3QRAA

The crystal structure of ail, the attachment invasion locus protein of yersinia pestis
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
157
structure length
152
Chain Sequence
MEGESSISIGYAQSRVKEDGYKLDKNPRGFNLKYRYEFNNDWGVIGSFAQTRRGFEESVLIDGDFKYYSVTAGPVFRINEYVSLYGLLGAGHGKAKFSSFGQSESRSKTSLAYGAGLQFNPHPNFVIDASYEYSKLDDVKVGTWMLGAGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell invasion
molecule keywords Attachment invasion locus protein
publication title Structural Insights into Ail-Mediated Adhesion in Yersinia pestis.
pubmed doi rcsb
source organism Yersinia pestis
total genus 39
structure length 152
sequence length 157
ec nomenclature
pdb deposition date 2011-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 3qraA00
2JMMA 2M07A 1ORMA 2MHLA 2M06A 2N2MA 4RLCA 1P4TA 2GE4A 1QJ8A 2N2LA 2X27X 1QJ9A 1THQA 3QRAA 4PUXA 1G90A 1MM5A 1Q9GA 3G7GA 2LHFA 2MNHA 1Q9FA 2ERVA 1MM4A 3C5OA 3QRCA 2F1TA 1BXWA 1QJPA 3GP6A 2K0LA 2F1VA
chains in the Genus database with same CATH superfamily
2JMMA 2Y7SA 3SZVA 3V8UA 1E54A 4N58A 5EE2A 3VY8X 3WU2O 4FZMA 4K3BA 3WI5A 2M06A 3LK2B 2LFUA 4RLCA 4BUMX 3VZWX 3LK42 4FRTA 5B66O 2GE4A 1OPFA 3AAEB 2OMFA 4O3ZA 3PF1A 2XE1A 4F4BA 4AYNA 3UPGA 3QRAA 3DA4A 5DL6A 3SY9A 4O3WA 3DWNA 1Q9GA 5DL5A 5T5FA 3AA0A 2Y0LA 5DL7A 2R4NA 5GTIO 2Y0KA 1PRNA 3AAAB 5TISO 3POUA 3POQA 3HOEA 4O4UA 5G3AA 4GF4A 4AKMA 1ZHZA 4O3YA 3EMNX 3SYSA 3UAQA 5D5DA 2KDYA 4E1SA 3JCUO 3POXA 2PRNA 5ADXL 2XTRA 2R8AA 2KC0A 2X9KA 3QRCA 5AFUK 3PGSA 3AA7A 2WVPA 4AKRA 2KXPA 3DA3A 4C4VA 4AYEC 3GP6A 1IZNB 4N59A 3AA1A 4PJ0O 3T0SA 4AUIA 2J4UP 5DL8A 4AYMC 3A0HO 4O4XA 5G39A 4FOZA 4C00A 3PRNA 5KAIO 5E79O 4AKRB 2J1NA 4G75A 2MHLA 3HW9A 3FYXA 4LSFA 2N2MA 2QTKA 3AAEA 1H6S1 3VZTX 4FESA 4FZNA 1GFQA 1QJ8A 4D64A 1YS5A 4C69X 1QJ9A 2Y2XA 2XG6A 4FSPA 3HOLA 2ODJA 2R4PA 2KZ7B 1OSMA 4RJXA 3G7GA 4AFKA 2R88A 1GFOA 1HXTA 4D65A 3KVDD 4FQEA 4U9CA 4XNLA 2ERVA 3T20A 4KR8A 2WJQA 3BRZA 3K19A 4Z3TA 1IZNA 2YPVA 5G38A 4AYID 4CTDA 4KRAA 3VZUX 4E1TA 3TZGA 3A0BO 2M07A 3LK3B 1ORMA 5GV0A 