA 4AKMA 1HXTA 2PRNA 3KVDD 4AYID 2KXPA 3AAEB 1THQA 5AFUK 2KC0A 4AKRA 2Y0HA 1GFMA 2X27X 4KR4A 4RJXA 3AAAA 1ZHTA 3FYXA 1ZHYA 4GF4A 1BXWA 3AA0A 1ZHZA 3K19A 3LK41 1BH3A 3POUA 4O4UA 4FZMA 4FZNA 5JDPA 3QRCA 1ORMA 4FESA 4PUXA 4FRXA 1HXUA 3SY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E1S A;  5G26 A;  4E1T A; 
#chains in the Genus database with same CATH topology
 1ZHW A;  4O4X A;  1PRN A;  3PQU A;  5H2F O;  4FUV A;  2K4T A;  3PGS A;  2WVP A;  3NJT A;  4JCH A;  3AA6 A;  2ODJ A;  3LK2 A;  4FSP A;  2XTQ A;  5GTI O;  2QTK A;  3TZG A;  4FRT A;  4O3Y A;  4E1T A;  5DL5 A;  5G38 A;  5E79 O;  3GP6 A;  5DL8 A;  4O49 A;  2F1C X;  4D65 A;  4RJW A;  1IZN B;  4PR7 A;  3SZV A;  2LHF A;  3HW9 A;  5KAF O;  4FSO A;  3T24 A;  3WI4 A;  4D5U A;  4N74 A;  3LK3 A;  4BUM X;  1GFP A;  3DWN A;  2R89 A;  3SY7 A;  3G7G A;  2FGQ X;  4IL6 O;  3EMN X;  3UAQ A;  3AA7 A;  3WU2 O;  4AYM C;  4FT6 A;  8PRN A;  2JQY A;  7PRN A;  2KXP B;  2Y2X A;  5D5D A;  2R8A A;  1T1L A;  4AKR B;  4LSF A;  2N2M A;  3JTY A;  2ZLD A;  4C4V A;  2MNH A;  1QJ8 A;  5AFU L;  4KRA A;  3AAA B;  3C5O A;  2N2L A;  3AA1 A;  3POR A;  4LSH A;  3VE1 A;  4FMS A;  3AA0 B;  4LSI A;  4QQ1 A;  2F1V A;  2OMF A;  1YS5 A;  4GCS A;  4C69 X;  3SYS A;  2YNK A;  3WI5 A;  3HOL A;  1MPF A;  2J1N A;  4KR8 A;  4B61 A;  4O3Z A;  2M07 A;  4FZL A;  2XTR A;  4GHB A;  5IYU A;  3KZI O;  5DL7 A;  2AXT O;  1G90 A;  2IWW A;  3VZT X;  1E54 A;  4AFK A;  4E1S A;  2WJR A;  4AYE C;  3AA6 B;  2R4L A;  3LK2 B;  3DZM A;  3T0S A;  3LK4 2;  1GFQ A;  1GFN A;  3POX A;  3HWB A;  4FOZ A;  4AYN A;  4U9C A;  2KZ7 A;  5ADX K;  3UPG A;  4XNL A;  3PGR A;  4F4B A;  3BS0 A;  2Y7S A;  3PGU A;  3PRN A;  4O3X B;  4CTD A;  5GV0 A;  2R4O A;  3LK3 B;  3A0H O;  3QRA A;  3BRZ A;  3UU2 A;  4D64 A;  2ERV A;  2O4V A;  4K3C A;  3A2S X;  3AA7 B;  2J4U P;  1ZHX A;  2W81 C;  2POR A;  5B5E O;  3AAE A;  2XE1 A;  4G76 A;  2F1T A;  2M06 A;  2R4N A;  3NSG A;  3PQS A;  1MM4 A;  4N59 A;  4O3W A;  1P4T A;  1HXX A;  2W80 C;  3BRY A;  4K3B A;  4C4V B;  1BT9 A;  5EE2 A;  2FGR A;  2R88 A;  2MHL A;  3AA1 B;  1QJ9 A;  1OPF A;  1S5L O;  4LSE A;  1H6S 1;  2Y0K A;  3O0E A;  5DL6 A;  5G26 A;  4XNK A;  1GFO A;  3VY9 X;  3DA4 A;  5G39 A;  1OSM A;  3SZD A;  4AZL A;  4C00 A;  2IWV A;  4RLC A;  4RL9 A;  4RLB A;  5G3A A;  5PRN A;  3T20 A;  1PHO A;  2LFU A;  4GCQ A;  3VZU X;  2YPV A;  2KDY A;  3VY8 X;  2R4P A;  3VZW X;  1MM5 A;  1QJP A;  4N58 A;  4G75 A;  1Q9G A;  4GCP A;  6PRN A;  1Q9F A;  3POQ A;  2K0L A;  5T5F A;  2XE3 A;  2ZFG A;  4UB8 O;  4AUI A;  3VE2 A;  3V8U A;  4AYD C;  2GE4 A;  2KZ7 B;  3DA3 A;  2XMX A;  2XE5 A;  3JCU O;  5KAI O;  2Y0L A;  4Z3T A;  1IZN A;  3RBH A;  4UB6 O;  4FQE A;  5ADX L;  2XE2 A;  3HOE A;  4JFB A;  2WJQ A;  5FVN A;  2JMM A;  2XG6 A;  3SYB A;  4AKM A;  1HXT A;  3A0B O;  2PRN A;  2X9K A;  3KVD D;  4AYI D;  2KXP A;  3AAE B;  1THQ A;  5AFU K;  2KC0 A;  4AKR A;  2Y0H A;  1GFM A;  5TIS O;  2X27 X;  4KR4 A;  4RJX A;  3AAA A;  1ZHT A;  5GTH O;  3FYX A;  1ZHY A;  4GF4 A;  1BXW A;  3AA0 A;  1ZHZ A;  3K19 A;  3LK4 1;  1BH3 A;  3POU A;  1T16 A;  4FZM A;  4O4U A;  5B66 O;  3DWO X;  4FZN A;  4N75 A;  3PF1 A;  5JDP A;  3QRC A;  1ORM A;  4FES A;  4PUX A;  4FRX A;  1HXU A;  3SY9 A;  4PJ0 O; 
