2PRNA

Rhodopseudomonas blastica porin, triple mutant e1m, e99w, a116w
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
289
structure length
289
Chain Sequence
MISLNGYGRFGLQYVEDRGVGLEDTIISSRLRINIVGTTETDQGVTFGAKLRMQWDDGDAFAGTAGNAAQFWTSYNGVTVSVGNVDTAFDSVALTYDSWMGYEASSFGDAQSSFFWYNSKYDASGALDNYNGIAVTYSISGVNLYLSYVDPDQTVDSSLVTEEFGIAADWSNDMISLAAAYTTDAGGIVDNDIAFVGAAYKFNDAGTVGLNWYDNGLSTAGDQVTLYGNYAFGATTVRAYVSDIDRAGADTAYGIGADYQFAEGVKVSGSVQSGFANETVADVGVRFDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Integral membrane protein
molecule keywords PORIN
publication title Porin mutants with new channel properties.
pubmed rcsb
source organism Rhodobacter blasticus
total genus 75
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 1998-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2prnA00
8PRNA 4GCQA 3SY9A 2J1NA 1OPFA 3O0EA 2ODJA 3T20A 3JTYA 3FYXA 1HXTA 2ZFGA 1HXXA 3VZWX 2K4TA 2XG6A 3WI5A 3POXA 4FSOA 1HXUA 3UPGA 3T0SA 4AUIA 4KR8A 1MPFA 4LSEA 2PRNA 1OSMA 5JDPA 4FT6A 4FSPA 4RJWA 3UU2A 1BH3A 2QTKA 4GCSA 4KRAA 7PRNA 4LSIA 2FGRA 3HWBA 3HW9A 3SZVA 2Y0KA 3A2SX 3EMNX 1GFNA 1GFPA 3WI4A 2FGQX 4FRXA 5DL5A 4RJXA 2XE5A 1E54A 4GCPA 3VZUX 4D5UA 4FOZA 2PORA 4BUMX 1BT9A 3POQA 3POUA 4FRTA 4KR4A 2XE2A 4C69X 1GFMA 3PORA 4LSHA 2ZLDA 1GFQA 3SYSA 2XE3A 1GFOA 2Y2XA 5PRNA 3VY8X 3VZTX 5FVNA 3SY7A 4FMSA 3K19A 3NSGA 5DL6A 1H6S1 1PRNA 4LSFA 2Y0HA 2O4VA 2Y0LA 3PRNA 1PHOA 3SZDA 5DL7A 6PRNA 3VY9X 3SYBA 3T24A 4D64A 2OMFA 2XE1A 4D65A 4JFBA 2J4UP 5DL8A
chains in the Genus database with same CATH superfamily
5B66O 4PJ0O 8PRNA 4GCQA 2F1CX 3SY9A 2J1NA 2KZ7B 1G90A 4XNLA 3HOEA 1OPFA 2R88A 3PGSA 4AYID 2WVPA 3O0EA 2IWWA 4FUVA 2ODJA 2LFUA 1T1LA 4AYDC 5AFUK 3BRZA 4RLBA 3A0BO 3JTYA 4FQEA 5G26A 5B5EO 3T20A 3PQSA 4O4UA 4C4VA 3AA1B 3AAEA 1HXTA 3FYXA 2ZFGA 1ZHTA 1HXXA 2KDYA 2KXPA 2MNHA 3BRYA 3GP6A 3LK42 2K4TA 2XG6A 4FZNA 3HOLA 5G3AA 3VZWX 3WI5A 3POXA 4FSOA 5EE2A 1HXUA 4K3BA 3UPGA 3T0SA 1P4TA 1ZHXA 4E1SA 2K0LA 3AA0A 1YS5A 4QQ1A 3JCUO 2WJQA 4AUIA 4G76A 2F1TA 3LK3A 1IZNB 2J4UP 4PUXA 4O3ZA 3VE1A 4KR8A 1MPFA 4LSEA 2PRNA 5GV0A 1OSMA 5JDPA 3DWNA 5ADXL 4O4XA 3TZGA 5G38A 3QRAA 4U9CA 5IYUA 4FT6A 4FSPA 4RJWA 3UU2A 1BH3A 3VE2A 4FZLA 2QTKA 4K3CA 3AAEB 4XNKA 2M06A 4AZLA 1Q9FA 3G7GA 2X9KA 4G75A 4GCSA 4KRAA 2KXPB 