5G26A

Unveiling the mechanism behind the in-meso crystallization of membrane proteins
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
241
structure length
241
Chain Sequence
HYGTAEVNLQSGNNFDGSSLDFLLPFYDSEKMLAFGQVGARYIDSRFTANLGAGQRFFLPANMLGYNVFIDQDFSGDNTRLGIGGEYWRDYFKSSVNGYFRMSGWHESYNKKDYDERPANGFDIRFNGYLPSYPALGAKLIYEQYYGDNVALFNSDKLQSNPGAATVGVNYTPIPLVTMGIDYRHGTGNENDLLYSMQFRYQFDKSWSQQIEPQYVNELRTLSGSRYDLVQRNNNIILEYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Nanoscience Behind the Art of in-Meso Crystallization of Membrane Proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords INTIMIN
total genus 69
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2016-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.160 Mainly Beta Beta Barrel Porin Porin 5g26A00
4E1SA 4E1TA 5G26A
chains in the Genus database with same CATH superfamily
2R4LA 2WJRA 3TZGA 2PORA 3LK3B 2X27X 4PR7A 5G38A 4IL6O 3JCUO 5DL8A 2XTRA 3DZMA 5G26A 5FVNA 1T16A 2XG6A 2FGQX 3VZWX 2XE3A 3QRCA 4AZLA 2IWVA 5AFUK 1BT9A 4O3XB 4AYMC 4KRAA 3NJTA 3PF1A 1HXXA 3AA1B 4GCSA 2LHFA 4GF4A 3VY8X 3AA7A 2GE4A 4O4XA 3UPGA 2YNKA 4BUMX 1GFOA 4KR4A 1MPFA 2KZ7B 1MM5A 5ADXL 4FZLA 1ZHYA 4FESA 4AYEC 3LK3A 3LK41 2X9KA 1Q9FA 2Y2XA 2ZLDA 3EMNX 2K4TA 4G76A 3DWOX 3SYBA 4C00A 4D64A 4O49A 2JQYA 2ERVA 1PHOA 3KVDD 5ADXK 3PGRA 3RBHA 5EE2A 4JFBA 2W80C 3BRZA 2Y0HA 1OSMA 4O4UA 4AKRB 3BS0A 3C5OA 4LSFA 3A0BO 5G39A 4FT6A 2ODJA 3POXA 2XE5A 7PRNA 3K19A 4Z3TA 1ORMA 4D5UA 2Y0LA 3QRAA 2QTKA 5G3AA 2R8AA 5JDPA 4RJXA 2XMXA 4GCQA 5D5DA 1PRNA 2KZ7A 3VY9X 3WI5A 4F4BA 3DA4A 3BRYA 2M07A 2XE1A 4KR8A 1OPFA 2KXPB 1QJ8A 4FUVA 4LSEA 4RLCA 4RL9A 3V8UA 3A0HO 2WJQA 4LSIA 4FMSA 2J1NA 4N74A 2M06A 1GFMA 3HWBA 1THQA 3LK2B 5IYUA 3HOLA 5KAFO 2R88A 4RLBA 4C4VB 3SY9A 4CTDA 4O3ZA 3AAEB 5E79O 4AKRA 4AYDC 1GFQA 3POQA 2XE2A 4FQEA 3UAQA 3G7GA 8PRNA 1Q9GA 3WI4A 1E54A 3AA6B 4C69X 2OMFA 1MM4A 2PRNA 5B66O 3LK42 2AXTO 3VZUX 2JMMA 5GTIO 4AFKA 2F1VA 