4LSIA

Ion selectivity of ompf porin soaked in 0.3m kbr
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
334
structure length
334
Chain Sequence
DGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Outer membrane protein F
publication title A structural study of ion permeation in OmpF porin from anomalous X-ray diffraction and molecular dynamics simulations.
pubmed doi rcsb
source organism Escherichia coli
total genus 100
structure length 334
sequence length 334
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4lsiA00
2XE5A 2Y0KA 4D64A 5DL8A 1GFPA 2ZLDA 4KRAA 3JTYA 3PORA 4LSEA 4FRXA 7PRNA 2K4TA 4AUIA 3SZVA 1GFMA 1PHOA 4LSIA 3A2SX 3VY9X 3T20A 2XE2A 4LSHA 1HXXA 2QTKA 3POUA 2FGRA 3UPGA 3SZDA 2FGQX 1E54A 4FSPA 4RJXA 3WI4A 2J4UP 1PRNA 3WI5A 6PRNA 5DL7A 4KR8A 3T0SA 3EMNX 1OSMA 3VZUX 1GFQA 4RJWA 1GFNA 1MPFA 4KR4A 2XE3A 2ODJA 2ZFGA 3HW9A 4FMSA 3POXA 3SYSA 3K19A 4LSFA 1HXUA 1OPFA 1BT9A 4D65A 2O4VA 1HXTA 3VZTX 2OMFA 1GFOA 2XE1A 3T24A 4GCPA 2J1NA 5DL6A 2PORA 3VZWX 5PRNA 3SYBA 3VY8X 1H6S1 2XG6A 3NSGA 5FVNA 4BUMX 8PRNA 4JFBA 3POQA 4FOZA 1BH3A 3SY7A 4GCQA 2Y2XA 2Y0LA 4C69X 3HWBA 3UU2A 4FT6A 3SY9A 3O0EA 4D5UA 2PRNA 4GCSA 5DL5A 3PRNA 4FRTA 2Y0HA 5JDPA 3FYXA 4FSOA
chains in the Genus database with same CATH superfamily
2JMMA 2YNKA 4C4VA 4GHBA 4N74A 1ZHTA 2XE5A 2Y0KA 3AA0A 3AA6B 3KVDD 4AKRA 2W80C 4FZMA 4D64A 2R4LA 1GFPA 5DL8A 5B5EO 2ZLDA 4K3CA 4KRAA 4PJ0O 3JTYA 4O49A 3QRCA 3PORA 2JQYA 4FRXA 4LSEA 3LK3B 3AA1B 4N75A 4CTDA 4E1SA 3BRZA 2N2MA 1T1LA 2R89A 2K4TA 7PRNA 4PUXA 3G7GA 4AUIA 3SZVA 1GFMA 4PR7A 1PHOA 1ZHXA 4G76A 4LSIA 1QJ8A 3A2SX 4AKRB 2WJRA 3AA0B 3VY9X 4K3BA 4C00A 3T20A 1G90A 4RLBA 2XE2A 2KC0A 4LSHA 1HXXA 2QTKA 3POUA 2FGRA 5EE2A 3LK42 4E1TA 5IYUA 4XNLA 3VE2A 4IL6O 3UPGA 3BS0A 3SZDA 5TISO 2M07A 3PF1A 2FGQX 3HOEA 2XTQA 4O3YA 5G3AA 3PGRA 4Z3TA 1E54A 4FSPA 3PQUA 4AYDC 3V8UA 4RJXA 4QQ1A 3WI4A 3PGSA 4N58A 5KAIO 2J4UP 1PRNA 3DZMA 1ORMA 3WI5A 1ZHWA 2X27X 6PRNA 2LHFA 2WVPA 4N59A 1BXWA 2K0LA 2KXPB 5DL7A 4AYMC 4KR8A 1YS5A 1ZHZA 3A0HO 3T0SA 3EMNX 3BRYA 4FESA 3AA7A 1OSMA 4JCHA 3VZUX 4F4BA 5H2FO 2MNHA 1IZNB 1GFQA 4RJWA 5GV0A 2KDYA 4AYID 1GFNA 1MPFA 2AXTO 4KR4A 3VE1A 2XE3A 3AAEB 3WU2O 4AYNA 2ODJA 2ZFGA 2KXPA 3HW9A 4O3XB 