4LSEA

Ion selectivity of ompf porin soaked in 0.2m nabr
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Outer membrane protein F
publication title A structural study of ion permeation in OmpF porin from anomalous X-ray diffraction and molecular dynamics simulations.
pubmed doi rcsb
source organism Escherichia coli
total genus 102
structure length 340
sequence length 340
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4lseA00
5DL7A 4BUMX 2XE5A 3WI5A 5FVNA 3POQA 1MPFA 2FGQX 2J4UP 6PRNA 4KR4A 1PRNA 1GFNA 3PORA 3VY9X 2QTKA 5DL6A 3PRNA 3O0EA 2XE1A 4C69X 5PRNA 3NSGA 3VY8X 2J1NA 2K4TA 3HWBA 3POXA 7PRNA 4D64A 2Y0HA 4FSOA 3UPGA 2XG6A 4LSHA 5DL8A 3A2SX 1PHOA 4KR8A 2XE3A 2Y2XA 4FOZA 4FMSA 4GCQA 3SYBA 1BH3A 3SY9A 2FGRA 1HXUA 4FT6A 4KRAA 2ODJA 3UU2A 3SYSA 8PRNA 3T24A 4RJXA 3HW9A 1GFQA 2OMFA 4D5UA 3WI4A 2XE2A 4D65A 2PRNA 2Y0KA 4LSFA 3VZUX 3VZWX 3POUA 5DL5A 4LSEA 3T20A 1OPFA 2O4VA 3FYXA 1E54A 1BT9A 2Y0LA 3T0SA 3K19A 4RJWA 3JTYA 3SZVA 3SZDA 1HXTA 2PORA 4LSIA 4FRTA 1GFPA 4FRXA 1GFOA 1HXXA 4GCPA 3EMNX 3SY7A 1OSMA 4GCSA 4FSPA 3VZTX 2ZLDA 1H6S1 1GFMA 4JFBA 4AUIA 2ZFGA 5JDPA
chains in the Genus database with same CATH superfamily
5IYUA 2M06A 4O4XA 1Q9FA 5D5DA 3JCUO 1ZHYA 5DL7A 4AYID 4B61A 4O4UA 2F1TA 2XE5A 4BUMX 4CTDA 2R8AA 3WI5A 3KVDD 4RL9A 5FVNA 3POQA 4FUVA 1MPFA 5TISO 3DWNA 2FGQX 4RLBA 1P4TA 3QRCA 2KZ7B 3A0BO 3DA4A 4PR7A 4XNLA 6PRNA 2J4UP 1QJPA 4FQEA 3AA1A 2R4NA 5EE2A 3VE1A 4KR4A 2KC0A 3AAAA 1PRNA 1GFNA 2MHLA 2N2LA 3HOEA 3PORA 3VY9X 4AKRB 4F4BA 3LK41 5T5FA 3C5OA 2QTKA 3G7GA 4AZLA 2R4OA 3VE2A 4K3BA 5DL6A 3LK3B 3PRNA 3O0EA 2XE1A 2JMMA 4C69X 1G90A 3V8UA 4XNKA 5PRNA 5GV0A 5G38A 3NSGA 3VY8X 4AYNA 3KZIO 3AA7A 2J1NA 3PGUA 4N74A 2K4TA 4UB8O 3HWBA 3POXA 2Y7SA 4O49A 4G75A 4D64A 2X9KA 2WJRA 2Y0HA 4FSOA 4E1SA 5B66O 4PUXA 3UPGA 2XG6A 4LSHA 1T1LA 5DL8A 3A2SX 4N59A 2XTQA 3AA1B 5KAIO 2W80C 1T16A 3LK2A 1PHOA 2KDYA 3AAAB 3AAEA 2N2MA 1THQA 2M07A 2XE3A 4K3CA 4KR8A 5H2FO 2Y2XA 2WVPA 4FOZA 4AKMA 4FMSA 4GCQA 2IWVA 2LFUA 2F1VA 3SYBA 3DA3A 1BH3A 1S5LO 2KXPA 4FZMA 5ADXL 3QRAA 3SY9A 2FGRA 4AYMC 1HXUA 2AXTO 3AA6B 4FT6A 4KRAA 1IZNA 1QJ8A 1MM5A 1YS5A 2ODJA 3BS0A 3UU2A 3SYSA 8PRNA 3T24A 4RJXA 3WU2O 3HW9A 4N58A 4GF4A 2R4PA 