5G26A

Unveiling the mechanism behind the in-meso crystallization of membrane proteins
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
241
structure length
241
Chain Sequence
HYGTAEVNLQSGNNFDGSSLDFLLPFYDSEKMLAFGQVGARYIDSRFTANLGAGQRFFLPANMLGYNVFIDQDFSGDNTRLGIGGEYWRDYFKSSVNGYFRMSGWHESYNKKDYDERPANGFDIRFNGYLPSYPALGAKLIYEQYYGDNVALFNSDKLQSNPGAATVGVNYTPIPLVTMGIDYRHGTGNENDLLYSMQFRYQFDKSWSQQIEPQYVNELRTLSGSRYDLVQRNNNIILEYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Nanoscience Behind the Art of in-Meso Crystallization of Membrane Proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords INTIMIN
total genus 69
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2016-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.160 Mainly Beta Beta Barrel Porin Porin 5g26A00
5G26A 4E1SA 4E1TA
chains in the Genus database with same CATH superfamily
1BXWA 2FGQX 2R8AA 3LK42 4FQEA 2JQYA 3EMNX 5H2FO 4C4VA 2Y0HA 3PGRA 4GCQA 5G39A 3UU2A 2XE3A 4E1SA 2R4PA 3KVDD 4PJ0O 4N75A 4O3XB 3NSGA 2ERVA 3LK2A 3WU2O 5T5FA 2N2MA 3AAAB 3PRNA 3VZTX 2WVPA 2LHFA 2F1TA 3VE2A 2X27X 4IL6O 2XG6A 4C00A 3LK41 1ZHXA 4KRAA 4O4XA 4KR4A 4RJWA 5GTIO 5AFUL 2OMFA 3PQSA 3SZVA 2M07A 2W80C 1PHOA 4FSOA 4BUMX 4Z3TA 1QJ8A 4RLBA 5B5EO 3BRYA 4AKRB 1OSMA 2JMMA 3FYXA 3VY9X 4E1TA 3AA6B 1S5LO 1MM4A 1YS5A 3A0HO 2XTRA 4K3BA 4LSEA 4RL9A 2XE5A 3LK3A 3AAEB 4FZLA 4O3ZA 2XE2A 3BRZA 2KC0A 2PRNA 3POXA 5DL8A 4F4BA 2XTQA 3POUA 4LSIA 7PRNA 2KZ7A 1HXXA 4FOZA 4XNLA 2R4NA 1P4TA 1ORMA 2R89A 3POQA 2F1CX 4K3CA 1G90A 2YNKA 3DWOX 4JCHA 4UB8O 1H6S1 5DL6A 3UAQA 4PR7A 1IZNB 3SY9A 3WI4A 3AA1B 1GFMA 4FMSA 3K19A 5G26A 4RLCA 3LK2B 4AYNA 1PRNA 3V8UA 4GF4A 4O3WA 1ZHWA 3DA4A 5ADXK 2IWVA 2R4OA 5KAIO 3QRAA 4AKMA 3GP6A 4AUIA 1GFQA 2F1VA 1MM5A 2W81C 3JTYA 4UB6O 3AA1A 1T16A 4JFBA 2N2LA 1IZNA 4G76A 3AA0A 3SY7A 3VZUX 1T1LA 4N59A 3PORA 2XMXA 3RBHA 8PRNA 4D65A 1OPFA 2Y0KA 3DZMA 2FGRA 2QTKA 1Q9FA 2K4TA 2KZ7B 3PGSA 4N74A 5PRNA 1GFPA 4GCPA 