3AA0B 4UB6O 1ZHWA 4U9CA 4RJWA 2KXPA 1H6S1 4AUIA 3DWNA 1S5LO 2F1CX 2K0LA 3O0EA 2ZFGA 1IZNA 1ZHZA 4N75A 4K3BA 3VE1A 3LK2A 2R4NA 5DL6A 5GV0A 3AAAA 2R4PA 3GP6A 4AKMA 1P4TA 4C4VA 3AAEA 2R4OA 4N59A 2KC0A 4O3YA 5DL7A 2MHLA 3POUA 3SY7A 4AYNA 1ZHTA 5KAIO 4FZMA 3AA6A 4GCPA 4QQ1A 3WU2O 3HOEA 4UB8O 1QJ9A 2F1TA 5B5EO 3PGUA 5DL5A 3JTYA 3PQSA 1QJPA 2N2LA 3PGSA 4PJ0O 4G75A 4PUXA 2J4UP 1BH3A 4FSOA 3T20A 3SZVA 2IWWA 3AA0A 3T0SA 3VE2A 3T24A 1HXUA 4GHBA 2KDYA 1GFNA 2Y0KA 4FRTA 3UU2A 4XNKA 4E1SA 4JCHA 1GFPA 3HW9A 2WVPA 3FYXA 1IZNB 2MNHA 4B61A 4FRXA 1YS5A 3SZDA 4LSHA 1T1LA 2N2MA 3VZTX 3AAAB 3NSGA 5H2FO 2W81C 4FZNA 3KZIO 5T5FA 3PRNA 2O4VA 2LFUA 1G90A 5TISO 4XNLA 2YPVA 4FOZA 3A2SX 4N58A 3DA3A 1ZHXA 2FGRA 3PQUA 2XTQA 3AA1A 5GTHO 4K3CA 4AYID 1HXTA 3AA7B 4E1TA 5AFUL 3PORA 4O3WA 2R89A 1BXWA 6PRNA 4FSPA 3SYSA 5PRNA 4D65A 2Y7SA
chains in the Genus database with same CATH topology
3TZGA 2PORA 3LK3B 2X27X 5DL8A 2XTRA 5G26A 5FVNA 2XG6A 2FGQX 3VZWX 2XE3A 3QRCA 4AZLA 5AFUK 1BT9A 4O3XB 4AYMC 4KRAA 1HXXA 3AA1B 4GCSA 2LHFA 4GF4A 3VY8X 3AA7A 2GE4A 4O4XA 3UPGA 2YNKA 4BUMX 1GFOA 4KR4A 1MPFA 2KZ7B 1MM5A 5ADXL 4FZLA 1ZHYA 4FESA 4AYEC 3LK3A 3LK41 2ZLDA 1Q9FA 2Y2XA 4G76A 3EMNX 2K4TA 3SYBA 4D64A 2ERVA 1PHOA 3KVDD 5ADXK 3RBHA 5EE2A 4JFBA 2W80C 2Y0HA 1OSMA 4O4UA 4AKRB 3C5OA 4LSFA 4FT6A 2ODJA 3POXA 2XE5A 7PRNA 3K19A 4Z3TA 1ORMA 4D5UA 2Y0LA 3QRAA 2QTKA 5JDPA 4RJXA 2XMXA 4GCQA 5D5DA 1PRNA 2KZ7A 3VY9X 3WI5A 4F4BA 3DA4A 2M07A 2XE1A 4KR8A 1OPFA 2KXPB 1QJ8A 4FUVA 4LSEA 4RLCA 4RL9A 3V8UA 4LSIA 4O49A 4FMSA 2J1NA 2M06A 1GFMA 3HWBA 1THQA 3LK2B 5IYUA 3HOLA 4RLBA 3SY9A 4O3ZA 3AAEB 4AKRA 4AYDC 1GFQA 3POQA 2XE2A 3UAQA 3G7GA 8PRNA 1Q9GA 3WI4A 1E54A 3AA6B 4C69X 2OMFA 1MM4A 2PRNA 3LK42 3VZUX 2JMMA 4AFKA 2F1VA 3AA0B 1ZHWA 4U9CA 4RJWA 2KXPA 1H6S1 4AUIA 2K0LA 3O0EA 2ZFGA 1IZNA 1ZHZA 3VE1A 3LK2A 5DL6A 5GV0A 3AAAA 3GP6A 4AKMA 1P4TA 3AAEA 4N59A 2KC0A 4O3YA 5DL7A 2MHLA 3POUA 3SY7A 4AYNA 1ZHTA 4FZMA 3AA6A 4GCPA 4QQ1A 