1GFQA 2MNHA 2OMFA 3AA0A 3UAQA 4FESA 4C4VA 4D5UA 4Z3TA 5GTHO 3WI4A 2LHFA 4N75A 3BRYA 1Q9GA 2XE2A 3A0HO 4RLCA 2KZ7A 4D65A 2PRNA 3PQSA 2Y0KA 4LSFA 4O3WA 4AFKA 3VZUX 5ADXK 3VZWX 3LK2B 3AAEB 4IL6O 5G26A 3POUA 4AYEC 2IWWA 3GP6A 4QQ1A 4O3YA 3NJTA 4LSEA 3DZMA 5DL5A 5G39A 3TZGA 4AYDC 5KAFO 3T20A 2X27X 1OPFA 3PF1A 4E1TA 5B5EO 2KXPB 4U9CA 2R88A 1QJ9A 2JQYA 2WJQA 2XMXA 2YPVA 7PRNA 5G3AA 1BXWA 2O4VA 1IZNB 2R4LA 3DWOX 1E54A 1BT9A 3FYXA 4FZLA 4PJ0O 4GHBA 2ERVA 4O3XB 2Y0LA 3PGRA 3T0SA 3AA0B 3K19A 1MM4A 4C4VB 4RJWA 2W81C 3JTYA 2F1CX 3AA7B 3SZVA 5AFUK 2R89A 5GTIO 2XTRA 1HXTA 3SZDA 4FZNA 2PORA 2YNKA 4LSIA 4C00A 4FRTA 1GFPA 4FRXA 1GFOA 1HXXA 2K0LA 4G76A 4GCPA 3EMNX 1ZHTA 1ZHWA 3SY7A 1OSMA 4GCSA 1ZHXA 3LK42 4AKRA 3PGSA 3PQUA 3RBHA 5AFUL 1ZHZA 4UB6O 4FSPA 3VZTX 4O3ZA 2ZLDA 1H6S1 4JCHA 2GE4A 1GFMA 1ORMA 3HOLA 4JFBA 2ZFGA 3AA6A 3BRZA 3LK3A 5E79O 4AUIA 5JDPA
chains in the Genus database with same CATH topology
5IYUA 2M06A 4O4XA 1Q9FA 5D5DA 5DL7A 1ZHYA 4AYID 4B61A 4O4UA 2F1TA 2XE5A 4BUMX 3WI5A 3KVDD 4RL9A 5FVNA 3POQA 4FUVA 1MPFA 2FGQX 4RLBA 1P4TA 3QRCA 2KZ7B 3DA4A 4XNLA 6PRNA 2J4UP 1QJPA 3AA1A 5EE2A 3VE1A 4KR4A 2KC0A 3AAAA 1PRNA 1GFNA 2MHLA 2N2LA 3HOEA 3PORA 3VY9X 4AKRB 4F4BA 3LK41 5T5FA 3C5OA 2QTKA 3G7GA 4AZLA 3VE2A 5DL6A 3LK3B 3PRNA 3O0EA 2XE1A 2JMMA 4C69X 1G90A 3V8UA 4XNKA 5PRNA 5GV0A 3NSGA 3VY8X 4AYNA 3AA7A 2J1NA 2K4TA 3HWBA 3POXA 2Y7SA 4O49A 4G75A 4D64A 2Y0HA 7PRNA 4FSOA 4E1SA 4PUXA 3UPGA 2XG6A 4LSHA 5DL8A 3A2SX 4N59A 2XTQA 3AA1B 2W80C 3LK2A 1PHOA 2KDYA 3AAAB 3AAEA 2N2MA 1THQA 2M07A 2XE3A 4KR8A 2Y2XA 4AKMA 4FOZA 4FMSA 4GCQA 2LFUA 2F1VA 3SYBA 3DA3A 1BH3A 2KXPA 4FZMA 5ADXL 3QRAA 3SY9A 2FGRA 4AYMC 1HXUA 3AA6B 4FT6A 4KRAA 1IZNA 1QJ8A 1MM5A 1YS5A 2ODJA 3UU2A 3SYSA 8PRNA 3T24A 4RJXA 3HW9A 4N58A 4GF4A 3AA0A 1GFQA 2MNHA 2OMFA 3UAQA 4FESA 4Z3TA 4D5UA 3WI4A 2LHFA 1Q9GA 2XE2A 4RLCA 4D65A 2KZ7A 2PRNA 3PQSA 2Y0KA 4LSFA 4O3WA 4AFKA 3VZUX 5ADXK 3VZWX 3LK2B 3AAEB 5G26A 3POUA 4AYEC 3GP6A 4QQ1A 4O3YA 5DL5A 4LSEA 3TZGA 4AYDC 3T20A 2X27X 1OPFA 4E1TA 2KXPB 4U9CA 2XMXA 1QJ9A 2YPVA 1BXWA 2O4VA 1IZNB 3FYXA 1E54A 1BT9A 4FZLA 4GHBA 2ERVA 4O3XB 2Y0LA 3T0SA 3AA0B 3K19A 1MM4A 4RJWA 2W81C 3JTYA 3AA7B 3SZVA 5AFUK 3SZDA 2XTRA 1HXTA 