4LSIA 4RL9A 4C00A 2R4LA 7PRNA 4AYMC 5KAIO 2FGRA 3HWBA 2W80C 3PGUA 3HW9A 2AXTO 3SZVA 2Y0KA 3A2SX 3EMNX 1GFNA 5ADXK 2JQYA 3AA0B 1GFPA 3WI4A 2FGQX 1ZHWA 2M07A 4FRXA 3RBHA 2XTRA 2YPVA 4FESA 4AKRA 3DZMA 3LK3B 2Y7SA 4N59A 5DL5A 3DA4A 4RJXA 4JCHA 2XE5A 3BS0A 1E54A 1ZHZA 3DWOX 2LHFA 4GCPA 4O49A 4O3YA 3UAQA 3LK41 3VZUX 4AFKA 4D5UA 5AFUL 1QJPA 4FOZA 1T16A 2PORA 3LK2A 4BUMX 1Q9GA 5E79O 1BT9A 4GF4A 3AAAA 3POQA 2IWVA 2R4PA 3NJTA 4B61A 4E1TA 3POUA 4FRTA 4C4VB 3WU2O 5GTIO 2R4OA 4Z3TA 4KR4A 1QJ8A 2XMXA 2JMMA 2XE2A 4N58A 4C69X 4N74A 4PR7A 1GFMA 4UB6O 5TISO 3PORA 4LSHA 5T5FA 3A0HO 1QJ9A 3DA3A 2ZLDA 4AKRB 3C5OA 1IZNA 1GFQA 3AA7A 3QRCA 4AKMA 3AA6A 4AYNA 2KC0A 4UB8O 3SYSA 2XE3A 2R8AA 4O3XB 2R89A 1GFOA 5G39A 2KZ7A 2WJRA 1MM5A 2Y2XA 2MHLA 3KZIO 3LK2B 5PRNA 2F1VA 2ERVA 3VY8X 3VZTX 5FVNA 3SY7A 4N75A 4FMSA 5H2FO 4O3WA 3K19A 3AAAB 3NSGA 5DL6A 4AYEC 2R4NA 1S5LO 1THQA 1H6S1 5GTHO 1PRNA 5KAFO 1ORMA 2GE4A 4LSFA 2N2LA 2Y0HA 3KVDD 3AA1A 2O4VA 2Y0LA 3PRNA 2W81C 3V8UA 4F4BA 4RLCA 1BXWA 1PHOA 5D5DA 3SZDA 4CTDA 1MM4A 5DL7A 6PRNA 3VY9X 2N2MA 2X27X 3PQUA 3PGRA 2YNKA 4FZMA 3SYBA 3T24A 4GHBA 4IL6O 4D64A 1ZHYA 3PF1A 2OMFA 2XE1A 4D65A 4JFBA 3AA7B 2XTQA 3AA6B 5DL8A
chains in the Genus database with same CATH topology
8PRNA 4GCQA 3SY9A 2J1NA 2KZ7B 1G90A 4XNLA 3HOEA 1OPFA 4AYID 3O0EA 4FUVA 2ODJA 2LFUA 4AYDC 5AFUK 4RLBA 3T20A 3JTYA 5G26A 3PQSA 4O4UA 3AA1B 3AAEA 1HXTA 3FYXA 2ZFGA 1ZHTA 1HXXA 2KDYA 2KXPA 2MNHA 3GP6A 4FZNA 3LK42 2K4TA 2XG6A 3VZWX 3HOLA 3WI5A 3POXA 4FSOA 5EE2A 1HXUA 3UPGA 3T0SA 1P4TA 1ZHXA 4E1SA 2K0LA 3AA0A 1YS5A 4QQ1A 4AUIA 4G76A 2F1TA 3LK3A 1IZNB 2J4UP 4PUXA 4O3ZA 3VE1A 4KR8A 1MPFA 4LSEA 2PRNA 5GV0A 1OSMA 5JDPA 5ADXL 4O4XA 3TZGA 5IYUA 3QRAA 4U9CA 4FT6A 4FSPA 4RJWA 3UU2A 1BH3A 3VE2A 4FZLA 2QTKA 3AAEB 4XNKA 2M06A 4AZLA 1Q9FA 3G7GA 4GCSA 4G75A 4KRAA 4LSIA 2KXPB 4RL9A 7PRNA 4AYMC 2FGRA 3HWBA 2W80C 3HW9A 3SZVA 2Y0KA 3A2SX 3EMNX 1GFNA 3AA0B 1GFPA 3WI4A 2FGQX 1ZHWA 2M07A 4FRXA 3RBHA 2XTRA 2YPVA 4FESA 4AKRA 3LK3B 2Y7SA 4N59A 5DL5A 3DA4A 4RJXA 4JCHA 2XE5A 3UAQA 1E54A 1ZHZA 4GCPA 2LHFA 4AFKA 4O49A 4O3YA 3VZUX 3LK41 5AFUL 4D5UA 1QJPA 4FOZA 2PORA 3LK2A 4BUMX 1Q9GA 1BT9A 4GF4A 3AAAA 3POQA 4B61A 4E1TA 3POUA 4FRTA 4Z3TA 4KR4A 1QJ8A 2XMXA 2JMMA 2XE2A 4N58A 4C69X 1GFMA 3PORA 4LSHA 5T5FA 1QJ9A 3DA3A 2ZLDA 