3QRAA

The crystal structure of ail, the attachment invasion locus protein of yersinia pestis
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
157
structure length
152
Chain Sequence
MEGESSISIGYAQSRVKEDGYKLDKNPRGFNLKYRYEFNNDWGVIGSFAQTRRGFEESVLIDGDFKYYSVTAGPVFRINEYVSLYGLLGAGHGKAKFSSFGQSESRSKTSLAYGAGLQFNPHPNFVIDASYEYSKLDDVKVGTWMLGAGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Ail-Mediated Adhesion in Yersinia pestis.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Cell invasion
molecule keywords Attachment invasion locus protein
total genus 39
structure length 152
sequence length 157
ec nomenclature
pdb deposition date 2011-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 3qraA00
1P4TA 2MHLA 4PUXA 1BXWA 2X27X 2M06A 2LHFA 1G90A 3GP6A 2F1TA 1ORMA 2N2MA 4RLCA 3C5OA 2F1VA 3QRAA 2JMMA 1MM4A 3G7GA 3QRCA 2M07A 1QJ9A 2ERVA 2N2LA 1QJ8A 2K0LA 1QJPA 2GE4A 2MNHA 1Q9GA 1THQA 1Q9FA 1MM5A
chains in the Genus database with same CATH superfamily
1ZHXA 2Y0KA 4FUVA 3UPGA 5KAFO 3AA6A 2ZFGA 3HWBA 4GF4A 4FT6A 5AFUK 3BS0A 4FZMA 4FESA 3UU2A 5B5EO 4D5UA 3JCUO 2XMXA 4FSPA 4N74A 2XTRA 1BH3A 2YPVA 3KVDD 3V8UA 3VY9X 2KDYA 1ZHTA 6PRNA 5AFUL 2XE5A 3LK3B 1ZHWA 1BT9A 3DZMA 5DL5A 3RBHA 3POQA 3SZVA 1PHOA 1S5LO 1ZHZA 2F1CX 4G76A 2IWWA 3BRZA 3AA1B 4E1TA 2ERVA 1QJPA 5GV0A 1OPFA 3VY8X 2XTQA 3PGUA 1MPFA 5G39A 3VZUX 3DA3A 3HW9A 4N58A 5IYUA 4IL6O 3T0SA 1E54A 3SY9A 3PQUA 1P4TA 3LK3A 3AA7A 4K3CA 3PGSA 1BXWA 2ODJA 5D5DA 2M06A 2ZLDA 3DWOX 4F4BA 2YNKA 3PRNA 4AKRB 4GCPA 4FRTA 3NJTA 4AKRA 4D65A 4Z3TA 5FVNA 1GFQA 4RLCA 4LSFA 2R8AA 1T1LA 4AFKA 2XE3A 2F1VA 2R4PA 4PJ0O 5DL8A 3PGRA 4RL9A 4C4VB 3POUA 2KXPB 4O4XA 2WJRA 3T20A 3G7GA 4XNKA 3A0BO 2KXPA 3AA0A 3TZGA 3NSGA 3FYXA 2GE4A 2O4VA 3AA0B 2WVPA 4O3ZA 2X9KA 3BRYA 4C4VA 3JTYA 1THQA 2X27X 2WJQA 1HXUA 2PRNA 3A2SX 5E79O 3T24A 4UB6O 4AYDC 3VZTX 2K4TA 3PF1A 4LSIA 3LK2B 1OSMA 4LSEA 4N75A 2XE1A 3WI5A 1HXTA 2R89A 2LHFA 2R88A 3GP6A 3K19A 4GHBA 4K3BA 4O49A 4AYID 3PORA 1PRNA 4AKMA 4O4UA 3DWNA 4AYMC 2PORA 3C5OA 2R4OA 