3C5OA

Crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
152
structure length
149
Chain Sequence
TPTLETKYVFTITARIGDVTSAGEIGTGVRRIIPILGGEVKGEGISGQVLPFGADFQIIRPNELIELEAKYAFETDDGAVVYVENVGIRFGPVELLRKGEPVDPKVIYFRTRPRFETGHPNYQWLMQYLFVGSAARHADRVVIDVHQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0311 protein RPA1785
publication title The Crystal Structure of the Conserved Protein of Unknown Function RPA1785 from Rhodopseudomonas palustris.
rcsb
source organism Rhodopseudomonas palustris
molecule tags Structural genomics, unknown function
total genus 29
structure length 149
sequence length 152
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11578 DUF3237 Protein of unknown function (DUF3237)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 3c5oA00
2M07A 2F1TA 2F1VA 2N2MA 1QJ9A 3GP6A 3C5OA 1G90A 2LHFA 2K0LA 1MM4A 1Q9FA 2JMMA 1MM5A 1ORMA 2N2LA 2MHLA 2MNHA 1QJPA 1P4TA 1Q9GA 4PUXA 1QJ8A 2X27X 4RLCA 2M06A 1BXWA 2ERVA 1THQA 3QRCA 3G7GA 3QRAA 2GE4A
chains in the Genus database with same CATH superfamily
4RJWA 2M07A 3DA3A 2F1TA 4O3WA 4D5UA 4LSIA 4PR7A 2R4NA 4O3YA 1E54A 2K4TA 2XE3A 3AA7A 4AYDC 3AAEA 3DA4A 1QJ9A 3HOLA 3LK41 3C5OA 4FZNA 4AYMC 4Z3TA 3VY9X 4O4XA 1MM4A 3POUA 2KC0A 4FT6A 4GCSA 4QQ1A 1PHOA 1MM5A 1OPFA 4AZLA 3AA7B 3PGSA 5TISO 3AAEB 3SZDA 4UB8O 4AKRA 3UPGA 4RLBA 1ZHXA 3T24A 1ZHTA 3NSGA 4XNKA 2LFUA 2ZLDA 4UB6O 2PORA 1IZNA 4PUXA 4IL6O 1T16A 2YPVA 2W80C 4E1TA 2X27X 4AKRB 2R88A 3BRZA 3PQUA 3SZVA 5E79O 3A0HO 2Y0HA 1IZNB 3QRAA 4FZMA 3VE1A 4FOZA 3POXA 2WVPA 4GHBA 5EE2A 3JCUO 5FVNA 3VZUX 2J4UP 3A0BO 2KXPA 2KZ7B 3AA0A 2FGRA 4C00A 6PRNA 3DWNA 4G75A 4FRTA 2ODJA 4C69X 7PRNA 2W81C 3LK42 4KRAA 2KXPB 3UU2A 3AA0B 2N2LA 3BS0A 3SYSA 4G76A 3RBHA 2MNHA 2Y0KA 4O3ZA 4AUIA 8PRNA 1P4TA 1Q9GA 2KDYA 3HWBA 3KVDD 4BUMX 3AAAA 4XNLA 1BH3A 3POQA 2Y2XA 1ZHYA 1BT9A 4N59A 4AYID 5IYUA 4GCPA 4O4UA 4RL9A 5DL7A 3WU2O 1GFMA 2ERVA 2ZFGA 2XE2A 2XE1A 3DWOX 3QRCA 3AAAB 2GE4A 4D65A 2KZ7A 3LK2A 3NJTA 4K3BA 3EMNX 5ADXL 3TZGA 2XTRA 3PORA 2XMXA 4N75A 3HW9A 2AXTO 