4LSIA

Ion selectivity of ompf porin soaked in 0.3m kbr
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
334
structure length
334
Chain Sequence
b'DGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein F
publication title A structural study of ion permeation in OmpF porin from anomalous X-ray diffraction and molecular dynamics simulations.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 100
structure length 334
sequence length 334
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4lsiA00
3SY9A 2XE5A 4FRXA 3POUA 3VY8X 2PRNA 5DL5A 3UU2A 2XE1A 4KR8A 1BT9A 3NSGA 4D5UA 4RJWA 4GCQA 4BUMX 4KRAA 3WI4A 7PRNA 2XE3A 3FYXA 1HXUA 4LSHA 2Y2XA 1H6S1 1GFOA 3SZDA 3SY7A 4C69X 1HXXA 5DL7A 4LSFA 4FRTA 2Y0LA 5DL6A 3PRNA 3POXA 2O4VA 4FMSA 3VZWX 8PRNA 4FT6A 1GFMA 6PRNA 2PORA 2QTKA 2FGQX 3VY9X 4FSPA 2FGRA 2J4UP 1PHOA 3A2SX 2ZLDA 1HXTA 4FSOA 1GFQA 3VZUX 5FVNA 4GCSA 2OMFA 4LSIA 3K19A 1OSMA 3SYBA 3HWBA 3VZTX 4AUIA 1E54A 2Y0HA 3T24A 3PORA 2ZFGA 2K4TA 4GCPA 5PRNA 4LSEA 2ODJA 3JTYA 1PRNA 3HW9A 1BH3A 5DL8A 3T0SA 4JFBA 3UPGA 3POQA 2J1NA 3T20A 4D64A 2Y0KA 4KR4A 4RJXA 2XG6A 3WI5A 2XE2A 1OPFA 3EMNX 1GFNA 3SZVA 4D65A 1MPFA 3SYSA 3O0EA 1GFPA 4FOZA 5JDPA
chains in the Genus database with same CATH superfamily
5D5DA 3SY9A 2XE5A 4O4XA 3VE2A 4FESA 4FRXA 2MHLA 2R88A 3POUA 5ADXL 1ZHWA 3LK2B 3DA4A 3DZMA 2XMXA 3VY8X 5IYUA 2PRNA 4E1SA 4AYEC 4PUXA 1ZHZA 3LK2A 4O3WA 2WJQA 5DL5A 5EE2A 5G39A 3PGSA 4U9CA 3UU2A 4AKRB 2XE1A 3AA1B 2R4LA 4KR8A 2M06A 1BT9A 2KDYA 2GE4A 5AFUK 3NSGA 3AA1A 3LK3B 4D5UA 2IWWA 4RJWA 4GCQA 4BUMX 5ADXK 4KRAA 2IWVA 5B66O 3WI4A 4FZLA 4XNLA 7PRNA 4G75A 2XE3A 3FYXA 1QJ8A 1HXUA 4GF4A 4JCHA 1QJPA 4LSHA 2Y2XA 4N59A 3DA3A 3DWNA 3QRCA 1H6S1 2WVPA 3G7GA 2R4OA 1GFOA 4O49A 2K0LA 5KAFO 3SZDA 3SY7A 4C69X 5H2FO 4QQ1A 2ERVA 1HXXA 4K3BA 4LSFA 5DL7A 3PQUA 4FRTA 2Y0LA 3BRZA 4C4VB 1MM5A 4O3YA 3BRYA 3PGUA 5DL6A 2R8AA 3POXA 2O4VA 3PRNA 4FMSA 3HOEA 3KZIO 3PGRA 5GTIO 4FT6A 3VZWX 4C4VA 8PRNA 1T1LA 2YPVA 4XNKA 3V8UA 5GV0A 2JMMA 2R4NA 4AKRA 1Q9GA 1GFMA 4AYDC 6PRNA 2PORA 2QTKA 3RBHA 2WJRA 3AAAB 4FQEA 3BS0A 1ZHXA 4IL6O 4AYMC 4CTDA 4N58A 1ZHTA 2F1TA 3LK3A 3LK42 4O4UA 1IZNB 3HOLA 1T16A 4PJ0O 5G3AA 3UAQA 4C00A 2FGQX 4O3ZA 3A0HO 3VY9X 5TISO 