3QRAA

The crystal structure of ail, the attachment invasion locus protein of yersinia pestis
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
157
structure length
152
Chain Sequence
MEGESSISIGYAQSRVKEDGYKLDKNPRGFNLKYRYEFNNDWGVIGSFAQTRRGFEESVLIDGDFKYYSVTAGPVFRINEYVSLYGLLGAGHGKAKFSSFGQSESRSKTSLAYGAGLQFNPHPNFVIDASYEYSKLDDVKVGTWMLGAGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Ail-Mediated Adhesion in Yersinia pestis.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Cell invasion
molecule keywords Attachment invasion locus protein
total genus 39
structure length 152
sequence length 157
ec nomenclature
pdb deposition date 2011-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 3qraA00
2ERVA 1MM5A 3G7GA 2LHFA 4PUXA 3C5OA 3GP6A 1THQA 2N2MA 1BXWA 2N2LA 1G90A 2JMMA 2MNHA 2GE4A 2M06A 1P4TA 1QJ8A 1QJPA 2M07A 2X27X 1Q9GA 1QJ9A 3QRCA 2K0LA 2F1TA 1Q9FA 3QRAA 4RLCA 2F1VA 2MHLA 1ORMA 1MM4A
chains in the Genus database with same CATH superfamily
1MM5A 2R4OA 2LHFA 2WJRA 4FRTA 3LK42 3AAAA 3T24A 3LK2A 3WI4A 2K4TA 5D5DA 4AKRA 2J4UP 3AA0B 1THQA 4FRXA 5GV0A 3BRYA 3LK2B 5G3AA 2N2MA 3NSGA 2R89A 4RJWA 2O4VA 1H6S1 3DZMA 2PORA 2IWWA 3AAEB 2N2LA 4LSEA 1S5LO 3AA6B 4N58A 3LK3B 2KXPB 4AKMA 3PRNA 3O0EA 4LSHA 2Y0HA 3AAEA 2GE4A 3PGUA 4FSOA 4AZLA 4D64A 4O3YA 2M06A 4GCPA 4C69X 1QJPA 2M07A 3POUA 8PRNA 3AA1B 1IZNB 2Y7SA 4O4XA 5DL6A 2JQYA 2KZ7A 2F1CX 3DA3A 4GF4A 3QRAA 3SZVA 3SY9A 5DL7A 6PRNA 4LSIA 2IWVA 2KXPA 1PRNA 1ORMA 1MM4A 2WVPA 3WI5A 3EMNX 2W80C 3SY7A 4PUXA 3PF1A 3SYSA 2PRNA 4IL6O 4O3WA 4FZMA 3SZDA 4E1SA 4F4BA 4UB6O 3AA7A 4FZNA 4FMSA 4KRAA 4AYID 5JDPA 2R4NA 3PGRA 4C4VA 5B66O 1BXWA 5T5FA 3AA7B 4FQEA 2Y0KA 3BS0A 1OPFA 3VE2A 1PHOA 3A0BO 3WU2O 2JMMA 4KR4A 3HW9A 4LSFA 3VY8X 3LK41 3K19A 5GTIO 3TZGA 5G39A 1P4TA 4FUVA 3RBHA 2KDYA 2X27X 2LFUA 4G76A 1Q9GA 4O3ZA 3A2SX 4JFBA 3QRCA 2AXTO 1YS5A 2XG6A 4GHBA 3SYBA 3V8UA 4AFKA 2R4LA 2R8AA 3NJTA 4RLBA 3T0SA 2OMFA 4N74A 4PR7A 3VE1A 4AKRB 1Q9FA 4N75A 2FGQX 3JTYA 2MHLA 2Y2XA 1BT9A 1GFQA 3PGSA 3UPGA 4CTDA 