3C5OA

Crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
152
structure length
149
Chain Sequence
TPTLETKYVFTITARIGDVTSAGEIGTGVRRIIPILGGEVKGEGISGQVLPFGADFQIIRPNELIELEAKYAFETDDGAVVYVENVGIRFGPVELLRKGEPVDPKVIYFRTRPRFETGHPNYQWLMQYLFVGSAARHADRVVIDVHQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords UPF0311 protein RPA1785
publication title The Crystal Structure of the Conserved Protein of Unknown Function RPA1785 from Rhodopseudomonas palustris.
rcsb
source organism Rhodopseudomonas palustris
total genus 29
structure length 149
sequence length 152
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11578 DUF3237 Protein of unknown function (DUF3237)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 3c5oA00
2F1TA 1QJ8A 2MHLA 2GE4A 3QRCA 2X27X 1P4TA 1G90A 1MM5A 2M06A 2MNHA 3C5OA 3G7GA 1QJPA 3QRAA 2N2MA 4PUXA 2ERVA 1Q9FA 1BXWA 3GP6A 2F1VA 2M07A 1QJ9A 1ORMA 1MM4A 2K0LA 4RLCA 2JMMA 1Q9GA 2LHFA 1THQA 2N2LA
chains in the Genus database with same CATH superfamily
4O3ZA 1S5LO 2KDYA 3LK2B 4D65A 1IZNB 4UB6O 3AA1B 1BT9A 3POQA 4FSOA 3WU2O 3PGRA 1GFPA 5ADXL 2KZ7B 5KAFO 4PJ0O 2X27X 5E79O 2F1CX 2MNHA 1GFNA 5G39A 1MPFA 2R88A 1PRNA 2J1NA 3G7GA 4FSPA 4G76A 2ERVA 5G38A 5B66O 2Y0HA 3HW9A 3GP6A 2F1VA 3LK3B 4FZLA 5DL8A 4N75A 3WI5A 2Y0LA 4AYMC 4B61A 2R4LA 4CTDA 1ORMA 4GCQA 3SZDA 4N58A 3PQSA 4LSFA 3KZIO 4O4XA 4LSEA 1T1LA 1OSMA 2XE3A 2JMMA 1Q9GA 3POUA 2QTKA 1ZHWA 5DL7A 5GTHO 3SY9A 2R4OA 4RLBA 4K3BA 3DA3A 2ZFGA 5EE2A 5TISO 4C4VB 5ADXK 3EMNX 3BS0A 3DZMA 3NSGA 2IWVA 3AA0B 4O49A 2M06A 6PRNA 4AYID 2FGQX 4G75A 5PRNA 2R8AA 3VE1A 1GFQA 3AAEB 2N2MA 2W81C 3PF1A 3PORA 2W80C 3PQUA 3AA6B 3LK2A 4FRXA 3TZGA 1IZNA 4AZLA 1BH3A 2XG6A 3AA1A 5AFUK 4XNKA 2M07A 2XE5A 2KZ7A 3JTYA 3LK42 3AA7B 4D5UA 5AFUL 3SYBA 3RBHA 3UAQA 3BRZA 3FYXA 3PRNA 4FQEA 1QJ9A 4KRAA 3SYSA 1MM4A 4JFBA 3T24A 4FUVA 4AKRB 3T20A 4RJWA 3UU2A 4GHBA 4UB8O 3HOLA 5GTIO 4GCSA 1YS5A 4E1SA 5B5EO 3SY7A 5DL6A 5IYUA 1THQA 2Y2XA 3LK3A 4N59A 2F1TA 3AAAB 1ZHYA 2K4TA 2LFUA 3VZTX 4E1TA 4D64A 3VZWX 4O4UA 