4LSIA

Ion selectivity of ompf porin soaked in 0.3m kbr
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
334
structure length
334
Chain Sequence
DGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural study of ion permeation in OmpF porin from anomalous X-ray diffraction and molecular dynamics simulations.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Outer membrane protein F
total genus 100
structure length 334
sequence length 334
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4lsiA00
3T0SA 3O0EA 3SY9A 3UU2A 1MPFA 4FRTA 2PRNA 4D64A 1GFPA 2Y0HA 1HXUA 4JFBA 3POQA 5FVNA 1PRNA 2XE5A 2ZLDA 4AUIA 1E54A 4RJWA 2J1NA 3T24A 3A2SX 5JDPA 2J4UP 3SZDA 1H6S1 4D65A 4LSIA 3K19A 2O4VA 2Y0LA 3VY8X 5DL8A 1HXXA 3POUA 3PRNA 2XE1A 2XE3A 1GFOA 5DL6A 5DL5A 2OMFA 1BT9A 2XE2A 3FYXA 4LSFA 3PORA 4KR8A 5DL7A 3EMNX 2ZFGA 2ODJA 3VZUX 2FGRA 1PHOA 4FMSA 4D5UA 4GCSA 2Y0KA 3SYBA 2FGQX 3UPGA 4C69X 3WI5A 2K4TA 4KRAA 1OSMA 4KR4A 1GFNA 1OPFA 4GCPA 7PRNA 3HW9A 3VZTX 1GFQA 1BH3A 3SZVA 3VY9X 4BUMX 4FT6A 4LSHA 3VZWX 3T20A 3POXA 8PRNA 4RJXA 3NSGA 4FSOA 3SY7A 1GFMA 3HWBA 6PRNA 2PORA 5PRNA 1HXTA 2XG6A 3JTYA 4FRXA 4FOZA 2QTKA 4FSPA 4GCQA 3SYSA 4LSEA 2Y2XA 3WI4A
chains in the Genus database with same CATH superfamily
3T0SA 3O0EA 3SY9A 3UU2A 3AA0A 1MPFA 4FRTA 5H2FO 4N59A 5AFUK 2JQYA 2IWVA 4UB8O 4C00A 5AFUL 2KC0A 2PRNA 4D64A 1GFPA 2Y0HA 2GE4A 1HXUA 1Q9GA 4G76A 4JFBA 3POQA 5FVNA 3PF1A 5G26A 4RLCA 1MM5A 1IZNB 1PRNA 2LHFA 2XE5A 4FZNA 4N75A 2ZLDA 4AUIA 4O4XA 1E54A 4RJWA 5GTIO 2J1NA 3LK41 3T24A 3A2SX 3LK3B 5E79O 5JDPA 3PGUA 5T5FA 4AYDC 3SZDA 2J4UP 1H6S1 3AA6A 3BRYA 5EE2A 2WVPA 4D65A 4LSIA 3K19A 1ZHZA 2O4VA 4O49A 3GP6A 4AYNA 4F4BA 3HOEA 5IYUA 3AAAB 3DZMA 2N2MA 4N74A 2Y0LA 3AAEA 3VY8X 3LK3A 4C4VB 3BS0A 1P4TA 3AAAA 3AA6B 5DL8A 1HXXA 1S5LO 2MHLA 3POUA 2XE1A 3PRNA 2XE3A 1GFOA 4E1TA 4GHBA 5DL6A 2MNHA 3TZGA 2R4OA 3DWNA 5DL5A 2R4NA 4AZLA 1ZHXA 5B5EO 2OMFA 1BT9A 2XE2A 4B61A 4E1SA 5ADXL 2KXPB 1ZHYA 5G3AA 4FZMA 3JCUO 2F1VA 4QQ1A 3FYXA 3KVDD 4AKRB 4LSFA 5B66O 3G7GA 4PJ0O 3PORA 5TISO 1G90A 3A0BO 4KR8A 2Y7SA 2YPVA 5DL7A 4CTDA 3EMNX 3PGSA 4AFKA 2R89A 2ZFGA 2ODJA 1BXWA 4AYMC 2W81C 3AA7A 2YNKA 3VZUX 3VE2A 2FGRA 1ZHWA 4FQEA 1PHOA 3LK2B 3QRCA 1ZHTA 