3AA6A 3T20A 3C5OA 4GCSA 1ZHXA 4C4VB 5KAFO 2W81C 3DWNA 5EE2A 4FZLA 2XE3A 3HOEA 3POXA 3AA1A 4FOZA 3PQUA 3DA4A 4GCQA 1HXXA 4RL9A 4PJ0O 1T1LA 3PQSA 2R88A 1HXTA 3KZIO 1OSMA 3PORA 4JCHA 4B61A 5PRNA 5ADXK 4XNKA 3HOLA 3UAQA 1ZHWA 3VY9X 3HWBA 1BH3A 1QJ8A 2Y0LA 1GFPA 2ZLDA 4U9CA 4BUMX 2XE2A 1ZHTA 3A0HO 2XTRA 1ZHZA 4UB8O 3KVDD 4N59A 1T16A 4AYEC 3FYXA 5IYUA 1ZHYA 5AFUK 4FT6A 5DL5A 2XE1A 4D65A 4O3XB 2ERVA 4AYDC 3VZTX 3G7GA 4AYNA 2FGRA 2QTKA 5G38A 5H2FO 2J1NA 1E54A 2KZ7B 4K3CA 2XE5A 3GP6A 3UU2A 1IZNA 4FESA 5AFUL 5ADXL 2XTQA 2YPVA 5FVNA 5KAIO 2KC0A 2ZFGA 5G26A 5TISO 4E1TA 4XNLA 4Z3TA 1G90A 4D5UA 5B5EO 3VZWX 4FSPA 1GFMA 4AUIA 2MNHA 2YNKA 4QQ1A 5GTHO 3LK3A 3DWOX 4K3BA 7PRNA 4O4UA 1GFOA 4C00A 3BRZA 4O49A 2X9KA 1QJ9A 5E79O 4G75A 3AA0A 1MPFA 2K0LA 2XMXA 3JCUO 3POQA 2WJQA 2F1TA 1GFNA 2R4PA 3AAAB 4RLCA 4RJXA 2F1VA 5DL8A 1HXUA 2ODJA 4KR8A 3VZUX 4AYMC
chains in the Genus database with same CATH topology
1MM5A 2LHFA 4FRTA 3LK42 3AAAA 3T24A 3LK2A 3WI4A 2K4TA 5D5DA 4AKRA 2J4UP 3AA0B 1THQA 4FRXA 5GV0A 3LK2B 2N2MA 3NSGA 4RJWA 2O4VA 1H6S1 2PORA 3AAEB 2N2LA 4LSEA 3AA6B 4N58A 3LK3B 2KXPB 4AKMA 3PRNA 3O0EA 4LSHA 2Y0HA 3AAEA 2GE4A 4FSOA 4AZLA 4D64A 4O3YA 2M06A 4GCPA 4C69X 1QJPA 2M07A 3POUA 8PRNA 3AA1B 1IZNB 2Y7SA 4O4XA 5DL6A 3DA3A 2KZ7A 4GF4A 3SZVA 3QRAA 3SY9A 5DL7A 4LSIA 2KXPA 1PRNA 1ORMA 1MM4A 3WI5A 3EMNX 2W80C 3SY7A 4PUXA 3SYSA 2PRNA 4O3WA 3SZDA 4FZMA 4E1SA 4F4BA 3AA7A 4FZNA 4FMSA 4KRAA 4AYID 5JDPA 1BXWA 5T5FA 3AA7B 2Y0KA 1OPFA 3VE2A 1PHOA 2JMMA 4KR4A 3HW9A 4LSFA 3VY8X 3LK41 3K19A 3TZGA 3RBHA 1P4TA 4FUVA 6PRNA 2KDYA 2X27X 2LFUA 4G76A 1Q9GA 4O3ZA 3A2SX 4JFBA 3QRCA 3V8UA 1YS5A 2XG6A 4GHBA 3SYBA 4AFKA 4AKRB 4RLBA 3T0SA 2OMFA 3VE1A 1Q9FA 2FGQX 3JTYA 2MHLA 2Y2XA 1BT9A 1GFQA 3UPGA 3AA6A 3T20A 3C5OA 4GCSA 1ZHXA 2W81C 5EE2A 4FZLA 2XE3A 3HOEA 3POXA 3AA1A 4FOZA 3PQUA 3DA4A 4GCQA 1HXXA 4RL9A 3PQSA 4B61A 3PORA 1HXTA 1OSMA 4JCHA 5PRNA 5ADXK 4XNKA 3HOLA 3UAQA 1ZHWA 3VY9X 3HWBA 1BH3A 2Y0LA 1QJ8A 1GFPA 2ZLDA 4U9CA 4BUMX 2XE2A 1ZHTA 2XTRA 1ZHZA 3KVDD 4N59A 4AYEC 