3SY9A 3T20A 2F1VA 5JDPA 3LK2B 4JCHA 2F1CX 2JQYA 3KZIO 3GP6A 3PRNA 3SY7A 1H6S1 5AFUL 2IWWA 1G90A 1ZHZA 2K0LA 2LHFA 3AA1A 3PGRA 4FMSA 5G26A 2JMMA 5G3AA 3T0SA 1OSMA 1ORMA 2MHLA 5DL8A 4KR4A 3JTYA 4CTDA 1QJPA 3WI5A 5B5EO 4AYEC 3AA1B 4FSOA 1GFPA 4FQEA 2WJRA 4LSHA 3PGUA 1QJ8A 1YS5A 4KR8A 5KAIO 3UAQA 1GFOA 4RLCA 4B61A 4LSEA 2WJQA 1BXWA 2M06A 2XTQA 4FUVA 1THQA 4GCQA 4E1SA 2R4OA 5GTIO 1S5LO 5ADXK 4N74A 5DL6A 4C4VA 4F4BA 5H2FO 4PJ0O 4RJXA 4JFBA 2X9KA 5G38A 1GFNA 5AFUK 3LK3B 4N58A 3A2SX 3BRYA 4C4VB 2N2MA 1HXTA 1HXXA 2IWVA 4K3CA 1T1LA 3DZMA 3FYXA 2XG6A 2FGQX 2Y7SA 2YNKA 3AA6A 5B66O 1MPFA 1Q9FA 3HOEA 4AKMA 4U9CA 4O49A 4FESA 5GV0A 2O4VA 3PF1A 2PRNA 2XE5A 4FRXA 5G39A 4AYNA 1HXUA 3O0EA 2OMFA 3SYBA 3WI4A 4O3XB 3AA6B 3PQSA 2R4PA 2Y0LA 5DL5A 5GTHO 1ZHWA 2R8AA 4LSFA 3V8UA 4FZLA 1PRNA 3K19A 2R89A 5PRNA 3VE2A 3VY8X 4AFKA 4D64A 5D5DA 4FSPA 2J1NA 5KAFO 3G7GA 1GFQA 5T5FA 3VZWX 3VZTX 3LK3A 4GF4A 2R4LA 2QTKA
chains in the Genus database with same CATH topology
4RJWA 2M07A 3DA3A 2F1TA 4O3WA 4D5UA 4LSIA 4O3YA 1E54A 2K4TA 2XE3A 3AA7A 4AYDC 3AAEA 3DA4A 1QJ9A 3HOLA 3LK41 3C5OA 4FZNA 4AYMC 4Z3TA 3VY9X 4O4XA 1MM4A 3POUA 2KC0A 4FT6A 4GCSA 4QQ1A 1PHOA 1MM5A 1OPFA 4AZLA 3AA7B 3UPGA 3AAEB 3SZDA 4AKRA 4RLBA 1ZHXA 3T24A 1ZHTA 3NSGA 4XNKA 2LFUA 2ZLDA 2PORA 1IZNA 4PUXA 4E1TA 2YPVA 2W80C 2X27X 4AKRB 3PQUA 3SZVA 2Y0HA 1IZNB 3QRAA 4FZMA 3VE1A 4FOZA 3POXA 4GHBA 5FVNA 5EE2A 3VZUX 2J4UP 2KXPA 2KZ7B 3AA0A 2FGRA 6PRNA 4G75A 4FRTA 2ODJA 4C69X 7PRNA 2W81C 3LK42 4KRAA 2KXPB 3UU2A 3AA0B 2N2LA 3SYSA 3RBHA 2MNHA 2Y0KA 4O3ZA 4AUIA 8PRNA 1P4TA 1Q9GA 2KDYA 3HWBA 3KVDD 4BUMX 3AAAA 4XNLA 1BH3A 3POQA 2Y2XA 1ZHYA 1BT9A 4N59A 4AYID 5IYUA 4GCPA 4O4UA 4RL9A 5DL7A 1GFMA 2ERVA 2ZFGA 2XE2A 2XE1A 3QRCA 3AAAB 2GE4A 4D65A 2KZ7A 3LK2A 3EMNX 5ADXL 3TZGA 2XTRA 3PORA 2XMXA 3SY9A 3HW9A 3T20A 2F1VA 5JDPA 3LK2B 4JCHA 3SY7A 3PRNA 5AFUL 3GP6A 1H6S1 1G90A 1ZHZA 2K0LA 2LHFA 3AA1A 4FMSA 5G26A 3T0SA 2JMMA 1OSMA 1ORMA 2MHLA 5DL8A 4KR4A 3JTYA 1QJPA 3WI5A 4AYEC 3AA1B 4FSOA 1GFPA 4LSHA 3UAQA 1QJ8A 1YS5A 4KR8A 1GFOA 4RLCA 