1HXXA 4KR8A 5FVNA 4JCHA 2JQYA 4C69X 4AKRA 4AYDC 2IWWA 2MHLA 5JDPA 4PR7A 4U9CA 4BUMX 5G26A 1P4TA 4Z3TA 1G90A 2KXPB 1ZHZA 2XE1A 4K3CA 5D5DA 3HWBA 4LSIA 3DWOX 1QJPA 1ZHTA 3LK41 2PRNA 3A2SX 3UPGA 4GF4A 1T16A 4C4VA 2WJRA 3JCUO 3DWNA 1GFOA 2YNKA 4LSHA 7PRNA 4RJXA 3AA0A 4FESA 5DL5A 4AYNA 4AFKA 2K0LA 3AAEA 1HXTA 2R4NA 4FRTA 4GCPA 5G3AA 3SZVA 2Y7SA 3VE2A 3T0SA 3AA6A 2ZLDA 2LHFA 4FZNA 4FZMA 5KAIO 2XTRA 2N2LA 4N74A 5H2FO 1OPFA 3HOEA 2WVPA 3AA7A 3KVDD 1QJ8A 2ODJA 3BRYA 4XNLA 4AYEC 4QQ1A 3O0EA 2XE2A 2PORA 2XMXA 2J4UP 4FMSA 3PGSA 2GE4A 3QRCA 3PGUA 4O3XB 2R89A 1E54A 1MM5A 2AXTO 3C5OA 2R4PA 2KC0A 3DA4A 3QRAA 4PUXA 3AAAA 4FOZA 3A0BO 4RL9A 3VY9X 2Y0KA 4AUIA 1Q9FA 5GV0A 4C00A 3NJTA 1BXWA 2OMFA 4O3YA 5T5FA 8PRNA 4IL6O 1ZHXA 1HXUA 1H6S1 3VZUX 3V8UA 2KXPA 3POXA 4FT6A 2O4VA 3K19A 4AKMA 4RLCA 2X9KA 1GFMA 1PHOA 3A0HO 4O3WA 3VY8X 3WI4A 2YPVA 2FGRA 4F4BA 2XTQA 2WJQA 4KR4A
chains in the Genus database with same CATH topology
4O3ZA 3LK2B 2KDYA 4D65A 1IZNB 3AA1B 1BT9A 3POQA 4FSOA 5ADXL 1GFPA 2KZ7B 2X27X 2MNHA 1GFNA 1MPFA 3G7GA 1PRNA 2J1NA 4FSPA 4G76A 2ERVA 2Y0HA 3HW9A 3GP6A 2F1VA 3LK3B 4FZLA 5DL8A 3WI5A 2Y0LA 4AYMC 4B61A 1ORMA 4GCQA 3SZDA 4N58A 3PQSA 4LSFA 4O4XA 4LSEA 1OSMA 2XE3A 2JMMA 1Q9GA 3POUA 2QTKA 1ZHWA 5DL7A 3SY9A 4RLBA 3DA3A 2ZFGA 5EE2A 5ADXK 3EMNX 3NSGA 3AA0B 4O49A 2M06A 6PRNA 4AYID 2FGQX 4G75A 5PRNA 3VE1A 1GFQA 3AAEB 2N2MA 2W81C 3PORA 2W80C 3PQUA 3AA6B 3LK2A 4FRXA 3TZGA 1IZNA 4AZLA 1BH3A 3AA1A 5AFUK 4XNKA 2M07A 2XE5A 2KZ7A 3JTYA 3LK42 3AA7B 4D5UA 5AFUL 3SYBA 3RBHA 3UAQA 3FYXA 3PRNA 1QJ9A 4KRAA 3SYSA 1MM4A 4JFBA 3T24A 4FUVA 4AKRB 3T20A 4RJWA 3UU2A 4GHBA 3HOLA 4GCSA 1YS5A 4E1SA 5IYUA 3SY7A 5DL6A 1THQA 2Y2XA 3LK3A 4N59A 2F1TA 3AAAB 1ZHYA 2K4TA 2LFUA 3VZTX 4E1TA 4D64A 3VZWX 4O4UA 1HXXA 4KR8A 5FVNA 4JCHA 4C69X 4AKRA 4AYDC 2MHLA 5JDPA 4U9CA 4BUMX 5G26A 1P4TA 4Z3TA 1G90A 2KXPB 1ZHZA 2XE1A 5D5DA 3HWBA 4LSIA 3LK41 1QJPA 1ZHTA 2PRNA 3A2SX 3UPGA 4GF4A 1GFOA 2YNKA 4LSHA 7PRNA 4RJXA 3AA0A 4FESA 5DL5A 4AYNA 4AFKA 2K0LA 3AAEA 1HXTA 4FRTA 4GCPA 3SZVA 2Y7SA 