2PRNA

Rhodopseudomonas blastica porin, triple mutant e1m, e99w, a116w
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
289
structure length
289
Chain Sequence
MISLNGYGRFGLQYVEDRGVGLEDTIISSRLRINIVGTTETDQGVTFGAKLRMQWDDGDAFAGTAGNAAQFWTSYNGVTVSVGNVDTAFDSVALTYDSWMGYEASSFGDAQSSFFWYNSKYDASGALDNYNGIAVTYSISGVNLYLSYVDPDQTVDSSLVTEEFGIAADWSNDMISLAAAYTTDAGGIVDNDIAFVGAAYKFNDAGTVGLNWYDNGLSTAGDQVTLYGNYAFGATTVRAYVSDIDRAGADTAYGIGADYQFAEGVKVSGSVQSGFANETVADVGVRFDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORIN
publication title Porin mutants with new channel properties.
pubmed rcsb
source organism Rhodobacter blasticus
molecule tags Integral membrane protein
total genus 75
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 1998-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2prnA00
2Y0LA 3JTYA 2Y2XA 3A2SX 4AUIA 1GFPA 1HXTA 1E54A 3SYBA 3VZUX 2PORA 2Y0KA 4GCQA 4BUMX 2PRNA 4KR8A 5DL6A 3VZTX 2FGQX 2ZFGA 2XE3A 3FYXA 3EMNX 2Y0HA 3VZWX 1MPFA 4FMSA 3T0SA 7PRNA 4LSFA 3NSGA 4FOZA 3HWBA 2QTKA 3SZVA 4LSIA 4LSEA 2XG6A 2OMFA 1PHOA 2XE2A 4KR4A 3T20A 5DL5A 4D64A 3UPGA 1GFOA 3SY7A 1HXXA 4JFBA 2J4UP 4LSHA 4KRAA 5DL8A 3VY9X 3T24A 5PRNA 3WI5A 4D65A 3O0EA 4GCSA 5JDPA 1HXUA 3K19A 3WI4A 8PRNA 2O4VA 4D5UA 1GFNA 3SY9A 3SZDA 2ZLDA 3POXA 2XE1A 1OPFA 2XE5A 3UU2A 3PRNA 3HW9A 2FGRA 4C69X 4GCPA 4FSPA 3POUA 4RJXA 1PRNA 1BH3A 4FSOA 5DL7A 1H6S1 4RJWA 1GFMA 5FVNA 4FRXA 2J1NA 4FT6A 3SYSA 1BT9A 3PORA 2ODJA 1OSMA 1GFQA 4FRTA 6PRNA 3POQA 2K4TA 3VY8X
chains in the Genus database with same CATH superfamily
2KZ7B 3G7GA 2Y0LA 3JTYA 2Y2XA 3A2SX 3WU2O 4AUIA 1GFPA 5IYUA 4AYEC 1HXTA 4FUVA 1E54A 3AA7B 3LK41 2R4LA 3SYBA 1QJ9A 2PORA 3VZUX 4K3CA 4FZLA 2Y0KA 4GCQA 4BUMX 4GHBA 5AFUK 2PRNA 4AFKA 4FZNA 2K0LA 4Z3TA 3AA0B 4KR8A 4E1TA 3AAEA 4FZMA 1P4TA 5DL6A 3VZTX 2FGQX 2Y7SA 4PJ0O 4AZLA 5G3AA 2ZFGA 3BRYA 1QJ8A 2KC0A 2XE3A 3FYXA 4N74A 3EMNX 2F1VA 4RLCA 1T1LA 2R4OA 2Y0HA 3VZWX 1MPFA 2M07A 2XTRA 4FMSA 3AAAA 4O3XB 3T0SA 7PRNA 4LSFA 1ZHWA 2IWVA 3NSGA 5G39A 4C4VB 3LK3B 4FOZA 1BXWA 3HWBA 4GF4A 2QTKA 3SZVA 3AA6A 3DA4A 4XNKA 4G75A 2KXPA 3AA1A 3KVDD 4UB8O 5TISO 2R89A 4JCHA 4LSIA 4LSEA 1ZHXA 3VE2A 1ORMA 2XG6A 3NJTA 3DA3A 2ERVA 1IZNB 2M06A 4N58A 2OMFA 3LK2B 1PHOA 2XE2A 3QRCA 4N75A 1G90A 4KR4A 3T20A 5G38A 2WVPA 4RL9A 