4G76A 1THQA 1IZNA 2MNHA 4FSPA 2FGRA 3C5OA 2M07A 2J4UP 1PHOA 3A2SX 2ZLDA 1HXTA 2KZ7B 4FSOA 4UB6O 5KAIO 1GFQA 3KVDD 3VZUX 5FVNA 2F1VA 1ZHYA 3PQSA 4FZMA 2KZ7A 4GCSA 2OMFA 2XTQA 4LSIA 4RLBA 5T5FA 4E1TA 3K19A 5E79O 2N2MA 1P4TA 5JDPA 3GP6A 1OSMA 5B5EO 3SYBA 4AYNA 3AA6B 4GHBA 3TZGA 4K3CA 4Z3TA 3HWBA 4N75A 4FZNA 3VZTX 4AKMA 3AA6A 4AUIA 1E54A 2Y0HA 3T24A 2KXPB 3AA7B 4N74A 5G26A 3PORA 5GTHO 3AAEB 4RLCA 3WU2O 2ZFGA 3AA7A 4AYID 4AZLA 2K4TA 3JCUO 3AAAA 4GCPA 4UB8O 5PRNA 4LSEA 2ODJA 5AFUL 3AAEA 3DWOX 3JTYA 1PRNA 3HW9A 3LK41 1BH3A 1G90A 5DL8A 2X9KA 3T0SA 4JFBA 2F1CX 2JQYA 2R89A 2Y7SA 3PF1A 3POQA 5G38A 1BXWA 3UPGA 1S5LO 1Q9FA 2J1NA 3T20A 2X27X 3VE1A 4D64A 2Y0KA 3A0BO 4O3XB 4KR4A 4RJXA 2XG6A 2N2LA 2KC0A 4PR7A 3WI5A 4AFKA 3AA0B 2XE2A 2LFUA 1OPFA 3EMNX 4B61A 1GFNA 1MM4A 1ORMA 2AXTO 2LHFA 2R4PA 2XTRA 3NJTA 3SZVA 4F4BA 2W81C 3AA0A 4D65A 3QRAA 1MPFA 2W80C 4FUVA 2YNKA 3O0EA 1GFPA 3SYSA 1QJ9A 2KXPA 1YS5A 4FOZA 4RL9A
chains in the Genus database with same CATH topology
5D5DA 3SY9A 2XE5A 4O4XA 3VE2A 4FESA 4FRXA 2MHLA 3POUA 5ADXL 1ZHWA 3LK2B 3DA4A 2XMXA 3VY8X 5IYUA 2PRNA 4E1SA 4PUXA 1ZHZA 3LK2A 4O3WA 5DL5A 3UU2A 5EE2A 4U9CA 4AKRB 2XE1A 3AA1B 4KR8A 2M06A 1BT9A 2KDYA 2GE4A 5AFUK 3NSGA 3AA1A 3LK3B 4D5UA 4RJWA 4GCQA 4BUMX 5ADXK 4KRAA 3WI4A 4FZLA 4XNLA 7PRNA 4G75A 2XE3A 3FYXA 1QJ8A 1HXUA 4GF4A 4JCHA 1QJPA 4LSHA 2Y2XA 4N59A 3DA3A 3QRCA 1H6S1 3G7GA 1GFOA 4O49A 2K0LA 3SZDA 3SY7A 4C69X 4QQ1A 2ERVA 1HXXA 5DL7A 4LSFA 3PQUA 4FRTA 2Y0LA 1MM5A 4O3YA 5DL6A 3PRNA 3POXA 2O4VA 4FMSA 3VZWX 3HOEA 4AYEC 8PRNA 4FT6A 2YPVA 4XNKA 3V8UA 5GV0A 2JMMA 4AKRA 1Q9GA 1GFMA 4AYDC 6PRNA 2PORA 2QTKA 3RBHA 3AAAB 1ZHXA 4AYMC 4N58A 1ZHTA 2F1TA 3LK3A 3LK42 4O4UA 1IZNB 3HOLA 3UAQA 2FGQX 4O3ZA 3VY9X 4G76A 1THQA 1IZNA 2MNHA 4FSPA 2FGRA 3C5OA 2M07A 2J4UP 1PHOA 3A2SX 2ZLDA 1HXTA 2KZ7B 4FSOA 1GFQA 3KVDD 3VZUX 5FVNA 2F1VA 1ZHYA 3PQSA 4FZMA 2KZ7A 4GCSA 2OMFA 2XTQA 4LSIA 4RLBA 5T5FA 4E1TA 3K19A 5JDPA 2N2MA 1P4TA 3GP6A 1OSMA 3SYBA 4AYNA 3AA6B 4GHBA 3TZGA 4Z3TA 3HWBA 4FZNA 3VZTX 4AKMA 3AA6A 4AUIA 1E54A 2Y0HA 3T24A 2KXPB 3AA7B 5G26A 3PORA 3AAEB 4RLCA 2ZFGA 3AA7A 4AYID 4AZLA 2K4TA 3AAAA 4GCPA 5PRNA 4LSEA 2ODJA 5AFUL 3AAEA 3JTYA 1PRNA 3HW9A 3LK41 1BH3A 1G90A 5DL8A 3T0SA 4JFBA 