3VE2A 3T0SA 3AA6A 2ZLDA 2LHFA 4FZNA 4FZMA 2XTRA 2N2LA 1OPFA 3HOEA 3KVDD 3AA7A 4XNLA 1QJ8A 2ODJA 4AYEC 4QQ1A 3O0EA 2XE2A 2PORA 2XMXA 2J4UP 4FMSA 4O3XB 2GE4A 3QRCA 1E54A 1MM5A 3C5OA 2KC0A 3DA4A 3QRAA 4PUXA 3AAAA 4FOZA 3VY9X 4RL9A 4AUIA 2Y0KA 5GV0A 1Q9FA 1BXWA 2OMFA 4O3YA 5T5FA 8PRNA 1ZHXA 1HXUA 1H6S1 3VZUX 3V8UA 2KXPA 3POXA 4FT6A 2O4VA 3K19A 4AKMA 4RLCA 1GFMA 1PHOA 4O3WA 3VY8X 3WI4A 2YPVA 2FGRA 4F4BA 2XTQA 2XG6A 4KR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F1T A;  1QJ8 A;  2MHL A;  2GE4 A;  3QRC A;  2X27 X;  1P4T A;  1G90 A;  1MM5 A;  2M06 A;  2MNH A;  3C5O A;  3G7G A;  1QJP A;  3QRA A;  2N2M A;  4PUX A;  2ERV A;  1Q9F A;  1BXW A;  3GP6 A;  2F1V A;  2M07 A;  1QJ9 A;  1ORM A;  1MM4 A;  2K0L A;  4RLC A;  2JMM A;  1Q9G A;  2LHF A;  1THQ A;  2N2L A; 
#chains in the Genus database with same CATH topology
 4O3Z A;  1S5L O;  2KDY A;  3LK2 B;  4D65 A;  1IZN B;  4UB6 O;  3AA1 B;  1BT9 A;  3POQ A;  4FSO A;  3WU2 O;  3PGR A;  1GFP A;  5ADX L;  2KZ7 B;  5KAF O;  4PJ0 O;  2X27 X;  5E79 O;  2F1C X;  2MNH A;  1GFN A;  5G39 A;  1MPF A;  2R88 A;  1PRN A;  2J1N A;  3G7G A;  4FSP A;  4G76 A;  2ERV A;  5G38 A;  5B66 O;  2Y0H A;  3HW9 A;  3GP6 A;  2F1V A;  3LK3 B;  4FZL A;  5DL8 A;  4N75 A;  3WI5 A;  2Y0L A;  4AYM C;  4B61 A;  2R4L A;  4CTD A;  1ORM A;  4GCQ A;  3SZD A;  4N58 A;  3PQS A;  4LSF A;  3KZI O;  4O4X A;  4LSE A;  1T1L A;  1OSM A;  2XE3 A;  2JMM A;  1Q9G A;  3POU A;  2QTK A;  1ZHW A;  5DL7 A;  5GTH O;  3SY9 A;  2R4O A;  4RLB A;  4K3B A;  3DA3 A;  2ZFG A;  5EE2 A;  5TIS O;  4C4V B;  5ADX K;  3EMN X;  3BS0 A;  3DZM A;  3NSG A;  2IWV A;  3AA0 B;  4O49 A;  2M06 A;  6PRN A;  4AYI D;  2FGQ X;  4G75 A;  5PRN A;  2R8A A;  3VE1 A;  1GFQ A;  3AAE B;  2N2M A;  2W81 C;  3PF1 A;  3POR A;  2W80 C;  3PQU A;  3AA6 B;  3LK2 A;  4FRX A;  3TZG A;  1IZN A;  4AZL A;  1BH3 A;  2XG6 A;  3AA1 A;  5AFU K;  4XNK A;  2M07 A;  2XE5 A;  2KZ7 A;  3JTY A;  3LK4 2;  3AA7 B;  4D5U A;  5AFU L;  3SYB A;  3RBH A;  3UAQ A;  3BRZ A;  3FYX A;  3PRN A;  4FQE A;  