2PRNA

Rhodopseudomonas blastica porin, triple mutant e1m, e99w, a116w
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
289
structure length
289
Chain Sequence
MISLNGYGRFGLQYVEDRGVGLEDTIISSRLRINIVGTTETDQGVTFGAKLRMQWDDGDAFAGTAGNAAQFWTSYNGVTVSVGNVDTAFDSVALTYDSWMGYEASSFGDAQSSFFWYNSKYDASGALDNYNGIAVTYSISGVNLYLSYVDPDQTVDSSLVTEEFGIAADWSNDMISLAAAYTTDAGGIVDNDIAFVGAAYKFNDAGTVGLNWYDNGLSTAGDQVTLYGNYAFGATTVRAYVSDIDRAGADTAYGIGADYQFAEGVKVSGSVQSGFANETVADVGVRFDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Porin mutants with new channel properties.
pubmed rcsb
source organism Rhodobacter blasticus
molecule tags Integral membrane protein
molecule keywords PORIN
total genus 75
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 1998-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2prnA00
5DL7A 3VY9X 3POQA 2Y0LA 4KRAA 2Y0HA 4GCQA 2FGQX 2FGRA 3A2SX 4FSPA 1MPFA 1PRNA 4FOZA 4C69X 3EMNX 3T20A 4FRTA 4BUMX 4LSEA 4RJXA 1HXUA 3PRNA 3UPGA 1BH3A 2Y2XA 1GFNA 2XE5A 2Y0KA 5DL5A 2ODJA 2QTKA 4KR4A 4RJWA 2PORA 1GFMA 4FMSA 4GCPA 4FRXA 2ZFGA 4FT6A 5PRNA 4GCSA 1HXXA 3VY8X 2ZLDA 4D65A 4KR8A 3WI5A 4D64A 5FVNA 4D5UA 3WI4A 1BT9A 8PRNA 3POXA 3K19A 3VZTX 5DL6A 2J4UP 2XE1A 1OPFA 1PHOA 3SZDA 1OSMA 3T24A 4AUIA 3FYXA 3NSGA 3HW9A 3O0EA 3POUA 6PRNA 1GFOA 7PRNA 1GFQA 1E54A 2OMFA 3SYBA 3SZVA 1GFPA 1HXTA 3VZWX 4LSHA 2XE2A 3PORA 3T0SA 5JDPA 2J1NA 2XG6A 2K4TA 3JTYA 4JFBA 3HWBA 2PRNA 4FSOA 4LSFA 4LSIA 1H6S1 2O4VA 3SYSA 3VZUX 3SY7A 3UU2A 2XE3A 5DL8A 3SY9A
chains in the Genus database with same CATH superfamily
5DL7A 1ZHZA 3VY9X 4CTDA 4RLBA 3POQA 2Y0LA 4KRAA 2R88A 4QQ1A 2Y0HA 4FQEA 2LHFA 2XTQA 4GCQA 2FGQX 2FGRA 3UAQA 4C00A 2JQYA 3A2SX 4AYNA 4FSPA 1MPFA 1PRNA 2YNKA 4FOZA 4AYEC 5B66O 3RBHA 3AAEB 1ZHWA 3EMNX 1T1LA 3DA3A 5EE2A 3TZGA 4C69X 4E1SA 2R4PA 3T20A 2M07A 4FRTA 3AA0B 2LFUA 4LSEA 4RJXA 5GTIO 4BUMX 1HXUA 3PRNA 1IZNA 4FZNA 3UPGA 1BH3A 2Y2XA 2MNHA 4AZLA 4FZMA 5ADXK 1GFNA 1QJ8A 2XE5A 1S5LO 2YPVA 3AA6B 4PR7A 5H2FO 2KZ7A 4G76A 2KC0A 2X9KA 3JCUO 2Y0KA 4C4VB 3AA1B 3HOLA 5KAIO 4N58A 3KZIO 5DL5A 2ODJA 2QTKA 3DWOX 3WU2O 3PQSA 3KVDD 4KR4A 4K3CA 1P4TA 4RJWA 4XNKA 4U9CA 3DZMA 4O3YA 2PORA 3QRCA 1GFMA 5T5FA 4FMSA 4GCPA 4FRXA 2ZFGA 4FT6A 3VZTX 5PRNA 4PUXA 4GCSA 2JMMA 3PGRA 3VE1A 5G3AA 1HXXA 1ZHYA 2ZLDA 3VY8X 