4FZNA 2PORA 2YNKA 4LSIA 4FRTA 1GFPA 4FRXA 1GFOA 1HXXA 2K0LA 4G76A 4GCPA 3EMNX 1ZHTA 1ZHWA 3SY7A 1OSMA 4GCSA 1ZHXA 3LK42 4AKRA 3PQUA 3RBHA 5AFUL 1ZHZA 4FSPA 3VZTX 4O3ZA 2ZLDA 1H6S1 4JCHA 2GE4A 1GFMA 1ORMA 3HOLA 4JFBA 2ZFGA 3AA6A 3LK3A 4AUIA 5JDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DL7 A;  4BUM X;  2XE5 A;  3WI5 A;  5FVN A;  3POQ A;  1MPF A;  2FGQ X;  2J4U P;  6PRN A;  4KR4 A;  1PRN A;  1GFN A;  3POR A;  3VY9 X;  2QTK A;  5DL6 A;  3PRN A;  3O0E A;  2XE1 A;  4C69 X;  5PRN A;  3NSG A;  3VY8 X;  2J1N A;  2K4T A;  3HWB A;  3POX A;  7PRN A;  4D64 A;  2Y0H A;  4FSO A;  3UPG A;  2XG6 A;  4LSH A;  5DL8 A;  3A2S X;  1PHO A;  4KR8 A;  2XE3 A;  2Y2X A;  4FOZ A;  4FMS A;  4GCQ A;  3SYB A;  1BH3 A;  3SY9 A;  2FGR A;  1HXU A;  4FT6 A;  4KRA A;  2ODJ A;  3UU2 A;  3SYS A;  8PRN A;  3T24 A;  4RJX A;  3HW9 A;  1GFQ A;  2OMF A;  4D5U A;  3WI4 A;  2XE2 A;  4D65 A;  2PRN A;  2Y0K A;  4LSF A;  3VZU X;  3VZW X;  3POU A;  5DL5 A;  4LSE A;  3T20 A;  1OPF A;  2O4V A;  3FYX A;  1E54 A;  1BT9 A;  2Y0L A;  3T0S A;  3K19 A;  4RJW A;  3JTY A;  3SZV A;  3SZD A;  1HXT A;  2POR A;  4LSI A;  4FRT A;  1GFP A;  4FRX A;  1GFO A;  1HXX A;  4GCP A;  3EMN X;  3SY7 A;  1OSM A;  4GCS A;  4FSP A;  3VZT X;  2ZLD A;  1H6S 1;  1GFM A;  4JFB A;  4AUI A;  2ZFG A;  5JDP A; 
#chains in the Genus database with same CATH topology
 5IYU A;  2M06 A;  4O4X A;  1Q9F A;  5D5D A;  3JCU O;  1ZHY A;  5DL7 A;  4AYI D;  4B61 A;  4O4U A;  2F1T A;  2XE5 A;  4BUM X;  4CTD A;  2R8A A;  3WI5 A;  3KVD D;  4RL9 A;  5FVN A;  3POQ A;  4FUV A;  1MPF A;  5TIS O;  3DWN A;  2FGQ X;  4RLB A;  1P4T A;  3QRC A;  2KZ7 B;  3A0B O;  3DA4 A;  4PR7 A;  4XNL A;  6PRN A;  2J4U P;  1QJP A;  4FQE A;  3AA1 A;  2R4N A;  5EE2 A;  3VE1 A;  4KR4 A;  2KC0 A;  3AAA A;  1PRN A;  1GFN A;  2MHL A;  2N2L A;  3HOE A;  3POR A;  3VY9 X;  4AKR B;  4F4B A;  3LK4 1;  5T5F A;  3C5O A;  2QTK A;  3G7G A;  4AZL A;  2R4O A;  3VE2 A;  4K3B A;  5DL6 A;  3LK3 B;  3PRN A;  3O0E A;  2XE1 A;  2JMM A;  4C69 X;  1G90 A;  3V8U A;  4XNK A;  5PRN A;  5GV0 A;  5G38 A;  3NSG A;  3VY8 X;  4AYN A;  3KZI O;  3AA7 A;  2J1N A;  3PGU A;  4N74 A;  2K4T A;  4UB8 O;  3HWB A;  3POX A;  2Y7S A;  4O49 