5DL5A 4CTDA 3HOEA 2KZ7A 3A0BO 4D64A 2R4NA 3UPGA 4PR7A 3DWNA 1YS5A 1GFOA 3SY7A 5AFUL 1HXXA 4JFBA 2J4UP 4U9CA 2LHFA 4LSHA 3KZIO 3DZMA 2W81C 3PGSA 4AYDC 3AA7A 4FQEA 4KRAA 3PGRA 2AXTO 5DL8A 3VY9X 4PUXA 3T24A 2LFUA 3A0HO 2MNHA 1T16A 5PRNA 2W80C 2YNKA 4K3BA 2WJRA 3AA0A 2X9KA 3WI5A 3O0EA 4AKRA 4UB6O 4O49A 3BS0A 4GCSA 4D65A 5B66O 5JDPA 3JCUO 1ZHZA 1HXUA 3K19A 3LK42 3PGUA 3WI4A 4B61A 8PRNA 2O4VA 2KDYA 2XTQA 2JQYA 3V8UA 4AYID 4D5UA 3RBHA 1GFNA 3GP6A 2IWWA 4AKMA 3AA6B 3SY9A 1ZHYA 2ZLDA 3SZDA 3POXA 4AYMC 4AYNA 2XMXA 1ZHTA 5GV0A 5KAFO 3PQSA 5GTHO 2F1CX 2XE1A 4RLBA 4IL6O 4C00A 3LK3A 1OPFA 5KAIO 2XE5A 3UU2A 3AAEB 2YPVA 3HW9A 3PRNA 4O3YA 2FGRA 5T5FA 4C69X 4G76A 4FSPA 4GCPA 3POUA 5G26A 5E79O 3DWOX 4RJXA 1Q9FA 5ADXK 2F1TA 3HOLA 1PRNA 3UAQA 1THQA 1BH3A 2R88A 1IZNA 2GE4A 4FSOA 1H6S1 3AAAB 3LK2A 3PF1A 4QQ1A 4RJWA 5DL7A 2X27X 1GFMA 1Q9GA 3C5OA 5FVNA 3QRAA 5EE2A 2R4PA 4FRXA 4AKRB 1MM5A 2J1NA 1QJPA 5ADXL 1S5LO 2MHLA 1MM4A 3TZGA 4FT6A 2KXPB 1BT9A 3AA1B 2WJQA 4N59A 3SYSA 4O4XA 3PORA 2N2LA 2ODJA 2JMMA 5D5DA 3VE1A 4O3ZA 4E1SA 5GTIO 4O4UA 1OSMA 1GFQA 4FESA 3BRZA 5H2FO 4C4VA 4FRTA 6PRNA 3POQA 4XNLA 4O3WA 4F4BA 5B5EO 2N2MA 2K4TA 3PQUA 3VY8X 2R8AA
chains in the Genus database with same CATH topology
2KZ7B 3G7GA 2Y0LA 3JTYA 2Y2XA 3A2SX 4AUIA 1GFPA 5IYUA 4AYEC 1HXTA 4FUVA 1E54A 3AA7B 3LK41 3SYBA 1QJ9A 2PORA 3VZUX 4FZLA 2Y0KA 4GCQA 4BUMX 4GHBA 5AFUK 2PRNA 4FZNA 2K0LA 4Z3TA 3AA0B 4KR8A 4E1TA 3AAEA 4FZMA 1P4TA 5DL6A 3VZTX 2FGQX 2Y7SA 4AZLA 2ZFGA 1QJ8A 2KC0A 2XE3A 3FYXA 3EMNX 2F1VA 4RLCA 2Y0HA 3VZWX 1MPFA 2M07A 2XTRA 4FMSA 3AAAA 4O3XB 3T0SA 7PRNA 4LSFA 1ZHWA 3NSGA 3LK3B 4FOZA 1BXWA 3HWBA 4GF4A 2QTKA 3SZVA 3AA6A 3DA4A 4XNKA 4G75A 2KXPA 3AA1A 3KVDD 4JCHA 4LSIA 4LSEA 1ZHXA 3VE2A 1ORMA 2XG6A 4AFKA 3DA3A 2ERVA 1IZNB 2M06A 4N58A 2OMFA 3LK2B 1PHOA 2XE2A 3QRCA 1G90A 4KR4A 3T20A 4RL9A 5DL5A 3HOEA 2KZ7A 4D64A 3UPGA 1YS5A 1GFOA 3SY7A 5AFUL 1HXXA 4JFBA 2J4UP 4U9CA 2LHFA 4LSHA 2W81C 4AYDC 3AA7A 4KRAA 5DL8A 3VY9X 4PUXA 3T24A 2LFUA 2MNHA 5PRNA 2W80C 2YNKA 3WI5A 5ADXK 3AA0A 4D65A 4AKRA 3O0EA 4O49A 4GCSA 5JDPA 1ZHZA 1HXUA 3K19A 3LK42 3WI4A 4B61A 8PRNA 2O4VA 2KDYA 2XTQA 3V8UA 4AYID 4D5UA 3RBHA 1GFNA 3GP6A 4AKMA 3AA6B 3SY9A 1ZHYA 2ZLDA 3SZDA 3POXA 4AYMC 4AYNA 2XMXA 1ZHTA 5GV0A 3PQSA 2XE1A 4RLBA 3LK3A 1OPFA 2XE5A 