5G26A

Unveiling the mechanism behind the in-meso crystallization of membrane proteins
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
241
structure length
241
Chain Sequence
b'HYGTAEVNLQSGNNFDGSSLDFLLPFYDSEKMLAFGQVGARYIDSRFTANLGAGQRFFLPANMLGYNVFIDQDFSGDNTRLGIGGEYWRDYFKSSVNGYFRMSGWHESYNKKDYDERPANGFDIRFNGYLPSYPALGAKLIYEQYYGDNVALFNSDKLQSNPGAATVGVNYTPIPLVTMGIDYRHGTGNENDLLYSMQFRYQFDKSWSQQIEPQYVNELRTLSGSRYDLVQRNNNIILEYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTIMIN
molecule tags Membrane protein
source organism Escherichia coli
publication title The Nanoscience Behind the Art of in-Meso Crystallization of Membrane Proteins.
pubmed doi rcsb
total genus 69
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2016-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.160 Mainly Beta Beta Barrel Porin Porin 5g26A00
4E1SA 4E1TA 5G26A
chains in the Genus database with same CATH superfamily
5AFUL 3AA0A 3PGSA 3WI5A 4FSOA 2QTKA 2ZLDA 3AA6B 3PGUA 4AUIA 1GFMA 3BS0A 4GCQA 3VY8X 2MHLA 3SYSA 2Y2XA 1H6S1 4BUMX 4B61A 3WU2O 2JMMA 4O49A 4O3XB 8PRNA 4GF4A 3T0SA 3JTYA 3VY9X 5DL6A 2ODJA 3QRAA 2Y0KA 2WJRA 1E54A 2WVPA 3HW9A 2FGRA 1BXWA 4KRAA 4N75A 4IL6O 4AKRA 4AKRB 3DZMA 1QJ8A 1G90A 3DA3A 3DWNA 4FZNA 3VE1A 4QQ1A 4FOZA 4AFKA 4AYEC 3AAAB 3G7GA 3HWBA 2R4OA 1ZHXA 2XE1A 4XNLA 2R89A 4FUVA 3LK3A 4RJXA 2R4NA 2K0LA 1BH3A 1MM4A 5G3AA 5B66O 4KR8A 5GTIO 2Y0LA 3AA6A 3POXA 2YPVA 5G26A 2KC0A 3AAEB 5DL8A 5AFUK 1QJPA 1HXXA 3POQA 4N74A 4K3BA 4LSEA 1THQA 2R4LA 3SZVA 2X9KA 1ZHWA 1GFNA 2PORA 4CTDA 4Z3TA 3SY7A 1IZNB 2O4VA 2KDYA 1ZHTA 2YNKA 2XTRA 3A0BO 4KR4A 2K4TA 2W81C 3AA1A 3DA4A 3K19A 3TZGA 5ADXL 3VE2A 1OPFA 4UB8O 5DL5A 3RBHA 3DWOX 4N59A 3AA7A 4RLBA 4N58A 4O4UA 2LFUA 4JCHA 1HXUA 2R8AA 3KVDD 5G38A 4O3YA 2JQYA 5PRNA 3SY9A 3QRCA 3C5OA 3UAQA 3LK42 3HOLA 2J4UP 4LSFA 1Q9FA 4O4XA 3AAEA 3VZTX 2M07A 3T20A 5KAIO 2IWWA 3PRNA 4AYMC 1T16A 7PRNA 4FQEA 4E1SA 2XTQA 5D5DA 4E1TA 1MM5A 4LSHA 4D5UA 1S5LO 