3LK2A 2W80C 6PRNA 3LK41 1PHOA 3PGRA 3SYBA 1ZHTA 4RLBA 2PORA 2W81C 5KAFO 2IWWA 3JTYA 2N2LA 2X27X 3KZIO 3SZDA 4KR4A 1THQA 2Y0HA 4O3XB 3VY9X 4PUXA 2ZFGA 3VE2A 4B61A 1G90A 4PR7A 4O49A 3AAAA 2JQYA 2LHFA 3A2SX 2MNHA 2K4TA 3AA6B 1Q9FA 2F1CX 2XE5A 4FT6A 4QQ1A 4UB8O 5FVNA 5AFUL 1MM4A 3DZMA 1ZHXA 3DWOX 4JCHA 4XNKA 2XTQA 2FGRA 4LSIA 3NJTA 4FRXA 3SY7A 5H2FO 8PRNA 2O4VA 4RJWA 2F1TA 1BXWA 2R4OA 1GFNA 5ADXK 2F1VA 3AA1B 4K3CA 4AYDC 7PRNA 3LK3A 1MPFA 4FZLA 2YNKA 4GCPA 3RBHA 5B5EO 3BRYA 2R89A 3PGUA 5G26A 4N74A 3WI4A 2WJRA 4GCSA 1BH3A 3PQUA 1P4TA 4FUVA 1T1LA 3O0EA 4G76A 5GTHO 4FMSA 3BS0A 5IYUA 4D5UA 4RL9A 3T24A 1MM5A 1S5LO 2KZ7A 2XE3A 2R4LA 3AA6A 3AA0B 1ZHWA 1ZHYA 4GCQA 4JFBA 3HWBA 1GFMA 4UB6O 4LSEA 5PRNA 3PORA 3VE1A 2IWVA 3UU2A 2FGQX 5JDPA 1GFPA 2ZLDA 2XE2A 1T16A 2AXTO 2XMXA 3C5OA 4AZLA 4FSOA 1HXXA 4N75A 4LSHA 1QJPA 4GHBA 1HXUA 3AA7B 2K0LA 1BT9A 3PQSA 2KXPB 4C4VB 4IL6O 3NSGA
chains in the Genus database with same CATH topology
2JMMA 2Y7SA 3SZVA 3V8UA 1E54A 4N58A 5EE2A 3VY8X 4FZMA 3WI5A 2M06A 3LK2B 2LFUA 4RLCA 4BUMX 3VZWX 3LK42 4FRTA 2GE4A 1OPFA 2KXPB 3AAEB 2OMFA 4O3ZA 2XE1A 4F4BA 4AYNA 3UPGA 3QRAA 3DA4A 5DL6A 3SY9A 4O3WA 1Q9GA 5DL5A 5T5FA 3AA0A 2Y0LA 5DL7A 5IYUA 2Y0KA 1PRNA 3AAAB 3POUA 3POQA 3HOEA 4O4UA 4GF4A 4AKMA 1ZHZA 4O3YA 3EMNX 3SYSA 3UAQA 5D5DA 2KDYA 4E1SA 3POXA 2PRNA 5ADXL 2XTRA 2KC0A 3QRCA 5AFUK 3AA7A 4AKRA 2KXPA 3DA3A 4AYEC 3GP6A 1IZNB 4N59A 3AA1A 4AUIA 3T0SA 2J4UP 5DL8A 4AYMC 4O4XA 4FOZA 3PRNA 4AKRB 2J1NA 4G75A 2MHLA 3HW9A 3FYXA 4LSFA 2N2MA 2QTKA 3AAEA 1H6S1 3VZTX 4FESA 4FZNA 1GFQA 1QJ8A 4D64A 1YS5A 4C69X 1QJ9A 2Y2XA 4FSPA 3HOLA 2ODJA 2KZ7B 1OSMA 4RJXA 3G7GA 4AFKA 1GFOA 1HXTA 4D65A 3KVDD 4U9CA 4XNLA 2ERVA 3T20A 4KR8A 3K19A 4Z3TA 1IZNA 2YPVA 4AYID 4KRAA 3VZUX 4E1TA 3TZGA 2M07A 3LK3B 1ORMA 5GV0A 3LK2A 2W80C 6PRNA 3LK41 1PHOA 3SYBA 1ZHTA 4RLBA 2PORA 2W81C 3JTYA 2N2LA 2X27X 3SZDA 4KR4A 1THQA 2Y0HA 4O3XB 3VY9X 4PUXA 2ZFGA 3VE2A 4B61A 1G90A 4O49A 3AAAA 2LHFA 3A2SX 2MNHA 2K4TA 3AA6B 1Q9FA 2XE5A 4FT6A 5FVNA 4QQ1A 5AFUL 1MM4A 1ZHXA 4JCHA 