4B61A 4LSEA 1BXWA 2M06A 2XTQA 4FUVA 1THQA 4GCQA 4E1SA 5ADXK 5DL6A 4F4BA 4RJXA 4JFBA 1GFNA 5AFUK 3LK3B 4N58A 3A2SX 2N2MA 1HXTA 1HXXA 3FYXA 2XG6A 2FGQX 2Y7SA 2YNKA 3AA6A 1MPFA 1Q9FA 3HOEA 4AKMA 4U9CA 4O49A 4FESA 5GV0A 2O4VA 4FRXA 2PRNA 2XE5A 4AYNA 1HXUA 3O0EA 2OMFA 3SYBA 3WI4A 4O3XB 3AA6B 3PQSA 2Y0LA 5DL5A 1ZHWA 4LSFA 3V8UA 4FZLA 1PRNA 3K19A 5PRNA 3VE2A 3VY8X 4AFKA 4D64A 5D5DA 4FSPA 2J1NA 3G7GA 1GFQA 5T5FA 3VZWX 3VZTX 3LK3A 4GF4A 4G76A 2QTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M07 A;  2F1T A;  2F1V A;  2N2M A;  1QJ9 A;  3GP6 A;  3C5O A;  1G90 A;  2LHF A;  2K0L A;  1MM4 A;  1Q9F A;  2JMM A;  1MM5 A;  1ORM A;  2N2L A;  2MHL A;  2MNH A;  1QJP A;  1P4T A;  1Q9G A;  4PUX A;  1QJ8 A;  2X27 X;  4RLC A;  2M06 A;  1BXW A;  2ERV A;  1THQ A;  3QRC A;  3G7G A;  3QRA A;  2GE4 A; 
#chains in the Genus database with same CATH topology
 4RJW A;  2M07 A;  3DA3 A;  2F1T A;  4O3W A;  4D5U A;  4LSI A;  4PR7 A;  2R4N A;  4O3Y A;  1E54 A;  2K4T A;  2XE3 A;  3AA7 A;  4AYD C;  3AAE A;  3DA4 A;  1QJ9 A;  3HOL A;  3LK4 1;  3C5O A;  4FZN A;  4AYM C;  4Z3T A;  3VY9 X;  4O4X A;  1MM4 A;  3POU A;  2KC0 A;  4FT6 A;  4GCS A;  4QQ1 A;  1PHO A;  1MM5 A;  1OPF A;  4AZL A;  3AA7 B;  3PGS A;  5TIS O;  3AAE B;  3SZD A;  4UB8 O;  4AKR A;  3UPG A;  4RLB A;  1ZHX A;  3T24 A;  1ZHT A;  3NSG A;  4XNK A;  2LFU A;  2ZLD A;  4UB6 O;  2POR A;  1IZN A;  4PUX A;  4IL6 O;  1T16 A;  2YPV A;  2W80 C;  4E1T A;  2X27 X;  4AKR B;  2R88 A;  3BRZ A;  3PQU A;  3SZV A;  5E79 O;  3A0H O;  2Y0H A;  1IZN B;  3QRA A;  4FZM A;  3VE1 A;  4FOZ A;  3POX A;  2WVP A;  4GHB A;  5EE2 A;  3JCU O;  5FVN A;  3VZU X;  2J4U P;  3A0B O;  2KXP A;  2KZ7 B;  3AA0 A;  2FGR A;  4C00 A;  6PRN A;  3DWN A;  4G75 A;  4FRT A;  2ODJ A;  4C69 X;  7PRN A;  2W81 C;  3LK4 2;  4KRA A;  2KXP B;  3UU2 A;  3AA0 B;  2N2L A;  3BS0 A;  3SYS A;  4G76 A;  3RBH A;  2MNH A;  2Y0K A;  4O3Z A;  4AUI A;  8PRN A;  1P4T A;  1Q9G A;  2KDY A;  3HWB A;  3KVD D;  4BUM X;  3AAA A;  4XNL A;  1BH3 A;  3POQ A;  2Y2X A;  1ZHY A;  