1QJ9 A;  4KRA A;  3SYS A;  1MM4 A;  4JFB A;  3T24 A;  4FUV A;  4AKR B;  3T20 A;  4RJW A;  3UU2 A;  4GHB A;  4UB8 O;  3HOL A;  5GTI O;  4GCS A;  1YS5 A;  4E1S A;  5B5E O;  3SY7 A;  5DL6 A;  5IYU A;  1THQ A;  2Y2X A;  3LK3 A;  4N59 A;  2F1T A;  3AAA B;  1ZHY A;  2K4T A;  2LFU A;  3VZT X;  4E1T A;  4D64 A;  3VZW X;  4O4U A;  1HXX A;  4KR8 A;  5FVN A;  4JCH A;  2JQY A;  4C69 X;  4AKR A;  4AYD C;  2IWW A;  2MHL A;  5JDP A;  4PR7 A;  4U9C A;  4BUM X;  5G26 A;  1P4T A;  4Z3T A;  1G90 A;  2KXP B;  1ZHZ A;  2XE1 A;  4K3C A;  5D5D A;  3HWB A;  4LSI A;  3DWO X;  1QJP A;  1ZHT A;  3LK4 1;  2PRN A;  3A2S X;  3UPG A;  4GF4 A;  1T16 A;  4C4V A;  2WJR A;  3JCU O;  3DWN A;  1GFO A;  2YNK A;  4LSH A;  7PRN A;  4RJX A;  3AA0 A;  4FES A;  5DL5 A;  4AYN A;  4AFK A;  2K0L A;  3AAE A;  1HXT A;  2R4N A;  4FRT A;  4GCP A;  5G3A A;  3SZV A;  2Y7S A;  3VE2 A;  3T0S A;  3AA6 A;  2ZLD A;  2LHF A;  4FZN A;  4FZM A;  5KAI O;  2XTR A;  2N2L A;  4N74 A;  5H2F O;  1OPF A;  3HOE A;  2WVP A;  3AA7 A;  3KVD D;  1QJ8 A;  2ODJ A;  3BRY A;  4XNL A;  4AYE C;  4QQ1 A;  3O0E A;  2XE2 A;  2POR A;  2XMX A;  2J4U P;  4FMS A;  3PGS A;  2GE4 A;  3QRC A;  3PGU A;  4O3X B;  2R89 A;  1E54 A;  1MM5 A;  2AXT O;  3C5O A;  2R4P A;  2KC0 A;  3DA4 A;  3QRA A;  4PUX A;  3AAA A;  4FOZ A;  3A0B O;  4RL9 A;  3VY9 X;  2Y0K A;  4AUI A;  1Q9F A;  5GV0 A;  4C00 A;  3NJT A;  1BXW A;  2OMF A;  4O3Y A;  5T5F A;  8PRN A;  4IL6 O;  1ZHX A;  1HXU A;  1H6S 1;  3VZU X;  3V8U A;  2KXP A;  3POX A;  4FT6 A;  2O4V A;  3K19 A;  4AKM A;  4RLC A;  2X9K A;  1GFM A;  1PHO A;  3A0H O;  4O3W A;  3VY8 X;  3WI4 A;  2YPV A;  2FGR A;  4F4B A;  2XTQ A;  2WJQ A;  4KR4 A; 
#chains in the Genus database with same CATH homology