4XNKA 2XTQA 2FGRA 4LSIA 4FRXA 3SY7A 8PRNA 2O4VA 4RJWA 2F1TA 1BXWA 1GFNA 5ADXK 2F1VA 3AA1B 4AYDC 7PRNA 3LK3A 1MPFA 4FZLA 2YNKA 4GCPA 3RBHA 5G26A 3WI4A 4GCSA 1BH3A 3PQUA 1P4TA 4FUVA 3O0EA 4G76A 4FMSA 4D5UA 4RL9A 3T24A 1MM5A 2KZ7A 2XE3A 3AA6A 3AA0B 1ZHWA 1ZHYA 4GCQA 4JFBA 3HWBA 1GFMA 5PRNA 4LSEA 3VE1A 3PORA 5JDPA 3UU2A 2FGQX 1GFPA 2ZLDA 2XE2A 2XMXA 3C5OA 4AZLA 4FSOA 1HXXA 4LSHA 1QJPA 4GHBA 1HXUA 3AA7B 2K0LA 1BT9A 3PQSA 2XG6A 3NSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMM A;  2M07 A;  1ORM A;  2MHL A;  2M06 A;  2N2M A;  4RLC A;  1P4T A;  2GE4 A;  1QJ8 A;  2N2L A;  2X27 X;  1QJ9 A;  1THQ A;  3QRA A;  4PUX A;  1G90 A;  1MM5 A;  1Q9G A;  3G7G A;  2LHF A;  2MNH A;  1Q9F A;  2ERV A;  1MM4 A;  3C5O A;  3QRC A;  2F1T A;  1BXW A;  1QJP A;  3GP6 A;  2K0L A;  2F1V A; 
#chains in the Genus database with same CATH topology
 2JMM A;  2Y7S A;  3SZV A;  3V8U A;  1E54 A;  4N58 A;  5EE2 A;  3VY8 X;  3WU2 O;  4FZM A;  4K3B A;  3WI5 A;  2M06 A;  3LK2 B;  2LFU A;  4RLC A;  4BUM X;  3VZW X;  3LK4 2;  4FRT A;  5B66 O;  2GE4 A;  1OPF A;  3AAE B;  2OMF A;  4O3Z A;  3PF1 A;  2XE1 A;  4F4B A;  4AYN A;  3UPG A;  3QRA A;  3DA4 A;  5DL6 A;  3SY9 A;  4O3W A;  3DWN A;  1Q9G A;  5DL5 A;  5T5F A;  3AA0 A;  2Y0L A;  5DL7 A;  2R4N A;  5GTI O;  2Y0K A;  1PRN A;  3AAA B;  5TIS O;  3POU A;  3POQ A;  3HOE A;  4O4U A;  5G3A A;  4GF4 A;  4AKM A;  1ZHZ A;  4O3Y A;  3EMN X;  3SYS A;  3UAQ A;  5D5D A;  2KDY A;  4E1S A;  3JCU O;  3POX A;  2PRN A;  5ADX L;  2XTR A;  2R8A A;  2KC0 A;  2X9K A;  3QRC A;  5AFU K;  3PGS A;  3AA7 A;  2WVP A;  4AKR A;  2KXP A;  3DA3 A;  4C4V A;  4AYE C;  3GP6 A;  1IZN B;  4N59 A;  3AA1 A;  4PJ0 O;  3T0S A;  4AUI A;  2J4U P;  5DL8 A;  4AYM C;  3A0H O;  4O4X A;  5G39 A;  4FOZ A;  4C00 A;  3PRN A;  5KAI O;  5E79 O;  4AKR B;  2J1N A;  4G75 A;  2MHL A;  3HW9 A;  3FYX A;  4LSF A;  2N2M A;  2QTK A;  3AAE A;  1H6S 1;  3VZT X;  4FES A;  4FZN A;  1GFQ A;  1QJ8 A;  4D64 A;  1YS5 A;  4C69 X;  1QJ9 A;  2Y2X A;  2XG6 A;  4FSP A;  3HOL A;  2ODJ A;  2R4P