4LSIA

Ion selectivity of ompf porin soaked in 0.3m kbr
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
334
structure length
334
Chain Sequence
DGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein F
publication title A structural study of ion permeation in OmpF porin from anomalous X-ray diffraction and molecular dynamics simulations.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 100
structure length 334
sequence length 334
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4lsiA00
5DL8A 3NSGA 3FYXA 1E54A 1BH3A 1OSMA 3UPGA 4D65A 5DL7A 1HXUA 3SY9A 4FSPA 2J1NA 2ZFGA 2O4VA 2XG6A 2J4UP 3T0SA 1PRNA 3VZTX 3VY8X 3SZDA 4LSIA 2Y0KA 4FRXA 3POUA 2PORA 2FGQX 4RJWA 4LSHA 1BT9A 1GFOA 3POXA 3POQA 7PRNA 3UU2A 4JFBA 5FVNA 2QTKA 4GCSA 3SYSA 3SYBA 1OPFA 3EMNX 8PRNA 3PORA 5DL5A 2Y0LA 1MPFA 4KR8A 5JDPA 2PRNA 2Y2XA 4FRTA 2XE2A 4GCQA 3VY9X 5PRNA 5DL6A 1GFQA 4KRAA 2K4TA 3JTYA 4D64A 2XE3A 4C69X 4AUIA 1H6S1 3HW9A 3K19A 3HWBA 4GCPA 4LSFA 3SY7A 3WI4A 2XE5A 4KR4A 1GFMA 3PRNA 4FMSA 4FSOA 2FGRA 4D5UA 2ODJA 3T24A 3O0EA 3SZVA 1GFPA 2ZLDA 3WI5A 1HXTA 4LSEA 3T20A 2XE1A 4FOZA 3VZUX 4FT6A 2OMFA 3VZWX 3A2SX 4BUMX 2Y0HA 6PRNA 1GFNA 1HXXA 1PHOA 4RJXA
chains in the Genus database with same CATH superfamily
3LK41 4O4UA 5DL8A 3NSGA 1T16A 3KZIO 5EE2A 3FYXA 1YS5A 4N75A 1E54A 2KC0A 2R4PA 1S5LO 1BH3A 1OSMA 3UPGA 4AFKA 3DA4A 4D65A 2F1CX 5DL7A 1HXUA 3SY9A 4FSPA 2IWWA 2KZ7A 2J1NA 2ZFGA 2O4VA 4F4BA 1ZHWA 2WJQA 3DWOX 5D5DA 2R4LA 3PGSA 2XG6A 3NJTA 4AKRA 5B66O 2MNHA 3T0SA 2J4UP 4C4VA 1PRNA 3AA7B 2M07A 2W81C 3VE1A 3SZDA 3VY8X 3VZTX 4AZLA 2XTQA 4O3ZA 3QRAA 4LSIA 2Y0KA 4O49A 2R8AA 4G76A 4FRXA 3POUA 5G3AA 2M06A 2PORA 2JMMA 3AAEB 1QJPA 3KVDD 4FUVA 4XNLA 4IL6O 3GP6A 4CTDA 2FGQX 3BS0A 4GF4A 4FESA 4RJWA 2JQYA 4LSHA 1BT9A 2XMXA 1GFOA 3POXA 3POQA 1ORMA 4PJ0O 2Y7SA 2KXPB 2X27X 4FZLA 3UU2A 3LK2A 7PRNA 5G26A 4RLCA 4Z3TA 4JFBA 5FVNA 1ZHZA 3HOLA 4E1SA 1IZNA 