4AKRB 3C5OA 1IZNA 1GFQA 3AA7A 3QRCA 4AKMA 3AA6A 4AYNA 2KC0A 3SYSA 2XE3A 4O3XB 1GFOA 2KZ7A 2Y2XA 1MM5A 5PRNA 2MHLA 3LK2B 3VY8X 2F1VA 2ERVA 3VZTX 5FVNA 3SY7A 4FMSA 4O3WA 3K19A 3AAAB 3NSGA 5DL6A 4AYEC 1THQA 1H6S1 1PRNA 5ADXK 1ORMA 2GE4A 4LSFA 2N2LA 2Y0HA 3KVDD 3AA1A 2O4VA 2Y0LA 3PRNA 2W81C 3V8UA 4F4BA 4RLCA 1BXWA 1PHOA 5D5DA 3SZDA 1MM4A 5DL7A 6PRNA 3VY9X 2N2MA 2X27X 3PQUA 4FZMA 2YNKA 3SYBA 3T24A 4GHBA 4D64A 1ZHYA 2OMFA 2XE1A 4D65A 4JFBA 3AA7B 2XTQA 3AA6B 5DL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 8PRN A;  4GCQ A;  3SY9 A;  2J1N A;  1OPF A;  3O0E A;  2ODJ A;  3T20 A;  3JTY A;  3FYX A;  1HXT A;  2ZFG A;  1HXX A;  3VZW X;  2K4T A;  2XG6 A;  3WI5 A;  3POX A;  4FSO A;  1HXU A;  3UPG A;  3T0S A;  4AUI A;  4KR8 A;  1MPF A;  4LSE A;  2PRN A;  1OSM A;  5JDP A;  4FT6 A;  4FSP A;  4RJW A;  3UU2 A;  1BH3 A;  2QTK A;  4GCS A;  4KRA A;  7PRN A;  4LSI A;  2FGR A;  3HWB A;  3HW9 A;  3SZV A;  2Y0K A;  3A2S X;  3EMN X;  1GFN A;  1GFP A;  3WI4 A;  2FGQ X;  4FRX A;  5DL5 A;  4RJX A;  2XE5 A;  1E54 A;  4GCP A;  3VZU X;  4D5U A;  4FOZ A;  2POR A;  4BUM X;  1BT9 A;  3POQ A;  3POU A;  4FRT A;  4KR4 A;  2XE2 A;  4C69 X;  1GFM A;  3POR A;  4LSH A;  2ZLD A;  1GFQ A;  3SYS A;  2XE3 A;  1GFO A;  2Y2X A;  5PRN A;  3VY8 X;  3VZT X;  5FVN A;  3SY7 A;  4FMS A;  3K19 A;  3NSG A;  5DL6 A;  1H6S 1;  1PRN A;  4LSF A;  2Y0H A;  2O4V A;  2Y0L A;  3PRN A;  1PHO A;  3SZD A;  5DL7 A;  6PRN A;  3VY9 X;  3SYB A;  3T24 A;  4D64 A;  2OMF A;  2XE1 A;  4D65 A;  4JFB A;  2J4U P;  5DL8 A; 
#chains in the Genus database with same CATH topology
 5B66 O;  4PJ0 O;  8PRN A;  4GCQ A;  2F1C X;  3SY9 A;  2J1N A;  2KZ7 B;  1G90 A;  4XNL A;  3HOE A;  1OPF A;  2R88 A;  3PGS A;  4AYI D;  2WVP A;  3O0E A;  2IWW A;  4FUV A;  2ODJ A;  2LFU A;  1T1L A;  4AYD C;  5AFU K;  3BRZ A;  4RLB A;  3A0B O;  3JTY A;  4FQE A;  5G26 A;  5B5E O;  3T20 A;  3PQS A;  4O4U A;  4C4V A;  3AA1 B;  3AAE A;  1HXT A;  3FYX A;  2ZFG A;  1ZHT A;  1HXX A;  2KDY A;  2KXP A;  2MNH A;  3BRY A;  3GP6 A;  3LK4 2;  2K4T A;  2XG6 A;  4FZN A;  3HOL A;  5G3A A;  3VZW X;  3WI5 A;  3POX A;  4FSO A;  5EE2 A;  1HXU A;  4K3B A;  3UPG A;  3T0S A;  1P4T A;  1ZHX A;  4E1S A;  2K0L A;  3AA0 A;  1YS5 A;  4QQ1 A;  3JCU O;  2WJQ A;  4AUI A;  4G76 A;  2F1T