3FYXA 5IYUA 1ZHYA 5AFUK 4FT6A 5DL5A 2XE1A 4D65A 4O3XB 2ERVA 4AYDC 3VZTX 3G7GA 4AYNA 2FGRA 2QTKA 2J1NA 1E54A 2KZ7B 3UU2A 2XE5A 3GP6A 1IZNA 4FESA 5AFUL 5ADXL 2XTQA 2YPVA 5FVNA 2KC0A 2ZFGA 5G26A 4E1TA 4XNLA 4Z3TA 1G90A 4D5UA 3VZWX 4FSPA 1GFMA 4AUIA 2MNHA 2YNKA 4QQ1A 3LK3A 7PRNA 4O4UA 1GFOA 4O49A 1QJ9A 4G75A 3AA0A 1MPFA 2K0LA 2XMXA 3POQA 2F1TA 1GFNA 4RLCA 3AAAB 4RJXA 2F1VA 5DL8A 1HXUA 2ODJA 4KR8A 3VZUX 4AYMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ERV A;  1MM5 A;  3G7G A;  2LHF A;  4PUX A;  3C5O A;  3GP6 A;  1THQ A;  2N2M A;  1BXW A;  2N2L A;  1G90 A;  2JMM A;  2MNH A;  2GE4 A;  2M06 A;  1P4T A;  1QJ8 A;  1QJP A;  2M07 A;  2X27 X;  1Q9G A;  1QJ9 A;  3QRC A;  2K0L A;  2F1T A;  1Q9F A;  3QRA A;  4RLC A;  2F1V A;  2MHL A;  1ORM A;  1MM4 A; 
#chains in the Genus database with same CATH topology
 1MM5 A;  2R4O A;  2LHF A;  2WJR A;  4FRT A;  3LK4 2;  3AAA A;  3T24 A;  3LK2 A;  3WI4 A;  2K4T A;  5D5D A;  4AKR A;  2J4U P;  3AA0 B;  1THQ A;  4FRX A;  5GV0 A;  3BRY A;  3LK2 B;  5G3A A;  2N2M A;  3NSG A;  2R89 A;  4RJW A;  2O4V A;  1H6S 1;  3DZM A;  2POR A;  2IWW A;  3AAE B;  2N2L A;  4LSE A;  1S5L O;  3AA6 B;  4N58 A;  3LK3 B;  2KXP B;  4AKM A;  3PRN A;  3O0E A;  4LSH A;  2Y0H A;  3AAE A;  2GE4 A;  3PGU A;  4FSO A;  4AZL A;  4D64 A;  4O3Y A;  2M06 A;  4GCP A;  4C69 X;  1QJP A;  2M07 A;  3POU A;  8PRN A;  3AA1 B;  1IZN B;  2Y7S A;  4O4X A;  5DL6 A;  2JQY A;  2KZ7 A;  2F1C X;  3DA3 A;  4GF4 A;  3QRA A;  3SZV A;  3SY9 A;  5DL7 A;  6PRN A;  4LSI A;  2IWV A;  2KXP A;  1PRN A;  1ORM A;  1MM4 A;  2WVP A;  3WI5 A;  3EMN X;  2W80 C;  3SY7 A;  4PUX A;  3PF1 A;  3SYS A;  2PRN A;  4IL6 O;  4O3W A;  4FZM A;  3SZD A;  4E1S A;  4F4B A;  4UB6 O;  3AA7 A;  4FZN A;  4FMS A;  4KRA A;  4AYI D;  5JDP A;  2R4N A;  3PGR A;  4C4V A;  5B66 O;  1BXW A;  5T5F A;  3AA7 B;  4FQE A;  2Y0K A;  3BS0 A;  1OPF A;  3VE2 A;  1PHO A;  3A0B O;  3WU2 O;  2JMM A;  4KR4 A;  3HW9 A;  4LSF A;  3VY8 X;  3LK4 1;  3K19 A;  5GTI O;  3TZG A;  5G39 A;  1P4T A;  4FUV A;  