3HOEA 1QJ9A 2F1TA 5DL5A 3JTYA 3PQSA 1QJPA 2N2LA 4PUXA 2J4UP 4G75A 3T20A 1BH3A 4FSOA 3SZVA 3AA0A 3T0SA 3VE2A 3T24A 1HXUA 4GHBA 2KDYA 1GFNA 2Y0KA 4FRTA 3UU2A 4XNKA 4E1SA 4JCHA 1GFPA 3HW9A 3FYXA 1IZNB 2MNHA 4B61A 4FRXA 1YS5A 3SZDA 4LSHA 3VZTX 2N2MA 3AAAB 3NSGA 2W81C 4FZNA 5T5FA 3PRNA 2O4VA 2LFUA 1G90A 4XNLA 2YPVA 4FOZA 3A2SX 4N58A 3DA3A 1ZHXA 2FGRA 3PQUA 2XTQA 3AA1A 4AYID 1HXTA 3AA7B 4E1TA 5AFUL 3PORA 4O3WA 1BXWA 6PRNA 4FSPA 3SYSA 5PRNA 4D65A 2Y7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E1S A;  4E1T A;  5G26 A; 
#chains in the Genus database with same CATH topology
 2R4L A;  2WJR A;  3TZG A;  2POR A;  3LK3 B;  2X27 X;  4PR7 A;  5G38 A;  4IL6 O;  3JCU O;  5DL8 A;  2XTR A;  3DZM A;  5G26 A;  5FVN A;  1T16 A;  2XG6 A;  2FGQ X;  3VZW X;  2XE3 A;  3QRC A;  4AZL A;  2IWV A;  5AFU K;  1BT9 A;  4O3X B;  4AYM C;  4KRA A;  3NJT A;  3PF1 A;  1HXX A;  3AA1 B;  4GCS A;  2LHF A;  4GF4 A;  3VY8 X;  3AA7 A;  2GE4 A;  4O4X A;  3UPG A;  2YNK A;  4BUM X;  1GFO A;  4KR4 A;  1MPF A;  2KZ7 B;  1MM5 A;  5ADX L;  4FZL A;  1ZHY A;  4FES A;  4AYE C;  3LK3 A;  3LK4 1;  2X9K A;  1Q9F A;  2Y2X A;  2ZLD A;  3EMN X;  2K4T A;  4G76 A;  3DWO X;  3SYB A;  4C00 A;  4D64 A;  4O49 A;  2JQY A;  2ERV A;  1PHO A;  3KVD D;  5ADX K;  3PGR A;  3RBH A;  5EE2 A;  4JFB A;  2W80 C;  3BRZ A;  2Y0H A;  1OSM A;  4O4U A;  4AKR B;  3BS0 A;  3C5O A;  4LSF A;  3A0B O;  5G39 A;  4FT6 A;  2ODJ A;  3POX A;  2XE5 A;  7PRN A;  3K19 A;  4Z3T A;  1ORM A;  4D5U A;  2Y0L A;  3QRA A;  2QTK A;  5G3A A;  2R8A A;  5JDP A;  4RJX A;  2XMX A;  4GCQ A;  5D5D A;  1PRN A;  2KZ7 A;  3VY9 X;  3WI5 A;  4F4B A;  3DA4 A;  3BRY A;  2M07 A;  2XE1 A;  4KR8 A;  1OPF A;  2KXP B;  1QJ8 A;  4FUV A;  4LSE A;  4RLC A;  4RL9 A;  3V8U A;  3A0H O;  2WJQ A;  4LSI A;  4FMS A;  2J1N A;  4N74 A;  2M06 A;  1GFM A;  3HWB A;  1THQ A;  3LK2 B;  5IYU A;  3HOL A;  5KAF O;  2R88 A;  4RLB A;  4C4V B;  3SY9 A;  4CTD A;  4O3Z A;  3AAE