2QTKA 1Q9FA 4GCSA 3PGUA 2WJRA 4XNKA 1QJ8A 3SYSA 3A0HO 3LK3B 4QQ1A 3SYBA 1OPFA 3EMNX 3BRZA 3PQSA 4PR7A 5ADXK 8PRNA 3PORA 3AA6B 5DL5A 5AFUL 2Y0LA 5G38A 1MPFA 4AYDC 5GV0A 5GTIO 3AA7A 3A0BO 3AAAB 4FQEA 4KR8A 2ERVA 4C00A 5JDPA 5B5EO 5ADXL 2PRNA 2Y2XA 4FRTA 4GHBA 2XE2A 1QJ9A 4GCQA 2LHFA 4AYID 2R4OA 3PF1A 5PRNA 3AA1B 1GFQA 5DL6A 3AAEA 5T5FA 3VY9X 4KRAA 2R89A 3C5OA 4AKRB 2AXTO 1T1LA 1Q9GA 3UAQA 5IYUA 2K4TA 3JTYA 2X9KA 1G90A 4C4VB 3LK42 2R88A 4PUXA 5G39A 4D64A 2YPVA 2XE3A 3G7GA 4C69X 2LFUA 4AUIA 1H6S1 3VE2A 3PQUA 3HW9A 4U9CA 3K19A 1BXWA 1THQA 4O3YA 3HWBA 5KAIO 4GCPA 3TZGA 2F1TA 3AA0B 4LSFA 3JCUO 1ZHTA 3SY7A 3WI4A 2XE5A 4KR4A 3LK3A 1GFMA 4AYEC 2IWVA 3PRNA 3QRCA 4FMSA 5GTHO 4FSOA 4N74A 1ZHXA 2FGRA 3LK2B 3AA6A 4K3CA 4O3XB 2KDYA 2ODJA 3T24A 4D5UA 3O0EA 1ZHYA 5E79O 3SZVA 1GFPA 2ZLDA 3WI5A 5TISO 3AAAA 4N58A 4RLBA 1HXTA 1IZNB 2KZ7B 4O4XA 4RL9A 4FZMA 2YNKA 4UB8O 2GE4A 4N59A 4E1TA 4G75A 4LSEA 3T20A 1MM4A 2XE1A 4FOZA 4UB6O 2XTRA 3AA1A 3WU2O 4AKMA 3VZUX 3PGRA 1MM5A 2N2LA 4FT6A 4AYMC 2OMFA 1P4TA 2KXPA 3VZWX 5AFUK 2R4NA 2F1VA 2K0LA 3A2SX 4BUMX 3HOEA 2Y0HA 6PRNA 1GFNA 4K3BA 2W80C 3V8UA 4B61A 1HXXA 3DA3A 4AYNA 4FZNA 4JCHA 3RBHA 5H2FO 1PHOA 2WVPA 4O3WA 3AA0A 3DZMA 3DWNA 2N2MA 3BRYA 2MHLA 4RJXA 5KAFO
chains in the Genus database with same CATH topology
3LK41 4O4UA 5DL8A 3NSGA 5EE2A 3FYXA 1YS5A 1E54A 2KC0A 1BH3A 1OSMA 3UPGA 4AFKA 3DA4A 4D65A 5DL7A 1HXUA 3SY9A 4FSPA 2KZ7A 2J1NA 2ZFGA 2O4VA 4F4BA 1ZHWA 5D5DA 2XG6A 4AKRA 2J4UP 2MNHA 3T0SA 1PRNA 3AA7B 2M07A 2W81C 3VE1A 3SZDA 3VY8X 3VZTX 4AZLA 2XTQA 4O3ZA 3QRAA 4LSIA 2Y0KA 4O49A 4G76A 4FRXA 3POUA 2M06A 2PORA 2JMMA 3AAEB 1QJPA 3KVDD 4FUVA 4XNLA 3GP6A 2FGQX 4GF4A 4FESA 4RJWA 4LSHA 1BT9A 2XMXA 1GFOA 3POXA 3POQA 1ORMA 7PRNA 2Y7SA 2KXPB 2X27X 4FZLA 3UU2A 3LK2A 5G26A 4RLCA 4Z3TA 4JFBA 5FVNA 1ZHZA 3HOLA 4E1SA 1IZNA 2QTKA 1Q9FA 4GCSA 4XNKA 1QJ8A 3SYSA 3LK3B 4QQ1A 3SYBA 1OPFA 3EMNX 3PQSA 5ADXK 8PRNA 3PORA 