2Y7SA 3UPGA 3POQA 1BXWA 1Q9FA 2J1NA 3T20A 2X27X 3VE1A 4D64A 2Y0KA 4O3XB 4KR4A 4RJXA 2XG6A 2N2LA 2KC0A 3WI5A 4AFKA 3AA0B 2XE2A 2LFUA 1OPFA 3EMNX 4B61A 1GFNA 1MM4A 1ORMA 2LHFA 2XTRA 4F4BA 3SZVA 2W81C 3AA0A 4D65A 3QRAA 1MPFA 2W80C 4FUVA 2YNKA 3O0EA 1GFPA 3SYSA 1QJ9A 2KXPA 1YS5A 4FOZA 4RL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SY9 A;  2XE5 A;  4FRX A;  3POU A;  3VY8 X;  2PRN A;  5DL5 A;  3UU2 A;  2XE1 A;  4KR8 A;  1BT9 A;  3NSG A;  4D5U A;  4RJW A;  4GCQ A;  4BUM X;  4KRA A;  3WI4 A;  7PRN A;  2XE3 A;  3FYX A;  1HXU A;  4LSH A;  2Y2X A;  1H6S 1;  1GFO A;  3SZD A;  3SY7 A;  4C69 X;  1HXX A;  5DL7 A;  4LSF A;  4FRT A;  2Y0L A;  5DL6 A;  3PRN A;  3POX A;  2O4V A;  4FMS A;  3VZW X;  8PRN A;  4FT6 A;  1GFM A;  6PRN A;  2POR A;  2QTK A;  2FGQ X;  3VY9 X;  4FSP A;  2FGR A;  2J4U P;  1PHO A;  3A2S X;  2ZLD A;  1HXT A;  4FSO A;  1GFQ A;  3VZU X;  5FVN A;  4GCS A;  2OMF A;  4LSI A;  3K19 A;  1OSM A;  3SYB A;  3HWB A;  3VZT X;  4AUI A;  1E54 A;  2Y0H A;  3T24 A;  3POR A;  2ZFG A;  2K4T A;  4GCP A;  5PRN A;  4LSE A;  2ODJ A;  3JTY A;  1PRN A;  3HW9 A;  1BH3 A;  5DL8 A;  3T0S A;  4JFB A;  3UPG A;  3POQ A;  2J1N A;  3T20 A;  4D64 A;  2Y0K A;  4KR4 A;  4RJX A;  2XG6 A;  3WI5 A;  2XE2 A;  1OPF A;  3EMN X;  1GFN A;  3SZV A;  4D65 A;  1MPF A;  3SYS A;  3O0E A;  1GFP A;  4FOZ A;  5JDP A; 
#chains in the Genus database with same CATH topology
 5D5D A;  3SY9 A;  2XE5 A;  4O4X A;  3VE2 A;  4FES A;  4FRX A;  2MHL A;  2R88 A;  3POU A;  5ADX L;  1ZHW A;  3LK2 B;  3DA4 A;  3DZM A;  2XMX A;  3VY8 X;  5IYU A;  2PRN A;  4E1S A;  4AYE C;  4PUX A;  1ZHZ A;  3LK2 A;  4O3W A;  2WJQ A;  5DL5 A;  5EE2 A;  5G39 A;  3PGS A;  4U9C A;  3UU2 A;  4AKR B;  2XE1 A;  3AA1 B;  2R4L A;  4KR8 A;  2M06 A;  1BT9 A;  2KDY A;  2GE4 A;  5AFU K;  3NSG A;  3AA1 A;  3LK3 B;  4D5U A;  2IWW A;  4RJW A;  4GCQ A;  4BUM X;  5ADX K;  4KRA A;  2IWV A;  5B66 O;  3WI4 A;  4FZL A;  4XNL A;  7PRN A;  4G75 A;  2XE3 A;  3FYX A;  1QJ8 A;  1HXU A;  4GF4 A;  4JCH A;  1QJP A;  4LSH A;  2Y2X A;  4N59 A;  3DA3 A;  3DWN A;  3QRC A;  1H6S 1;  2WVP A;  3G7G A;  2R4O A;  1GFO A;  4O49 A;  2K0L A;  5KAF O;  3SZD A;  3SY7 A;  4C69 X;  5H2F O;  4QQ1 A;  2ERV A;  1HXX