4LSIA

Ion selectivity of ompf porin soaked in 0.3m kbr
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
334
structure length
334
Chain Sequence
DGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural study of ion permeation in OmpF porin from anomalous X-ray diffraction and molecular dynamics simulations.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Outer membrane protein F
total genus 100
structure length 334
sequence length 334
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4lsiA00
2Y0LA 2Y0KA 4BUMX 2XE2A 4FSPA 5DL7A 3PRNA 4FMSA 2PORA 4RJWA 4LSHA 2XE5A 1GFMA 1GFQA 3VY8X 3VZWX 3PORA 1HXUA 2XG6A 8PRNA 3POQA 1H6S1 4KR8A 2XE1A 4KR4A 5FVNA 1PHOA 3SZDA 2XE3A 1MPFA 3UU2A 4RJXA 4GCPA 3T0SA 7PRNA 3NSGA 5DL6A 1OPFA 1HXTA 4GCSA 1GFNA 3POXA 3T20A 4GCQA 5JDPA 4C69X 2OMFA 4LSEA 3WI4A 3FYXA 2Y0HA 2J1NA 2K4TA 3T24A 3HW9A 1GFOA 3SY9A 2PRNA 4FRTA 3SYSA 4D65A 1PRNA 2J4UP 3VZUX 6PRNA 2O4VA 4D64A 1HXXA 3O0EA 3SYBA 3HWBA 4AUIA 4JFBA 2QTKA 2FGQX 2ZFGA 3A2SX 3SZVA 5DL5A 3POUA 2ZLDA 3JTYA 5PRNA 4KRAA 5DL8A 3WI5A 4D5UA 2ODJA 4FRXA 4LSFA 3VY9X 4LSIA 3UPGA 3K19A 4FT6A 2FGRA 1BH3A 4FOZA 1BT9A 1GFPA 3VZTX 4FSOA 3SY7A 2Y2XA 1OSMA 1E54A 3EMNX
chains in the Genus database with same CATH superfamily
1G90A 2AXTO 1THQA 4C00A 2Y0LA 5KAFO 1ZHWA 2Y0KA 4RLBA 1YS5A 2XTRA 3AAAB 4O49A 2XE2A 3PF1A 4FSPA 5DL7A 2ERVA 4BUMX 4O3XB 3PRNA 4FMSA 2JMMA 1QJPA 1ZHYA 2PORA 4RJWA 5D5DA 4LSHA 2XE5A 4G76A 1GFMA 2KXPB 1GFQA 2IWWA 3VY8X 3A0BO 3VZWX 4AKRA 3PORA 4FUVA 5ADXL 1HXUA 4B61A 2N2MA 2XG6A 8PRNA 1IZNA 3POQA 4FZLA 1H6S1 4N59A 2KXPA 2MNHA 4KR8A 4N75A 2X9KA 2XE1A 5T5FA 4AYID 1ZHXA 1BXWA 3VE1A 4KR4A 4E1TA 5FVNA 1PHOA 4XNLA 2R4LA 3SZDA 1MPFA 2XE3A 3AA1A 4Z3TA 5GTHO 3AA6A 3PQSA 3UU2A 1QJ8A 4QQ1A 3RBHA 3VE2A 4RJXA 4GCPA 2F1VA 4RLCA 3T0SA 3TZGA 2XMXA 4E1SA 3NSGA 7PRNA 5DL6A 1T16A 5KAIO 4N58A 4C4VB 4CTDA 1OPFA 3AA7A 4O4XA 1HXTA 2R89A 4GCSA 5B5EO 2WJQA 1GFNA 1MM4A 3POXA 3A0HO 4GCQA 4AYDC 5JDPA 3T20A 2R4NA 3AA0A 4FESA 4AYMC 3WU2O 5IYUA 2F1CX 2WVPA 2R88A 4C69X 4IL6O 4XNKA 1T1LA 2KZ7A 2F1TA 2OMFA 3LK2A 4LSEA 3WI4A 5TISO 4AKMA 2R8AA 3BRYA 3QRCA 1Q9FA 3FYXA 2X27X 3AA7B 5G38A 5GV0A 2LFUA 4O3ZA 4C4VA 5H2FO 2K0LA 3PQUA 2Y0HA 4AFKA 2XTQA 3LK41 