B;  5E79 O;  4AKR A;  4AYD C;  1GFQ A;  3POQ A;  2XE2 A;  4FQE A;  3UAQ A;  3G7G A;  8PRN A;  1Q9G A;  3WI4 A;  1E54 A;  3AA6 B;  4C69 X;  2OMF A;  1MM4 A;  2PRN A;  5B66 O;  3LK4 2;  2AXT O;  3VZU X;  2JMM A;  5GTI O;  4AFK A;  2F1V A;  3AA0 B;  4UB6 O;  1ZHW A;  4U9C A;  4RJW A;  2KXP A;  1H6S 1;  4AUI A;  3DWN A;  1S5L O;  2F1C X;  2K0L A;  3O0E A;  2ZFG A;  1IZN A;  1ZHZ A;  4N75 A;  4K3B A;  3VE1 A;  3LK2 A;  2R4N A;  5DL6 A;  5GV0 A;  3AAA A;  2R4P A;  3GP6 A;  4AKM A;  1P4T A;  4C4V A;  3AAE A;  2R4O A;  4N59 A;  2KC0 A;  4O3Y A;  5DL7 A;  2MHL A;  3POU A;  3SY7 A;  4AYN A;  1ZHT A;  5KAI O;  4FZM A;  3AA6 A;  4GCP A;  4QQ1 A;  3WU2 O;  3HOE A;  4UB8 O;  1QJ9 A;  2F1T A;  5B5E O;  3PGU A;  5DL5 A;  3JTY A;  3PQS A;  1QJP A;  2N2L A;  3PGS A;  4PJ0 O;  4G75 A;  4PUX A;  2J4U P;  1BH3 A;  4FSO A;  3T20 A;  3SZV A;  2IWW A;  3AA0 A;  3T0S A;  3VE2 A;  3T24 A;  1HXU A;  4GHB A;  2KDY A;  1GFN A;  2Y0K A;  4FRT A;  3UU2 A;  4XNK A;  4E1S A;  4JCH A;  1GFP A;  3HW9 A;  2WVP A;  3FYX A;  1IZN B;  2MNH A;  4B61 A;  4FRX A;  1YS5 A;  3SZD A;  4LSH A;  1T1L A;  2N2M A;  3VZT X;  3AAA B;  3NSG A;  5H2F O;  2W81 C;  4FZN A;  3KZI O;  5T5F A;  3PRN A;  2O4V A;  2LFU A;  1G90 A;  5TIS O;  4XNL A;  2YPV A;  4FOZ A;  3A2S X;  4N58 A;  3DA3 A;  1ZHX A;  2FGR A;  3PQU A;  2XTQ A;  3AA1 A;  5GTH O;  4K3C A;  4AYI D;  1HXT A;  3AA7 B;  4E1T A;  5AFU L;  3POR A;  4O3W A;  2R89 A;  1BXW A;  6PRN A;  4FSP A;  3SYS A;  5PRN A;  4D65 A;  2Y7S A; 
#chains in the Genus database with same CATH homology
 3TZG A;  2POR A;  3LK3 B;  2X27 X;  5DL8 A;  2XTR A;  5G26 A;  5FVN A;  2XG6 A;  2FGQ X;  3VZW X;  2XE3 A;  3QRC A;  4AZL A;  5AFU K;  1BT9 A;  4O3X B;  4AYM C;  4KRA A;  1HXX A;  3AA1 B;  4GCS A;  2LHF A;  4GF4 A;  3VY8 X;  3AA7 A;  2GE4 A;  4O4X A;  3UPG A;  2YNK A;  4BUM X;  1GFO A;  4KR4 A;  1MPF A;  2KZ7 B;  1MM5 A;  5ADX L;  4FZL A;  1ZHY A;  4FES A;  4AYE C;  