A;  3LK3 A;  1IZN B;  2J4U P;  4PUX A;  4O3Z A;  3VE1 A;  4KR8 A;  1MPF A;  4LSE A;  2PRN A;  5GV0 A;  1OSM A;  5JDP A;  3DWN A;  5ADX L;  4O4X A;  3TZG A;  5G38 A;  3QRA A;  4U9C A;  5IYU A;  4FT6 A;  4FSP A;  4RJW A;  3UU2 A;  1BH3 A;  3VE2 A;  4FZL A;  2QTK A;  4K3C A;  3AAE B;  4XNK A;  2M06 A;  4AZL A;  1Q9F A;  3G7G A;  2X9K A;  4G75 A;  4GCS A;  4KRA A;  2KXP B;  4LSI A;  4RL9 A;  4C00 A;  2R4L A;  7PRN A;  4AYM C;  5KAI O;  2FGR A;  3HWB A;  2W80 C;  3PGU A;  3HW9 A;  2AXT O;  3SZV A;  2Y0K A;  3A2S X;  3EMN X;  1GFN A;  5ADX K;  2JQY A;  3AA0 B;  1GFP A;  3WI4 A;  2FGQ X;  1ZHW A;  2M07 A;  4FRX A;  3RBH A;  2XTR A;  2YPV A;  4FES A;  4AKR A;  3DZM A;  3LK3 B;  2Y7S A;  4N59 A;  5DL5 A;  3DA4 A;  4RJX A;  4JCH A;  2XE5 A;  3BS0 A;  1E54 A;  1ZHZ A;  3DWO X;  2LHF A;  4GCP A;  4O49 A;  4O3Y A;  3UAQ A;  3LK4 1;  3VZU X;  4AFK A;  4D5U A;  5AFU L;  1QJP A;  4FOZ A;  1T16 A;  2POR A;  3LK2 A;  4BUM X;  1Q9G A;  5E79 O;  1BT9 A;  4GF4 A;  3AAA A;  3POQ A;  2IWV A;  2R4P A;  3NJT A;  4B61 A;  4E1T A;  3POU A;  4FRT A;  4C4V B;  3WU2 O;  5GTI O;  2R4O A;  4Z3T A;  4KR4 A;  1QJ8 A;  2XMX A;  2JMM A;  2XE2 A;  4N58 A;  4C69 X;  4N74 A;  4PR7 A;  1GFM A;  4UB6 O;  5TIS O;  3POR A;  4LSH A;  5T5F A;  3A0H O;  1QJ9 A;  3DA3 A;  2ZLD A;  4AKR B;  3C5O A;  1IZN A;  1GFQ A;  3AA7 A;  3QRC A;  4AKM A;  3AA6 A;  4AYN A;  2KC0 A;  4UB8 O;  3SYS A;  2XE3 A;  2R8A A;  4O3X B;  2R89 A;  1GFO A;  5G39 A;  2KZ7 A;  2WJR A;  1MM5 A;  2Y2X A;  2MHL A;  3KZI O;  3LK2 B;  5PRN A;  2F1V A;  2ERV A;  3VY8 X;  3VZT X;  5FVN A;  3SY7 A;  4N75 A;  4FMS A;  5H2F O;  4O3W A;  3K19 A;  3AAA B;  3NSG A;  5DL6 A;  4AYE C;  2R4N A;  1S5L O;  1THQ A;  1H6S 1;  5GTH O;  1PRN A;  5KAF O;  1ORM A;  2GE4 A;  4LSF A;  2N2L A;  2Y0H A;  3KVD D;  3AA1 A;  2O4V A;  2Y0L A;  3PRN A;  2W81 C;  3V8U A;  4F4B A;  4RLC A;  1BXW A;  1PHO A;  5D5D A;  3SZD A;  4CTD A;  1MM4 A;  5DL7 A;  6PRN A;  3VY9 X;  2N2M A;  2X27 X;  3PQU A;  3PGR A;  2YNK A;  4FZM A;  3SYB A;  3T24 A;  4GHB A;  4IL6 O;  4D64 A;  1ZHY A;  3PF1 A;  2OMF A;  2XE1 A;  4D65 A;  4JFB A;  3AA7 B;  2XTQ A;  3AA6 B;  5DL8 A; 
#chains in the Genus database with same CATH homology