1BT9 A;  4N59 A;  4AYI D;  5IYU A;  4GCP A;  4O4U A;  4RL9 A;  5DL7 A;  3WU2 O;  1GFM A;  2ERV A;  2ZFG A;  2XE2 A;  2XE1 A;  3DWO X;  3QRC A;  3AAA B;  2GE4 A;  4D65 A;  2KZ7 A;  3LK2 A;  3NJT A;  4K3B A;  3EMN X;  5ADX L;  3TZG A;  2XTR A;  3POR A;  2XMX A;  4N75 A;  3HW9 A;  2AXT O;  3SY9 A;  3T20 A;  2F1V A;  5JDP A;  3LK2 B;  4JCH A;  2F1C X;  2JQY A;  3KZI O;  3GP6 A;  3PRN A;  3SY7 A;  1H6S 1;  5AFU L;  2IWW A;  1G90 A;  1ZHZ A;  2K0L A;  2LHF A;  3AA1 A;  3PGR A;  4FMS A;  5G26 A;  2JMM A;  5G3A A;  3T0S A;  1OSM A;  1ORM A;  2MHL A;  5DL8 A;  4KR4 A;  3JTY A;  4CTD A;  1QJP A;  3WI5 A;  5B5E O;  4AYE C;  3AA1 B;  4FSO A;  1GFP A;  4FQE A;  2WJR A;  4LSH A;  3PGU A;  1QJ8 A;  1YS5 A;  4KR8 A;  5KAI O;  3UAQ A;  1GFO A;  4RLC A;  4B61 A;  4LSE A;  2WJQ A;  1BXW A;  2M06 A;  2XTQ A;  4FUV A;  1THQ A;  4GCQ A;  4E1S A;  2R4O A;  5GTI O;  1S5L O;  5ADX K;  4N74 A;  5DL6 A;  4C4V A;  4F4B A;  5H2F O;  4PJ0 O;  4RJX A;  4JFB A;  2X9K A;  5G38 A;  1GFN A;  5AFU K;  3LK3 B;  4N58 A;  3A2S X;  3BRY A;  4C4V B;  2N2M A;  1HXT A;  1HXX A;  2IWV A;  4K3C A;  1T1L A;  3DZM A;  3FYX A;  2XG6 A;  2FGQ X;  2Y7S A;  2YNK A;  3AA6 A;  5B66 O;  1MPF A;  1Q9F A;  3HOE A;  4AKM A;  4U9C A;  4O49 A;  4FES A;  5GV0 A;  2O4V A;  3PF1 A;  2PRN A;  2XE5 A;  4FRX A;  5G39 A;  4AYN A;  1HXU A;  3O0E A;  2OMF A;  3SYB A;  3WI4 A;  4O3X B;  3AA6 B;  3PQS A;  2R4P A;  2Y0L A;  5DL5 A;  5GTH O;  1ZHW A;  2R8A A;  4LSF A;  3V8U A;  4FZL A;  1PRN A;  3K19 A;  2R89 A;  5PRN A;  3VE2 A;  3VY8 X;  4AFK A;  4D64 A;  5D5D A;  4FSP A;  2J1N A;  5KAF O;  3G7G A;  1GFQ A;  5T5F A;  3VZW X;  3VZT X;  3LK3 A;  4GF4 A;  2R4L A;  2QTK A; 
#chains in the Genus database with same CATH homology
