3QRAA

The crystal structure of ail, the attachment invasion locus protein of yersinia pestis
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
157
structure length
152
Chain Sequence
b'MEGESSISIGYAQSRVKEDGYKLDKNPRGFNLKYRYEFNNDWGVIGSFAQTRRGFEESVLIDGDFKYYSVTAGPVFRINEYVSLYGLLGAGHGKAKFSSFGQSESRSKTSLAYGAGLQFNPHPNFVIDASYEYSKLDDVKVGTWMLGAGYRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Attachment invasion locus protein
publication title Structural Insights into Ail-Mediated Adhesion in Yersinia pestis.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Cell invasion
total genus 39
structure length 152
sequence length 157
ec nomenclature
pdb deposition date 2011-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 3qraA00
2JMMA 3GP6A 2MNHA 3C5OA 2N2MA 2X27X 2N2LA 4RLCA 2ERVA 1QJ8A 4PUXA 2K0LA 1MM5A 2F1TA 3QRCA 1P4TA 2F1VA 1BXWA 3G7GA 2GE4A 1MM4A 2MHLA 1ORMA 3QRAA 1QJ9A 2M07A 2M06A 1THQA 1G90A 2LHFA 1QJPA 1Q9FA 1Q9GA
chains in the Genus database with same CATH superfamily
5KAIO 4O3WA 4AYMC 3LK42 2IWVA 1IZNA 3GP6A 3PF1A 1GFOA 3DWOX 3T0SA 3C5OA 2N2MA 3AA1B 3DA4A 4UB6O 2N2LA 4LSIA 3LK2A 2XG6A 1QJ8A 2FGQX 1MM5A 4QQ1A 4AKRA 4AUIA 3BS0A 2XTRA 2YPVA 2FGRA 3VZTX 2J4UP 3PGSA 4D64A 4FZMA 4UB8O 5KAFO 5AFUK 4LSFA 4N59A 5GTHO 3SZVA 2Y7SA 5FVNA 2R89A 7PRNA 4FRTA 4LSHA 3POXA 4G76A 4E1TA 2R4PA 3T20A 1E54A 3HWBA 3PQSA 5DL8A 8PRNA 1QJ9A 3POUA 4AYNA 3TZGA 3UU2A 4F4BA 3A0HO 2J1NA 3SZDA 4FUVA 4BUMX 3VE1A 2KDYA 3AA7A 4JCHA 6PRNA 1G90A 5G38A 1OPFA 4K3BA 5PRNA 5G26A 5G39A 4C00A 4KRAA 2AXTO 1S5LO 2KZ7B 2Y0LA 4PJ0O 4AYDC 3WU2O 4GHBA 2K4TA 3EMNX 5DL5A 3PQUA 1BT9A 2ERVA 3AA1A 4PUXA 4B61A 3VY9X 5T5FA 2Y2XA 5GTIO 5E79O 1GFPA 3V8UA 1H6S1 1GFNA 4GF4A 1ZHWA 1GFMA 2YNKA 5AFUL 3LK3B 1BXWA 4FQEA 2GE4A 1MM4A 3LK41 4C69X 3WI4A 1T16A 2QTKA 3PORA 4O4XA 4FESA 4O3YA 3VZUX 4RL9A 2ODJA 3POQA 4FZNA 4CTDA 1PRNA 4XNLA 4N75A 1HXXA 5G3AA 1OSMA 2LHFA 5EE2A 3WI5A 4K3CA 4N58A 4AYID 2IWWA 3NJTA 4KR8A 3AAEB 3KZIO 1Q9GA 2WJRA 2ZLDA 3AAEA 3HOLA 4FZLA 3VZWX 1MPFA 1ZHXA 3DZMA 