3RBH A;  2KDY A;  2X27 X;  2LFU A;  4G76 A;  1Q9G A;  4O3Z A;  3A2S X;  4JFB A;  3QRC A;  2AXT O;  1YS5 A;  2XG6 A;  4GHB A;  3SYB A;  3V8U A;  4AFK A;  2R4L A;  2R8A A;  3NJT A;  4RLB A;  3T0S A;  2OMF A;  4N74 A;  4PR7 A;  3VE1 A;  4AKR B;  1Q9F A;  4N75 A;  2FGQ X;  3JTY A;  2MHL A;  2Y2X A;  1BT9 A;  1GFQ A;  3PGS A;  3UPG A;  4CTD A;  3AA6 A;  3T20 A;  3C5O A;  4GCS A;  1ZHX A;  4C4V B;  5KAF O;  2W81 C;  3DWN A;  5EE2 A;  4FZL A;  2XE3 A;  3HOE A;  3POX A;  3AA1 A;  4FOZ A;  3PQU A;  3DA4 A;  4GCQ A;  1HXX A;  4RL9 A;  4PJ0 O;  1T1L A;  3PQS A;  2R88 A;  1HXT A;  3KZI O;  1OSM A;  3POR A;  4JCH A;  4B61 A;  5PRN A;  5ADX K;  4XNK A;  3HOL A;  3UAQ A;  1ZHW A;  3VY9 X;  3HWB A;  1BH3 A;  1QJ8 A;  2Y0L A;  1GFP A;  2ZLD A;  4U9C A;  4BUM X;  2XE2 A;  1ZHT A;  3A0H O;  2XTR A;  1ZHZ A;  4UB8 O;  3KVD D;  4N59 A;  1T16 A;  4AYE C;  3FYX A;  5IYU A;  1ZHY A;  5AFU K;  4FT6 A;  5DL5 A;  2XE1 A;  4D65 A;  4O3X B;  2ERV A;  4AYD C;  3VZT X;  3G7G A;  4AYN A;  2FGR A;  2QTK A;  5G38 A;  5H2F O;  2J1N A;  1E54 A;  2KZ7 B;  4K3C A;  2XE5 A;  3GP6 A;  3UU2 A;  1IZN A;  4FES A;  5AFU L;  5ADX L;  2XTQ A;  2YPV A;  5FVN A;  5KAI O;  2KC0 A;  2ZFG A;  5G26 A;  5TIS O;  4E1T A;  4XNL A;  4Z3T A;  1G90 A;  4D5U A;  5B5E O;  3VZW X;  4FSP A;  1GFM A;  4AUI A;  2MNH A;  2YNK A;  4QQ1 A;  5GTH O;  3LK3 A;  3DWO X;  4K3B A;  7PRN A;  4O4U A;  1GFO A;  4C00 A;  3BRZ A;  4O49 A;  2X9K A;  1QJ9 A;  5E79 O;  4G75 A;  3AA0 A;  1MPF A;  2K0L A;  2XMX A;  3JCU O;  3POQ A;  2WJQ A;  2F1T A;  1GFN A;  2R4P A;  3AAA B;  4RLC A;  4RJX A;  2F1V A;  5DL8 A;  1HXU A;  2ODJ A;  4KR8 A;  3VZU X;  4AYM C; 
#chains in the Genus database with same CATH homology
 1MM5 A;  2LHF A;  4FRT A;  3LK4 2;  3AAA A;  3T24 A;  3LK2 A;  3WI4 A;  2K4T A;  5D5D A;  4AKR A;  2J4U P;  3AA0 B;  1THQ A;  4FRX A;  5GV0 A;  3LK2 B;  2N2M A;  3NSG A;  4RJW A;  2O4V A;  1H6S 1;  2POR A;  3AAE B;  2N2L A;  4LSE A;  3AA6 B;  4N58 A;  3LK3 B;  2KXP B;  4AKM A;  3PRN A;  3O0E A;  