#chains in the Genus database with same CATH homology
 1ZHW A;  4O4X A;  1PRN A;  3PQU A;  4FUV A;  2K4T A;  4JCH A;  3AA6 A;  2ODJ A;  3LK2 A;  4FSP A;  2XTQ A;  2QTK A;  3TZG A;  4FRT A;  4O3Y A;  4E1T A;  5DL5 A;  3GP6 A;  5DL8 A;  4O49 A;  4D65 A;  4RJW A;  1IZN B;  3T24 A;  3SZV A;  2LHF A;  3HW9 A;  3WI4 A;  4FSO A;  4D5U A;  3LK3 A;  4BUM X;  1GFP A;  4E1S A;  3SY7 A;  4AYM C;  3G7G A;  2FGQ X;  3UAQ A;  3EMN X;  3AA7 A;  8PRN A;  4FT6 A;  7PRN A;  2KXP B;  2Y2X A;  5D5D A;  4AKR B;  4LSF A;  2N2M A;  3JTY A;  2ZLD A;  5AFU L;  2MNH A;  1QJ8 A;  4KRA A;  3AAA B;  3C5O A;  2N2L A;  3AA1 A;  3POR A;  4LSH A;  3VE1 A;  4FMS A;  3AA0 B;  4LSI A;  4QQ1 A;  2F1V A;  2OMF A;  1YS5 A;  4GCS A;  4C69 X;  3SYS A;  2YNK A;  3WI5 A;  3HOL A;  1MPF A;  2J1N A;  4KR8 A;  4B61 A;  4O3Z A;  2M07 A;  4FZL A;  2XTR A;  4GHB A;  5IYU A;  1G90 A;  5DL7 A;  3VZT X;  1E54 A;  4AFK A;  4AYE C;  3AA6 B;  3LK2 B;  3T0S A;  3LK4 2;  1GFQ A;  1GFN A;  3POX A;  3HWB A;  4FOZ A;  4AYN A;  4U9C A;  2KZ7 A;  5ADX K;  3UPG A;  4XNL A;  4F4B A;  5GV0 A;  2Y7S A;  3PRN A;  4O3X B;  3LK3 B;  4D64 A;  3QRA A;  3UU2 A;  2ERV A;  2O4V A;  2J4U P;  3A2S X;  3AA7 B;  1ZHX A;  2W81 C;  2POR A;  3AAE A;  2XE1 A;  4G76 A;  2F1T A;  2M06 A;  3PQS A;  3NSG A;  4N59 A;  1MM4 A;  4O3W A;  1P4T A;  1HXX A;  2W80 C;  1BT9 A;  5EE2 A;  2FGR A;  2MHL A;  3AA1 B;  1QJ9 A;  1OPF A;  4LSE A;  5G26 A;  1H6S 1;  2Y0K A;  3O0E A;  5DL6 A;  4XNK A;  1GFO A;  3VY9 X;  3DA4 A;  3SZD A;  1OSM A;  4AZL A;  4RLC A;  4RL9 A;  4RLB A;  5PRN A;  3T20 A;  1PHO A;  2LFU A;  4GCQ A;  3VZU X;  2YPV A;  2KDY A;  3VY8 X;  3VZW X;  1MM5 A;  1QJP A;  4N58 A;  4G75 A;  1Q9G A;  4GCP A;  6PRN A;  1Q9F A;  3POQ A;  2K0L A;  5T5F A;  2XE3 A;  2ZFG A;  4AUI A;  3VE2 A;  3V8U A;  4AYD C;  2GE4 A;  2KZ7 B;  3DA3 A;  2XMX A;  2XE5 A;  4Z3T A;  2Y0L A;  1IZN A;  3RBH A;  5ADX L;  2XE2 A;  3HOE A;  4JFB A;  5FVN A;  2JMM A;  2XG6 A;  3SYB A;  4AKM A;  1HXT A;  2PRN A;  3KVD D;  4AYI D;  2KXP A;  3AAE B;  1THQ A;  5AFU K;  2KC0 A;  4AKR A;  2Y0H A;  1GFM A;  2X27 X;  4KR4 A;  4RJX A;  3AAA A;  1ZHT A;  3FYX A;  1ZHY A;  4GF4 A;  1BXW A;  3AA0 A;  1ZHZ A;  3K19 A;  3LK4 1;  1BH3 A;  3POU A;  4O4U A;  4FZM A;  4FZN A;  5JDP A;  3QRC A;  1ORM A;  4FES A;  4PUX A;  4FRX A;  1HXU A;  3SY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...