3LK3 A;  3LK4 1;  2ZLD A;  1Q9F A;  2Y2X A;  4G76 A;  3EMN X;  2K4T A;  3SYB A;  4D64 A;  2ERV A;  1PHO A;  3KVD D;  5ADX K;  3RBH A;  5EE2 A;  4JFB A;  2W80 C;  2Y0H A;  1OSM A;  4O4U A;  4AKR B;  3C5O A;  4LSF A;  4FT6 A;  2ODJ A;  3POX A;  2XE5 A;  7PRN A;  3K19 A;  4Z3T A;  1ORM A;  4D5U A;  2Y0L A;  3QRA A;  2QTK A;  5JDP A;  4RJX A;  2XMX A;  4GCQ A;  5D5D A;  1PRN A;  2KZ7 A;  3VY9 X;  3WI5 A;  4F4B A;  3DA4 A;  2M07 A;  2XE1 A;  4KR8 A;  1OPF A;  2KXP B;  1QJ8 A;  4FUV A;  4LSE A;  4RLC A;  4RL9 A;  3V8U A;  4LSI A;  4O49 A;  4FMS A;  2J1N A;  2M06 A;  1GFM A;  3HWB A;  1THQ A;  3LK2 B;  5IYU A;  3HOL A;  4RLB A;  3SY9 A;  4O3Z A;  3AAE B;  4AKR A;  4AYD C;  1GFQ A;  3POQ A;  2XE2 A;  3UAQ A;  3G7G A;  8PRN A;  1Q9G A;  3WI4 A;  1E54 A;  3AA6 B;  4C69 X;  2OMF A;  1MM4 A;  2PRN A;  3LK4 2;  3VZU X;  2JMM A;  4AFK A;  2F1V A;  3AA0 B;  1ZHW A;  4U9C A;  4RJW A;  2KXP A;  1H6S 1;  4AUI A;  2K0L A;  3O0E A;  2ZFG A;  1IZN A;  1ZHZ A;  3VE1 A;  3LK2 A;  5DL6 A;  5GV0 A;  3AAA A;  3GP6 A;  4AKM A;  1P4T A;  3AAE A;  4N59 A;  2KC0 A;  4O3Y A;  5DL7 A;  2MHL A;  3POU A;  3SY7 A;  4AYN A;  1ZHT A;  4FZM A;  3AA6 A;  4GCP A;  4QQ1 A;  3HOE A;  1QJ9 A;  2F1T A;  5DL5 A;  3JTY A;  3PQS A;  1QJP A;  2N2L A;  4PUX A;  2J4U P;  4G75 A;  3T20 A;  1BH3 A;  4FSO A;  3SZV A;  3AA0 A;  3T0S A;  3VE2 A;  3T24 A;  1HXU A;  4GHB A;  2KDY A;  1GFN A;  2Y0K A;  4FRT A;  3UU2 A;  4XNK A;  4E1S A;  4JCH A;  1GFP A;  3HW9 A;  3FYX A;  1IZN B;  2MNH A;  4B61 A;  4FRX A;  1YS5 A;  3SZD A;  4LSH A;  3VZT X;  2N2M A;  3AAA B;  3NSG A;  2W81 C;  4FZN A;  5T5F A;  3PRN A;  2O4V A;  2LFU A;  1G90 A;  4XNL A;  2YPV A;  4FOZ A;  3A2S X;  4N58 A;  3DA3 A;  1ZHX A;  2FGR A;  3PQU A;  2XTQ A;  3AA1 A;  4AYI D;  1HXT A;  3AA7 B;  4E1T A;  5AFU L;  3POR A;  4O3W A;  1BXW A;  6PRN A;  4FSP A;  3SYS A;  5PRN A;  4D65 A;  2Y7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...