A;  4G75 A;  4D64 A;  2X9K A;  2WJR A;  2Y0H A;  4FSO A;  4E1S A;  5B66 O;  4PUX A;  3UPG A;  2XG6 A;  4LSH A;  1T1L A;  5DL8 A;  3A2S X;  4N59 A;  2XTQ A;  3AA1 B;  5KAI O;  2W80 C;  1T16 A;  3LK2 A;  1PHO A;  2KDY A;  3AAA B;  3AAE A;  2N2M A;  1THQ A;  2M07 A;  2XE3 A;  4K3C A;  4KR8 A;  5H2F O;  2Y2X A;  2WVP A;  4FOZ A;  4AKM A;  4FMS A;  4GCQ A;  2IWV A;  2LFU A;  2F1V A;  3SYB A;  3DA3 A;  1BH3 A;  1S5L O;  2KXP A;  4FZM A;  5ADX L;  3QRA A;  3SY9 A;  2FGR A;  4AYM C;  1HXU A;  2AXT O;  3AA6 B;  4FT6 A;  4KRA A;  1IZN A;  1QJ8 A;  1MM5 A;  1YS5 A;  2ODJ A;  3BS0 A;  3UU2 A;  3SYS A;  8PRN A;  3T24 A;  4RJX A;  3WU2 O;  3HW9 A;  4N58 A;  4GF4 A;  2R4P A;  1GFQ A;  2MNH A;  2OMF A;  3AA0 A;  3UAQ A;  4FES A;  4C4V A;  4D5U A;  4Z3T A;  5GTH O;  3WI4 A;  2LHF A;  4N75 A;  3BRY A;  1Q9G A;  2XE2 A;  3A0H O;  4RLC A;  2KZ7 A;  4D65 A;  2PRN A;  3PQS A;  2Y0K A;  4LSF A;  4O3W A;  4AFK A;  3VZU X;  5ADX K;  3VZW X;  3LK2 B;  3AAE B;  4IL6 O;  5G26 A;  3POU A;  4AYE C;  2IWW A;  3GP6 A;  4QQ1 A;  4O3Y A;  3NJT A;  4LSE A;  3DZM A;  5DL5 A;  5G39 A;  3TZG A;  4AYD C;  5KAF O;  3T20 A;  2X27 X;  1OPF A;  3PF1 A;  4E1T A;  5B5E O;  2KXP B;  4U9C A;  2R88 A;  1QJ9 A;  2JQY A;  2WJQ A;  2XMX A;  2YPV A;  7PRN A;  5G3A A;  1BXW A;  2O4V A;  1IZN B;  2R4L A;  3DWO X;  1E54 A;  1BT9 A;  3FYX A;  4FZL A;  4PJ0 O;  4GHB A;  2ERV A;  4O3X B;  2Y0L A;  3PGR A;  3T0S A;  3AA0 B;  3K19 A;  1MM4 A;  4C4V B;  4RJW A;  2W81 C;  3JTY A;  2F1C X;  3AA7 B;  3SZV A;  5AFU K;  2R89 A;  5GTI O;  2XTR A;  1HXT A;  3SZD A;  4FZN A;  2POR A;  2YNK A;  4LSI A;  4C00 A;  4FRT A;  1GFP A;  4FRX A;  1GFO A;  1HXX A;  2K0L A;  4G76 A;  4GCP A;  3EMN X;  1ZHT A;  1ZHW A;  3SY7 A;  1OSM A;  4GCS A;  1ZHX A;  3LK4 2;  4AKR A;  3PGS A;  3PQU A;  3RBH A;  5AFU L;  1ZHZ A;  4UB6 O;  4FSP A;  3VZT X;  4O3Z A;  2ZLD A;  1H6S 1;  4JCH A;  2GE4 A;  1GFM A;  1ORM A;  3HOL A;  4JFB A;  2ZFG A;  3AA6 A;  3BRZ A;  3LK3 A;  5E79 O;  4AUI A;  5JDP A; 
#chains in the Genus database with same CATH homology