1GFQA 2PORA 4RJXA 3AA0B 1YS5A 3AA0A 3T24A 4AFKA 4O4UA 2KZ7A 5B66O 5B5EO 3HW9A 2XMXA 3O0EA 2KXPB 3SYSA 2WJQA 4GCPA 4E1SA 2K0LA 4O3ZA 2O4VA 3AA6B 3PGRA 2W80C 2JQYA 2Y0HA 4O3XB 3HOEA 4D5UA 3JTYA 4FSOA 4AZLA 5ADXK 1P4TA 2W81C 4IL6O 2F1VA 3AAAB 3VE2A 3K19A 2WVPA 2PRNA 2R8AA 3G7GA 3LK3A 4RLBA 3PRNA 2MHLA 3DA3A 5DL7A 1ORMA 3QRAA 2XE3A 1PHOA 2XE5A 3BRZA 2R4LA 3A0BO 2M07A 2M06A 3UAQA 4U9CA 3KVDD 4D65A 2KC0A 3JCUO 1HXUA 4N74A 1QJPA 2R4NA 1Q9FA 2LFUA 5GV0A 1IZNB 2JMMA 5DL6A 3DWNA 4FOZA 2X9KA 3VY8X 1ZHZA 2MNHA 3PGUA 2F1CX 3LK2B 3SY7A 2X27X 2ZFGA 4JFBA 4RLCA 4C4VB 5TISO 4AKMA 3SYBA 4AKRB 4C4VA 5IYUA 4FT6A 2KXPA 2F1TA 3BRYA 4AYEC 3AA6A 2Y0KA 1BH3A 3A2SX 3RBHA 3QRCA 4PR7A 2R88A 1ZHYA 5ADXL 4RJWA 2R4OA 2OMFA 3AAAA 3UPGA 4LSEA 4O49A 3FYXA 4KR4A 5D5DA 1HXTA 1ZHTA 5H2FO 3SY9A 2XE2A 2XE1A 4FMSA 4G75A 4GCSA 4Z3TA 4FSPA 4XNKA 1THQA 3AA7B 1T1LA 2XTQA 3NSGA 4FRXA 4GCQA 5JDPA
chains in the Genus database with same CATH topology
4O3WA 4AYMC 3LK42 1IZNA 3GP6A 1GFOA 3T0SA 3C5OA 2N2MA 3AA1B 3DA4A 2N2LA 4LSIA 3LK2A 2XG6A 1QJ8A 2FGQX 1MM5A 4QQ1A 4AKRA 4AUIA 3VZTX 2XTRA 2YPVA 2FGRA 2J4UP 4D64A 4FZMA 5AFUK 4LSFA 4N59A 3SZVA 2Y7SA 5FVNA 7PRNA 4FRTA 4LSHA 3POXA 4G76A 3T20A 1E54A 3HWBA 3PQSA 5DL8A 8PRNA 1QJ9A 3POUA 4AYNA 3TZGA 3UU2A 4F4BA 2J1NA 3SZDA 4FUVA 4BUMX 3VE1A 2KDYA 3AA7A 4JCHA 6PRNA 1G90A 1OPFA 5PRNA 5G26A 4KRAA 2Y0LA 2KZ7B 4AYDC 4GHBA 2K4TA 3EMNX 5DL5A 3PQUA 1BT9A 2ERVA 3AA1A 4PUXA 4B61A 3VY9X 5T5FA 2Y2XA 1GFPA 3V8UA 1H6S1 1GFNA 4GF4A 1ZHWA 1GFMA 2YNKA 5AFUL 3LK3B 1BXWA 2GE4A 1MM4A 3LK41 4C69X 3WI4A 2QTKA 4O4XA 3PORA 4O3YA 4FESA 3VZUX 4RL9A 2ODJA 3POQA 4FZNA 1PRNA 4XNLA 1HXXA 1OSMA 2LHFA 5EE2A 3WI5A 4N58A 4AYID 4KR8A 3AAEB 4FZLA 1Q9GA 2ZLDA 3AAEA 3HOLA 3VZWX 1MPFA 1ZHXA 4AFKA 1GFQA 2PORA 4RJXA 3AA0B 1YS5A 3AA0A 3T24A 4O4UA 2KZ7A 3HW9A 2XMXA 3O0EA 2KXPB 3SYSA 4GCPA 4E1SA 2K0LA 4O3ZA 2O4VA 3AA6B 2W80C 2Y0HA 4O3XB 3HOEA 4D5UA 3JTYA 4FSOA 4AZLA 5ADXK 1P4TA 2W81C 2F1VA 3AAAB 3VE2A 3K19A 2PRNA 3G7GA 3LK3A 4RLBA 3PRNA 2MHLA 3DA3A 5DL7A 1ORMA 3QRAA 2XE3A 