A;  4K3B A;  4LSF A;  5DL7 A;  3PQU A;  4FRT A;  2Y0L A;  3BRZ A;  4C4V B;  1MM5 A;  4O3Y A;  3BRY A;  3PGU A;  5DL6 A;  2R8A A;  3POX A;  2O4V A;  3PRN A;  4FMS A;  3HOE A;  3KZI O;  3PGR A;  5GTI O;  4FT6 A;  3VZW X;  4C4V A;  8PRN A;  1T1L A;  2YPV A;  4XNK A;  3V8U A;  5GV0 A;  2JMM A;  2R4N A;  4AKR A;  1Q9G A;  1GFM A;  4AYD C;  6PRN A;  2POR A;  2QTK A;  3RBH A;  2WJR A;  3AAA B;  4FQE A;  3BS0 A;  1ZHX A;  4IL6 O;  4AYM C;  4CTD A;  4N58 A;  1ZHT A;  2F1T A;  3LK3 A;  3LK4 2;  4O4U A;  1IZN B;  3HOL A;  1T16 A;  4PJ0 O;  5G3A A;  3UAQ A;  4C00 A;  2FGQ X;  4O3Z A;  3A0H O;  3VY9 X;  5TIS O;  4G76 A;  1THQ A;  1IZN A;  2MNH A;  4FSP A;  2FGR A;  3C5O A;  2M07 A;  2J4U P;  1PHO A;  3A2S X;  2ZLD A;  1HXT A;  2KZ7 B;  4FSO A;  4UB6 O;  5KAI O;  1GFQ A;  3KVD D;  3VZU X;  5FVN A;  2F1V A;  1ZHY A;  3PQS A;  4FZM A;  2KZ7 A;  4GCS A;  2OMF A;  2XTQ A;  4LSI A;  4RLB A;  5T5F A;  4E1T A;  3K19 A;  5E79 O;  2N2M A;  1P4T A;  5JDP A;  3GP6 A;  1OSM A;  5B5E O;  3SYB A;  4AYN A;  3AA6 B;  4GHB A;  3TZG A;  4K3C A;  4Z3T A;  3HWB A;  4N75 A;  4FZN A;  3VZT X;  4AKM A;  3AA6 A;  4AUI A;  1E54 A;  2Y0H A;  3T24 A;  2KXP B;  3AA7 B;  4N74 A;  5G26 A;  3POR A;  5GTH O;  3AAE B;  4RLC A;  3WU2 O;  2ZFG A;  3AA7 A;  4AYI D;  4AZL A;  2K4T A;  3JCU O;  3AAA A;  4GCP A;  4UB8 O;  5PRN A;  4LSE A;  2ODJ A;  5AFU L;  3AAE A;  3DWO X;  3JTY A;  1PRN A;  3HW9 A;  3LK4 1;  1BH3 A;  1G90 A;  5DL8 A;  2X9K A;  3T0S A;  4JFB A;  2F1C X;  2JQY A;  2R89 A;  2Y7S A;  3PF1 A;  3POQ A;  5G38 A;  1BXW A;  3UPG A;  1S5L O;  1Q9F A;  2J1N A;  3T20 A;  2X27 X;  3VE1 A;  4D64 A;  2Y0K A;  3A0B O;  4O3X B;  4KR4 A;  4RJX A;  2XG6 A;  2N2L A;  2KC0 A;  4PR7 A;  3WI5 A;  4AFK A;  3AA0 B;  2XE2 A;  2LFU A;  1OPF A;  3EMN X;  4B61 A;  1GFN A;  1MM4 A;  1ORM A;  2AXT O;  2LHF A;  2R4P A;  2XTR A;  3NJT A;  3SZV A;  4F4B A;  2W81 C;  3AA0 A;  4D65 A;  3QRA A;  1MPF A;  2W80 C;  4FUV A;  2YNK A;  3O0E A;  1GFP A;  3SYS A;  1QJ9 A;  2KXP A;  1YS5 A;  4FOZ A;  4RL9 A; 
#chains in the Genus database with same CATH homology