5H2FO 3SZDA 3AAAB 4KRAA 5G3AA 1YS5A 3AA6B 4E1SA 5B66O 3LK42 4RLBA 2JMMA 4FMSA 5KAIO 4FZNA 4CTDA 3AA1A 2W80C 2Y2XA 3HOEA 3LK41 3QRCA 4FOZA 1GFPA 4G75A 4U9CA 3O0EA 3PQSA 3VE2A 1QJ8A 4RJXA 2AXTO 2W81C 3HOLA 4AYEC 1IZNA 1GFNA 1T16A 4AUIA 1IZNB 4O3YA 2FGRA 4LSHA 2JQYA 4C00A 3A0HO 4FRXA 2QTKA 2FGQX 1Q9FA 5EE2A 3SYBA 1MM5A 3SY7A 4BUMX 1H6S1 3EMNX 2J1NA 2MHLA 2KC0A 4PUXA 2J4UP 2XE2A 4FZLA 3AA7B 1HXXA 4GCSA 1GFOA 4KR4A 4UB8O 5T5FA 4JCHA 2Y0HA 5DL7A 4D64A 4O3WA 4QQ1A 3SYSA 4XNLA 4AZLA 4C69X 8PRNA 2F1TA 5ADXL 1ORMA 2N2MA 4FQEA 5DL6A 4PR7A 4GCQA 3KZIO 4JFBA 3VE1A 3QRAA 2KZ7B 5JDPA 2IWVA 5TISO 4N59A 1ZHYA 2OMFA 2Y7SA 5G26A 3DA4A 4AYNA 2Y0LA 2M07A 1QJ9A 3WU2O 3AAEB 2R4NA 2K0LA 2N2LA 2MNHA 1GFMA 4FSOA 4KR8A 1Q9GA 2R4LA 4B61A 5G38A 3AAEA 2KZ7A 2XG6A 3UAQA 3WI4A 3POXA 3VZWX 7PRNA 5GTHO 5GTIO 3AAAA 5ADXK 5PRNA 4RJWA 1MM4A 2LFUA 1G90A 4O3XB 3LK2A
chains in the Genus database with same CATH topology
1ZHXA 2Y0KA 4FUVA 3UPGA 3AA6A 2ZFGA 3HWBA 4GF4A 4FT6A 5AFUK 3UU2A 4FZMA 4FESA 4D5UA 2XMXA 4FSPA 2XTRA 1BH3A 2YPVA 3KVDD 3V8UA 3VY9X 2KDYA 1ZHTA 6PRNA 5AFUL 2XE5A 3LK3B 1ZHWA 1BT9A 5DL5A 3RBHA 3POQA 3SZVA 1PHOA 1ZHZA 4G76A 3AA1B 4E1TA 2ERVA 1QJPA 5GV0A 1OPFA 3VY8X 2XTQA 1MPFA 3VZUX 3DA3A 3HW9A 4N58A 5IYUA 3T0SA 1E54A 3SY9A 3PQUA 1P4TA 3LK3A 3AA7A 1BXWA 2ODJA 5D5DA 2M06A 2ZLDA 4F4BA 2YNKA 3PRNA 4AKRB 4GCPA 4FRTA 4Z3TA 4AKRA 5FVNA 1GFQA 4RLCA 4LSFA 4AFKA 4D65A 2XE3A 2F1VA 5DL8A 4RL9A 3POUA 2KXPB 4O4XA 3T20A 3G7GA 4XNKA 3AA0A 2KXPA 3TZGA 3NSGA 3FYXA 2GE4A 2O4VA 3AA0B 4O3ZA 3JTYA 2X27X 1THQA 1HXUA 2PRNA 3A2SX 3T24A 4AYDC 3VZTX 2K4TA 4LSIA 4LSEA 3LK2B 1OSMA 3WI5A 2XE1A 1HXTA 2LHFA 4O49A 3GP6A 3K19A 4GHBA 4AYID 3PORA 1PRNA 4AKMA 4O4UA 4AYMC 2PORA 3C5OA 3SZDA 3AAAB 4KRAA 1YS5A 3AA6B 4E1SA 3LK42 4RLBA 2JMMA 4FMSA 4FZNA 3AA1A 2W80C 2Y2XA 3HOEA 3LK41 3QRCA 4FOZA 1GFPA 4G75A 4U9CA 3O0EA 3PQSA 3VE2A 1QJ8A 4RJXA 2W81C 3HOLA 4AYEC 1IZNA 1GFNA 4AUIA 1IZNB 4O3YA 2FGRA 4LSHA 4FRXA 2QTKA 2FGQX 1Q9FA 5EE2A 3SYBA 1MM5A 3SY7A 4BUMX 1H6S1 3EMNX 2J1NA 2MHLA 2KC0A 