1Q9GA 4RLCA 4FSPA 3KZIO 3AA1B 4RJWA 4D64A 5H2FO 4O3ZA 4C69X 2LHFA 4G76A 1PHOA 4O3WA 5ADXK 2XE2A 2KZ7A 3PGRA 5DL7A 2F1TA 1IZNA 2AXTO 2FGQX 3BRYA 3LK41 3EMNX 1YS5A 3PQSA 2MNHA 4FT6A 5E79O 5G39A 3PF1A 1PRNA 2KXPB 2Y0HA 4C4VB 2IWVA 3PORA 4U9CA 3SYBA 3O0EA 5EE2A 4F4BA 3JCUO 5KAFO 4PUXA 2F1VA 2ERVA 3AA7B 4GHBA 4XNKA 2J1NA 4AYDC 1MPFA 4FRTA 5TISO 3LK2B 3AA0B 4FZMA 1HXTA 3UPGA 2PRNA 3UU2A 5T5FA 2XG6A 2N2LA 3SZDA 5FVNA 2XE5A 1ORMA 2WJQA 3BRZA 3PQUA 4D65A 5B5EO 2Y7SA 1BT9A 4PJ0O 2R88A 4AZLA 2XMXA 5JDPA 3NSGA 3VZUX 3WI4A 3V8UA 2GE4A 5GV0A 2F1CX 4AYID 4K3CA 1OSMA 1P4TA 2R4PA 3POUA 4LSIA 4GCSA 2KXPA 4JFBA 4UB6O 3T24A 4C4VA 6PRNA 1ZHZA 3AAAA 3HOEA 2XE3A 3A2SX 4FRXA 4RL9A 4FESA 2W80C 3GP6A 2KZ7B 2N2MA 3LK3B 5GTHO 2OMFA 3NJTA 3LK2A 4C00A 3FYXA 3A0HO 1QJ9A 1GFQA 4PR7A 5IYUA 4AYNA 4G75A 4FMSA 2M06A 4AKMA 1ZHYA 1GFPA 4FZLA 1GFOA 4GCPA 2ZFGA 2X27X 1T1LA 3VZWX
chains in the Genus database with same CATH topology
5AFUL 3AA0A 3WI5A 4FSOA 2QTKA 2ZLDA 3AA6B 4AUIA 1GFMA 4GCQA 2MHLA 3SYSA 2Y2XA 1H6S1 4BUMX 2JMMA 4O49A 4O3XB 8PRNA 4GF4A 3T0SA 3JTYA 3VY9X 5DL6A 2ODJA 3QRAA 2Y0KA 1E54A 3HW9A 2FGRA 1BXWA 4KRAA 4AKRB 1G90A 1QJ8A 3DA3A 4FZNA 3VE1A 4QQ1A 4FOZA 4AFKA 4AYEC 3AAAB 3G7GA 3HWBA 2XE1A 1ZHXA 4XNLA 4FUVA 4RJXA 3LK3A 2K0LA 1BH3A 1MM4A 4KR8A 2Y0LA 3AA6A 3POXA 2YPVA 5G26A 2KC0A 3AAEB 5DL8A 5AFUK 1QJPA 1HXXA 3POQA 4LSEA 1THQA 4Z3TA 3SZVA 1ZHWA 1GFNA 2PORA 3SY7A 1IZNB 2O4VA 2KDYA 1ZHTA 2YNKA 2XTRA 4KR4A 4AKRA 2K4TA 2W81C 3AA1A 3DA4A 3K19A 3TZGA 5ADXL 3VE2A 1OPFA 5DL5A 3RBHA 4N59A 3AA7A 4RLBA 4N58A 4O4UA 2LFUA 4JCHA 1HXUA 3KVDD 3UAQA 4O3YA 5PRNA 3QRCA 3C5OA 3LK42 3HOLA 2J4UP 4LSFA 1Q9FA 4O4XA 3AAEA 3VZTX 2M07A 3T20A 3PRNA 4AYMC 7PRNA 4E1SA 2XTQA 5D5DA 4E1TA 1MM5A 4LSHA 4D5UA 4RLCA 1Q9GA 4FSPA 3AA1B 4RJWA 4D64A 4O3ZA 4C69X 2LHFA 4G76A 1PHOA 4O3WA 5ADXK 2XE2A 2KZ7A 5DL7A 2F1TA 1IZNA 3VY8X 2FGQX 3LK41 3SY9A 3EMNX 1YS5A 3PQSA 2MNHA 4FT6A 3WI4A 4B61A 1PRNA 2KXPB 2Y0HA 3PORA 4U9CA 3SYBA 3O0EA 5EE2A 4F4BA 4PUXA 2F1VA 2ERVA 3AA7B 4GHBA 4XNKA 2J1NA 4AYDC 1MPFA 4FRTA 3LK2B 3AA0B 4FZMA 1HXTA 3UPGA 2PRNA 3UU2A 5T5FA 2XG6A 2N2LA 3SZDA 5FVNA 2XE5A 1ORMA 3PQUA 4D65A 2Y7SA 4AZLA 2XMXA 5JDPA 3NSGA 3VZUX 3V8UA 2GE4A 5GV0A 4AYID 1OSMA 1P4TA 3POUA 4LSIA 6PRNA 4GCSA 2KXPA 4JFBA 3T24A 1ZHZA 3AAAA 3HOEA 2XE3A 3A2SX 4FRXA 4RL9A 4FESA 2W80C 3GP6A 2KZ7B 2N2MA 3LK3B 2OMFA 3LK2A 3FYXA 1QJ9A 1GFQA 5IYUA 4AYNA 4G75A 4FMSA 2M06A 4AKMA 1ZHYA 1GFPA 4FZLA 1GFOA 4GCPA 2ZFGA 2X27X 1BT9A 3VZWX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E1S A;  4E1T A;  5G26 A; 
#chains in the Genus database with same CATH topology
 5AFU L;  3AA0 A;  3PGS A;  3WI5 A;  4FSO A;  2QTK A;  2ZLD A;  3AA6 B;  3PGU A;  4AUI A;  1GFM A;  3BS0 A;  4GCQ A;  3VY8 X;  2MHL A;  3SYS A;  2Y2X A;  1H6S 1;  4BUM X;  4B61 A;  3WU2 O;  2JMM A;  4O49 A;  4O3X B;  8PRN A;  4GF4 A;  3T0S A;  3JTY A;  3VY9 X;  5DL6 A;  2ODJ A;  3QRA A;  2Y0K A;  2WJR A;  1E54 A;  2WVP A;  3HW9 A;  2FGR A;  1BXW A;  4KRA A;  4N75 A;  4IL6 O;  4AKR A;  4AKR B;  3DZM A;  1QJ8 A;  1G90 A;  3DA3 A;  3DWN A;  4FZN A;  3VE1 A;  4QQ1 A;  4FOZ A;  4AFK A;  4AYE C;  3AAA B;  3G7G A;  3HWB A;  2R4O A;  1ZHX A;  2XE1 A;  4XNL A;  2R89 A;  4FUV A;  3LK3 A;  4RJX A;  2R4N A;  2K0L A;  1BH3 A;  1MM4 A;  5G3A A;  5B66 O;  4KR8 A;  5GTI O;  2Y0L A;  3AA6 A;  3POX A;  2YPV A;  5G26 A;  2KC0 A;  3AAE B;  5DL8 A;  5AFU K;  1QJP A;  1HXX A;  3POQ A;  4N74 A;  4K3B A;  4LSE A;  1THQ A;  2R4L A;  3SZV A;  2X9K A;  1ZHW A;  1GFN A;  2POR A;  4CTD A;  4Z3T A;  3SY7 A;  1IZN B;  2O4V A;  2KDY A;  1ZHT A;  2YNK A;  2XTR A;  3A0B O;  4KR4 A;  2K4T A;  2W81 C;  3AA1 A;  3DA4 A;  3K19 A;  3TZG A;  5ADX L;  3VE2 A;  1OPF A;  4UB8 O;  5DL5 A;  3RBH A;  3DWO X;  4N59 A;  3AA7 A;  4RLB A;  4N58 A;  4O4U A;  2LFU A;  4JCH A;  1HXU A;  2R8A A;  3KVD D;  5G38 A;  4O3Y A;  2JQY A;  5PRN A;  3SY9 A;  3QRC A;  3C5O A;  3UAQ A;  3LK4 2;  3HOL A;  2J4U P;  4LSF