4FQEA 4O4XA 3NJTA 4FMSA 3POXA 3PQSA 4RL9A 5G39A 3RBHA 3SYSA 5AFUL 1IZNA 2R8AA 3VZTX 3LK2B 3K19A 4LSFA 1T16A 1HXUA 1OPFA 1BT9A 2R4PA 3AA7B 3DWOX 3AAEA 2N2LA 5KAFO 4D65A 4XNKA 3UAQA 2Y7SA 2O4VA 1HXTA 3AAAA 2OMFA 2WJQA 1GFOA 2M06A 2XE1A 3GP6A 4FZLA 3JCUO 4FUVA 2F1VA 2X9KA 4GCPA 2J1NA 2ERVA 5DL6A 3T24A 4O3WA 5AFUK 3LK41 3TZGA 2PORA 2GE4A 3LK2A 3PGUA 4O4UA 4UB6O 1MM4A 2R4OA 3VZWX 5ADXL 2MHLA 1QJPA 4AZLA 5B66O 5PRNA 2W81C 4O3ZA 1QJ9A 3SYBA 3VY8X 2XMXA 4FZNA 1Q9GA 5GTHO 1H6S1 2XG6A 3DA4A 3AAAB 3NSGA 5FVNA 3QRAA 3DA3A 4BUMX 3HOLA 5GTIO 2YPVA 4GF4A 4JFBA 8PRNA 2R88A 4AYEC 3DWNA 3POQA 4FOZA 5G38A 1BH3A 2KZ7B 3SY7A 5ADXK 2XTRA 5T5FA 4UB8O 3C5OA 4GCQA 2Y2XA 2Y0LA 4C69X 2IWWA 1ZHYA 3HWBA 2R4NA 3AA6A 3UU2A 3KZIO 4FT6A 5D5DA 3SY9A 1S5LO 1P4TA 2F1CX 3O0EA 1THQA 2LFUA 2KZ7A 2IWVA 4C4VB 2PRNA 4GCSA 5DL5A 4D5UA 2F1TA 3PRNA 4U9CA 3LK3A 3AA1A 4AFKA 4AKMA 3A0BO 4FRTA 5G26A 1Q9FA 2Y0HA 4B61A 4G75A 1MM5A 4RLCA 5JDPA 3FYXA 5E79O 4FSOA
chains in the Genus database with same CATH topology
2JMMA 2YNKA 4GHBA 4AKRA 1ZHTA 2XE5A 2Y0KA 3AA0A 3AA6B 3KVDD 2W80C 4FZMA 4D64A 1GFPA 5DL8A 2ZLDA 4KRAA 3JTYA 4O49A 3QRCA 3PORA 4LSEA 4FRXA 3LK3B 3AA1B 4E1SA 2N2MA 7PRNA 2K4TA 4PUXA 3G7GA 4AUIA 3SZVA 1GFMA 1PHOA 1ZHXA 4G76A 4LSIA 1QJ8A 3A2SX 4AKRB 3AA0B 3VY9X 3T20A 1G90A 4RLBA 2XE2A 2KC0A 4LSHA 1HXXA 2QTKA 3POUA 2FGRA 5EE2A 3LK42 4E1TA 5IYUA 4XNLA 3VE2A 3UPGA 3SZDA 2M07A 2FGQX 3HOEA 2XTQA 4O3YA 4Z3TA 1E54A 4FSPA 3PQUA 4AYDC 3V8UA 4RJXA 4QQ1A 3WI4A 4N58A 2J4UP 1PRNA 1ORMA 3WI5A 1ZHWA 2X27X 6PRNA 2LHFA 4N59A 5DL7A 1BXWA 2K0LA 2KXPB 4AYMC 4KR8A 1YS5A 1ZHZA 3T0SA 3EMNX 4FESA 3AA7A 1OSMA 4JCHA 3VZUX 4F4BA 2MNHA 1IZNB 1GFQA 4RJWA 5GV0A 2KDYA 4AYID 1GFNA 1MPFA 4KR4A 3VE1A 2XE3A 3AAEB 4AYNA 2ODJA 2ZFGA 2KXPA 3HW9A 4O3XB 4O4XA 4FMSA 4RL9A 3POXA 3PQSA 3RBHA 3SYSA 5AFUL 1IZNA 3LK2B 3K19A 4LSFA 1HXUA 1OPFA 1BT9A 3AA7B 4D65A 3AAEA 2N2LA 4XNKA 3UAQA 2Y7SA 2O4VA 1HXTA 3AAAA 2OMFA 4FZLA 1GFOA 2M06A 2XE1A 3GP6A 3VZTX 4FUVA 3T24A 2F1VA 4GCPA 2J1NA 2ERVA 5DL6A 4O3WA 5AFUK 3LK41 3TZGA 2PORA 2GE4A 3LK2A 4O4UA 1MM4A 3VZWX 5ADXL 2MHLA 1QJPA 4AZLA 5PRNA 2W81C 4O3ZA 1QJ9A 3SYBA 3VY8X 2XMXA 4FZNA 1Q9GA 1H6S1 2XG6A 3DA4A 3AAAB 3NSGA 5FVNA 3QRAA 3DA3A 4BUMX 3HOLA 2YPVA 4GF4A 