3VY8X 2M06A 2ZLDA 2Y7SA 3C5OA 4FZNA 2R88A 4GHBA 3AAEA 5G3AA 5TISO 5FVNA 3LK3B 2O4VA 2R4LA 3HOEA 2WJRA 1ZHZA 4FSPA 2GE4A 4AYMC 5D5DA 3AA6A 4AYEC 1ZHYA 5G38A 3NJTA 1HXUA 2WJQA 3A2SX 4AKRA 3PQUA 5B66O 2J4UP 1GFNA 2ZFGA 4PUXA 4C69X 5GV0A 5IYUA 5E79O 4LSHA 2KDYA 2XE1A 4FRTA 4KR8A 5DL7A 3SYBA 5JDPA 3DA3A 3HWBA 3KZIO 1BH3A 4FT6A 4AYID 2AXTO 4GCSA 1ZHTA 4AYDC 1MPFA 4G75A 2MNHA 2X9KA 3JCUO 3TZGA 2LFUA 4LSFA 3AAAA 3HW9A 2PORA 4U9CA 3A0BO 2Y2XA 3T20A 1QJPA 3PGUA 3VZWX 1E54A 5KAFO 2YPVA 4RJXA 4C4VB 3VE1A 5ADXL 4O3YA 4FZMA 5GTHO 4D5UA 1GFOA 2Y0LA 1THQA 3T24A 4D64A 3DWNA 3AA7B 4XNKA 3PF1A 1HXTA 3UPGA 3SZDA 3T0SA 2KXPA 2J1NA 5AFUK 6PRNA 3BS0A 1BT9A 4FRXA 4QQ1A 2IWWA 4FUVA 4N58A 2KXPB 4O49A 2K0LA 5DL5A 3G7GA 1Q9GA 3HOLA 3O0EA 1QJ9A 5EE2A 3WI5A 2ODJA 4O4UA 4AZLA 3QRCA 4B61A 3AA7A 4AFKA 3AA0B 4FESA 2MHLA 3SYSA 4CTDA
chains in the Genus database with same CATH topology
1BXWA 2FGQX 3LK42 3EMNX 2Y0HA 4GCQA 3UU2A 2XE3A 4E1SA 3KVDD 4O3XB 3NSGA 2ERVA 3LK2A 5T5FA 2N2MA 3AAAB 3PRNA 3VZTX 2LHFA 2F1TA 3VE2A 2X27X 2XG6A 3LK41 1ZHXA 4KRAA 4O4XA 4KR4A 4RJWA 5AFUL 2OMFA 3PQSA 3SZVA 2M07A 2W80C 1PHOA 4FSOA 4BUMX 4Z3TA 1QJ8A 4RLBA 4AKRB 1OSMA 2JMMA 3FYXA 3VY9X 4E1TA 3AA6B 1MM4A 1YS5A 2XTRA 4LSEA 4RL9A 2XE5A 3LK3A 3AAEB 4FZLA 4O3ZA 2XE2A 5DL8A 2KC0A 2PRNA 3POXA 4F4BA 2XTQA 3POUA 4LSIA 7PRNA 2KZ7A 1HXXA 4FOZA 4XNLA 1P4TA 1ORMA 3POQA 1G90A 2YNKA 4JCHA 1H6S1 5DL6A 3UAQA 3SY9A 1IZNB 3WI4A 3AA1B 1GFMA 4FMSA 3K19A 5G26A 4RLCA 3LK2B 4AYNA 1PRNA 3V8UA 4GF4A 4O3WA 1ZHWA 3DA4A 5ADXK 4AKMA 3QRAA 3GP6A 4AUIA 1GFQA 2F1VA 1MM5A 2W81C 3JTYA 3AA1A 4JFBA 2N2LA 1IZNA 4G76A 3AA0A 3SY7A 3VZUX 4N59A 3PORA 2XMXA 8PRNA 4D65A 1OPFA 2Y0KA 2FGRA 2QTKA 1Q9FA 2K4TA 2KZ7B 5PRNA 1GFPA 4GCPA 3VY8X 2M06A 2ZLDA 2Y7SA 3C5OA 4FZNA 4GHBA 3RBHA 3AAEA 5FVNA 3LK3B 2O4VA 3HOEA 1ZHZA 4FSPA 2GE4A 4AYMC 5D5DA 3AA6A 4AYEC 1ZHYA 1HXUA 3A2SX 4AKRA 3PQUA 2J4UP 1GFNA 2ZFGA 4PUXA 4C69X 5GV0A 5IYUA 4LSHA 2KDYA 2XE1A 4FRTA 4KR8A 