4LSEA

Ion selectivity of ompf porin soaked in 0.2m nabr
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein F
publication title A structural study of ion permeation in OmpF porin from anomalous X-ray diffraction and molecular dynamics simulations.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 102
structure length 340
sequence length 340
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4lseA00
3VZUX 2FGQX 3SYBA 3FYXA 5DL5A 1GFNA 5PRNA 3JTYA 5DL6A 3VZTX 4LSHA 5DL8A 4LSIA 2J4UP 1HXUA 3POQA 1PRNA 4KR4A 4C69X 3NSGA 3VY8X 3SZDA 2Y0LA 3HW9A 4RJWA 6PRNA 2OMFA 1GFQA 4FRXA 4GCPA 1HXTA 1H6S1 8PRNA 3VZWX 3WI5A 4GCSA 4LSEA 2XE3A 1OPFA 3PRNA 1E54A 4D64A 3O0EA 3SYSA 1OSMA 1GFPA 3SY9A 4D65A 3EMNX 3UPGA 4AUIA 2XG6A 2QTKA 2Y0HA 5JDPA 1GFOA 4FOZA 2ZLDA 2FGRA 7PRNA 2Y2XA 2O4VA 4KRAA 4LSFA 3K19A 5DL7A 2J1NA 2Y0KA 3SZVA 4FSPA 3T0SA 4FSOA 1PHOA 1GFMA 1BT9A 4BUMX 2XE2A 3POXA 4FRTA 2PRNA 2PORA 1BH3A 3UU2A 3T20A 2ZFGA 3A2SX 3T24A 2ODJA 4JFBA 1HXXA 2K4TA 5FVNA 2XE5A 3VY9X 4D5UA 3PORA 3HWBA 2XE1A 3WI4A 3SY7A 4FMSA 4FT6A 4GCQA 4RJXA 4KR8A 3POUA 1MPFA
chains in the Genus database with same CATH superfamily
3AA0A 3VZUX 1ZHXA 2FGQX 2R88A 5KAFO 3AAAB 3SYBA 1BXWA 3QRAA 4O4UA 3FYXA 5DL5A 1GFNA 5PRNA 3JTYA 5DL6A 3VZTX 3WU2O 3HOEA 4LSHA 2KXPA 4U9CA 2XMXA 4UB8O 5DL8A 1ZHWA 2IWVA 4LSIA 4AKMA 2LFUA 2JMMA 3AA6B 5B66O 3DWNA 3PGUA 2J4UP 4N59A 2XTQA 2YNKA 1HXUA 4FZNA 3POQA 2N2MA 3KVDD 1PRNA 4AKRA 4C4VA 3BS0A 5B5EO 4KR4A 3HOLA 3NSGA 4C69X 1IZNB 3VY8X 5KAIO 3SZDA 2Y0LA 2F1VA 4AYMC 3HW9A 4RJWA 3TZGA 2AXTO 2OMFA 2X9KA 3AAAA 4FESA 4AYID 6PRNA 4O3XB 1QJPA 1GFQA 4RL9A 4FRXA 1MM5A 4GCPA 2R4LA 3UAQA 4Z3TA 1HXTA 1H6S1 5G26A 3DWOX 8PRNA 2M07A 3VZWX 1THQA 4GHBA 1Q9GA 4GCSA 4LSEA 4O3ZA 3WI5A 4C00A 4E1SA 1Q9FA 2XE3A 3AA6A 4FZMA 3LK41 1OPFA 4AYEC 2MNHA 1E54A 3PRNA 2GE4A 2W80C 4O3YA 5AFUK 2ERVA 2Y7SA 2YPVA 1MM4A 1T16A 3DA3A 3GP6A 3LK42 3JCUO 1YS5A 2JQYA 3LK3B 4AZLA 3PQUA 3O0EA 4RLBA 4UB6O 4AYNA 3SYSA 1OSMA 1GFPA 4PJ0O 1IZNA 3SY9A 3EMNX 4D65A 3UPGA 4XNKA 3LK2B 3G7GA 2XTRA 3PF1A 1QJ8A 3BRZA 4FZLA 4PUXA 3A0HO 4AUIA 1ZHTA 4AFKA 2XG6A 2QTKA 2Y0HA 5T5FA 5JDPA 1GFOA 4FOZA 4O4XA 2R4PA 4E1TA 1QJ9A 4CTDA 5GV0A 5H2FO 2K0LA 2ZLDA 