4JFBA 8PRNA 4AYEC 3POQA 4FOZA 1BH3A 2KZ7B 3SY7A 5ADXK 2XTRA 5T5FA 3C5OA 4GCQA 2Y2XA 2Y0LA 4C69X 1ZHYA 3HWBA 3AA6A 3UU2A 4FT6A 5D5DA 3SY9A 1P4TA 3O0EA 1THQA 2LFUA 2KZ7A 4D5UA 2PRNA 4GCSA 5DL5A 2F1TA 3PRNA 4U9CA 3LK3A 3AA1A 4AFKA 4AKMA 4FRTA 5G26A 1Q9FA 2Y0HA 4B61A 4G75A 1MM5A 4RLCA 5JDPA 3FYXA 4FSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XE5 A;  2Y0K A;  4D64 A;  5DL8 A;  1GFP A;  2ZLD A;  4KRA A;  3JTY A;  3POR A;  4LSE A;  4FRX A;  7PRN A;  2K4T A;  4AUI A;  3SZV A;  1GFM A;  1PHO A;  4LSI A;  3A2S X;  3VY9 X;  3T20 A;  2XE2 A;  4LSH A;  1HXX A;  2QTK A;  3POU A;  2FGR A;  3UPG A;  3SZD A;  2FGQ X;  1E54 A;  4FSP A;  4RJX A;  3WI4 A;  2J4U P;  1PRN A;  3WI5 A;  6PRN A;  5DL7 A;  4KR8 A;  3T0S A;  3EMN X;  1OSM A;  3VZU X;  1GFQ A;  4RJW A;  1GFN A;  1MPF A;  4KR4 A;  2XE3 A;  2ODJ A;  2ZFG A;  3HW9 A;  4FMS A;  3POX A;  3SYS A;  3K19 A;  4LSF A;  1HXU A;  1OPF A;  1BT9 A;  4D65 A;  2O4V A;  1HXT A;  3VZT X;  2OMF A;  1GFO A;  2XE1 A;  3T24 A;  4GCP A;  2J1N A;  5DL6 A;  2POR A;  3VZW X;  5PRN A;  3SYB A;  3VY8 X;  1H6S 1;  2XG6 A;  3NSG A;  5FVN A;  4BUM X;  8PRN A;  4JFB A;  3POQ A;  4FOZ A;  1BH3 A;  3SY7 A;  4GCQ A;  2Y2X A;  2Y0L A;  4C69 X;  3HWB A;  3UU2 A;  4FT6 A;  3SY9 A;  3O0E A;  4D5U A;  2PRN A;  4GCS A;  5DL5 A;  3PRN A;  4FRT A;  2Y0H A;  5JDP A;  3FYX A;  4FSO A; 
#chains in the Genus database with same CATH topology
 2JMM A;  2YNK A;  4C4V A;  4GHB A;  4N74 A;  1ZHT A;  2XE5 A;  2Y0K A;  3AA0 A;  3AA6 B;  3KVD D;  4AKR A;  2W80 C;  4FZM A;  4D64 A;  2R4L A;  1GFP A;  5DL8 A;  5B5E O;  2ZLD A;  4K3C A;  4KRA A;  4PJ0 O;  3JTY A;  4O49 A;  3QRC A;  3POR A;  2JQY A;  4FRX A;  4LSE A;  3LK3 B;  3AA1 B;  4N75 A;  4CTD A;  4E1S A;  3BRZ A;  2N2M A;  1T1L A;  2R89 A;  2K4T A;  7PRN A;  4PUX A;  3G7G A;  4AUI A;  3SZV A;  1GFM A;  4PR7 A;  1PHO A;  1ZHX A;  4G76 A;  4LSI A;  1QJ8 A;  3A2S X;  4AKR B;  2WJR A;  3AA0 B;  3VY9 X;  4K3B A;  4C00 A;  3T20 A;  1G90 A;  4RLB A;  2XE2 A;  2KC0 A;  4LSH A;  1HXX A;  2QTK A;  3POU A;  2FGR A;  5EE2 A;  3LK4 2;  4E1T A;  5IYU A;  4XNL A;  3VE2 A;  4IL6 O;  3UPG A;  3BS0 A;  3SZD A;  5TIS O;  2M07 A;  3PF1 A;  2FGQ X;  3HOE A;  2XTQ A;  4O3Y