2X27X 3BRZA 4FMSA 4O3XB 3A0HO 4FZLA 4K3CA 5KAFO 4D5UA 4GCSA 2Y0KA 2IWWA 2KDYA 1Q9FA 3KZIO 3SYBA 3DA3A 3AA7B 3AAEB 4RL9A 2FGQX 3PGRA 2F1CX 3UPGA 2M07A 2W80C 4C69X 4AKMA 4PR7A 2WJQA 4C4VA 4FUVA 2R4LA 3WI5A 4N58A 2ERVA 4GF4A 4O3YA 2XTRA 2K4TA 4KRAA 3DWOX 4O3ZA 1OSMA 2KXPA 4KR4A 3AA1A 4XNKA 1GFNA 2KZ7A 4O4UA 1OPFA 5GTHO 4GCPA 2XTQA 4JCHA 2AXTO 4Z3TA 2R88A 7PRNA 3UAQA 3HW9A 3QRAA 3VZTX 1GFQA 3WU2O 2N2LA 3PQSA 1BH3A 3SZVA 3NJTA 3LK2A 3VY9X 4BUMX 4FT6A 4LSHA 5GV0A 2K0LA 3DA4A 5KAIO 3VZWX 2KZ7B 3T20A 4XNLA 2R4PA 1ORMA 4IL6O 3LK42 4U9CA 3AA1B 3POXA 4G75A 2JMMA 2X9KA 1IZNA 4PUXA 5D5DA 1YS5A 3PQUA 4RJXA 3RBHA 4AYID 8PRNA 1QJ8A 1T1LA 3NSGA 4FSOA 3SY7A 2R8AA 3VE1A 3AA0B 2M06A 4FESA 2Y2XA 1GFMA 1MM4A 2LFUA 3HWBA 4AKRA 6PRNA 2PORA 1T16A 4RLBA 5PRNA 1HXTA 2WJRA 2XG6A 3JTYA 4FRXA 5ADXK 1QJ9A 4FOZA 5G38A 2QTKA 3C5OA 1THQA 3HOLA 4O3WA 2XMXA 4FSPA 4GCQA 3SYSA 3WI4A 5G39A 2F1TA 4K3BA 1QJPA 4LSEA 4AYEC 3V8UA 4UB6O
chains in the Genus database with same CATH topology
3T0SA 3O0EA 3SY9A 3UU2A 3AA0A 1MPFA 4FRTA 4N59A 5AFUK 5AFUL 2KC0A 2PRNA 4D64A 1GFPA 2Y0HA 2GE4A 1HXUA 1Q9GA 4G76A 4JFBA 3POQA 5FVNA 5G26A 4RLCA 1MM5A 1IZNB 1PRNA 2LHFA 2XE5A 4FZNA 2ZLDA 4AUIA 4O4XA 1E54A 4RJWA 2J1NA 3LK41 3T24A 3A2SX 3LK3B 5JDPA 5T5FA 2J4UP 4AYDC 3SZDA 1H6S1 3AA6A 5EE2A 4D65A 4LSIA 3K19A 1ZHZA 2O4VA 4O49A 3GP6A 4AYNA 4F4BA 3HOEA 5IYUA 3AAAB 2N2MA 2Y0LA 3AAEA 3VY8X 3LK3A 1P4TA 3AAAA 3AA6B 5DL8A 1HXXA 3POUA 2MHLA 3PRNA 2XE1A 4E1TA 2XE3A 1GFOA 4GHBA 5DL6A 2MNHA 3TZGA 5DL5A 4AZLA 1ZHXA 2OMFA 1BT9A 2XE2A 4B61A 4E1SA 5ADXL 2KXPB 1ZHYA 4FZMA 4QQ1A 2F1VA 3FYXA 3KVDD 4AKRB 4LSFA 1G90A 3G7GA 3PORA 4KR8A 2Y7SA 2YPVA 5DL7A 3EMNX 4AFKA 4AYMC 2ZFGA 2ODJA 1BXWA 2W81C 3AA7A 2YNKA 3VZUX 3VE2A 2FGRA 1ZHWA 1PHOA 3LK2B 3QRCA 1ZHTA 2X27X 4FMSA 4D5UA 4O3XB 4FZLA 4GCSA 2Y0KA 2KDYA 1Q9FA 3SYBA 3DA3A 3AA7B 3AAEB 4RL9A 2FGQX 3UPGA 2M07A 2W80C 4C69X 4AKMA 4FUVA 1QJPA 3WI5A 4N58A 2ERVA 4GF4A 4O3YA 2XTRA 2K4TA 4KRAA 4O3ZA 1OSMA 2KXPA 4KR4A 3AA1A 4XNKA 1GFNA 2KZ7A 4O4UA 1OPFA 4GCPA 2XTQA 4JCHA 4Z3TA 7PRNA 3UAQA 3HW9A 3QRAA 3VZTX 1GFQA 2N2LA 3PQSA 1BH3A 3SZVA 5GV0A 3LK2A 3VY9X 4BUMX 4FT6A 4LSHA 2K0LA 3DA4A 3VZWX 3T20A 2KZ7B 4XNLA 1ORMA 3LK42 4U9CA 3AA1B 3POXA 4G75A 2JMMA 