5DL7A 3SYBA 5JDPA 3DA3A 3HWBA 4FT6A 1BH3A 4AYID 4GCSA 1ZHTA 4AYDC 1MPFA 4G75A 2MNHA 3TZGA 2LFUA 4LSFA 3AAAA 3HW9A 2PORA 4U9CA 2Y2XA 3T20A 1QJPA 3VZWX 1E54A 2YPVA 4RJXA 5ADXL 3VE1A 4O3YA 4FZMA 4D5UA 1GFOA 2Y0LA 1THQA 3T24A 4D64A 4XNKA 3AA7B 1HXTA 3UPGA 3SZDA 3T0SA 2KXPA 2J1NA 5AFUK 6PRNA 4FRXA 1BT9A 4QQ1A 4FUVA 4N58A 2KXPB 4O49A 2K0LA 5DL5A 3G7GA 1Q9GA 3HOLA 3O0EA 1QJ9A 5EE2A 3WI5A 2ODJA 4O4UA 4AZLA 3QRCA 4B61A 3AA7A 4AFKA 3AA0B 4FESA 2MHLA 3SYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G26 A;  4E1S A;  4E1T A; 
#chains in the Genus database with same CATH topology
 1BXW A;  2FGQ X;  2R8A A;  3LK4 2;  4FQE A;  2JQY A;  3EMN X;  5H2F O;  4C4V A;  2Y0H A;  3PGR A;  4GCQ A;  5G39 A;  3UU2 A;  2XE3 A;  4E1S A;  2R4P A;  3KVD D;  4PJ0 O;  4N75 A;  4O3X B;  3NSG A;  2ERV A;  3LK2 A;  3WU2 O;  5T5F A;  2N2M A;  3AAA B;  3PRN A;  3VZT X;  2WVP A;  2LHF A;  2F1T A;  3VE2 A;  2X27 X;  4IL6 O;  2XG6 A;  4C00 A;  3LK4 1;  1ZHX A;  4KRA A;  4O4X A;  4KR4 A;  4RJW A;  5GTI O;  5AFU L;  2OMF A;  3PQS A;  3SZV A;  2M07 A;  2W80 C;  1PHO A;  4FSO A;  4BUM X;  4Z3T A;  1QJ8 A;  4RLB A;  5B5E O;  3BRY A;  4AKR B;  1OSM A;  2JMM A;  3FYX A;  3VY9 X;  4E1T A;  3AA6 B;  1S5L O;  1MM4 A;  1YS5 A;  3A0H O;  2XTR A;  4K3B A;  4LSE A;  4RL9 A;  2XE5 A;  3LK3 A;  3AAE B;  4FZL A;  4O3Z A;  2XE2 A;  3BRZ A;  2KC0 A;  2PRN A;  3POX A;  5DL8 A;  4F4B A;  2XTQ A;  3POU A;  4LSI A;  7PRN A;  2KZ7 A;  1HXX A;  4FOZ A;  4XNL A;  2R4N A;  1P4T A;  1ORM A;  2R89 A;  3POQ A;  2F1C X;  4K3C A;  1G90 A;  2YNK A;  3DWO X;  4JCH A;  4UB8 O;  1H6S 1;  5DL6 A;  3UAQ A;  4PR7 A;  1IZN B;  3SY9 A;  3WI4 A;  3AA1 B;  1GFM A;  4FMS A;  3K19 A;  5G26 A;  4RLC A;  3LK2 B;  4AYN A;  1PRN A;  3V8U A;  4GF4 A;  4O3W A;  1ZHW A;  3DA4 A;  5ADX K;  2IWV A;  2R4O A;  5KAI O;  3QRA A;  4AKM A;  3GP6 A;  4AUI A;  1GFQ A;  2F1V A;  1MM5 A;  2W81 C;  3JTY A;  4UB6 O;  3AA1 A;  1T16 A;  4JFB