A;  2KZ7 B;  1OSM A;  4RJX A;  3G7G A;  4AFK A;  2R88 A;  1GFO A;  1HXT A;  4D65 A;  3KVD D;  4FQE A;  4U9C A;  4XNL A;  2ERV A;  3T20 A;  4KR8 A;  2WJQ A;  3BRZ A;  3K19 A;  4Z3T A;  1IZN A;  2YPV A;  5G38 A;  4AYI D;  4CTD A;  4KRA A;  3VZU X;  4E1T A;  3TZG A;  3A0B O;  2M07 A;  3LK3 B;  1ORM A;  5GV0 A;  3LK2 A;  2W80 C;  6PRN A;  3LK4 1;  1PHO A;  3PGR A;  3SYB A;  1ZHT A;  4RLB A;  2POR A;  2W81 C;  5KAF O;  2IWW A;  3JTY A;  2N2L A;  2X27 X;  3KZI O;  3SZD A;  4KR4 A;  1THQ A;  2Y0H A;  4O3X B;  3VY9 X;  4PUX A;  2ZFG A;  3VE2 A;  4B61 A;  1G90 A;  4PR7 A;  4O49 A;  3AAA A;  2JQY A;  2LHF A;  3A2S X;  2MNH A;  2K4T A;  3AA6 B;  1Q9F A;  2F1C X;  2XE5 A;  4FT6 A;  4QQ1 A;  4UB8 O;  5FVN A;  5AFU L;  1MM4 A;  3DZM A;  1ZHX A;  3DWO X;  4JCH A;  4XNK A;  2XTQ A;  2FGR A;  4LSI A;  3NJT A;  4FRX A;  3SY7 A;  5H2F O;  8PRN A;  2O4V A;  4RJW A;  2F1T A;  1BXW A;  2R4O A;  1GFN A;  5ADX K;  2F1V A;  3AA1 B;  4K3C A;  4AYD C;  7PRN A;  3LK3 A;  1MPF A;  4FZL A;  2YNK A;  4GCP A;  3RBH A;  5B5E O;  3BRY A;  2R89 A;  3PGU A;  5G26 A;  4N74 A;  3WI4 A;  2WJR A;  4GCS A;  1BH3 A;  3PQU A;  1P4T A;  4FUV A;  1T1L A;  3O0E A;  4G76 A;  5GTH O;  4FMS A;  3BS0 A;  5IYU A;  4D5U A;  4RL9 A;  3T24 A;  1MM5 A;  1S5L O;  2KZ7 A;  2XE3 A;  2R4L A;  3AA6 A;  3AA0 B;  1ZHW A;  1ZHY A;  4GCQ A;  4JFB A;  3HWB A;  1GFM A;  4UB6 O;  4LSE A;  5PRN A;  3POR A;  3VE1 A;  2IWV A;  3UU2 A;  2FGQ X;  5JDP A;  1GFP A;  2ZLD A;  2XE2 A;  1T16 A;  2AXT O;  2XMX A;  3C5O A;  4AZL A;  4FSO A;  1HXX A;  4N75 A;  4LSH A;  1QJP A;  4GHB A;  1HXU A;  3AA7 B;  2K0L A;  1BT9 A;  3PQS A;  2KXP B;  4C4V B;  4IL6 O;  3NSG A; 
#chains in the Genus database with same CATH homology