 4RJW A;  2M07 A;  3DA3 A;  2F1T A;  4O3W A;  4D5U A;  4LSI A;  4O3Y A;  1E54 A;  2K4T A;  2XE3 A;  3AA7 A;  4AYD C;  3AAE A;  3DA4 A;  1QJ9 A;  3HOL A;  3LK4 1;  3C5O A;  4FZN A;  4AYM C;  4Z3T A;  3VY9 X;  4O4X A;  1MM4 A;  3POU A;  2KC0 A;  4FT6 A;  4GCS A;  4QQ1 A;  1PHO A;  1MM5 A;  1OPF A;  4AZL A;  3AA7 B;  3UPG A;  3AAE B;  3SZD A;  4AKR A;  4RLB A;  1ZHX A;  3T24 A;  1ZHT A;  3NSG A;  4XNK A;  2LFU A;  2ZLD A;  2POR A;  1IZN A;  4PUX A;  4E1T A;  2YPV A;  2W80 C;  2X27 X;  4AKR B;  3PQU A;  3SZV A;  2Y0H A;  1IZN B;  3QRA A;  4FZM A;  3VE1 A;  4FOZ A;  3POX A;  4GHB A;  5FVN A;  5EE2 A;  3VZU X;  2J4U P;  2KXP A;  2KZ7 B;  3AA0 A;  2FGR A;  6PRN A;  4G75 A;  4FRT A;  2ODJ A;  4C69 X;  7PRN A;  2W81 C;  3LK4 2;  4KRA A;  2KXP B;  3UU2 A;  3AA0 B;  2N2L A;  3SYS A;  3RBH A;  2MNH A;  2Y0K A;  4O3Z A;  4AUI A;  8PRN A;  1P4T A;  1Q9G A;  2KDY A;  3HWB A;  3KVD D;  4BUM X;  3AAA A;  4XNL A;  1BH3 A;  3POQ A;  2Y2X A;  1ZHY A;  1BT9 A;  4N59 A;  4AYI D;  5IYU A;  4GCP A;  4O4U A;  4RL9 A;  5DL7 A;  1GFM A;  2ERV A;  2ZFG A;  2XE2 A;  2XE1 A;  3QRC A;  3AAA B;  2GE4 A;  4D65 A;  2KZ7 A;  3LK2 A;  3EMN X;  5ADX L;  3TZG A;  2XTR A;  3POR A;  2XMX A;  3SY9 A;  3HW9 A;  3T20 A;  2F1V A;  5JDP A;  3LK2 B;  4JCH A;  3SY7 A;  3PRN A;  5AFU L;  3GP6 A;  1H6S 1;  1G90 A;  1ZHZ A;  2K0L A;  2LHF A;  3AA1 A;  4FMS A;  5G26 A;  3T0S A;  2JMM A;  1OSM A;  1ORM A;  2MHL A;  5DL8 A;  4KR4 A;  3JTY A;  1QJP A;  3WI5 A;  4AYE C;  3AA1 B;  4FSO A;  1GFP A;  4LSH A;  3UAQ A;  1QJ8 A;  1YS5 A;  4KR8 A;  1GFO A;  4RLC A;  4B61 A;  4LSE A;  1BXW A;  2M06 A;  2XTQ A;  4FUV A;  1THQ A;  4GCQ A;  4E1S A;  5ADX K;  5DL6 A;  4F4B A;  4RJX A;  4JFB A;  1GFN A;  5AFU K;  3LK3 B;  4N58 A;  3A2S X;  2N2M A;  1HXT A;  1HXX A;  3FYX A;  2XG6 A;  2FGQ X;  2Y7S A;  2YNK A;  3AA6 A;  1MPF A;  1Q9F A;  3HOE A;  4AKM A;  4U9C A;  4O49 A;  4FES A;  5GV0 A;  2O4V A;  4FRX A;  2PRN A;  2XE5 A;  4AYN A;  1HXU A;  3O0E A;  2OMF A;  3SYB A;  3WI4 A;  4O3X B;  3AA6 B;  3PQS A;  2Y0L A;  5DL5 A;  1ZHW A;  4LSF A;  3V8U A;  4FZL A;  1PRN A;  3K19 A;  5PRN A;  3VE2 A;  3VY8 X;  4AFK A;  4D64 A;  5D5D A;  4FSP A;  2J1N A;  3G7G A;  1GFQ A;  5T5F A;  3VZW X;  3VZT X;  3LK3 A;  4GF4 A;  4G76 A;  2QTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...