A;  5G3A A;  3PGR A;  4Z3T A;  1E54 A;  4FSP A;  3PQU A;  4AYD C;  3V8U A;  4RJX A;  4QQ1 A;  3WI4 A;  3PGS A;  4N58 A;  5KAI O;  2J4U P;  1PRN A;  3DZM A;  1ORM A;  3WI5 A;  1ZHW A;  2X27 X;  6PRN A;  2LHF A;  2WVP A;  4N59 A;  1BXW A;  2K0L A;  2KXP B;  5DL7 A;  4AYM C;  4KR8 A;  1YS5 A;  1ZHZ A;  3A0H O;  3T0S A;  3EMN X;  3BRY A;  4FES A;  3AA7 A;  1OSM A;  4JCH A;  3VZU X;  4F4B A;  5H2F O;  2MNH A;  1IZN B;  1GFQ A;  4RJW A;  5GV0 A;  2KDY A;  4AYI D;  1GFN A;  1MPF A;  2AXT O;  4KR4 A;  3VE1 A;  2XE3 A;  3AAE B;  3WU2 O;  4AYN A;  2ODJ A;  2ZFG A;  2KXP A;  3HW9 A;  4O3X B;  4FQE A;  4O4X A;  3NJT A;  4FMS A;  3POX A;  3PQS A;  4RL9 A;  5G39 A;  3RBH A;  3SYS A;  5AFU L;  1IZN A;  2R8A A;  3VZT X;  3LK2 B;  3K19 A;  4LSF A;  1T16 A;  1HXU A;  1OPF A;  1BT9 A;  2R4P A;  3AA7 B;  3DWO X;  3AAE A;  2N2L A;  5KAF O;  4D65 A;  4XNK A;  3UAQ A;  2Y7S A;  2O4V A;  1HXT A;  3AAA A;  2OMF A;  2WJQ A;  1GFO A;  2M06 A;  2XE1 A;  3GP6 A;  4FZL A;  3JCU O;  4FUV A;  2F1V A;  2X9K A;  4GCP A;  2J1N A;  2ERV A;  5DL6 A;  3T24 A;  4O3W A;  5AFU K;  3LK4 1;  3TZG A;  2POR A;  2GE4 A;  3LK2 A;  3PGU A;  4O4U A;  4UB6 O;  1MM4 A;  2R4O A;  3VZW X;  5ADX L;  2MHL A;  1QJP A;  4AZL A;  5B66 O;  5PRN A;  2W81 C;  4O3Z A;  1QJ9 A;  3SYB A;  3VY8 X;  2XMX A;  4FZN A;  1Q9G A;  5GTH O;  1H6S 1;  2XG6 A;  3DA4 A;  3AAA B;  3NSG A;  5FVN A;  3QRA A;  3DA3 A;  4BUM X;  3HOL A;  5GTI O;  2YPV A;  4GF4 A;  4JFB A;  8PRN A;  2R88 A;  4AYE C;  3DWN A;  3POQ A;  4FOZ A;  5G38 A;  1BH3 A;  2KZ7 B;  3SY7 A;  5ADX K;  2XTR A;  5T5F A;  4UB8 O;  3C5O A;  4GCQ A;  2Y2X A;  2Y0L A;  4C69 X;  2IWW A;  1ZHY A;  3HWB A;  2R4N A;  3AA6 A;  3UU2 A;  3KZI O;  4FT6 A;  5D5D A;  3SY9 A;  1S5L O;  1P4T A;  2F1C X;  3O0E A;  1THQ A;  2LFU A;  2KZ7 A;  2IWV A;  4C4V B;  2PRN A;  4GCS A;  5DL5 A;  4D5U A;  2F1T A;  3PRN A;  4U9C A;  3LK3 A;  3AA1 A;  4AFK A;  4AKM A;  3A0B O;  4FRT A;  5G26 A;  1Q9F A;  2Y0H A;  4B61 A;  4G75 A;  1MM5 A;  4RLC A;  5JDP A;  3FYX A;  5E79 O;  4FSO A; 
#chains in the Genus database with same CATH homology