4FZMA 3LK3B 4UB8O 2J1NA 2MHLA 3AA6B 2K4TA 3T24A 3HW9A 5G26A 4GF4A 1GFOA 3SY9A 2PRNA 4FRTA 3DZMA 3JCUO 3SYSA 5AFUK 5B66O 4D65A 3KVDD 2WJRA 1PRNA 2LHFA 2J4UP 3GP6A 1MM5A 3AAAA 2GE4A 3AAEA 3VZUX 4PUXA 6PRNA 1ORMA 3BS0A 3DWNA 3DWOX 2O4VA 4PR7A 5G39A 3DA3A 4AKRB 4D64A 1HXXA 2YPVA 3LK3A 3O0EA 3SYBA 3HWBA 4JCHA 4AUIA 3AAEB 4JFBA 2KDYA 5G3AA 2QTKA 2FGQX 3G7GA 2ZFGA 3KZIO 3A2SX 2N2LA 3PGSA 3SZVA 5DL5A 2YNKA 3POUA 3LK2B 1P4TA 2ZLDA 4O3WA 2IWVA 3JTYA 5PRNA 4AZLA 4FQEA 2W81C 3UAQA 5AFUL 1S5LO 1ZHTA 2M06A 4KRAA 5GTIO 3DA4A 4F4BA 3HOEA 1QJ9A 5DL8A 2KC0A 4RL9A 3WI5A 4AYEC 5EE2A 2JQYA 4GHBA 2R4OA 4N74A 3BRZA 4K3BA 4D5UA 2ODJA 1ZHZA 2KZ7B 2M07A 3PGUA 4FRXA 4LSFA 4PJ0O 3VY9X 4K3CA 4LSIA 3AA1B 1Q9GA 4G75A 5E79O 3K19A 3NJTA 3V8UA 3UPGA 3AA0B 3LK42 4FT6A 5ADXK 2FGRA 4AYNA 3HOLA 1BH3A 4FOZA 2W80C 3PGRA 1GFPA 1BT9A 4UB6O 3QRAA 2R4PA 4O3YA 4FZNA 3VZTX 4FSOA 3C5OA 1IZNB 3SY7A 2Y2XA 4U9CA 2Y7SA 4O4UA 1OSMA 1E54A 3EMNX
chains in the Genus database with same CATH topology
1G90A 1THQA 2Y0LA 1ZHWA 2Y0KA 4RLBA 1YS5A 2XTRA 3AAAB 4O49A 2XE2A 4FSPA 4BUMX 5DL7A 2ERVA 4O3XB 3PRNA 4FMSA 2JMMA 1QJPA 1ZHYA 2PORA 4RJWA 5D5DA 4LSHA 2XE5A 4G76A 1GFMA 2KXPB 1GFQA 3VY8X 3VZWX 4AKRA 3PORA 4FUVA 5ADXL 1HXUA 4B61A 2N2MA 2XG6A 8PRNA 1IZNA 3POQA 4FZLA 1H6S1 4N59A 2KXPA 2MNHA 4KR8A 5T5FA 2XE1A 4AYID 1ZHXA 1BXWA 3VE1A 4KR4A 4E1TA 5FVNA 1PHOA 4XNLA 3SZDA 2XE3A 1MPFA 3AA1A 4Z3TA 3AA6A 3PQSA 3UU2A 1QJ8A 4QQ1A 3RBHA 3VE2A 4RJXA 4GCPA 2F1VA 4RLCA 3T0SA 3TZGA 2XMXA 4E1SA 3NSGA 7PRNA 5DL6A 4N58A 1OPFA 3AA7A 4O4XA 1HXTA 4GCSA 1GFNA 1MM4A 3POXA 3T20A 4GCQA 4AYDC 5JDPA 3AA0A 4FESA 4AYMC 5IYUA 4C69X 4XNKA 2KZ7A 2F1TA 2OMFA 3LK2A 4LSEA 3WI4A 4AKMA 3QRCA 1Q9FA 3FYXA 2X27X 3AA7B 5GV0A 2LFUA 4O3ZA 2K0LA 3PQUA 2Y0HA 4AFKA 2XTQA 3LK41 4FZMA 3LK3B 2J1NA 2MHLA 3AA6B 2K4TA 3T24A 3HW9A 5G26A 4GF4A 1GFOA 3SY9A 2PRNA 4FRTA 5AFUK 3SYSA 4D65A 3KVDD 1PRNA 2LHFA 2J4UP 3GP6A 1MM5A 3AAAA 2GE4A 3AAEA 3VZUX 4PUXA 6PRNA 1ORMA 2O4VA 3DA3A 4AKRB 4D64A 1HXXA 2YPVA 3LK3A 3O0EA 3SYBA 3HWBA 4JCHA 4AUIA 3AAEB 4JFBA 2KDYA 2QTKA 2FGQX 3G7GA 2ZFGA 3A2SX 2N2LA 3SZVA 5DL5A 2YNKA 3POUA 3LK2B 1P4TA 2ZLDA 4O3WA 3JTYA 5PRNA 4AZLA 2W81C 3UAQA 5AFUL 1ZHTA 2M06A 4KRAA 3DA4A 4F4BA 3HOEA 1QJ9A 5DL8A 