1PHOA 2XE5A 3UAQA 2M07A 2M06A 4U9CA 3KVDD 4D65A 2KC0A 1HXUA 1QJPA 1Q9FA 2LFUA 5GV0A 1IZNB 2JMMA 5DL6A 4FOZA 3VY8X 1ZHZA 2MNHA 3LK2B 3SY7A 2X27X 2ZFGA 4JFBA 4RLCA 4E1TA 5IYUA 4AKMA 3SYBA 4AKRB 4FT6A 2KXPA 2F1TA 4AYEC 3AA6A 2Y0KA 1BH3A 3A2SX 3RBHA 3QRCA 1ZHYA 5ADXL 4RJWA 2OMFA 3AAAA 3UPGA 4LSEA 4O49A 3FYXA 4KR4A 5D5DA 1HXTA 1ZHTA 3SY9A 2XE2A 2XE1A 4FMSA 4G75A 4GCSA 4Z3TA 4FSPA 4XNKA 1THQA 3AA7B 3NSGA 2XTQA 4FRXA 4GCQA 5JDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMM A;  3GP6 A;  2MNH A;  3C5O A;  2N2M A;  2X27 X;  2N2L A;  4RLC A;  2ERV A;  1QJ8 A;  4PUX A;  2K0L A;  1MM5 A;  2F1T A;  3QRC A;  1P4T A;  2F1V A;  1BXW A;  3G7G A;  2GE4 A;  1MM4 A;  2MHL A;  1ORM A;  3QRA A;  1QJ9 A;  2M07 A;  2M06 A;  1THQ A;  1G90 A;  2LHF A;  1QJP A;  1Q9F A;  1Q9G A; 
#chains in the Genus database with same CATH topology
 5KAI O;  4O3W A;  4AYM C;  3LK4 2;  2IWV A;  1IZN A;  3GP6 A;  3PF1 A;  1GFO A;  3DWO X;  3T0S A;  3C5O A;  2N2M A;  3AA1 B;  3DA4 A;  4UB6 O;  2N2L A;  4LSI A;  3LK2 A;  2XG6 A;  1QJ8 A;  2FGQ X;  1MM5 A;  4QQ1 A;  4AKR A;  4AUI A;  3BS0 A;  2XTR A;  2YPV A;  2FGR A;  3VZT X;  2J4U P;  3PGS A;  4D64 A;  4FZM A;  4UB8 O;  5KAF O;  5AFU K;  4LSF A;  4N59 A;  5GTH O;  3SZV A;  2Y7S A;  5FVN A;  2R89 A;  7PRN A;  4FRT A;  4LSH A;  3POX A;  4G76 A;  4E1T A;  2R4P A;  3T20 A;  1E54 A;  3HWB A;  3PQS A;  5DL8 A;  8PRN A;  1QJ9 A;  3POU A;  4AYN A;  3TZG A;  3UU2 A;  4F4B A;  3A0H O;  2J1N A;  3SZD A;  4FUV A;  4BUM X;  3VE1 A;  2KDY A;  3AA7 A;  4JCH A;  6PRN A;  1G90 A;  5G38 A;  1OPF A;  4K3B A;  5PRN A;  5G26 A;  5G39 A;  4C00 A;  4KRA A;  2AXT O;  1S5L O;  2KZ7 B;  2Y0L A;  4PJ0 O;  4AYD C;  3WU2 O;  4GHB A;  2K4T A;  3EMN X;  5DL5 A;  3PQU A;  1BT9 A;  2ERV A;  3AA1 A;  4PUX A;  4B61 A;  3VY9 X;  5T5F A;  2Y2X A;  5GTI O;  5E79 O;  1GFP A;  3V8U A;  1H6S 1;  1GFN A;  4GF4 A;  1ZHW A;  1GFM A;  2YNK A;  5AFU L;  3LK3 B;  1BXW A;  4FQE A;  2GE4 A;  1MM4 A;  3LK4 1;  4C69 X;  3WI4 A;  1T16 A;  2QTK A;  3POR A;  4O4X