 4O3Z A;  3LK2 B;  2KDY A;  4D65 A;  1IZN B;  3AA1 B;  1BT9 A;  3POQ A;  4FSO A;  5ADX L;  1GFP A;  2KZ7 B;  2X27 X;  2MNH A;  1GFN A;  1MPF A;  3G7G A;  1PRN A;  2J1N A;  4FSP A;  4G76 A;  2ERV A;  2Y0H A;  3HW9 A;  3GP6 A;  2F1V A;  3LK3 B;  4FZL A;  5DL8 A;  3WI5 A;  2Y0L A;  4AYM C;  4B61 A;  1ORM A;  4GCQ A;  3SZD A;  4N58 A;  3PQS A;  4LSF A;  4O4X A;  4LSE A;  1OSM A;  2XE3 A;  2JMM A;  1Q9G A;  3POU A;  2QTK A;  1ZHW A;  5DL7 A;  3SY9 A;  4RLB A;  3DA3 A;  2ZFG A;  5EE2 A;  5ADX K;  3EMN X;  3NSG A;  3AA0 B;  4O49 A;  2M06 A;  6PRN A;  4AYI D;  2FGQ X;  4G75 A;  5PRN A;  3VE1 A;  1GFQ A;  3AAE B;  2N2M A;  2W81 C;  3POR A;  2W80 C;  3PQU A;  3AA6 B;  3LK2 A;  4FRX A;  3TZG A;  1IZN A;  4AZL A;  1BH3 A;  3AA1 A;  5AFU K;  4XNK A;  2M07 A;  2XE5 A;  2KZ7 A;  3JTY A;  3LK4 2;  3AA7 B;  4D5U A;  5AFU L;  3SYB A;  3RBH A;  3UAQ A;  3FYX A;  3PRN A;  1QJ9 A;  4KRA A;  3SYS A;  1MM4 A;  4JFB A;  3T24 A;  4FUV A;  4AKR B;  3T20 A;  4RJW A;  3UU2 A;  4GHB A;  3HOL A;  4GCS A;  1YS5 A;  4E1S A;  5IYU A;  3SY7 A;  5DL6 A;  1THQ A;  2Y2X A;  3LK3 A;  4N59 A;  2F1T A;  3AAA B;  1ZHY A;  2K4T A;  2LFU A;  3VZT X;  4E1T A;  4D64 A;  3VZW X;  4O4U A;  1HXX A;  4KR8 A;  5FVN A;  4JCH A;  4C69 X;  4AKR A;  4AYD C;  2MHL A;  5JDP A;  4U9C A;  4BUM X;  5G26 A;  1P4T A;  4Z3T A;  1G90 A;  2KXP B;  1ZHZ A;  2XE1 A;  5D5D A;  3HWB A;  4LSI A;  3LK4 1;  1QJP A;  1ZHT A;  2PRN A;  3A2S X;  3UPG A;  4GF4 A;  1GFO A;  2YNK A;  4LSH A;  7PRN A;  4RJX A;  3AA0 A;  4FES A;  5DL5 A;  4AYN A;  4AFK A;  2K0L A;  3AAE A;  1HXT A;  4FRT A;  4GCP A;  3SZV A;  2Y7S A;  3VE2 A;  3T0S A;  3AA6 A;  2ZLD A;  2LHF A;  4FZN A;  4FZM A;  2XTR A;  2N2L A;  1OPF A;  3HOE A;  3KVD D;  3AA7 A;  4XNL A;  1QJ8 A;  2ODJ A;  4AYE C;  4QQ1 A;  3O0E A;  2XE2 A;  2POR A;  2XMX A;  2J4U P;  4FMS A;  4O3X B;  2GE4 A;  3QRC A;  1E54 A;  1MM5 A;  3C5O A;  2KC0 A;  3DA4 A;  3QRA A;  4PUX A;  3AAA A;  4FOZ A;  3VY9 X;  4RL9 A;  4AUI A;  2Y0K A;  5GV0 A;  1Q9F A;  1BXW A;  2OMF A;  4O3Y A;  5T5F A;  8PRN A;  1ZHX A;  1HXU A;  1H6S 1;  3VZU X;  3V8U A;  2KXP A;  3POX A;  4FT6 A;  2O4V A;  3K19 A;  4AKM A;  4RLC A;  1GFM A;  1PHO A;  4O3W A;  3VY8 X;  3WI4 A;  2YPV A;  2FGR A;  4F4B A;  2XTQ A;  2XG6 A;  4KR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...