4AYDC 2FGRA 5G38A 3VE2A 5ADXL 5GTHO 4FUVA 3QRCA 2Y2XA 2O4VA 2KC0A 7PRNA 4N75A 4KRAA 3AA7B 2MHLA 4LSFA 3VE1A 5ADXK 2KZ7B 5AFUL 3C5OA 3BRYA 4JCHA 4D64A 3K19A 4G75A 5EE2A 1G90A 2LHFA 2F1CX 3NJTA 5DL7A 2J1NA 2W81C 2Y0KA 2WJQA 3LK2A 3SZVA 4N74A 1ZHZA 4N58A 3V8UA 4GF4A 4FSPA 3T0SA 4FSOA 4XNLA 2R89A 1PHOA 3A0BO 1GFMA 4O49A 1BT9A 5IYUA 3KZIO 5GTIO 4BUMX 2WJRA 1ORMA 2XE2A 3POXA 3AA7A 5D5DA 4FRTA 2N2LA 3AA1B 2WVPA 2KZ7A 4F4BA 2PRNA 2R8AA 4K3BA 5G39A 3RBHA 2PORA 1BH3A 4FQEA 3T24A 3UU2A 4QQ1A 3T20A 2KDYA 1T1LA 2ZFGA 3A2SX 2R4OA 2X27X 3AAEB 3PGSA 2ODJA 4JFBA 1HXXA 4G76A 2M06A 3AA0B 2K4TA 3PQSA 5G3AA 1P4TA 3LK3A 4RLCA 5FVNA 2XE5A 3VY9X 4IL6O 4D5UA 1ZHYA 3PORA 3DA4A 5E79O 2KXPB 3HWBA 2XE1A 2R4NA 3WI4A 3DZMA 3SY7A 4PR7A 2F1TA 4FMSA 4FT6A 4GCQA 3AA1A 4RJXA 4K3CA 4AKRB 4C4VB 2IWWA 4KR8A 3PGRA 1S5LO 3POUA 1MPFA 5TISO 3AAEA 4B61A 4O3WA
chains in the Genus database with same CATH topology
3AA0A 3VZUX 1ZHXA 2FGQX 3AAAB 3SYBA 1BXWA 3QRAA 4O4UA 3FYXA 5DL5A 1GFNA 5PRNA 3JTYA 5DL6A 3VZTX 3HOEA 4LSHA 2KXPA 4U9CA 2XMXA 5DL8A 1ZHWA 4LSIA 4AKMA 2LFUA 2JMMA 3AA6B 2J4UP 4N59A 2XTQA 2YNKA 1HXUA 4FZNA 3POQA 2N2MA 3KVDD 1PRNA 4AKRA 4KR4A 3HOLA 3NSGA 4C69X 1IZNB 3VY8X 3SZDA 2Y0LA 2F1VA 4AYMC 3HW9A 4RJWA 3TZGA 4FESA 2OMFA 3AAAA 6PRNA 4AYID 4O3XB 1QJPA 1GFQA 4RL9A 4FRXA 1MM5A 4GCPA 3UAQA 4Z3TA 1HXTA 1H6S1 5G26A 8PRNA 2M07A 3VZWX 1THQA 4GHBA 1Q9GA 4GCSA 4LSEA 4O3ZA 3WI5A 4E1SA 1Q9FA 2XE3A 3AA6A 4FZMA 3LK41 1OPFA 4AYEC 2MNHA 1E54A 3PRNA 2GE4A 2W80C 4O3YA 5AFUK 2ERVA 2Y7SA 2YPVA 1MM4A 3DA3A 3LK42 3GP6A 4D64A 1YS5A 4AZLA 3LK3B 3PQUA 3O0EA 4RLBA 4AYNA 3SYSA 1OSMA 1GFPA 3SY9A 1IZNA 4D65A 3EMNX 3UPGA 4XNKA 3LK2B 3G7GA 2XTRA 1QJ8A 4FZLA 4PUXA 4AUIA 1ZHTA 4AFKA 2XG6A 2QTKA 2Y0HA 5T5FA 5JDPA 1GFOA 4FOZA 4O4XA 4E1TA 1QJ9A 5GV0A 2K0LA 2ZLDA 4AYDC 2FGRA 3VE2A 5ADXL 4FUVA 3QRCA 2Y2XA 2O4VA 2KC0A 7PRNA 4KRAA 3AA7B 2MHLA 4LSFA 3VE1A 5ADXK 2KZ7B 5AFUL 3C5OA 4JCHA 3K19A 4G75A 5EE2A 1G90A 2LHFA 5DL7A 2J1NA 2W81C 2Y0KA 3LK2A 3SZVA 1ZHZA 4N58A 3V8UA 4GF4A 4FSPA 3T0SA 4FSOA 4XNLA 1PHOA 1GFMA 4O49A 1BT9A 5IYUA 4BUMX 1ORMA 2XE2A 3POXA 3AA7A 5D5DA 4FRTA 2N2LA 3AA1B 2KZ7A 4F4BA 2PRNA 3RBHA 2PORA 1BH3A 3UU2A 4QQ1A 3T20A 2KDYA 2ZFGA 3A2SX 3AAEB 