 2JMM A;  2Y7S A;  3SZV A;  3V8U A;  1E54 A;  4N58 A;  5EE2 A;  3VY8 X;  4FZM A;  3WI5 A;  2M06 A;  3LK2 B;  2LFU A;  4RLC A;  4BUM X;  3VZW X;  3LK4 2;  4FRT A;  2GE4 A;  1OPF A;  2KXP B;  3AAE B;  2OMF A;  4O3Z A;  2XE1 A;  4F4B A;  4AYN A;  3UPG A;  3QRA A;  3DA4 A;  5DL6 A;  3SY9 A;  4O3W A;  1Q9G A;  5DL5 A;  5T5F A;  3AA0 A;  2Y0L A;  5DL7 A;  5IYU A;  2Y0K A;  1PRN A;  3AAA B;  3POU A;  3POQ A;  3HOE A;  4O4U A;  4GF4 A;  4AKM A;  1ZHZ A;  4O3Y A;  3EMN X;  3SYS A;  3UAQ A;  5D5D A;  2KDY A;  4E1S A;  3POX A;  2PRN A;  5ADX L;  2XTR A;  2KC0 A;  3QRC A;  5AFU K;  3AA7 A;  4AKR A;  2KXP A;  3DA3 A;  4AYE C;  3GP6 A;  1IZN B;  4N59 A;  3AA1 A;  4AUI A;  3T0S A;  2J4U P;  5DL8 A;  4AYM C;  4O4X A;  4FOZ A;  3PRN A;  4AKR B;  2J1N A;  4G75 A;  2MHL A;  3HW9 A;  3FYX A;  4LSF A;  2N2M A;  2QTK A;  3AAE A;  1H6S 1;  3VZT X;  4FES A;  4FZN A;  1GFQ A;  1QJ8 A;  4D64 A;  1YS5 A;  4C69 X;  1QJ9 A;  2Y2X A;  4FSP A;  3HOL A;  2ODJ A;  2KZ7 B;  1OSM A;  4RJX A;  3G7G A;  4AFK A;  1GFO A;  1HXT A;  4D65 A;  3KVD D;  4U9C A;  4XNL A;  2ERV A;  3T20 A;  4KR8 A;  3K19 A;  4Z3T A;  1IZN A;  2YPV A;  4AYI D;  4KRA A;  3VZU X;  4E1T A;  3TZG A;  2M07 A;  3LK3 B;  1ORM A;  5GV0 A;  3LK2 A;  2W80 C;  6PRN A;  3LK4 1;  1PHO A;  3SYB A;  1ZHT A;  4RLB A;  2POR A;  2W81 C;  3JTY A;  2N2L A;  2X27 X;  3SZD A;  4KR4 A;  1THQ A;  2Y0H A;  4O3X B;  3VY9 X;  4PUX A;  2ZFG A;  3VE2 A;  4B61 A;  1G90 A;  4O49 A;  3AAA A;  2LHF A;  3A2S X;  2MNH A;  2K4T A;  3AA6 B;  1Q9F A;  2XE5 A;  4FT6 A;  5FVN A;  4QQ1 A;  5AFU L;  1MM4 A;  1ZHX A;  4JCH A;  4XNK A;  2XTQ A;  2FGR A;  4LSI A;  4FRX A;  3SY7 A;  8PRN A;  2O4V A;  4RJW A;  2F1T A;  1BXW A;  1GFN A;  5ADX K;  2F1V A;  3AA1 B;  4AYD C;  7PRN A;  3LK3 A;  1MPF A;  4FZL A;  2YNK A;  4GCP A;  3RBH A;  5G26 A;  3WI4 A;  4GCS A;  1BH3 A;  3PQU A;  1P4T A;  4FUV A;  3O0E A;  4G76 A;  4FMS A;  4D5U A;  4RL9 A;  3T24 A;  1MM5 A;  2KZ7 A;  2XE3 A;  3AA6 A;  3AA0 B;  1ZHW A;  1ZHY A;  4GCQ A;  4JFB A;  3HWB A;  1GFM A;  5PRN A;  4LSE A;  3VE1 A;  3POR A;  5JDP A;  3UU2 A;  2FGQ X;  1GFP A;  2ZLD A;  2XE2 A;  2XMX A;  3C5O A;  4AZL A;  4FSO A;  1HXX A;  4LSH A;  1QJP A;  4GHB A;  1HXU A;  3AA7 B;  2K0L A;  1BT9 A;  3PQS A;  2XG6 A;  3NSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...