 5D5D A;  3SY9 A;  2XE5 A;  4O4X A;  3VE2 A;  4FES A;  4FRX A;  2MHL A;  3POU A;  5ADX L;  1ZHW A;  3LK2 B;  3DA4 A;  2XMX A;  3VY8 X;  5IYU A;  2PRN A;  4E1S A;  4PUX A;  1ZHZ A;  3LK2 A;  4O3W A;  5DL5 A;  3UU2 A;  5EE2 A;  4U9C A;  4AKR B;  2XE1 A;  3AA1 B;  4KR8 A;  2M06 A;  1BT9 A;  2KDY A;  2GE4 A;  5AFU K;  3NSG A;  3AA1 A;  3LK3 B;  4D5U A;  4RJW A;  4GCQ A;  4BUM X;  5ADX K;  4KRA A;  3WI4 A;  4FZL A;  4XNL A;  7PRN A;  4G75 A;  2XE3 A;  3FYX A;  1QJ8 A;  1HXU A;  4GF4 A;  4JCH A;  1QJP A;  4LSH A;  2Y2X A;  4N59 A;  3DA3 A;  3QRC A;  1H6S 1;  3G7G A;  1GFO A;  4O49 A;  2K0L A;  3SZD A;  3SY7 A;  4C69 X;  4QQ1 A;  2ERV A;  1HXX A;  5DL7 A;  4LSF A;  3PQU A;  4FRT A;  2Y0L A;  1MM5 A;  4O3Y A;  5DL6 A;  3PRN A;  3POX A;  2O4V A;  4FMS A;  3VZW X;  3HOE A;  4AYE C;  8PRN A;  4FT6 A;  2YPV A;  4XNK A;  3V8U A;  5GV0 A;  2JMM A;  4AKR A;  1Q9G A;  1GFM A;  4AYD C;  6PRN A;  2POR A;  2QTK A;  3RBH A;  3AAA B;  1ZHX A;  4AYM C;  4N58 A;  1ZHT A;  2F1T A;  3LK3 A;  3LK4 2;  4O4U A;  1IZN B;  3HOL A;  3UAQ A;  2FGQ X;  4O3Z A;  3VY9 X;  4G76 A;  1THQ A;  1IZN A;  2MNH A;  4FSP A;  2FGR A;  3C5O A;  2M07 A;  2J4U P;  1PHO A;  3A2S X;  2ZLD A;  1HXT A;  2KZ7 B;  4FSO A;  1GFQ A;  3KVD D;  3VZU X;  5FVN A;  2F1V A;  1ZHY A;  3PQS A;  4FZM A;  2KZ7 A;  4GCS A;  2OMF A;  2XTQ A;  4LSI A;  4RLB A;  5T5F A;  4E1T A;  3K19 A;  5JDP A;  2N2M A;  1P4T A;  3GP6 A;  1OSM A;  3SYB A;  4AYN A;  3AA6 B;  4GHB A;  3TZG A;  4Z3T A;  3HWB A;  4FZN A;  3VZT X;  4AKM A;  3AA6 A;  4AUI A;  1E54 A;  2Y0H A;  3T24 A;  2KXP B;  3AA7 B;  5G26 A;  3POR A;  3AAE B;  4RLC A;  2ZFG A;  3AA7 A;  4AYI D;  4AZL A;  2K4T A;  3AAA A;  4GCP A;  5PRN A;  4LSE A;  2ODJ A;  5AFU L;  3AAE A;  3JTY A;  1PRN A;  3HW9 A;  3LK4 1;  1BH3 A;  1G90 A;  5DL8 A;  3T0S A;  4JFB A;  2Y7S A;  3UPG A;  3POQ A;  1BXW A;  1Q9F A;  2J1N A;  3T20 A;  2X27 X;  3VE1 A;  4D64 A;  2Y0K A;  4O3X B;  4KR4 A;  4RJX A;  2XG6 A;  2N2L A;  2KC0 A;  3WI5 A;  4AFK A;  3AA0 B;  2XE2 A;  2LFU A;  1OPF A;  3EMN X;  4B61 A;  1GFN A;  1MM4 A;  1ORM A;  2LHF A;  2XTR A;  4F4B A;  3SZV A;  2W81 C;  3AA0 A;  4D65 A;  3QRA A;  1MPF A;  2W80 C;  4FUV A;  2YNK A;  3O0E A;  1GFP A;  3SYS A;  1QJ9 A;  2KXP A;  1YS5 A;  4FOZ A;  4RL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...