2X27X 3T24A 2ODJA 4JFBA 1HXXA 4G76A 2M06A 3AA0B 2K4TA 3PQSA 1P4TA 3LK3A 4RLCA 5FVNA 2XE5A 3VY9X 4D5UA 1ZHYA 3PORA 3DA4A 2KXPB 3HWBA 2XE1A 3WI4A 3SY7A 2F1TA 4FMSA 4FT6A 4GCQA 3AA1A 4RJXA 4AKRB 4KR8A 3POUA 1MPFA 3AAEA 4B61A 4O3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VZU X;  2FGQ X;  3SYB A;  3FYX A;  5DL5 A;  1GFN A;  5PRN A;  3JTY A;  5DL6 A;  3VZT X;  4LSH A;  5DL8 A;  4LSI A;  2J4U P;  1HXU A;  3POQ A;  1PRN A;  4KR4 A;  4C69 X;  3NSG A;  3VY8 X;  3SZD A;  2Y0L A;  3HW9 A;  4RJW A;  6PRN A;  2OMF A;  1GFQ A;  4FRX A;  4GCP A;  1HXT A;  1H6S 1;  8PRN A;  3VZW X;  3WI5 A;  4GCS A;  4LSE A;  2XE3 A;  1OPF A;  3PRN A;  1E54 A;  4D64 A;  3O0E A;  3SYS A;  1OSM A;  1GFP A;  3SY9 A;  4D65 A;  3EMN X;  3UPG A;  4AUI A;  2XG6 A;  2QTK A;  2Y0H A;  5JDP A;  1GFO A;  4FOZ A;  2ZLD A;  2FGR A;  7PRN A;  2Y2X A;  2O4V A;  4KRA A;  4LSF A;  3K19 A;  5DL7 A;  2J1N A;  2Y0K A;  3SZV A;  4FSP A;  3T0S A;  4FSO A;  1PHO A;  1GFM A;  1BT9 A;  4BUM X;  2XE2 A;  3POX A;  4FRT A;  2PRN A;  2POR A;  1BH3 A;  3UU2 A;  3T20 A;  2ZFG A;  3A2S X;  3T24 A;  2ODJ A;  4JFB A;  1HXX A;  2K4T A;  5FVN A;  2XE5 A;  3VY9 X;  4D5U A;  3POR A;  3HWB A;  2XE1 A;  3WI4 A;  3SY7 A;  4FMS A;  4FT6 A;  4GCQ A;  4RJX A;  4KR8 A;  3POU A;  1MPF A; 
#chains in the Genus database with same CATH topology
 3AA0 A;  3VZU X;  1ZHX A;  2FGQ X;  2R88 A;  5KAF O;  3AAA B;  3SYB A;  1BXW A;  3QRA A;  4O4U A;  3FYX A;  5DL5 A;  1GFN A;  5PRN A;  3JTY A;  5DL6 A;  3VZT X;  3WU2 O;  3HOE A;  4LSH A;  2KXP A;  4U9C A;  2XMX A;  4UB8 O;  5DL8 A;  1ZHW A;  2IWV A;  4LSI A;  4AKM A;  2LFU A;  2JMM A;  3AA6 B;  5B66 O;  3DWN A;  3PGU A;  2J4U P;  4N59 A;  2XTQ A;  2YNK A;  1HXU A;  4FZN A;  3POQ A;  2N2M A;  3KVD D;  1PRN A;  4AKR A;  4C4V A;  3BS0 A;  5B5E O;  4KR4 A;  3HOL A;  3NSG A;  4C69 X;  1IZN B;  3VY8 X;  5KAI O;  3SZD A;  2Y0L A;  2F1V A;  4AYM C;  3HW9 A;  4RJW A;  3TZG A;  2AXT O;  2OMF A;  2X9K A;  3AAA A;  4FES A;  4AYI D;  6PRN A;  4O3X B;  1QJP A;  1GFQ A;  4RL9 A;  4FRX A;  1MM5 A;  4GCP A;  2R4L A;  3UAQ A;  4Z3T A;  1HXT A;  1H6S 1;  5G26 A;  3DWO X;  8PRN A;  2M07 A;  3VZW X;  1THQ A;  4GHB A;  1Q9G A;  