4PUXA 2J4UP 2XE2A 4FZLA 3AA7B 1HXXA 4GCSA 1GFOA 4KR4A 5T5FA 4JCHA 2Y0HA 5DL7A 4D64A 4O3WA 4QQ1A 3SYSA 4XNLA 4AZLA 4C69X 8PRNA 2F1TA 5ADXL 1ORMA 2N2MA 5DL6A 4GCQA 4JFBA 3VE1A 3QRAA 2KZ7B 5JDPA 4N59A 1ZHYA 2OMFA 2Y7SA 5G26A 3DA4A 4AYNA 2Y0LA 2M07A 1QJ9A 3AAEB 2N2LA 2K0LA 4FSOA 2MNHA 1GFMA 4KR8A 1Q9GA 4B61A 3UAQA 3AAEA 2KZ7A 2XG6A 7PRNA 3WI4A 3POXA 3VZWX 3AAAA 5ADXK 5PRNA 4RJWA 1MM4A 2LFUA 1G90A 4O3XB 3LK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P4T A;  2MHL A;  4PUX A;  1BXW A;  2X27 X;  2M06 A;  2LHF A;  1G90 A;  3GP6 A;  2F1T A;  1ORM A;  2N2M A;  4RLC A;  3C5O A;  2F1V A;  3QRA A;  2JMM A;  1MM4 A;  3G7G A;  3QRC A;  2M07 A;  1QJ9 A;  2ERV A;  2N2L A;  1QJ8 A;  2K0L A;  1QJP A;  2GE4 A;  2MNH A;  1Q9G A;  1THQ A;  1Q9F A;  1MM5 A; 
#chains in the Genus database with same CATH topology
 1ZHX A;  2Y0K A;  4FUV A;  3UPG A;  5KAF O;  3AA6 A;  2ZFG A;  3HWB A;  4GF4 A;  4FT6 A;  5AFU K;  3BS0 A;  4FZM A;  4FES A;  3UU2 A;  5B5E O;  4D5U A;  3JCU O;  2XMX A;  4FSP A;  4N74 A;  2XTR A;  1BH3 A;  2YPV A;  3KVD D;  3V8U A;  3VY9 X;  2KDY A;  1ZHT A;  6PRN A;  5AFU L;  2XE5 A;  3LK3 B;  1ZHW A;  1BT9 A;  3DZM A;  5DL5 A;  3RBH A;  3POQ A;  3SZV A;  1PHO A;  1S5L O;  1ZHZ A;  2F1C X;  4G76 A;  2IWW A;  3BRZ A;  3AA1 B;  4E1T A;  2ERV A;  1QJP A;  5GV0 A;  1OPF A;  3VY8 X;  2XTQ A;  3PGU A;  1MPF A;  5G39 A;  3VZU X;  3DA3 A;  3HW9 A;  4N58 A;  5IYU A;  4IL6 O;  3T0S A;  1E54 A;  3SY9 A;  3PQU A;  1P4T A;  3LK3 A;  3AA7 A;  4K3C A;  3PGS A;  1BXW A;  2ODJ A;  5D5D A;  2M06 A;  2ZLD A;  3DWO X;  4F4B A;  2YNK A;  3PRN A;  4AKR B;  4GCP A;  4FRT A;  3NJT A;  4AKR A;  4D65 A;  4Z3T A;  5FVN A;  1GFQ A;  4RLC A;  4LSF A;  2R8A A;  1T1L A;  4AFK A;  2XE3 A;  2F1V A;  2R4P A;  4PJ0 O;  5DL8 A;  3PGR A;  4RL9 A;  4C4V B;  3POU A;  2KXP B;  4O4X A;  2WJR A;  3T20 A;  3G7G A;  4XNK A;  3A0B O;  2KXP A;  3AA0 A;  3TZG A;  3NSG A;  3FYX A;  2GE4 A;  2O4V A;  3AA0 B;  2WVP A;  4O3Z A;  2X9K A;  3BRY A;  4C4V A;  3JTY A;  1THQ A;  