3UU2A 3AAEB 2YPVA 3HW9A 3PRNA 4O3YA 2FGRA 5T5FA 4C69X 4G76A 4FSPA 4GCPA 3POUA 5G26A 4RJXA 1Q9FA 2F1TA 3HOLA 1PRNA 3UAQA 1THQA 1BH3A 4FSOA 1IZNA 2GE4A 4QQ1A 1H6S1 3AAAB 3LK2A 4RJWA 5DL7A 2X27X 1GFMA 1Q9GA 3C5OA 5FVNA 3QRAA 5EE2A 4FRXA 4AKRB 1MM5A 2J1NA 1QJPA 5ADXL 2MHLA 3TZGA 1MM4A 4FT6A 2KXPB 1BT9A 3AA1B 4N59A 3SYSA 3VE1A 4O4XA 3PORA 2N2LA 2ODJA 2JMMA 5D5DA 4E1SA 4O3ZA 4O4UA 1OSMA 1GFQA 4FESA 4FRTA 6PRNA 3POQA 4XNLA 4O3WA 4F4BA 2N2MA 2K4TA 3PQUA 3VY8X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0L A;  3JTY A;  2Y2X A;  3A2S X;  4AUI A;  1GFP A;  1HXT A;  1E54 A;  3SYB A;  3VZU X;  2POR A;  2Y0K A;  4GCQ A;  4BUM X;  2PRN A;  4KR8 A;  5DL6 A;  3VZT X;  2FGQ X;  2ZFG A;  2XE3 A;  3FYX A;  3EMN X;  2Y0H A;  3VZW X;  1MPF A;  4FMS A;  3T0S A;  7PRN A;  4LSF A;  3NSG A;  4FOZ A;  3HWB A;  2QTK A;  3SZV A;  4LSI A;  4LSE A;  2XG6 A;  2OMF A;  1PHO A;  2XE2 A;  4KR4 A;  3T20 A;  5DL5 A;  4D64 A;  3UPG A;  1GFO A;  3SY7 A;  1HXX A;  4JFB A;  2J4U P;  4LSH A;  4KRA A;  5DL8 A;  3VY9 X;  3T24 A;  5PRN A;  3WI5 A;  4D65 A;  3O0E A;  4GCS A;  5JDP A;  1HXU A;  3K19 A;  3WI4 A;  8PRN A;  2O4V A;  4D5U A;  1GFN A;  3SY9 A;  3SZD A;  2ZLD A;  3POX A;  2XE1 A;  1OPF A;  2XE5 A;  3UU2 A;  3PRN A;  3HW9 A;  2FGR A;  4C69 X;  4GCP A;  4FSP A;  3POU A;  4RJX A;  1PRN A;  1BH3 A;  4FSO A;  5DL7 A;  1H6S 1;  4RJW A;  1GFM A;  5FVN A;  4FRX A;  2J1N A;  4FT6 A;  3SYS A;  1BT9 A;  3POR A;  2ODJ A;  1OSM A;  1GFQ A;  4FRT A;  6PRN A;  3POQ A;  2K4T A;  3VY8 X; 
#chains in the Genus database with same CATH topology
 2KZ7 B;  3G7G A;  2Y0L A;  3JTY A;  2Y2X A;  3A2S X;  3WU2 O;  4AUI A;  1GFP A;  5IYU A;  4AYE C;  1HXT A;  4FUV A;  1E54 A;  3AA7 B;  3LK4 1;  2R4L A;  3SYB A;  1QJ9 A;  2POR A;  3VZU X;  4K3C A;  4FZL A;  2Y0K A;  4GCQ A;  4BUM X;  4GHB A;  5AFU K;  2PRN A;  4AFK A;  4FZN A;  2K0L A;  4Z3T A;  3AA0 B;  4KR8 A;  4E1T A;  3AAE A;  4FZM A;  1P4T A;  5DL6 A;  3VZT X;  2FGQ X;  2Y7S A;  4PJ0 O;  4AZL A;  5G3A A;  2ZFG A;  3BRY A;  1QJ8 A;  2KC0 A;  2XE3 A;  3FYX A;  4N74 A;  3EMN X;  2F1V A;  4RLC A;  1T1L A;  2R4O A;  2Y0H A;  3VZW X;  1MPF A;  2M07 A;  2XTR A;  4FMS A;  3AAA A;  4O3X B;  3T0S A;  7PRN A;  4LSF A;  1ZHW A;  2IWV A;  3NSG A;  5G39 A;  4C4V B;  