A;  1Q9F A;  4O4X A;  3AAE A;  3VZT X;  2M07 A;  3T20 A;  5KAI O;  2IWW A;  3PRN A;  4AYM C;  1T16 A;  7PRN A;  4FQE A;  4E1S A;  2XTQ A;  5D5D A;  4E1T A;  1MM5 A;  4LSH A;  4D5U A;  1S5L O;  1Q9G A;  4RLC A;  4FSP A;  3KZI O;  3AA1 B;  4RJW A;  4D64 A;  5H2F O;  4O3Z A;  4C69 X;  2LHF A;  4G76 A;  1PHO A;  4O3W A;  5ADX K;  2XE2 A;  2KZ7 A;  3PGR A;  5DL7 A;  2F1T A;  1IZN A;  2AXT O;  2FGQ X;  3BRY A;  3LK4 1;  3EMN X;  1YS5 A;  3PQS A;  2MNH A;  4FT6 A;  5E79 O;  5G39 A;  3PF1 A;  1PRN A;  2KXP B;  2Y0H A;  4C4V B;  2IWV A;  3POR A;  4U9C A;  3SYB A;  3O0E A;  5EE2 A;  4F4B A;  3JCU O;  5KAF O;  4PUX A;  2F1V A;  2ERV A;  3AA7 B;  4GHB A;  4XNK A;  2J1N A;  4AYD C;  1MPF A;  4FRT A;  5TIS O;  3LK2 B;  3AA0 B;  4FZM A;  1HXT A;  3UPG A;  2PRN A;  3UU2 A;  5T5F A;  2XG6 A;  2N2L A;  3SZD A;  5FVN A;  2XE5 A;  1ORM A;  2WJQ A;  3BRZ A;  3PQU A;  4D65 A;  5B5E O;  2Y7S A;  1BT9 A;  4PJ0 O;  2R88 A;  4AZL A;  2XMX A;  5JDP A;  3NSG A;  3VZU X;  3WI4 A;  3V8U A;  2GE4 A;  5GV0 A;  2F1C X;  4AYI D;  4K3C A;  1OSM A;  1P4T A;  2R4P A;  3POU A;  4LSI A;  4GCS A;  2KXP A;  4JFB A;  4UB6 O;  3T24 A;  4C4V A;  6PRN A;  1ZHZ A;  3AAA A;  3HOE A;  2XE3 A;  3A2S X;  4FRX A;  4RL9 A;  4FES A;  2W80 C;  3GP6 A;  2KZ7 B;  2N2M A;  3LK3 B;  5GTH O;  2OMF A;  3NJT A;  3LK2 A;  4C00 A;  3FYX A;  3A0H O;  1QJ9 A;  1GFQ A;  4PR7 A;  5IYU A;  4AYN A;  4G75 A;  4FMS A;  2M06 A;  4AKM A;  1ZHY A;  1GFP A;  4FZL A;  1GFO A;  4GCP A;  2ZFG A;  2X27 X;  1T1L A;  3VZW X; 
#chains in the Genus database with same CATH homology
 5AFU L;  3AA0 A;  3WI5 A;  4FSO A;  2QTK A;  2ZLD A;  3AA6 B;  4AUI A;  1GFM A;  4GCQ A;  2MHL A;  3SYS A;  2Y2X A;  1H6S 1;  4BUM X;  2JMM A;  4O49 A;  4O3X B;  8PRN A;  4GF4 A;  3T0S A;  3JTY A;  3VY9 X;  5DL6 A;  2ODJ A;  3QRA A;  2Y0K A;  1E54 A;  3HW9 A;  2FGR A;  1BXW A;  4KRA A;  4AKR B;  1G90 A;  1QJ8 A;  3DA3 A;  4FZN A;  3VE1 A;  4QQ1 A;  4FOZ A;  