A;  4FES A;  4O3Y A;  3VZU X;  4RL9 A;  2ODJ A;  3POQ A;  4FZN A;  4CTD A;  1PRN A;  4XNL A;  4N75 A;  1HXX A;  5G3A A;  1OSM A;  2LHF A;  5EE2 A;  3WI5 A;  4K3C A;  4N58 A;  4AYI D;  2IWW A;  3NJT A;  4KR8 A;  3AAE B;  3KZI O;  1Q9G A;  2WJR A;  2ZLD A;  3AAE A;  3HOL A;  4FZL A;  3VZW X;  1MPF A;  1ZHX A;  3DZM A;  1GFQ A;  2POR A;  4RJX A;  3AA0 B;  1YS5 A;  3AA0 A;  3T24 A;  4AFK A;  4O4U A;  2KZ7 A;  5B66 O;  5B5E O;  3HW9 A;  2XMX A;  3O0E A;  2KXP B;  3SYS A;  2WJQ A;  4GCP A;  4E1S A;  2K0L A;  4O3Z A;  2O4V A;  3AA6 B;  3PGR A;  2W80 C;  2JQY A;  2Y0H A;  4O3X B;  3HOE A;  4D5U A;  3JTY A;  4FSO A;  4AZL A;  5ADX K;  1P4T A;  2W81 C;  4IL6 O;  2F1V A;  3AAA B;  3VE2 A;  3K19 A;  2WVP A;  2PRN A;  2R8A A;  3G7G A;  3LK3 A;  4RLB A;  3PRN A;  2MHL A;  3DA3 A;  5DL7 A;  1ORM A;  3QRA A;  2XE3 A;  1PHO A;  2XE5 A;  3BRZ A;  2R4L A;  3A0B O;  2M07 A;  2M06 A;  3UAQ A;  4U9C A;  3KVD D;  4D65 A;  2KC0 A;  3JCU O;  1HXU A;  4N74 A;  1QJP A;  2R4N A;  1Q9F A;  2LFU A;  5GV0 A;  1IZN B;  2JMM A;  5DL6 A;  3DWN A;  4FOZ A;  2X9K A;  3VY8 X;  1ZHZ A;  2MNH A;  3PGU A;  2F1C X;  3LK2 B;  3SY7 A;  2X27 X;  2ZFG A;  4JFB A;  4RLC A;  4C4V B;  5TIS O;  4AKM A;  3SYB A;  4AKR B;  4C4V A;  5IYU A;  4FT6 A;  2KXP A;  2F1T A;  3BRY A;  4AYE C;  3AA6 A;  2Y0K A;  1BH3 A;  3A2S X;  3RBH A;  3QRC A;  4PR7 A;  2R88 A;  1ZHY A;  5ADX L;  4RJW A;  2R4O A;  2OMF A;  3AAA A;  3UPG A;  4LSE A;  4O49 A;  3FYX A;  4KR4 A;  5D5D A;  1HXT A;  1ZHT A;  5H2F O;  3SY9 A;  2XE2 A;  2XE1 A;  4FMS A;  4G75 A;  4GCS A;  4Z3T A;  4FSP A;  4XNK A;  1THQ A;  3AA7 B;  1T1L A;  2XTQ A;  3NSG A;  4FRX A;  4GCQ A;  5JDP A; 
#chains in the Genus database with same CATH homology