4AKRB 4D65A 3LK3A 3GP6A 4KR8A 5KAFO 5AFUL 5E79O 4UB8O 1Q9GA 2KXPA 3WI5A 4F4BA 3PQUA 4FZLA 2F1TA 2XMXA 2Y7SA 3V8UA 2R4OA 5IYUA 3QRAA 4D64A 5FVNA 4GF4A 4D5UA 2F1CX 2R4NA 1THQA 3AA6A 3NJTA 3WI4A 3C5OA 4E1TA 3LK2B 1BT9A 4C4VA 8PRNA 3POXA 1ZHXA 2IWVA 3AA1A 2R8AA 2N2MA 3G7GA 3K19A 3LK42 3PF1A 4FESA 1ORMA 1T16A 2W81C 4K3BA 2XTRA 4N74A 2XE1A 1OPFA 1PHOA 1QJ9A 4UB6O 3SZDA 2IWWA 1OSMA 3AAAA 4G75A 5G38A 3T24A 4AUIA 5GTHO 5TISO 3BS0A 3FYXA 3NSGA 3PGSA 4RL9A 4N59A 5DL8A 5D5DA 3HW9A 1G90A 3O0EA 4AKRA 5G26A 3POUA 4IL6O 1GFOA 6PRNA 3AA7B 1GFQA 3LK3B 7PRNA 1E54A 4PJ0O 1MM5A 3A0BO 2OMFA 4O4XA 5B5EO 2KXPB 4O49A 3SYBA 3SZVA 4AKMA 4AYMC 1GFPA 1HXTA 2W80C 4AYID 3VZWX 5GV0A 4LSHA 5G39A 2XE2A 1Q9FA 3HOEA 3LK2A 2R89A 1ZHTA 5ADXL 3PORA 2X27X 3T0SA 5JDPA 2J1NA 2K0LA 2WVPA 2ERVA 4B61A 4AFKA 2AXTO 2MHLA 2R4LA 2XG6A 3AAAB 4FUVA 4O3XB 4O4UA 3DWNA 1BXWA 3BRYA 4N75A 2F1VA 4Z3TA 2GE4A 5AFUK 2N2LA 3BRZA 2J4UP 2K4TA 4RLCA 1YS5A 3JTYA 4JFBA 4AYDC 2WJQA 3AAEA 3HWBA 2PRNA 3LK41 4FSOA 4LSFA 1MM4A 3AA0A 4O3WA 3AA7A 2M06A 1IZNB 4LSIA 4JCHA 1H6S1 2WJRA 1QJPA 2O4VA 5DL6A 3A0HO 3SY7A 3SYSA 3VE2A 3VZUX 2KDYA 3PGUA 3UU2A 3DA4A 4XNLA 2XE3A 4O3ZA 4GHBA 2KZ7B 3SY9A
chains in the Genus database with same CATH topology
5DL7A 1ZHZA 3VY9X 4RLBA 3POQA 2Y0LA 4KRAA 4QQ1A 2Y0HA 2LHFA 2XTQA 4GCQA 2FGQX 2FGRA 3UAQA 3A2SX 4AYNA 4FSPA 1MPFA 1PRNA 2YNKA 4FOZA 4AYEC 3RBHA 3AAEB 1ZHWA 3EMNX 5EE2A 3DA3A 3TZGA 4C69X 4E1SA 3T20A 2M07A 4FRTA 3AA0B 2LFUA 4LSEA 4RJXA 4BUMX 1HXUA 3PRNA 1IZNA 4FZNA 3UPGA 1BH3A 2Y2XA 2MNHA 4AZLA 4FZMA 5ADXK 1GFNA 1QJ8A 2XE5A 2YPVA 3AA6B 2KZ7A 4G76A 2KC0A 2Y0KA 3AA1B 3HOLA 4N58A 5DL5A 2ODJA 2QTKA 3PQSA 3KVDD 4KR4A 4XNKA 1P4TA 4RJWA 4U9CA 4O3YA 2PORA 3QRCA 1GFMA 5T5FA 4FMSA 4GCPA 4FRXA 2ZFGA 4FT6A 5PRNA 4GCSA 2JMMA 3VE1A 4AKRB 1HXXA 1ZHYA 2ZLDA 3VY8X 4D65A 3LK3A 3GP6A 4KR8A 5AFUL 1Q9GA 2KXPA 3WI5A 4F4BA 3PQUA 4FZLA 2F1TA 2XMXA 2Y7SA 3V8UA 5IYUA 3QRAA 4D64A 5FVNA 4GF4A 4D5UA 3AA6A 1THQA 3WI4A 3C5OA 4E1TA 3LK2B 1BT9A 8PRNA 3POXA 1ZHXA 3AA1A 3K19A 3G7GA 2N2MA 3LK42 4FESA 3VZTX 4PUXA 5DL6A 1ORMA 2W81C 5ADXL 2J4UP 2XTRA 2XE1A 1OPFA 1PHOA 1QJ9A 3SZDA 1OSMA 3AAAA 4G75A 3T24A 4AUIA 3FYXA 3NSGA 4RL9A 4N59A 5DL8A 5D5DA 3HW9A 1G90A 3O0EA 4AKRA 5G26A 3POUA 6PRNA 1GFOA 7PRNA 3AA7B 1GFQA 3LK3B 1E54A 1MM5A 