5D5DA 1IZNA 4PUXA 8PRNA 1YS5A 3PQUA 4RJXA 3RBHA 4AYID 1QJ8A 3NSGA 4FSOA 3SY7A 3VE1A 3AA0B 2M06A 4FESA 1GFMA 1MM4A 2LFUA 3HWBA 4AKRA 6PRNA 2PORA 4RLBA 5PRNA 1HXTA 2XG6A 3JTYA 4FRXA 5ADXK 1QJ9A 4FOZA 2QTKA 3C5OA 1THQA 3HOLA 4O3WA 2XMXA 4FSPA 4GCQA 3SYSA 2F1TA 4LSEA 2Y2XA 3WI4A 4AYEC 3V8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T0S A;  3O0E A;  3SY9 A;  3UU2 A;  1MPF A;  4FRT A;  2PRN A;  4D64 A;  1GFP A;  2Y0H A;  1HXU A;  4JFB A;  3POQ A;  5FVN A;  1PRN A;  2XE5 A;  2ZLD A;  4AUI A;  1E54 A;  4RJW A;  2J1N A;  3T24 A;  3A2S X;  5JDP A;  2J4U P;  3SZD A;  1H6S 1;  4D65 A;  4LSI A;  3K19 A;  2O4V A;  2Y0L A;  3VY8 X;  5DL8 A;  1HXX A;  3POU A;  3PRN A;  2XE1 A;  2XE3 A;  1GFO A;  5DL6 A;  5DL5 A;  2OMF A;  1BT9 A;  2XE2 A;  3FYX A;  4LSF A;  3POR A;  4KR8 A;  5DL7 A;  3EMN X;  2ZFG A;  2ODJ A;  3VZU X;  2FGR A;  1PHO A;  4FMS A;  4D5U A;  4GCS A;  2Y0K A;  3SYB A;  2FGQ X;  3UPG A;  4C69 X;  3WI5 A;  2K4T A;  4KRA A;  1OSM A;  4KR4 A;  1GFN A;  1OPF A;  4GCP A;  7PRN A;  3HW9 A;  3VZT X;  1GFQ A;  1BH3 A;  3SZV A;  3VY9 X;  4BUM X;  4FT6 A;  4LSH A;  3VZW X;  3T20 A;  3POX A;  8PRN A;  4RJX A;  3NSG A;  4FSO A;  3SY7 A;  1GFM A;  3HWB A;  6PRN A;  2POR A;  5PRN A;  1HXT A;  2XG6 A;  3JTY A;  4FRX A;  4FOZ A;  2QTK A;  4FSP A;  4GCQ A;  3SYS A;  4LSE A;  2Y2X A;  3WI4 A; 
#chains in the Genus database with same CATH topology
 3T0S A;  3O0E A;  3SY9 A;  3UU2 A;  3AA0 A;  1MPF A;  4FRT A;  5H2F O;  4N59 A;  5AFU K;  2JQY A;  2IWV A;  4UB8 O;  4C00 A;  5AFU L;  2KC0 A;  2PRN A;  4D64 A;  1GFP A;  2Y0H A;  2GE4 A;  1HXU A;  1Q9G A;  4G76 A;  4JFB A;  3POQ A;  5FVN A;  3PF1 A;  5G26 A;  4RLC A;  1MM5 A;  1IZN B;  1PRN A;  2LHF A;  2XE5 A;  4FZN A;  4N75 A;  2ZLD A;  4AUI A;  4O4X A;  1E54 A;  4RJW A;  5GTI O;  2J1N A;  3LK4 1;  3T24 A;  3A2S X;  3LK3 B;  5E79 O;  5JDP A;  3PGU A;  5T5F A;  4AYD C;  3SZD A;  2J4U P;  1H6S 1;  3AA6 A;  3BRY A;  5EE2 A;  2WVP A;  4D65 A;  4LSI A;  3K19 A;  1ZHZ A;  2O4V A;  4O49 A;  3GP6 A;  4AYN A;  4F4B A;  3HOE A;  5IYU A;  3AAA B;  3DZM A;  2N2M A;  4N74 A;  2Y0L A;  3AAE A;  3VY8 X;  3LK3 A;  4C4V B;  3BS0 A;  1P4T A;  3AAA A;  3AA6 B;  5DL8 A;  1HXX A;  1S5L