2KC0A 4RL9A 3WI5A 4AYEC 5EE2A 4GHBA 4D5UA 2ODJA 1ZHZA 2KZ7B 2M07A 4FRXA 4LSFA 3VY9X 4LSIA 3AA1B 1Q9GA 4G75A 3V8UA 3K19A 3UPGA 3AA0B 3LK42 4FT6A 5ADXK 2FGRA 4AYNA 3HOLA 1BH3A 4FOZA 2W80C 1GFPA 1BT9A 3QRAA 4O3YA 4FZNA 3VZTX 4FSOA 3C5OA 1IZNB 3SY7A 2Y2XA 4U9CA 2Y7SA 4O4UA 1OSMA 1E54A 3EMNX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0L A;  2Y0K A;  4BUM X;  2XE2 A;  4FSP A;  5DL7 A;  3PRN A;  4FMS A;  2POR A;  4RJW A;  4LSH A;  2XE5 A;  1GFM A;  1GFQ A;  3VY8 X;  3VZW X;  3POR A;  1HXU A;  2XG6 A;  8PRN A;  3POQ A;  1H6S 1;  4KR8 A;  2XE1 A;  4KR4 A;  5FVN A;  1PHO A;  3SZD A;  2XE3 A;  1MPF A;  3UU2 A;  4RJX A;  4GCP A;  3T0S A;  7PRN A;  3NSG A;  5DL6 A;  1OPF A;  1HXT A;  4GCS A;  1GFN A;  3POX A;  3T20 A;  4GCQ A;  5JDP A;  4C69 X;  2OMF A;  4LSE A;  3WI4 A;  3FYX A;  2Y0H A;  2J1N A;  2K4T A;  3T24 A;  3HW9 A;  1GFO A;  3SY9 A;  2PRN A;  4FRT A;  3SYS A;  4D65 A;  1PRN A;  2J4U P;  3VZU X;  6PRN A;  2O4V A;  4D64 A;  1HXX A;  3O0E A;  3SYB A;  3HWB A;  4AUI A;  4JFB A;  2QTK A;  2FGQ X;  2ZFG A;  3A2S X;  3SZV A;  5DL5 A;  3POU A;  2ZLD A;  3JTY A;  5PRN A;  4KRA A;  5DL8 A;  3WI5 A;  4D5U A;  2ODJ A;  4FRX A;  4LSF A;  3VY9 X;  4LSI A;  3UPG A;  3K19 A;  4FT6 A;  2FGR A;  1BH3 A;  4FOZ A;  1BT9 A;  1GFP A;  3VZT X;  4FSO A;  3SY7 A;  2Y2X A;  1OSM A;  1E54 A;  3EMN X; 
#chains in the Genus database with same CATH topology
 1G90 A;  2AXT O;  1THQ A;  4C00 A;  2Y0L A;  5KAF O;  1ZHW A;  2Y0K A;  4RLB A;  1YS5 A;  2XTR A;  3AAA B;  4O49 A;  2XE2 A;  3PF1 A;  4FSP A;  5DL7 A;  2ERV A;  4BUM X;  4O3X B;  3PRN A;  4FMS A;  2JMM A;  1QJP A;  1ZHY A;  2POR A;  4RJW A;  5D5D A;  4LSH A;  2XE5 A;  4G76 A;  1GFM A;  2KXP B;  1GFQ A;  2IWW A;  3VY8 X;  3A0B O;  3VZW X;  4AKR A;  3POR A;  4FUV A;  5ADX L;  1HXU A;  4B61 A;  2N2M A;  2XG6 A;  8PRN A;  1IZN A;  3POQ A;  4FZL A;  1H6S 1;  4N59 A;  2KXP A;  2MNH A;  4KR8 A;  4N75 A;  2X9K A;  2XE1 A;  5T5F A;  4AYI D;  1ZHX A;  1BXW A;  3VE1 A;  4KR4 A;  4E1T A;  5FVN A;  1PHO A;  4XNL A;  2R4L A;  3SZD A;  1MPF A;  2XE3 A;  3AA1 A;  4Z3T A;  5GTH O;  3AA6 A;  3PQS A;  3UU2 A;  1QJ8 A;  4QQ1 A;  3RBH A;  3VE2 A;  4RJX A;  4GCP A;  2F1V A;  4RLC A;  3T0S