 2JMM A;  2YNK A;  4GHB A;  4AKR A;  1ZHT A;  2XE5 A;  2Y0K A;  3AA0 A;  3AA6 B;  3KVD D;  2W80 C;  4FZM A;  4D64 A;  1GFP A;  5DL8 A;  2ZLD A;  4KRA A;  3JTY A;  4O49 A;  3QRC A;  3POR A;  4LSE A;  4FRX A;  3LK3 B;  3AA1 B;  4E1S A;  2N2M A;  7PRN A;  2K4T A;  4PUX A;  3G7G A;  4AUI A;  3SZV A;  1GFM A;  1PHO A;  1ZHX A;  4G76 A;  4LSI A;  1QJ8 A;  3A2S X;  4AKR B;  3AA0 B;  3VY9 X;  3T20 A;  1G90 A;  4RLB A;  2XE2 A;  2KC0 A;  4LSH A;  1HXX A;  2QTK A;  3POU A;  2FGR A;  5EE2 A;  3LK4 2;  4E1T A;  5IYU A;  4XNL A;  3VE2 A;  3UPG A;  3SZD A;  2M07 A;  2FGQ X;  3HOE A;  2XTQ A;  4O3Y A;  4Z3T A;  1E54 A;  4FSP A;  3PQU A;  4AYD C;  3V8U A;  4RJX A;  4QQ1 A;  3WI4 A;  4N58 A;  2J4U P;  1PRN A;  1ORM A;  3WI5 A;  1ZHW A;  2X27 X;  6PRN A;  2LHF A;  4N59 A;  5DL7 A;  1BXW A;  2K0L A;  2KXP B;  4AYM C;  4KR8 A;  1YS5 A;  1ZHZ A;  3T0S A;  3EMN X;  4FES A;  3AA7 A;  1OSM A;  4JCH A;  3VZU X;  4F4B A;  2MNH A;  1IZN B;  1GFQ A;  4RJW A;  5GV0 A;  2KDY A;  4AYI D;  1GFN A;  1MPF A;  4KR4 A;  3VE1 A;  2XE3 A;  3AAE B;  4AYN A;  2ODJ A;  2ZFG A;  2KXP A;  3HW9 A;  4O3X B;  4O4X A;  4FMS A;  4RL9 A;  3POX A;  3PQS A;  3RBH A;  3SYS A;  5AFU L;  1IZN A;  3LK2 B;  3K19 A;  4LSF A;  1HXU A;  1OPF A;  1BT9 A;  3AA7 B;  4D65 A;  3AAE A;  2N2L A;  4XNK A;  3UAQ A;  2Y7S A;  2O4V A;  1HXT A;  3AAA A;  2OMF A;  4FZL A;  1GFO A;  2M06 A;  2XE1 A;  3GP6 A;  3VZT X;  4FUV A;  3T24 A;  2F1V A;  4GCP A;  2J1N A;  2ERV A;  5DL6 A;  4O3W A;  5AFU K;  3LK4 1;  3TZG A;  2POR A;  2GE4 A;  3LK2 A;  4O4U A;  1MM4 A;  3VZW X;  5ADX L;  2MHL A;  1QJP A;  4AZL A;  5PRN A;  2W81 C;  4O3Z A;  1QJ9 A;  3SYB A;  3VY8 X;  2XMX A;  4FZN A;  1Q9G A;  1H6S 1;  2XG6 A;  3DA4 A;  3AAA B;  3NSG A;  5FVN A;  3QRA A;  3DA3 A;  4BUM X;  3HOL A;  2YPV A;  4GF4 A;  4JFB A;  8PRN A;  4AYE C;  3POQ A;  4FOZ A;  1BH3 A;  2KZ7 B;  3SY7 A;  5ADX K;  2XTR A;  5T5F A;  3C5O A;  4GCQ A;  2Y2X A;  2Y0L A;  4C69 X;  1ZHY A;  3HWB A;  3AA6 A;  3UU2 A;  4FT6 A;  5D5D A;  3SY9 A;  1P4T A;  3O0E A;  1THQ A;  2LFU A;  2KZ7 A;  4D5U A;  2PRN A;  4GCS A;  5DL5 A;  2F1T A;  3PRN A;  4U9C A;  3LK3 A;  3AA1 A;  4AFK A;  4AKM A;  4FRT A;  5G26 A;  1Q9F A;  2Y0H A;  4B61 A;  4G75 A;  1MM5 A;  4RLC A;  5JDP A;  3FYX A;  4FSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...