4GCS A;  4LSE A;  4O3Z A;  3WI5 A;  4C00 A;  4E1S A;  1Q9F A;  2XE3 A;  3AA6 A;  4FZM A;  3LK4 1;  1OPF A;  4AYE C;  2MNH A;  1E54 A;  3PRN A;  2GE4 A;  2W80 C;  4O3Y A;  5AFU K;  2ERV A;  2Y7S A;  2YPV A;  1MM4 A;  1T16 A;  3DA3 A;  3GP6 A;  3LK4 2;  3JCU O;  1YS5 A;  2JQY A;  3LK3 B;  4AZL A;  3PQU A;  3O0E A;  4RLB A;  4UB6 O;  4AYN A;  3SYS A;  1OSM A;  1GFP A;  4PJ0 O;  1IZN A;  3SY9 A;  3EMN X;  4D65 A;  3UPG A;  4XNK A;  3LK2 B;  3G7G A;  2XTR A;  3PF1 A;  1QJ8 A;  3BRZ A;  4FZL A;  4PUX A;  3A0H O;  4AUI A;  1ZHT A;  4AFK A;  2XG6 A;  2QTK A;  2Y0H A;  5T5F A;  5JDP A;  1GFO A;  4FOZ A;  4O4X A;  2R4P A;  4E1T A;  1QJ9 A;  4CTD A;  5GV0 A;  5H2F O;  2K0L A;  2ZLD A;  4AYD C;  2FGR A;  5G38 A;  3VE2 A;  5ADX L;  5GTH O;  4FUV A;  3QRC A;  2Y2X A;  2O4V A;  2KC0 A;  7PRN A;  4N75 A;  4KRA A;  3AA7 B;  2MHL A;  4LSF A;  3VE1 A;  5ADX K;  2KZ7 B;  5AFU L;  3C5O A;  3BRY A;  4JCH A;  4D64 A;  3K19 A;  4G75 A;  5EE2 A;  1G90 A;  2LHF A;  2F1C X;  3NJT A;  5DL7 A;  2J1N A;  2W81 C;  2Y0K A;  2WJQ A;  3LK2 A;  3SZV A;  4N74 A;  1ZHZ A;  4N58 A;  3V8U A;  4GF4 A;  4FSP A;  3T0S A;  4FSO A;  4XNL A;  2R89 A;  1PHO A;  3A0B O;  1GFM A;  4O49 A;  1BT9 A;  5IYU A;  3KZI O;  5GTI O;  4BUM X;  2WJR A;  1ORM A;  2XE2 A;  3POX A;  3AA7 A;  5D5D A;  4FRT A;  2N2L A;  3AA1 B;  2WVP A;  2KZ7 A;  4F4B A;  2PRN A;  2R8A A;  4K3B A;  5G39 A;  3RBH A;  2POR A;  1BH3 A;  4FQE A;  3T24 A;  3UU2 A;  4QQ1 A;  3T20 A;  2KDY A;  1T1L A;  2ZFG A;  3A2S X;  2R4O A;  2X27 X;  3AAE B;  3PGS A;  2ODJ A;  4JFB A;  1HXX A;  4G76 A;  2M06 A;  3AA0 B;  2K4T A;  3PQS A;  5G3A A;  1P4T A;  3LK3 A;  4RLC A;  5FVN A;  2XE5 A;  3VY9 X;  4IL6 O;  4D5U A;  1ZHY A;  3POR A;  3DA4 A;  5E79 O;  2KXP B;  3HWB A;  2XE1 A;  2R4N A;  3WI4 A;  3DZM A;  3SY7 A;  4PR7 A;  2F1T A;  4FMS A;  4FT6 A;  4GCQ A;  3AA1 A;  4RJX A;  4K3C A;  4AKR B;  4C4V B;  2IWW A;  4KR8 A;  3PGR A;  1S5L O;  3POU A;  1MPF A;  5TIS O;  3AAE A;  4B61 A;  4O3W A; 
#chains in the Genus database with same CATH homology