A;  2N2L A;  1IZN A;  4G76 A;  3AA0 A;  3SY7 A;  3VZU X;  1T1L A;  4N59 A;  3POR A;  2XMX A;  3RBH A;  8PRN A;  4D65 A;  1OPF A;  2Y0K A;  3DZM A;  2FGR A;  2QTK A;  1Q9F A;  2K4T A;  2KZ7 B;  3PGS A;  4N74 A;  5PRN A;  1GFP A;  4GCP A;  3VY8 X;  2M06 A;  2ZLD A;  2Y7S A;  3C5O A;  4FZN A;  2R88 A;  4GHB A;  3AAE A;  5G3A A;  5TIS O;  5FVN A;  3LK3 B;  2O4V A;  2R4L A;  3HOE A;  2WJR A;  1ZHZ A;  4FSP A;  2GE4 A;  4AYM C;  5D5D A;  3AA6 A;  4AYE C;  1ZHY A;  5G38 A;  3NJT A;  1HXU A;  2WJQ A;  3A2S X;  4AKR A;  3PQU A;  5B66 O;  2J4U P;  1GFN A;  2ZFG A;  4PUX A;  4C69 X;  5GV0 A;  5IYU A;  5E79 O;  4LSH A;  2KDY A;  2XE1 A;  4FRT A;  4KR8 A;  5DL7 A;  3SYB A;  5JDP A;  3DA3 A;  3HWB A;  3KZI O;  1BH3 A;  4FT6 A;  4AYI D;  2AXT O;  4GCS A;  1ZHT A;  4AYD C;  1MPF A;  4G75 A;  2MNH A;  2X9K A;  3JCU O;  3TZG A;  2LFU A;  4LSF A;  3AAA A;  3HW9 A;  2POR A;  4U9C A;  3A0B O;  2Y2X A;  3T20 A;  1QJP A;  3PGU A;  3VZW X;  1E54 A;  5KAF O;  2YPV A;  4RJX A;  4C4V B;  3VE1 A;  5ADX L;  4O3Y A;  4FZM A;  5GTH O;  4D5U A;  1GFO A;  2Y0L A;  1THQ A;  3T24 A;  4D64 A;  3DWN A;  3AA7 B;  4XNK A;  3PF1 A;  1HXT A;  3UPG A;  3SZD A;  3T0S A;  2KXP A;  2J1N A;  5AFU K;  6PRN A;  3BS0 A;  1BT9 A;  4FRX A;  4QQ1 A;  2IWW A;  4FUV A;  4N58 A;  2KXP B;  4O49 A;  2K0L A;  5DL5 A;  3G7G A;  1Q9G A;  3HOL A;  3O0E A;  1QJ9 A;  5EE2 A;  3WI5 A;  2ODJ A;  4O4U A;  4AZL A;  3QRC A;  4B61 A;  3AA7 A;  4AFK A;  3AA0 B;  4FES A;  2MHL A;  3SYS A;  4CTD A; 
#chains in the Genus database with same CATH homology
 1BXW A;  2FGQ X;  3LK4 2;  3EMN X;  2Y0H A;  4GCQ A;  3UU2 A;  2XE3 A;  4E1S A;  3KVD D;  4O3X B;  3NSG A;  2ERV A;  3LK2 A;  5T5F A;  2N2M A;  3AAA B;  3PRN A;  3VZT X;  2LHF A;  2F1T A;  3VE2 A;  2X27 X;  2XG6 A;  3LK4 1;  1ZHX A;  4KRA A;  4O4X A;  4KR4 A;  4RJW A;  5AFU L;  2OMF A;  3PQS A;  3SZV A;  2M07 A;  2W80 C;  1PHO A;  4FSO A;  4BUM X;  4Z3T A;  1QJ8 A;  