A;  3TZG A;  2XMX A;  4E1S A;  3NSG A;  7PRN A;  5DL6 A;  1T16 A;  5KAI O;  4N58 A;  4C4V B;  4CTD A;  1OPF A;  3AA7 A;  4O4X A;  1HXT A;  2R89 A;  4GCS A;  5B5E O;  2WJQ A;  1GFN A;  1MM4 A;  3POX A;  3A0H O;  4GCQ A;  4AYD C;  5JDP A;  3T20 A;  2R4N A;  3AA0 A;  4FES A;  4AYM C;  3WU2 O;  5IYU A;  2F1C X;  2WVP A;  2R88 A;  4C69 X;  4IL6 O;  4XNK A;  1T1L A;  2KZ7 A;  2F1T A;  2OMF A;  3LK2 A;  4LSE A;  3WI4 A;  5TIS O;  4AKM A;  2R8A A;  3BRY A;  3QRC A;  1Q9F A;  3FYX A;  2X27 X;  3AA7 B;  5G38 A;  5GV0 A;  2LFU A;  4O3Z A;  4C4V A;  5H2F O;  2K0L A;  3PQU A;  2Y0H A;  4AFK A;  2XTQ A;  3LK4 1;  4FZM A;  3LK3 B;  4UB8 O;  2J1N A;  2MHL A;  3AA6 B;  2K4T A;  3T24 A;  3HW9 A;  5G26 A;  4GF4 A;  1GFO A;  3SY9 A;  2PRN A;  4FRT A;  3DZM A;  3JCU O;  3SYS A;  5AFU K;  5B66 O;  4D65 A;  3KVD D;  2WJR A;  1PRN A;  2LHF A;  2J4U P;  3GP6 A;  1MM5 A;  3AAA A;  2GE4 A;  3AAE A;  3VZU X;  4PUX A;  6PRN A;  1ORM A;  3BS0 A;  3DWN A;  3DWO X;  2O4V A;  4PR7 A;  5G39 A;  3DA3 A;  4AKR B;  4D64 A;  1HXX A;  2YPV A;  3LK3 A;  3O0E A;  3SYB A;  3HWB A;  4JCH A;  4AUI A;  3AAE B;  4JFB A;  2KDY A;  5G3A A;  2QTK A;  2FGQ X;  3G7G A;  2ZFG A;  3KZI O;  3A2S X;  2N2L A;  3PGS A;  3SZV A;  5DL5 A;  2YNK A;  3POU A;  3LK2 B;  1P4T A;  2ZLD A;  4O3W A;  2IWV A;  3JTY A;  5PRN A;  4AZL A;  4FQE A;  2W81 C;  3UAQ A;  5AFU L;  1S5L O;  1ZHT A;  2M06 A;  4KRA A;  5GTI O;  3DA4 A;  4F4B A;  3HOE A;  1QJ9 A;  5DL8 A;  2KC0 A;  4RL9 A;  3WI5 A;  4AYE C;  5EE2 A;  2JQY A;  4GHB A;  2R4O A;  4N74 A;  3BRZ A;  4K3B A;  4D5U A;  2ODJ A;  1ZHZ A;  2KZ7 B;  2M07 A;  3PGU A;  4FRX A;  4LSF A;  4PJ0 O;  3VY9 X;  4K3C A;  4LSI A;  3AA1 B;  1Q9G A;  4G75 A;  5E79 O;  3K19 A;  3NJT A;  3V8U A;  3UPG A;  3AA0 B;  3LK4 2;  4FT6 A;  5ADX K;  2FGR A;  4AYN A;  3HOL A;  1BH3 A;  4FOZ A;  2W80 C;  3PGR A;  1GFP A;  1BT9 A;  4UB6 O;  3QRA A;  2R4P A;  4O3Y A;  4FZN A;  3VZT X;  4FSO A;  3C5O A;  1IZN B;  3SY7 A;  2Y2X A;  4U9C A;  2Y7S A;  4O4U A;  1OSM A;  1E54 A;  3EMN X; 
#chains in the Genus database with same CATH homology