3LK3 B;  4FOZ A;  1BXW A;  3HWB A;  4GF4 A;  2QTK A;  3SZV A;  3AA6 A;  3DA4 A;  4XNK A;  4G75 A;  2KXP A;  3AA1 A;  3KVD D;  4UB8 O;  5TIS O;  2R89 A;  4JCH A;  4LSI A;  4LSE A;  1ZHX A;  3VE2 A;  1ORM A;  2XG6 A;  3NJT A;  3DA3 A;  2ERV A;  1IZN B;  2M06 A;  4N58 A;  2OMF A;  3LK2 B;  1PHO A;  2XE2 A;  3QRC A;  4N75 A;  1G90 A;  4KR4 A;  3T20 A;  5G38 A;  2WVP A;  4RL9 A;  5DL5 A;  4CTD A;  3HOE A;  2KZ7 A;  3A0B O;  4D64 A;  2R4N A;  3UPG A;  4PR7 A;  3DWN A;  1YS5 A;  1GFO A;  3SY7 A;  5AFU L;  1HXX A;  4JFB A;  2J4U P;  4U9C A;  2LHF A;  4LSH A;  3KZI O;  3DZM A;  2W81 C;  3PGS A;  4AYD C;  3AA7 A;  4FQE A;  4KRA A;  3PGR A;  2AXT O;  5DL8 A;  3VY9 X;  4PUX A;  3T24 A;  2LFU A;  3A0H O;  2MNH A;  1T16 A;  5PRN A;  2W80 C;  2YNK A;  4K3B A;  2WJR A;  3AA0 A;  2X9K A;  3WI5 A;  3O0E A;  4AKR A;  4UB6 O;  4O49 A;  3BS0 A;  4GCS A;  4D65 A;  5B66 O;  5JDP A;  3JCU O;  1ZHZ A;  1HXU A;  3K19 A;  3LK4 2;  3PGU A;  3WI4 A;  4B61 A;  8PRN A;  2O4V A;  2KDY A;  2XTQ A;  2JQY A;  3V8U A;  4AYI D;  4D5U A;  3RBH A;  1GFN A;  3GP6 A;  2IWW A;  4AKM A;  3AA6 B;  3SY9 A;  1ZHY A;  2ZLD A;  3SZD A;  3POX A;  4AYM C;  4AYN A;  2XMX A;  1ZHT A;  5GV0 A;  5KAF O;  3PQS A;  5GTH O;  2F1C X;  2XE1 A;  4RLB A;  4IL6 O;  4C00 A;  3LK3 A;  1OPF A;  5KAI O;  2XE5 A;  3UU2 A;  3AAE B;  2YPV A;  3HW9 A;  3PRN A;  4O3Y A;  2FGR A;  5T5F A;  4C69 X;  4G76 A;  4FSP A;  4GCP A;  3POU A;  5G26 A;  5E79 O;  3DWO X;  4RJX A;  1Q9F A;  5ADX K;  2F1T A;  3HOL A;  1PRN A;  3UAQ A;  1THQ A;  1BH3 A;  2R88 A;  1IZN A;  2GE4 A;  4FSO A;  1H6S 1;  3AAA B;  3LK2 A;  3PF1 A;  4QQ1 A;  4RJW A;  5DL7 A;  2X27 X;  1GFM A;  1Q9G A;  3C5O A;  5FVN A;  3QRA A;  5EE2 A;  2R4P A;  4FRX A;  4AKR B;  1MM5 A;  2J1N A;  1QJP A;  5ADX L;  1S5L O;  2MHL A;  1MM4 A;  3TZG A;  4FT6 A;  2KXP B;  1BT9 A;  3AA1 B;  2WJQ A;  4N59 A;  3SYS A;  4O4X A;  3POR A;  2N2L A;  2ODJ A;  2JMM A;  5D5D A;  3VE1 A;  4O3Z A;  4E1S A;  5GTI O;  4O4U A;  1OSM A;  1GFQ A;  4FES A;  3BRZ A;  5H2F O;  4C4V A;  4FRT A;  6PRN A;  3POQ A;  4XNL A;  4O3W A;  4F4B A;  5B5E O;  2N2M A;  2K4T A;  3PQU A;  3VY8 X;  2R8A A; 
#chains in the Genus database with same CATH homology