2OMFA 4O4XA 2KXPB 4O49A 3SYBA 3SZVA 4AKMA 4AYMC 1GFPA 1HXTA 2W80C 4AYID 3VZWX 5GV0A 4LSHA 2XE2A 1Q9FA 3HOEA 3LK2A 1ZHTA 3PORA 2X27X 3T0SA 5JDPA 2J1NA 2K0LA 2ERVA 4B61A 4AFKA 2MHLA 2XG6A 4FUVA 3AAAB 4O3XB 4O4UA 1BXWA 2F1VA 4Z3TA 2GE4A 5AFUK 2N2LA 2K4TA 4RLCA 1YS5A 3JTYA 4JFBA 4AYDC 3AAEA 3HWBA 2PRNA 3LK41 4FSOA 4LSFA 1MM4A 3AA0A 4O3WA 3AA7A 2M06A 1IZNB 4LSIA 4JCHA 1H6S1 1QJPA 2O4VA 3SYSA 3VZUX 3SY7A 3VE2A 2KDYA 3UU2A 3DA4A 4XNLA 2XE3A 4O3ZA 4GHBA 2KZ7B 3SY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DL7 A;  3VY9 X;  3POQ A;  2Y0L A;  4KRA A;  2Y0H A;  4GCQ A;  2FGQ X;  2FGR A;  3A2S X;  4FSP A;  1MPF A;  1PRN A;  4FOZ A;  4C69 X;  3EMN X;  3T20 A;  4FRT A;  4BUM X;  4LSE A;  4RJX A;  1HXU A;  3PRN A;  3UPG A;  1BH3 A;  2Y2X A;  1GFN A;  2XE5 A;  2Y0K A;  5DL5 A;  2ODJ A;  2QTK A;  4KR4 A;  4RJW A;  2POR A;  1GFM A;  4FMS A;  4GCP A;  4FRX A;  2ZFG A;  4FT6 A;  5PRN A;  4GCS A;  1HXX A;  3VY8 X;  2ZLD A;  4D65 A;  4KR8 A;  3WI5 A;  4D64 A;  5FVN A;  4D5U A;  3WI4 A;  1BT9 A;  8PRN A;  3POX A;  3K19 A;  3VZT X;  5DL6 A;  2J4U P;  2XE1 A;  1OPF A;  1PHO A;  3SZD A;  1OSM A;  3T24 A;  4AUI A;  3FYX A;  3NSG A;  3HW9 A;  3O0E A;  3POU A;  6PRN A;  1GFO A;  7PRN A;  1GFQ A;  1E54 A;  2OMF A;  3SYB A;  3SZV A;  1GFP A;  1HXT A;  3VZW X;  4LSH A;  2XE2 A;  3POR A;  3T0S A;  5JDP A;  2J1N A;  2XG6 A;  2K4T A;  3JTY A;  4JFB A;  3HWB A;  2PRN A;  4FSO A;  4LSF A;  4LSI A;  1H6S 1;  2O4V A;  3SYS A;  3VZU X;  3SY7 A;  3UU2 A;  2XE3 A;  5DL8 A;  3SY9 A; 
#chains in the Genus database with same CATH topology
 5DL7 A;  1ZHZ A;  3VY9 X;  4CTD A;  4RLB A;  3POQ A;  2Y0L A;  4KRA A;  2R88 A;  4QQ1 A;  2Y0H A;  4FQE A;  2LHF A;  2XTQ A;  4GCQ A;  2FGQ X;  2FGR A;  3UAQ A;  4C00 A;  2JQY A;  3A2S X;  4AYN A;  4FSP A;  1MPF A;  1PRN A;  2YNK A;  4FOZ A;  4AYE C;  5B66 O;  3RBH A;  3AAE B;  1ZHW A;  3EMN X;  1T1L A;  3DA3 A;  5EE2 A;  3TZG A;  4C69 X;  4E1S A;  2R4P A;  3T20 A;  2M07 A;  4FRT A;  3AA0 B;  2LFU A;  4LSE A;  4RJX A;  5GTI O;  4BUM X;  1HXU A;  3PRN A;  1IZN A;  4FZN A;  3UPG A;  1BH3 A;  2Y2X A;  2MNH A;  4AZL A;  4FZM A;  5ADX K;  1GFN A;  1QJ8 A;  2XE5 A;  1S5L O;  2YPV A;  3AA6 B;  4PR7 A;  5H2F O;  2KZ7 A;  4G76 A;  2KC0 A;  2X9K A;  3JCU O;  2Y0K