4LSH A;  2Y0H A;  3AAE A;  2GE4 A;  4FSO A;  4AZL A;  4D64 A;  4O3Y A;  2M06 A;  4GCP A;  4C69 X;  1QJP A;  2M07 A;  3POU A;  8PRN A;  3AA1 B;  1IZN B;  2Y7S A;  4O4X A;  5DL6 A;  3DA3 A;  2KZ7 A;  4GF4 A;  3SZV A;  3QRA A;  3SY9 A;  5DL7 A;  4LSI A;  2KXP A;  1PRN A;  1ORM A;  1MM4 A;  3WI5 A;  3EMN X;  2W80 C;  3SY7 A;  4PUX A;  3SYS A;  2PRN A;  4O3W A;  3SZD A;  4FZM A;  4E1S A;  4F4B A;  3AA7 A;  4FZN A;  4FMS A;  4KRA A;  4AYI D;  5JDP A;  1BXW A;  5T5F A;  3AA7 B;  2Y0K A;  1OPF A;  3VE2 A;  1PHO A;  2JMM A;  4KR4 A;  3HW9 A;  4LSF A;  3VY8 X;  3LK4 1;  3K19 A;  3TZG A;  3RBH A;  1P4T A;  4FUV A;  6PRN A;  2KDY A;  2X27 X;  2LFU A;  4G76 A;  1Q9G A;  4O3Z A;  3A2S X;  4JFB A;  3QRC A;  3V8U A;  1YS5 A;  2XG6 A;  4GHB A;  3SYB A;  4AFK A;  4AKR B;  4RLB A;  3T0S A;  2OMF A;  3VE1 A;  1Q9F A;  2FGQ X;  3JTY A;  2MHL A;  2Y2X A;  1BT9 A;  1GFQ A;  3UPG A;  3AA6 A;  3T20 A;  3C5O A;  4GCS A;  1ZHX A;  2W81 C;  5EE2 A;  4FZL A;  2XE3 A;  3HOE A;  3POX A;  3AA1 A;  4FOZ A;  3PQU A;  3DA4 A;  4GCQ A;  1HXX A;  4RL9 A;  3PQS A;  4B61 A;  3POR A;  1HXT A;  1OSM A;  4JCH A;  5PRN A;  5ADX K;  4XNK A;  3HOL A;  3UAQ A;  1ZHW A;  3VY9 X;  3HWB A;  1BH3 A;  2Y0L A;  1QJ8 A;  1GFP A;  2ZLD A;  4U9C A;  4BUM X;  2XE2 A;  1ZHT A;  2XTR A;  1ZHZ A;  3KVD D;  4N59 A;  4AYE C;  3FYX A;  5IYU A;  1ZHY A;  5AFU K;  4FT6 A;  5DL5 A;  2XE1 A;  4D65 A;  4O3X B;  2ERV A;  4AYD C;  3VZT X;  3G7G A;  4AYN A;  2FGR A;  2QTK A;  2J1N A;  1E54 A;  2KZ7 B;  3UU2 A;  2XE5 A;  3GP6 A;  1IZN A;  4FES A;  5AFU L;  5ADX L;  2XTQ A;  2YPV A;  5FVN A;  2KC0 A;  2ZFG A;  5G26 A;  4E1T A;  4XNL A;  4Z3T A;  1G90 A;  4D5U A;  3VZW X;  4FSP A;  1GFM A;  4AUI A;  2MNH A;  2YNK A;  4QQ1 A;  3LK3 A;  7PRN A;  4O4U A;  1GFO A;  4O49 A;  1QJ9 A;  4G75 A;  3AA0 A;  1MPF A;  2K0L A;  2XMX A;  3POQ A;  2F1T A;  1GFN A;  4RLC A;  3AAA B;  4RJX A;  2F1V A;  5DL8 A;  1HXU A;  2ODJ A;  4KR8 A;  3VZU X;  4AYM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...