O;  2MHL A;  3POU A;  2XE1 A;  3PRN A;  2XE3 A;  1GFO A;  4E1T A;  4GHB A;  5DL6 A;  2MNH A;  3TZG A;  2R4O A;  3DWN A;  5DL5 A;  2R4N A;  4AZL A;  1ZHX A;  5B5E O;  2OMF A;  1BT9 A;  2XE2 A;  4B61 A;  4E1S A;  5ADX L;  2KXP B;  1ZHY A;  5G3A A;  4FZM A;  3JCU O;  2F1V A;  4QQ1 A;  3FYX A;  3KVD D;  4AKR B;  4LSF A;  5B66 O;  3G7G A;  4PJ0 O;  3POR A;  5TIS O;  1G90 A;  3A0B O;  4KR8 A;  2Y7S A;  2YPV A;  5DL7 A;  4CTD A;  3EMN X;  3PGS A;  4AFK A;  2R89 A;  2ZFG A;  2ODJ A;  1BXW A;  4AYM C;  2W81 C;  3AA7 A;  2YNK A;  3VZU X;  3VE2 A;  2FGR A;  1ZHW A;  4FQE A;  1PHO A;  3LK2 B;  3QRC A;  1ZHT A;  2X27 X;  3BRZ A;  4FMS A;  4O3X B;  3A0H O;  4FZL A;  4K3C A;  5KAF O;  4D5U A;  4GCS A;  2Y0K A;  2IWW A;  2KDY A;  1Q9F A;  3KZI O;  3SYB A;  3DA3 A;  3AA7 B;  3AAE B;  4RL9 A;  2FGQ X;  3PGR A;  2F1C X;  3UPG A;  2M07 A;  2W80 C;  4C69 X;  4AKM A;  4PR7 A;  2WJQ A;  4C4V A;  4FUV A;  2R4L A;  3WI5 A;  4N58 A;  2ERV A;  4GF4 A;  4O3Y A;  2XTR A;  2K4T A;  4KRA A;  3DWO X;  4O3Z A;  1OSM A;  2KXP A;  4KR4 A;  3AA1 A;  4XNK A;  1GFN A;  2KZ7 A;  4O4U A;  1OPF A;  5GTH O;  4GCP A;  2XTQ A;  4JCH A;  2AXT O;  4Z3T A;  2R88 A;  7PRN A;  3UAQ A;  3HW9 A;  3QRA A;  3VZT X;  1GFQ A;  3WU2 O;  2N2L A;  3PQS A;  1BH3 A;  3SZV A;  3NJT A;  3LK2 A;  3VY9 X;  4BUM X;  4FT6 A;  4LSH A;  5GV0 A;  2K0L A;  3DA4 A;  5KAI O;  3VZW X;  2KZ7 B;  3T20 A;  4XNL A;  2R4P A;  1ORM A;  4IL6 O;  3LK4 2;  4U9C A;  3AA1 B;  3POX A;  4G75 A;  2JMM A;  2X9K A;  1IZN A;  4PUX A;  5D5D A;  1YS5 A;  3PQU A;  4RJX A;  3RBH A;  4AYI D;  8PRN A;  1QJ8 A;  1T1L A;  3NSG A;  4FSO A;  3SY7 A;  2R8A A;  3VE1 A;  3AA0 B;  2M06 A;  4FES A;  2Y2X A;  1GFM A;  1MM4 A;  2LFU A;  3HWB A;  4AKR A;  6PRN A;  2POR A;  1T16 A;  4RLB A;  5PRN A;  1HXT A;  2WJR A;  2XG6 A;  3JTY A;  4FRX A;  5ADX K;  1QJ9 A;  4FOZ A;  5G38 A;  2QTK A;  3C5O A;  1THQ A;  3HOL A;  4O3W A;  2XMX A;  4FSP A;  4GCQ A;  3SYS A;  3WI4 A;  5G39 A;  2F1T A;  4K3B A;  1QJP A;  4LSE A;  4AYE C;  3V8U A;  4UB6 O; 
#chains in the Genus database with same CATH homology