A;  4C4V B;  3AA1 B;  3HOL A;  5KAI O;  4N58 A;  3KZI O;  5DL5 A;  2ODJ A;  2QTK A;  3DWO X;  3WU2 O;  3PQS A;  3KVD D;  4KR4 A;  4K3C A;  1P4T A;  4RJW A;  4XNK A;  4U9C A;  3DZM A;  4O3Y A;  2POR A;  3QRC A;  1GFM A;  5T5F A;  4FMS A;  4GCP A;  4FRX A;  2ZFG A;  4FT6 A;  3VZT X;  5PRN A;  4PUX A;  4GCS A;  2JMM A;  3PGR A;  3VE1 A;  5G3A A;  1HXX A;  1ZHY A;  2ZLD A;  3VY8 X;  4AKR B;  4D65 A;  3LK3 A;  3GP6 A;  4KR8 A;  5KAF O;  5AFU L;  5E79 O;  4UB8 O;  1Q9G A;  2KXP A;  3WI5 A;  4F4B A;  3PQU A;  4FZL A;  2F1T A;  2XMX A;  2Y7S A;  3V8U A;  2R4O A;  5IYU A;  3QRA A;  4D64 A;  5FVN A;  4GF4 A;  4D5U A;  2F1C X;  2R4N A;  1THQ A;  3AA6 A;  3NJT A;  3WI4 A;  3C5O A;  4E1T A;  3LK2 B;  1BT9 A;  4C4V A;  8PRN A;  3POX A;  1ZHX A;  2IWV A;  3AA1 A;  2R8A A;  2N2M A;  3G7G A;  3K19 A;  3LK4 2;  3PF1 A;  4FES A;  1ORM A;  1T16 A;  2W81 C;  4K3B A;  2XTR A;  4N74 A;  2XE1 A;  1OPF A;  1PHO A;  1QJ9 A;  4UB6 O;  3SZD A;  2IWW A;  1OSM A;  3AAA A;  4G75 A;  5G38 A;  3T24 A;  4AUI A;  5GTH O;  5TIS O;  3BS0 A;  3FYX A;  3NSG A;  3PGS A;  4RL9 A;  4N59 A;  5DL8 A;  5D5D A;  3HW9 A;  1G90 A;  3O0E A;  4AKR A;  5G26 A;  3POU A;  4IL6 O;  1GFO A;  6PRN A;  3AA7 B;  1GFQ A;  3LK3 B;  7PRN A;  1E54 A;  4PJ0 O;  1MM5 A;  3A0B O;  2OMF A;  4O4X A;  5B5E O;  2KXP B;  4O49 A;  3SYB A;  3SZV A;  4AKM A;  4AYM C;  1GFP A;  1HXT A;  2W80 C;  4AYI D;  3VZW X;  5GV0 A;  4LSH A;  5G39 A;  2XE2 A;  1Q9F A;  3HOE A;  3LK2 A;  2R89 A;  1ZHT A;  5ADX L;  3POR A;  2X27 X;  3T0S A;  5JDP A;  2J1N A;  2K0L A;  2WVP A;  2ERV A;  4B61 A;  4AFK A;  2AXT O;  2MHL A;  2R4L A;  2XG6 A;  3AAA B;  4FUV A;  4O3X B;  4O4U A;  3DWN A;  1BXW A;  3BRY A;  4N75 A;  2F1V A;  4Z3T A;  2GE4 A;  5AFU K;  2N2L A;  3BRZ A;  2J4U P;  2K4T A;  4RLC A;  1YS5 A;  3JTY A;  4JFB A;  4AYD C;  2WJQ A;  3AAE A;  3HWB A;  2PRN A;  3LK4 1;  4FSO A;  4LSF A;  1MM4 A;  3AA0 A;  4O3W A;  3AA7 A;  2M06 A;  1IZN B;  4LSI A;  4JCH A;  1H6S 1;  2WJR A;  1QJP A;  2O4V A;  5DL6 A;  3A0H O;  3SY7 A;  3SYS A;  3VE2 A;  3VZU X;  2KDY A;  3PGU A;  3UU2 A;  3DA4 A;  4XNL A;  2XE3 A;  4O3Z A;  4GHB A;  2KZ7 B;  3SY9 A; 
#chains in the Genus database with same CATH homology