2X27 X;  2WJQ A;  1HXU A;  2PRN A;  3A2S X;  5E79 O;  3T24 A;  4UB6 O;  4AYD C;  3VZT X;  2K4T A;  3PF1 A;  4LSI A;  3LK2 B;  1OSM A;  4LSE A;  4N75 A;  2XE1 A;  3WI5 A;  1HXT A;  2R89 A;  2LHF A;  2R88 A;  3GP6 A;  3K19 A;  4GHB A;  4K3B A;  4O49 A;  4AYI D;  3POR A;  1PRN A;  4AKM A;  4O4U A;  3DWN A;  4AYM C;  2POR A;  3C5O A;  2R4O A;  5H2F O;  3SZD A;  3AAA B;  4KRA A;  5G3A A;  1YS5 A;  3AA6 B;  4E1S A;  5B66 O;  3LK4 2;  4RLB A;  2JMM A;  4FMS A;  5KAI O;  4FZN A;  4CTD A;  3AA1 A;  2W80 C;  2Y2X A;  3HOE A;  3LK4 1;  3QRC A;  4FOZ A;  1GFP A;  4G75 A;  4U9C A;  3O0E A;  3PQS A;  3VE2 A;  1QJ8 A;  4RJX A;  2AXT O;  2W81 C;  3HOL A;  4AYE C;  1IZN A;  1GFN A;  1T16 A;  4AUI A;  1IZN B;  4O3Y A;  2FGR A;  4LSH A;  2JQY A;  4C00 A;  3A0H O;  4FRX A;  2QTK A;  2FGQ X;  1Q9F A;  5EE2 A;  3SYB A;  1MM5 A;  3SY7 A;  4BUM X;  1H6S 1;  3EMN X;  2J1N A;  2MHL A;  2KC0 A;  4PUX A;  2J4U P;  2XE2 A;  4FZL A;  3AA7 B;  1HXX A;  4GCS A;  1GFO A;  4KR4 A;  4UB8 O;  5T5F A;  4JCH A;  2Y0H A;  5DL7 A;  4D64 A;  4O3W A;  4QQ1 A;  3SYS A;  4XNL A;  4AZL A;  4C69 X;  8PRN A;  2F1T A;  5ADX L;  1ORM A;  2N2M A;  4FQE A;  5DL6 A;  4PR7 A;  4GCQ A;  3KZI O;  4JFB A;  3VE1 A;  3QRA A;  2KZ7 B;  5JDP A;  2IWV A;  5TIS O;  4N59 A;  1ZHY A;  2OMF A;  2Y7S A;  5G26 A;  3DA4 A;  4AYN A;  2Y0L A;  2M07 A;  1QJ9 A;  3WU2 O;  3AAE B;  2R4N A;  2K0L A;  2N2L A;  2MNH A;  1GFM A;  4FSO A;  4KR8 A;  1Q9G A;  2R4L A;  4B61 A;  5G38 A;  3AAE A;  2KZ7 A;  2XG6 A;  3UAQ A;  3WI4 A;  3POX A;  3VZW X;  7PRN A;  5GTH O;  5GTI O;  3AAA A;  5ADX K;  5PRN A;  4RJW A;  1MM4 A;  2LFU A;  1G90 A;  4O3X B;  3LK2 A; 
#chains in the Genus database with same CATH homology
 1ZHX A;  2Y0K A;  4FUV A;  3UPG A;  3AA6 A;  2ZFG A;  3HWB A;  4GF4 A;  4FT6 A;  5AFU K;  3UU2 A;  4FZM A;  4FES A;  4D5U A;  2XMX A;  4FSP A;  2XTR A;  1BH3 A;  2YPV A;  3KVD D;  3V8U A;  3VY9 X;  2KDY A;  1ZHT A;  6PRN A;  5AFU L;  2XE5 A;  3LK3 B;  1ZHW A;  1BT9 A;  5DL5 A;  3RBH A;  3POQ A;  3SZV A;  1PHO A;  1ZHZ A;  4G76 A;  3AA1 B;  4E1T A;  2ERV A;  1QJP A;  5GV0 A;  1OPF A;  3VY8 X;  2XTQ A;  1MPF A;  3VZU X;  3DA3 A;  3HW9 A;  4N58 A;  5IYU A;  3T0S A;  1E54 A;  3SY9 A;  3PQU A;  1P4T A;  3LK3 A;  3AA7 A;  1BXW A;  2ODJ A;  5D5D A;  2M06 A;  2ZLD A;  4F4B A;  2YNK A;  3PRN A;  4AKR B;  4GCP A;  4FRT A;  4Z3T A;  4AKR A;  5FVN A;  1GFQ A;  4RLC A;  4LSF A;  4AFK A;  4D65 A;  2XE3 A;  2F1V A;  5DL8 A;  4RL9 A;  3POU A;  2KXP B;  4O4X A;  3T20 A;  3G7G A;  4XNK A;  3AA0 A;  2KXP A;  3TZG A;  3NSG A;  3FYX A;  2GE4 A;  2O4V A;  3AA0 B;  4O3Z A;  3JTY A;  2X27 X;  1THQ A;  1HXU A;  2PRN A;  3A2S X;  3T24 A;  4AYD C;  3VZT X;  2K4T A;  4LSI A;  4LSE A;  3LK2 B;  1OSM A;  3WI5 A;  2XE1 A;  1HXT A;  2LHF A;  4O49 A;  3GP6 A;  3K19 A;  4GHB A;  4AYI D;  3POR A;  1PRN A;  4AKM A;  4O4U A;  4AYM C;  2POR A;  3C5O A;  3SZD A;  3AAA B;  4KRA A;  1YS5 A;  3AA6 B;  4E1S A;  3LK4 2;  4RLB A;  2JMM A;  4FMS A;  4FZN A;  3AA1 A;  2W80 C;  2Y2X A;  3HOE A;  3LK4 1;  3QRC A;  4FOZ A;  1GFP A;  4G75 A;  4U9C A;  3O0E A;  3PQS A;  3VE2 A;  1QJ8 A;  4RJX A;  2W81 C;  3HOL A;  4AYE C;  1IZN A;  1GFN A;  4AUI A;  1IZN B;  4O3Y A;  2FGR A;  4LSH A;  4FRX A;  2QTK A;  2FGQ X;  1Q9F A;  5EE2 A;  3SYB A;  1MM5 A;  3SY7 A;  4BUM X;  1H6S 1;  3EMN X;  2J1N A;  2MHL A;  2KC0 A;  4PUX A;  2J4U P;  2XE2 A;  4FZL A;  3AA7 B;  1HXX A;  4GCS A;  1GFO A;  4KR4 A;  5T5F A;  4JCH A;  2Y0H A;  5DL7 A;  4D64 A;  4O3W A;  4QQ1 A;  3SYS A;  4XNL A;  4AZL A;  4C69 X;  8PRN A;  2F1T A;  5ADX L;  1ORM A;  2N2M A;  5DL6 A;  4GCQ A;  4JFB A;  3VE1 A;  3QRA A;  2KZ7 B;  5JDP A;  4N59 A;  1ZHY A;  2OMF A;  2Y7S A;  5G26 A;  3DA4 A;  4AYN A;  2Y0L A;  2M07 A;  1QJ9 A;  3AAE B;  2N2L A;  2K0L A;  4FSO A;  2MNH A;  1GFM A;  4KR8 A;  1Q9G A;  4B61 A;  3UAQ A;  3AAE A;  2KZ7 A;  2XG6 A;  7PRN A;  3WI4 A;  3POX A;  3VZW X;  3AAA A;  5ADX K;  5PRN A;  4RJW A;  1MM4 A;  2LFU A;  1G90 A;  4O3X B;  3LK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...