 4O3W A;  4AYM C;  3LK4 2;  1IZN A;  3GP6 A;  1GFO A;  3T0S A;  3C5O A;  2N2M A;  3AA1 B;  3DA4 A;  2N2L A;  4LSI A;  3LK2 A;  2XG6 A;  1QJ8 A;  2FGQ X;  1MM5 A;  4QQ1 A;  4AKR A;  4AUI A;  3VZT X;  2XTR A;  2YPV A;  2FGR A;  2J4U P;  4D64 A;  4FZM A;  5AFU K;  4LSF A;  4N59 A;  3SZV A;  2Y7S A;  5FVN A;  7PRN A;  4FRT A;  4LSH A;  3POX A;  4G76 A;  3T20 A;  1E54 A;  3HWB A;  3PQS A;  5DL8 A;  8PRN A;  1QJ9 A;  3POU A;  4AYN A;  3TZG A;  3UU2 A;  4F4B A;  2J1N A;  3SZD A;  4FUV A;  4BUM X;  3VE1 A;  2KDY A;  3AA7 A;  4JCH A;  6PRN A;  1G90 A;  1OPF A;  5PRN A;  5G26 A;  4KRA A;  2Y0L A;  2KZ7 B;  4AYD C;  4GHB A;  2K4T A;  3EMN X;  5DL5 A;  3PQU A;  1BT9 A;  2ERV A;  3AA1 A;  4PUX A;  4B61 A;  3VY9 X;  5T5F A;  2Y2X A;  1GFP A;  3V8U A;  1H6S 1;  1GFN A;  4GF4 A;  1ZHW A;  1GFM A;  2YNK A;  5AFU L;  3LK3 B;  1BXW A;  2GE4 A;  1MM4 A;  3LK4 1;  4C69 X;  3WI4 A;  2QTK A;  4O4X A;  3POR A;  4O3Y A;  4FES A;  3VZU X;  4RL9 A;  2ODJ A;  3POQ A;  4FZN A;  1PRN A;  4XNL A;  1HXX A;  1OSM A;  2LHF A;  5EE2 A;  3WI5 A;  4N58 A;  4AYI D;  4KR8 A;  3AAE B;  4FZL A;  1Q9G A;  2ZLD A;  3AAE A;  3HOL A;  3VZW X;  1MPF A;  1ZHX A;  4AFK A;  1GFQ A;  2POR A;  4RJX A;  3AA0 B;  1YS5 A;  3AA0 A;  3T24 A;  4O4U A;  2KZ7 A;  3HW9 A;  2XMX A;  3O0E A;  2KXP B;  3SYS A;  4GCP A;  4E1S A;  2K0L A;  4O3Z A;  2O4V A;  3AA6 B;  2W80 C;  2Y0H A;  4O3X B;  3HOE A;  4D5U A;  3JTY A;  4FSO A;  4AZL A;  5ADX K;  1P4T A;  2W81 C;  2F1V A;  3AAA B;  3VE2 A;  3K19 A;  2PRN A;  3G7G A;  3LK3 A;  4RLB A;  3PRN A;  2MHL A;  3DA3 A;  5DL7 A;  1ORM A;  3QRA A;  2XE3 A;  1PHO A;  2XE5 A;  3UAQ A;  2M07 A;  2M06 A;  4U9C A;  3KVD D;  4D65 A;  2KC0 A;  1HXU A;  1QJP A;  1Q9F A;  2LFU A;  5GV0 A;  1IZN B;  2JMM A;  5DL6 A;  4FOZ A;  3VY8 X;  1ZHZ A;  2MNH A;  3LK2 B;  3SY7 A;  2X27 X;  2ZFG A;  4JFB A;  4RLC A;  4E1T A;  5IYU A;  4AKM A;  3SYB A;  4AKR B;  4FT6 A;  2KXP A;  2F1T A;  4AYE C;  3AA6 A;  2Y0K A;  1BH3 A;  3A2S X;  3RBH A;  3QRC A;  1ZHY A;  5ADX L;  4RJW A;  2OMF A;  3AAA A;  3UPG A;  4LSE A;  4O49 A;  3FYX A;  4KR4 A;  5D5D A;  1HXT A;  1ZHT A;  3SY9 A;  2XE2 A;  2XE1 A;  4FMS A;  4G75 A;  4GCS A;  4Z3T A;  4FSP A;  4XNK A;  1THQ A;  3AA7 B;  3NSG A;  2XTQ A;  4FRX A;  4GCQ A;  5JDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...