 3T0S A;  3O0E A;  3SY9 A;  3UU2 A;  3AA0 A;  1MPF A;  4FRT A;  4N59 A;  5AFU K;  5AFU L;  2KC0 A;  2PRN A;  4D64 A;  1GFP A;  2Y0H A;  2GE4 A;  1HXU A;  1Q9G A;  4G76 A;  4JFB A;  3POQ A;  5FVN A;  5G26 A;  4RLC A;  1MM5 A;  1IZN B;  1PRN A;  2LHF A;  2XE5 A;  4FZN A;  2ZLD A;  4AUI A;  4O4X A;  1E54 A;  4RJW A;  2J1N A;  3LK4 1;  3T24 A;  3A2S X;  3LK3 B;  5JDP A;  5T5F A;  2J4U P;  4AYD C;  3SZD A;  1H6S 1;  3AA6 A;  5EE2 A;  4D65 A;  4LSI A;  3K19 A;  1ZHZ A;  2O4V A;  4O49 A;  3GP6 A;  4AYN A;  4F4B A;  3HOE A;  5IYU A;  3AAA B;  2N2M A;  2Y0L A;  3AAE A;  3VY8 X;  3LK3 A;  1P4T A;  3AAA A;  3AA6 B;  5DL8 A;  1HXX A;  3POU A;  2MHL A;  3PRN A;  2XE1 A;  4E1T A;  2XE3 A;  1GFO A;  4GHB A;  5DL6 A;  2MNH A;  3TZG A;  5DL5 A;  4AZL A;  1ZHX A;  2OMF A;  1BT9 A;  2XE2 A;  4B61 A;  4E1S A;  5ADX L;  2KXP B;  1ZHY A;  4FZM A;  4QQ1 A;  2F1V A;  3FYX A;  3KVD D;  4AKR B;  4LSF A;  1G90 A;  3G7G A;  3POR A;  4KR8 A;  2Y7S A;  2YPV A;  5DL7 A;  3EMN X;  4AFK A;  4AYM C;  2ZFG A;  2ODJ A;  1BXW A;  2W81 C;  3AA7 A;  2YNK A;  3VZU X;  3VE2 A;  2FGR A;  1ZHW A;  1PHO A;  3LK2 B;  3QRC A;  1ZHT A;  2X27 X;  4FMS A;  4D5U A;  4O3X B;  4FZL A;  4GCS A;  2Y0K A;  2KDY A;  1Q9F A;  3SYB A;  3DA3 A;  3AA7 B;  3AAE B;  4RL9 A;  2FGQ X;  3UPG A;  2M07 A;  2W80 C;  4C69 X;  4AKM A;  4FUV A;  1QJP A;  3WI5 A;  4N58 A;  2ERV A;  4GF4 A;  4O3Y A;  2XTR A;  2K4T A;  4KRA A;  4O3Z A;  1OSM A;  2KXP A;  4KR4 A;  3AA1 A;  4XNK A;  1GFN A;  2KZ7 A;  4O4U A;  1OPF A;  4GCP A;  2XTQ A;  4JCH A;  4Z3T A;  7PRN A;  3UAQ A;  3HW9 A;  3QRA A;  3VZT X;  1GFQ A;  2N2L A;  3PQS A;  1BH3 A;  3SZV A;  5GV0 A;  3LK2 A;  3VY9 X;  4BUM X;  4FT6 A;  4LSH A;  2K0L A;  3DA4 A;  3VZW X;  3T20 A;  2KZ7 B;  4XNL A;  1ORM A;  3LK4 2;  4U9C A;  3AA1 B;  3POX A;  4G75 A;  2JMM A;  5D5D A;  1IZN A;  4PUX A;  8PRN A;  1YS5 A;  3PQU A;  4RJX A;  3RBH A;  4AYI D;  1QJ8 A;  3NSG A;  4FSO A;  3SY7 A;  3VE1 A;  3AA0 B;  2M06 A;  4FES A;  1GFM A;  1MM4 A;  2LFU A;  3HWB A;  4AKR A;  6PRN A;  2POR A;  4RLB A;  5PRN A;  1HXT A;  2XG6 A;  3JTY A;  4FRX A;  5ADX K;  1QJ9 A;  4FOZ A;  2QTK A;  3C5O A;  1THQ A;  3HOL A;  4O3W A;  2XMX A;  4FSP A;  4GCQ A;  3SYS A;  2F1T A;  4LSE A;  2Y2X A;  3WI4 A;  4AYE C;  3V8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...