 8PRN A;  4GCQ A;  3SY9 A;  2J1N A;  2KZ7 B;  1G90 A;  4XNL A;  3HOE A;  1OPF A;  4AYI D;  3O0E A;  4FUV A;  2ODJ A;  2LFU A;  4AYD C;  5AFU K;  4RLB A;  3T20 A;  3JTY A;  5G26 A;  3PQS A;  4O4U A;  3AA1 B;  3AAE A;  1HXT A;  3FYX A;  2ZFG A;  1ZHT A;  1HXX A;  2KDY A;  2KXP A;  2MNH A;  3GP6 A;  4FZN A;  3LK4 2;  2K4T A;  2XG6 A;  3VZW X;  3HOL A;  3WI5 A;  3POX A;  4FSO A;  5EE2 A;  1HXU A;  3UPG A;  3T0S A;  1P4T A;  1ZHX A;  4E1S A;  2K0L A;  3AA0 A;  1YS5 A;  4QQ1 A;  4AUI A;  4G76 A;  2F1T A;  3LK3 A;  1IZN B;  2J4U P;  4PUX A;  4O3Z A;  3VE1 A;  4KR8 A;  1MPF A;  4LSE A;  2PRN A;  5GV0 A;  1OSM A;  5JDP A;  5ADX L;  4O4X A;  3TZG A;  5IYU A;  3QRA A;  4U9C A;  4FT6 A;  4FSP A;  4RJW A;  3UU2 A;  1BH3 A;  3VE2 A;  4FZL A;  2QTK A;  3AAE B;  4XNK A;  2M06 A;  4AZL A;  1Q9F A;  3G7G A;  4GCS A;  4G75 A;  4KRA A;  4LSI A;  2KXP B;  4RL9 A;  7PRN A;  4AYM C;  2FGR A;  3HWB A;  2W80 C;  3HW9 A;  3SZV A;  2Y0K A;  3A2S X;  3EMN X;  1GFN A;  3AA0 B;  1GFP A;  3WI4 A;  2FGQ X;  1ZHW A;  2M07 A;  4FRX A;  3RBH A;  2XTR A;  2YPV A;  4FES A;  4AKR A;  3LK3 B;  2Y7S A;  4N59 A;  5DL5 A;  3DA4 A;  4RJX A;  4JCH A;  2XE5 A;  3UAQ A;  1E54 A;  1ZHZ A;  4GCP A;  2LHF A;  4AFK A;  4O49 A;  4O3Y A;  3VZU X;  3LK4 1;  5AFU L;  4D5U A;  1QJP A;  4FOZ A;  2POR A;  3LK2 A;  4BUM X;  1Q9G A;  1BT9 A;  4GF4 A;  3AAA A;  3POQ A;  4B61 A;  4E1T A;  3POU A;  4FRT A;  4Z3T A;  4KR4 A;  1QJ8 A;  2XMX A;  2JMM A;  2XE2 A;  4N58 A;  4C69 X;  1GFM A;  3POR A;  4LSH A;  5T5F A;  1QJ9 A;  3DA3 A;  2ZLD A;  4AKR B;  3C5O A;  1IZN A;  1GFQ A;  3AA7 A;  3QRC A;  4AKM A;  3AA6 A;  4AYN A;  2KC0 A;  3SYS A;  2XE3 A;  4O3X B;  1GFO A;  2KZ7 A;  2Y2X A;  1MM5 A;  5PRN A;  2MHL A;  3LK2 B;  3VY8 X;  2F1V A;  2ERV A;  3VZT X;  5FVN A;  3SY7 A;  4FMS A;  4O3W A;  3K19 A;  3AAA B;  3NSG A;  5DL6 A;  4AYE C;  1THQ A;  1H6S 1;  1PRN A;  5ADX K;  1ORM A;  2GE4 A;  4LSF A;  2N2L A;  2Y0H A;  3KVD D;  3AA1 A;  2O4V A;  2Y0L A;  3PRN A;  2W81 C;  3V8U A;  4F4B A;  4RLC A;  1BXW A;  1PHO A;  5D5D A;  3SZD A;  1MM4 A;  5DL7 A;  6PRN A;  3VY9 X;  2N2M A;  2X27 X;  3PQU A;  4FZM A;  2YNK A;  3SYB A;  3T24 A;  4GHB A;  4D64 A;  1ZHY A;  2OMF A;  2XE1 A;  4D65 A;  4JFB A;  3AA7 B;  2XTQ A;  3AA6 B;  5DL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...