 1G90 A;  1THQ A;  2Y0L A;  1ZHW A;  2Y0K A;  4RLB A;  1YS5 A;  2XTR A;  3AAA B;  4O49 A;  2XE2 A;  4FSP A;  4BUM X;  5DL7 A;  2ERV A;  4O3X B;  3PRN A;  4FMS A;  2JMM A;  1QJP A;  1ZHY A;  2POR A;  4RJW A;  5D5D A;  4LSH A;  2XE5 A;  4G76 A;  1GFM A;  2KXP B;  1GFQ A;  3VY8 X;  3VZW X;  4AKR A;  3POR A;  4FUV A;  5ADX L;  1HXU A;  4B61 A;  2N2M A;  2XG6 A;  8PRN A;  1IZN A;  3POQ A;  4FZL A;  1H6S 1;  4N59 A;  2KXP A;  2MNH A;  4KR8 A;  5T5F A;  2XE1 A;  4AYI D;  1ZHX A;  1BXW A;  3VE1 A;  4KR4 A;  4E1T A;  5FVN A;  1PHO A;  4XNL A;  3SZD A;  2XE3 A;  1MPF A;  3AA1 A;  4Z3T A;  3AA6 A;  3PQS A;  3UU2 A;  1QJ8 A;  4QQ1 A;  3RBH A;  3VE2 A;  4RJX A;  4GCP A;  2F1V A;  4RLC A;  3T0S A;  3TZG A;  2XMX A;  4E1S A;  3NSG A;  7PRN A;  5DL6 A;  4N58 A;  1OPF A;  3AA7 A;  4O4X A;  1HXT A;  4GCS A;  1GFN A;  1MM4 A;  3POX A;  3T20 A;  4GCQ A;  4AYD C;  5JDP A;  3AA0 A;  4FES A;  4AYM C;  5IYU A;  4C69 X;  4XNK A;  2KZ7 A;  2F1T A;  2OMF A;  3LK2 A;  4LSE A;  3WI4 A;  4AKM A;  3QRC A;  1Q9F A;  3FYX A;  2X27 X;  3AA7 B;  5GV0 A;  2LFU A;  4O3Z A;  2K0L A;  3PQU A;  2Y0H A;  4AFK A;  2XTQ A;  3LK4 1;  4FZM A;  3LK3 B;  2J1N A;  2MHL A;  3AA6 B;  2K4T A;  3T24 A;  3HW9 A;  5G26 A;  4GF4 A;  1GFO A;  3SY9 A;  2PRN A;  4FRT A;  5AFU K;  3SYS A;  4D65 A;  3KVD D;  1PRN A;  2LHF A;  2J4U P;  3GP6 A;  1MM5 A;  3AAA A;  2GE4 A;  3AAE A;  3VZU X;  4PUX A;  6PRN A;  1ORM A;  2O4V A;  3DA3 A;  4AKR B;  4D64 A;  1HXX A;  2YPV A;  3LK3 A;  3O0E A;  3SYB A;  3HWB A;  4JCH A;  4AUI A;  3AAE B;  4JFB A;  2KDY A;  2QTK A;  2FGQ X;  3G7G A;  2ZFG A;  3A2S X;  2N2L A;  3SZV A;  5DL5 A;  2YNK A;  3POU A;  3LK2 B;  1P4T A;  2ZLD A;  4O3W A;  3JTY A;  5PRN A;  4AZL A;  2W81 C;  3UAQ A;  5AFU L;  1ZHT A;  2M06 A;  4KRA A;  3DA4 A;  4F4B A;  3HOE A;  1QJ9 A;  5DL8 A;  2KC0 A;  4RL9 A;  3WI5 A;  4AYE C;  5EE2 A;  4GHB A;  4D5U A;  2ODJ A;  1ZHZ A;  2KZ7 B;  2M07 A;  4FRX A;  4LSF A;  3VY9 X;  4LSI A;  3AA1 B;  1Q9G A;  4G75 A;  3V8U A;  3K19 A;  3UPG A;  3AA0 B;  3LK4 2;  4FT6 A;  5ADX K;  2FGR A;  4AYN A;  3HOL A;  1BH3 A;  4FOZ A;  2W80 C;  1GFP A;  1BT9 A;  3QRA A;  4O3Y A;  4FZN A;  3VZT X;  4FSO A;  3C5O A;  1IZN B;  3SY7 A;  2Y2X A;  4U9C A;  2Y7S A;  4O4U A;  1OSM A;  1E54 A;  3EMN X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...