 5IYU A;  2M06 A;  4O4X A;  1Q9F A;  5D5D A;  5DL7 A;  1ZHY A;  4AYI D;  4B61 A;  4O4U A;  2F1T A;  2XE5 A;  4BUM X;  3WI5 A;  3KVD D;  4RL9 A;  5FVN A;  3POQ A;  4FUV A;  1MPF A;  2FGQ X;  4RLB A;  1P4T A;  3QRC A;  2KZ7 B;  3DA4 A;  4XNL A;  6PRN A;  2J4U P;  1QJP A;  3AA1 A;  5EE2 A;  3VE1 A;  4KR4 A;  2KC0 A;  3AAA A;  1PRN A;  1GFN A;  2MHL A;  2N2L A;  3HOE A;  3POR A;  3VY9 X;  4AKR B;  4F4B A;  3LK4 1;  5T5F A;  3C5O A;  2QTK A;  3G7G A;  4AZL A;  3VE2 A;  5DL6 A;  3LK3 B;  3PRN A;  3O0E A;  2XE1 A;  2JMM A;  4C69 X;  1G90 A;  3V8U A;  4XNK A;  5PRN A;  5GV0 A;  3NSG A;  3VY8 X;  4AYN A;  3AA7 A;  2J1N A;  2K4T A;  3HWB A;  3POX A;  2Y7S A;  4O49 A;  4G75 A;  4D64 A;  2Y0H A;  7PRN A;  4FSO A;  4E1S A;  4PUX A;  3UPG A;  2XG6 A;  4LSH A;  5DL8 A;  3A2S X;  4N59 A;  2XTQ A;  3AA1 B;  2W80 C;  3LK2 A;  1PHO A;  2KDY A;  3AAA B;  3AAE A;  2N2M A;  1THQ A;  2M07 A;  2XE3 A;  4KR8 A;  2Y2X A;  4AKM A;  4FOZ A;  4FMS A;  4GCQ A;  2LFU A;  2F1V A;  3SYB A;  3DA3 A;  1BH3 A;  2KXP A;  4FZM A;  5ADX L;  3QRA A;  3SY9 A;  2FGR A;  4AYM C;  1HXU A;  3AA6 B;  4FT6 A;  4KRA A;  1IZN A;  1QJ8 A;  1MM5 A;  1YS5 A;  2ODJ A;  3UU2 A;  3SYS A;  8PRN A;  3T24 A;  4RJX A;  3HW9 A;  4N58 A;  4GF4 A;  3AA0 A;  1GFQ A;  2MNH A;  2OMF A;  3UAQ A;  4FES A;  4Z3T A;  4D5U A;  3WI4 A;  2LHF A;  1Q9G A;  2XE2 A;  4RLC A;  4D65 A;  2KZ7 A;  2PRN A;  3PQS A;  2Y0K A;  4LSF A;  4O3W A;  4AFK A;  3VZU X;  5ADX K;  3VZW X;  3LK2 B;  3AAE B;  5G26 A;  3POU A;  4AYE C;  3GP6 A;  4QQ1 A;  4O3Y A;  5DL5 A;  4LSE A;  3TZG A;  4AYD C;  3T20 A;  2X27 X;  1OPF A;  4E1T A;  2KXP B;  4U9C A;  2XMX A;  1QJ9 A;  2YPV A;  1BXW A;  2O4V A;  1IZN B;  3FYX A;  1E54 A;  1BT9 A;  4FZL A;  4GHB A;  2ERV A;  4O3X B;  2Y0L A;  3T0S A;  3AA0 B;  3K19 A;  1MM4 A;  4RJW A;  2W81 C;  3JTY A;  3AA7 B;  3SZV A;  5AFU K;  3SZD A;  2XTR A;  1HXT A;  4FZN A;  2POR A;  2YNK A;  4LSI A;  4FRT A;  1GFP A;  4FRX A;  1GFO A;  1HXX A;  2K0L A;  4G76 A;  4GCP A;  3EMN X;  1ZHT A;  1ZHW A;  3SY7 A;  1OSM A;  4GCS A;  1ZHX A;  3LK4 2;  4AKR A;  3PQU A;  3RBH A;  5AFU L;  1ZHZ A;  4FSP A;  3VZT X;  4O3Z A;  2ZLD A;  1H6S 1;  4JCH A;  2GE4 A;  1GFM A;  1ORM A;  3HOL A;  4JFB A;  2ZFG A;  3AA6 A;  3LK3 A;  4AUI A;  5JDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...