4AFK A;  4AYE C;  3AAA B;  3G7G A;  3HWB A;  2XE1 A;  1ZHX A;  4XNL A;  4FUV A;  4RJX A;  3LK3 A;  2K0L A;  1BH3 A;  1MM4 A;  4KR8 A;  2Y0L A;  3AA6 A;  3POX A;  2YPV A;  5G26 A;  2KC0 A;  3AAE B;  5DL8 A;  5AFU K;  1QJP A;  1HXX A;  3POQ A;  4LSE A;  1THQ A;  4Z3T A;  3SZV A;  1ZHW A;  1GFN A;  2POR A;  3SY7 A;  1IZN B;  2O4V A;  2KDY A;  1ZHT A;  2YNK A;  2XTR A;  4KR4 A;  4AKR A;  2K4T A;  2W81 C;  3AA1 A;  3DA4 A;  3K19 A;  3TZG A;  5ADX L;  3VE2 A;  1OPF A;  5DL5 A;  3RBH A;  4N59 A;  3AA7 A;  4RLB A;  4N58 A;  4O4U A;  2LFU A;  4JCH A;  1HXU A;  3KVD D;  3UAQ A;  4O3Y A;  5PRN A;  3QRC A;  3C5O A;  3LK4 2;  3HOL A;  2J4U P;  4LSF A;  1Q9F A;  4O4X A;  3AAE A;  3VZT X;  2M07 A;  3T20 A;  3PRN A;  4AYM C;  7PRN A;  4E1S A;  2XTQ A;  5D5D A;  4E1T A;  1MM5 A;  4LSH A;  4D5U A;  4RLC A;  1Q9G A;  4FSP A;  3AA1 B;  4RJW A;  4D64 A;  4O3Z A;  4C69 X;  2LHF A;  4G76 A;  1PHO A;  4O3W A;  5ADX K;  2XE2 A;  2KZ7 A;  5DL7 A;  2F1T A;  1IZN A;  3VY8 X;  2FGQ X;  3LK4 1;  3SY9 A;  3EMN X;  1YS5 A;  3PQS A;  2MNH A;  4FT6 A;  3WI4 A;  4B61 A;  1PRN A;  2KXP B;  2Y0H A;  3POR A;  4U9C A;  3SYB A;  3O0E A;  5EE2 A;  4F4B A;  4PUX A;  2F1V A;  2ERV A;  3AA7 B;  4GHB A;  4XNK A;  2J1N A;  4AYD C;  1MPF A;  4FRT A;  3LK2 B;  3AA0 B;  4FZM A;  1HXT A;  3UPG A;  2PRN A;  3UU2 A;  5T5F A;  2XG6 A;  2N2L A;  3SZD A;  5FVN A;  2XE5 A;  1ORM A;  3PQU A;  4D65 A;  2Y7S A;  4AZL A;  2XMX A;  5JDP A;  3NSG A;  3VZU X;  3V8U A;  2GE4 A;  5GV0 A;  4AYI D;  1OSM A;  1P4T A;  3POU A;  4LSI A;  6PRN A;  4GCS A;  2KXP A;  4JFB A;  3T24 A;  1ZHZ A;  3AAA A;  3HOE A;  2XE3 A;  3A2S X;  4FRX A;  4RL9 A;  4FES A;  2W80 C;  3GP6 A;  2KZ7 B;  2N2M A;  3LK3 B;  2OMF A;  3LK2 A;  3FYX A;  1QJ9 A;  1GFQ A;  5IYU A;  4AYN A;  4G75 A;  4FMS A;  2M06 A;  4AKM A;  1ZHY A;  1GFP A;  4FZL A;  1GFO A;  4GCP A;  2ZFG A;  2X27 X;  1BT9 A;  3VZW X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...