 2KZ7 B;  3G7G A;  2Y0L A;  3JTY A;  2Y2X A;  3A2S X;  4AUI A;  1GFP A;  5IYU A;  4AYE C;  1HXT A;  4FUV A;  1E54 A;  3AA7 B;  3LK4 1;  3SYB A;  1QJ9 A;  2POR A;  3VZU X;  4FZL A;  2Y0K A;  4GCQ A;  4BUM X;  4GHB A;  5AFU K;  2PRN A;  4FZN A;  2K0L A;  4Z3T A;  3AA0 B;  4KR8 A;  4E1T A;  3AAE A;  4FZM A;  1P4T A;  5DL6 A;  3VZT X;  2FGQ X;  2Y7S A;  4AZL A;  2ZFG A;  1QJ8 A;  2KC0 A;  2XE3 A;  3FYX A;  3EMN X;  2F1V A;  4RLC A;  2Y0H A;  3VZW X;  1MPF A;  2M07 A;  2XTR A;  4FMS A;  3AAA A;  4O3X B;  3T0S A;  7PRN A;  4LSF A;  1ZHW A;  3NSG A;  3LK3 B;  4FOZ A;  1BXW A;  3HWB A;  4GF4 A;  2QTK A;  3SZV A;  3AA6 A;  3DA4 A;  4XNK A;  4G75 A;  2KXP A;  3AA1 A;  3KVD D;  4JCH A;  4LSI A;  4LSE A;  1ZHX A;  3VE2 A;  1ORM A;  2XG6 A;  4AFK A;  3DA3 A;  2ERV A;  1IZN B;  2M06 A;  4N58 A;  2OMF A;  3LK2 B;  1PHO A;  2XE2 A;  3QRC A;  1G90 A;  4KR4 A;  3T20 A;  4RL9 A;  5DL5 A;  3HOE A;  2KZ7 A;  4D64 A;  3UPG A;  1YS5 A;  1GFO A;  3SY7 A;  5AFU L;  1HXX A;  4JFB A;  2J4U P;  4U9C A;  2LHF A;  4LSH A;  2W81 C;  4AYD C;  3AA7 A;  4KRA A;  5DL8 A;  3VY9 X;  4PUX A;  3T24 A;  2LFU A;  2MNH A;  5PRN A;  2W80 C;  2YNK A;  3WI5 A;  5ADX K;  3AA0 A;  4D65 A;  4AKR A;  3O0E A;  4O49 A;  4GCS A;  5JDP A;  1ZHZ A;  1HXU A;  3K19 A;  3LK4 2;  3WI4 A;  4B61 A;  8PRN A;  2O4V A;  2KDY A;  2XTQ A;  3V8U A;  4AYI D;  4D5U A;  3RBH A;  1GFN A;  3GP6 A;  4AKM A;  3AA6 B;  3SY9 A;  1ZHY A;  2ZLD A;  3SZD A;  3POX A;  4AYM C;  4AYN A;  2XMX A;  1ZHT A;  5GV0 A;  3PQS A;  2XE1 A;  4RLB A;  3LK3 A;  1OPF A;  2XE5 A;  3UU2 A;  3AAE B;  2YPV A;  3HW9 A;  3PRN A;  4O3Y A;  2FGR A;  5T5F A;  4C69 X;  4G76 A;  4FSP A;  4GCP A;  3POU A;  5G26 A;  4RJX A;  1Q9F A;  2F1T A;  3HOL A;  1PRN A;  3UAQ A;  1THQ A;  1BH3 A;  4FSO A;  1IZN A;  2GE4 A;  4QQ1 A;  1H6S 1;  3AAA B;  3LK2 A;  4RJW A;  5DL7 A;  2X27 X;  1GFM A;  1Q9G A;  3C5O A;  5FVN A;  3QRA A;  5EE2 A;  4FRX A;  4AKR B;  1MM5 A;  2J1N A;  1QJP A;  5ADX L;  2MHL A;  3TZG A;  1MM4 A;  4FT6 A;  2KXP B;  1BT9 A;  3AA1 B;  4N59 A;  3SYS A;  3VE1 A;  4O4X A;  3POR A;  2N2L A;  2ODJ A;  2JMM A;  5D5D A;  4E1S A;  4O3Z A;  4O4U A;  1OSM A;  1GFQ A;  4FES A;  4FRT A;  6PRN A;  3POQ A;  4XNL A;  4O3W A;  4F4B A;  2N2M A;  2K4T A;  3PQU A;  3VY8 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...