 5DL7 A;  1ZHZ A;  3VY9 X;  4RLB A;  3POQ A;  2Y0L A;  4KRA A;  4QQ1 A;  2Y0H A;  2LHF A;  2XTQ A;  4GCQ A;  2FGQ X;  2FGR A;  3UAQ A;  3A2S X;  4AYN A;  4FSP A;  1MPF A;  1PRN A;  2YNK A;  4FOZ A;  4AYE C;  3RBH A;  3AAE B;  1ZHW A;  3EMN X;  5EE2 A;  3DA3 A;  3TZG A;  4C69 X;  4E1S A;  3T20 A;  2M07 A;  4FRT A;  3AA0 B;  2LFU A;  4LSE A;  4RJX A;  4BUM X;  1HXU A;  3PRN A;  1IZN A;  4FZN A;  3UPG A;  1BH3 A;  2Y2X A;  2MNH A;  4AZL A;  4FZM A;  5ADX K;  1GFN A;  1QJ8 A;  2XE5 A;  2YPV A;  3AA6 B;  2KZ7 A;  4G76 A;  2KC0 A;  2Y0K A;  3AA1 B;  3HOL A;  4N58 A;  5DL5 A;  2ODJ A;  2QTK A;  3PQS A;  3KVD D;  4KR4 A;  4XNK A;  1P4T A;  4RJW A;  4U9C A;  4O3Y A;  2POR A;  3QRC A;  1GFM A;  5T5F A;  4FMS A;  4GCP A;  4FRX A;  2ZFG A;  4FT6 A;  5PRN A;  4GCS A;  2JMM A;  3VE1 A;  4AKR B;  1HXX A;  1ZHY A;  2ZLD A;  3VY8 X;  4D65 A;  3LK3 A;  3GP6 A;  4KR8 A;  5AFU L;  1Q9G A;  2KXP A;  3WI5 A;  4F4B A;  3PQU A;  4FZL A;  2F1T A;  2XMX A;  2Y7S A;  3V8U A;  5IYU A;  3QRA A;  4D64 A;  5FVN A;  4GF4 A;  4D5U A;  3AA6 A;  1THQ A;  3WI4 A;  3C5O A;  4E1T A;  3LK2 B;  1BT9 A;  8PRN A;  3POX A;  1ZHX A;  3AA1 A;  3K19 A;  3G7G A;  2N2M A;  3LK4 2;  4FES A;  3VZT X;  4PUX A;  5DL6 A;  1ORM A;  2W81 C;  5ADX L;  2J4U P;  2XTR A;  2XE1 A;  1OPF A;  1PHO A;  1QJ9 A;  3SZD A;  1OSM A;  3AAA A;  4G75 A;  3T24 A;  4AUI A;  3FYX A;  3NSG A;  4RL9 A;  4N59 A;  5DL8 A;  5D5D A;  3HW9 A;  1G90 A;  3O0E A;  4AKR A;  5G26 A;  3POU A;  6PRN A;  1GFO A;  7PRN A;  3AA7 B;  1GFQ A;  3LK3 B;  1E54 A;  1MM5 A;  2OMF A;  4O4X A;  2KXP B;  4O49 A;  3SYB A;  3SZV A;  4AKM A;  4AYM C;  1GFP A;  1HXT A;  2W80 C;  4AYI D;  3VZW X;  5GV0 A;  4LSH A;  2XE2 A;  1Q9F A;  3HOE A;  3LK2 A;  1ZHT A;  3POR A;  2X27 X;  3T0S A;  5JDP A;  2J1N A;  2K0L A;  2ERV A;  4B61 A;  4AFK A;  2MHL A;  2XG6 A;  4FUV A;  3AAA B;  4O3X B;  4O4U A;  1BXW A;  2F1V A;  4Z3T A;  2GE4 A;  5AFU K;  2N2L A;  2K4T A;  4RLC A;  1YS5 A;  3JTY A;  4JFB A;  4AYD C;  3AAE A;  3HWB A;  2PRN A;  3LK4 1;  4FSO A;  4LSF A;  1MM4 A;  3AA0 A;  4O3W A;  3AA7 A;  2M06 A;  1IZN B;  4LSI A;  4JCH A;  1H6S 1;  1QJP A;  2O4V A;  3SYS A;  3VZU X;  3SY7 A;  3VE2 A;  2KDY A;  3UU2 A;  3DA4 A;  4XNL A;  2XE3 A;  4O3Z A;  4GHB A;  2KZ7 B;  3SY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...