 3AA0 A;  3VZU X;  1ZHX A;  2FGQ X;  3AAA B;  3SYB A;  1BXW A;  3QRA A;  4O4U A;  3FYX A;  5DL5 A;  1GFN A;  5PRN A;  3JTY A;  5DL6 A;  3VZT X;  3HOE A;  4LSH A;  2KXP A;  4U9C A;  2XMX A;  5DL8 A;  1ZHW A;  4LSI A;  4AKM A;  2LFU A;  2JMM A;  3AA6 B;  2J4U P;  4N59 A;  2XTQ A;  2YNK A;  1HXU A;  4FZN A;  3POQ A;  2N2M A;  3KVD D;  1PRN A;  4AKR A;  4KR4 A;  3HOL A;  3NSG A;  4C69 X;  1IZN B;  3VY8 X;  3SZD A;  2Y0L A;  2F1V A;  4AYM C;  3HW9 A;  4RJW A;  3TZG A;  4FES A;  2OMF A;  3AAA A;  6PRN A;  4AYI D;  4O3X B;  1QJP A;  1GFQ A;  4RL9 A;  4FRX A;  1MM5 A;  4GCP A;  3UAQ A;  4Z3T A;  1HXT A;  1H6S 1;  5G26 A;  8PRN A;  2M07 A;  3VZW X;  1THQ A;  4GHB A;  1Q9G A;  4GCS A;  4LSE A;  4O3Z A;  3WI5 A;  4E1S A;  1Q9F A;  2XE3 A;  3AA6 A;  4FZM A;  3LK4 1;  1OPF A;  4AYE C;  2MNH A;  1E54 A;  3PRN A;  2GE4 A;  2W80 C;  4O3Y A;  5AFU K;  2ERV A;  2Y7S A;  2YPV A;  1MM4 A;  3DA3 A;  3LK4 2;  3GP6 A;  4D64 A;  1YS5 A;  4AZL A;  3LK3 B;  3PQU A;  3O0E A;  4RLB A;  4AYN A;  3SYS A;  1OSM A;  1GFP A;  3SY9 A;  1IZN A;  4D65 A;  3EMN X;  3UPG A;  4XNK A;  3LK2 B;  3G7G A;  2XTR A;  1QJ8 A;  4FZL A;  4PUX A;  4AUI A;  1ZHT A;  4AFK A;  2XG6 A;  2QTK A;  2Y0H A;  5T5F A;  5JDP A;  1GFO A;  4FOZ A;  4O4X A;  4E1T A;  1QJ9 A;  5GV0 A;  2K0L A;  2ZLD A;  4AYD C;  2FGR A;  3VE2 A;  5ADX L;  4FUV A;  3QRC A;  2Y2X A;  2O4V A;  2KC0 A;  7PRN A;  4KRA A;  3AA7 B;  2MHL A;  4LSF A;  3VE1 A;  5ADX K;  2KZ7 B;  5AFU L;  3C5O A;  4JCH A;  3K19 A;  4G75 A;  5EE2 A;  1G90 A;  2LHF A;  5DL7 A;  2J1N A;  2W81 C;  2Y0K A;  3LK2 A;  3SZV A;  1ZHZ A;  4N58 A;  3V8U A;  4GF4 A;  4FSP A;  3T0S A;  4FSO A;  4XNL A;  1PHO A;  1GFM A;  4O49 A;  1BT9 A;  5IYU A;  4BUM X;  1ORM A;  2XE2 A;  3POX A;  3AA7 A;  5D5D A;  4FRT A;  2N2L A;  3AA1 B;  2KZ7 A;  4F4B A;  2PRN A;  3RBH A;  2POR A;  1BH3 A;  3UU2 A;  4QQ1 A;  3T20 A;  2KDY A;  2ZFG A;  3A2S X;  3AAE B;  2X27 X;  3T24 A;  2ODJ A;  4JFB A;  1HXX A;  4G76 A;  2M06 A;  3AA0 B;  2K4T A;  3PQS A;  1P4T A;  3LK3 A;  4RLC A;  5FVN A;  2XE5 A;  3VY9 X;  4D5U A;  1ZHY A;  3POR A;  3DA4 A;  2KXP B;  3HWB A;  2XE1 A;  3WI4 A;  3SY7 A;  2F1T A;  4FMS A;  4FT6 A;  4GCQ A;  3AA1 A;  4RJX A;  4AKR B;  4KR8 A;  3POU A;  1MPF A;  3AAE A;  4B61 A;  4O3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...