4RLB A;  4AKR B;  1OSM A;  2JMM A;  3FYX A;  3VY9 X;  4E1T A;  3AA6 B;  1MM4 A;  1YS5 A;  2XTR A;  4LSE A;  4RL9 A;  2XE5 A;  3LK3 A;  3AAE B;  4FZL A;  4O3Z A;  2XE2 A;  5DL8 A;  2KC0 A;  2PRN A;  3POX A;  4F4B A;  2XTQ A;  3POU A;  4LSI A;  7PRN A;  2KZ7 A;  1HXX A;  4FOZ A;  4XNL A;  1P4T A;  1ORM A;  3POQ A;  1G90 A;  2YNK A;  4JCH A;  1H6S 1;  5DL6 A;  3UAQ A;  3SY9 A;  1IZN B;  3WI4 A;  3AA1 B;  1GFM A;  4FMS A;  3K19 A;  5G26 A;  4RLC A;  3LK2 B;  4AYN A;  1PRN A;  3V8U A;  4GF4 A;  4O3W A;  1ZHW A;  3DA4 A;  5ADX K;  4AKM A;  3QRA A;  3GP6 A;  4AUI A;  1GFQ A;  2F1V A;  1MM5 A;  2W81 C;  3JTY A;  3AA1 A;  4JFB A;  2N2L A;  1IZN A;  4G76 A;  3AA0 A;  3SY7 A;  3VZU X;  4N59 A;  3POR A;  2XMX A;  8PRN A;  4D65 A;  1OPF A;  2Y0K A;  2FGR A;  2QTK A;  1Q9F A;  2K4T A;  2KZ7 B;  5PRN A;  1GFP A;  4GCP A;  3VY8 X;  2M06 A;  2ZLD A;  2Y7S A;  3C5O A;  4FZN A;  4GHB A;  3RBH A;  3AAE A;  5FVN A;  3LK3 B;  2O4V A;  3HOE A;  1ZHZ A;  4FSP A;  2GE4 A;  4AYM C;  5D5D A;  3AA6 A;  4AYE C;  1ZHY A;  1HXU A;  3A2S X;  4AKR A;  3PQU A;  2J4U P;  1GFN A;  2ZFG A;  4PUX A;  4C69 X;  5GV0 A;  5IYU A;  4LSH A;  2KDY A;  2XE1 A;  4FRT A;  4KR8 A;  5DL7 A;  3SYB A;  5JDP A;  3DA3 A;  3HWB A;  4FT6 A;  1BH3 A;  4AYI D;  4GCS A;  1ZHT A;  4AYD C;  1MPF A;  4G75 A;  2MNH A;  3TZG A;  2LFU A;  4LSF A;  3AAA A;  3HW9 A;  2POR A;  4U9C A;  2Y2X A;  3T20 A;  1QJP A;  3VZW X;  1E54 A;  2YPV A;  4RJX A;  5ADX L;  3VE1 A;  4O3Y A;  4FZM A;  4D5U A;  1GFO A;  2Y0L A;  1THQ A;  3T24 A;  4D64 A;  4XNK A;  3AA7 B;  1HXT A;  3UPG A;  3SZD A;  3T0S A;  2KXP A;  2J1N A;  5AFU K;  6PRN A;  4FRX A;  1BT9 A;  4QQ1 A;  4FUV A;  4N58 A;  2KXP B;  4O49 A;  2K0L A;  5DL5 A;  3G7G A;  1Q9G A;  3HOL A;  3O0E A;  1QJ9 A;  5EE2 A;  3WI5 A;  2ODJ A;  4O4U A;  4AZL A;  3QRC A;  4B61 A;  3AA7 A;  4AFK A;  3AA0 B;  4FES A;  2MHL A;  3SYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...