3AA6B 5DL5A 5AFUL 2Y0LA 1MPFA 4AYDC 5GV0A 3AA7A 3AAAB 4KR8A 2ERVA 5JDPA 5ADXL 2PRNA 2Y2XA 4FRTA 4GHBA 2XE2A 1QJ9A 4GCQA 2LHFA 4AYID 3VY9X 5PRNA 3AA1B 1GFQA 5DL6A 3AAEA 5T5FA 4KRAA 3C5OA 4AKRB 3UAQA 1Q9GA 5IYUA 1G90A 2K4TA 3JTYA 3LK42 4PUXA 4D64A 2YPVA 2XE3A 3G7GA 4C69X 2LFUA 4AUIA 1H6S1 3VE2A 3PQUA 3HW9A 4U9CA 3K19A 1BXWA 1THQA 4O3YA 3HWBA 3TZGA 4GCPA 2F1TA 3AA0B 4LSFA 1ZHTA 3SY7A 3WI4A 2XE5A 4KR4A 3LK3A 1GFMA 4AYEC 3PRNA 3QRCA 4FMSA 4FSOA 1ZHXA 2FGRA 3LK2B 3AA6A 4D5UA 4O3XB 2KDYA 2ODJA 3T24A 3O0EA 1ZHYA 3SZVA 1GFPA 2ZLDA 3WI5A 3AAAA 4N58A 4RLBA 1HXTA 1IZNB 2KZ7B 4O4XA 4RL9A 4FZMA 2YNKA 4E1TA 2GE4A 4N59A 4G75A 4LSEA 3T20A 1MM4A 2XE1A 4FOZA 2XTRA 3AA1A 4AKMA 3VZUX 1MM5A 2N2LA 4FT6A 4AYMC 2OMFA 1P4TA 2KXPA 3VZWX 5AFUK 2F1VA 2K0LA 3A2SX 4BUMX 3HOEA 2Y0HA 6PRNA 1GFNA 2W80C 3V8UA 4B61A 1HXXA 3DA3A 4AYNA 4FZNA 4JCHA 3RBHA 1PHOA 4O3WA 3AA0A 2N2MA 2MHLA 4RJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DL8 A;  3NSG A;  3FYX A;  1E54 A;  1BH3 A;  1OSM A;  3UPG A;  4D65 A;  5DL7 A;  1HXU A;  3SY9 A;  4FSP A;  2J1N A;  2ZFG A;  2O4V A;  2XG6 A;  2J4U P;  3T0S A;  1PRN A;  3VZT X;  3VY8 X;  3SZD A;  4LSI A;  2Y0K A;  4FRX A;  3POU A;  2POR A;  2FGQ X;  4RJW A;  4LSH A;  1BT9 A;  1GFO A;  3POX A;  3POQ A;  7PRN A;  3UU2 A;  4JFB A;  5FVN A;  2QTK A;  4GCS A;  3SYS A;  3SYB A;  1OPF A;  3EMN X;  8PRN A;  3POR A;  5DL5 A;  2Y0L A;  1MPF A;  4KR8 A;  5JDP A;  2PRN A;  2Y2X A;  4FRT A;  2XE2 A;  4GCQ A;  3VY9 X;  5PRN A;  5DL6 A;  1GFQ A;  4KRA A;  2K4T A;  3JTY A;  4D64 A;  2XE3 A;  4C69 X;  4AUI A;  1H6S 1;  3HW9 A;  3K19 A;  3HWB A;  4GCP A;  4LSF A;  3SY7 A;  3WI4 A;  2XE5 A;  4KR4 A;  1GFM A;  3PRN A;  4FMS A;  4FSO A;  2FGR A;  4D5U A;  2ODJ A;  3T24 A;  3O0E A;  3SZV A;  1GFP A;  2ZLD A;  3WI5 A;  1HXT A;  4LSE A;  3T20 A;  2XE1 A;  4FOZ A;  3VZU X;  4FT6 A;  2OMF A;  3VZW X;  3A2S X;  4BUM X;  2Y0H A;  6PRN A;  1GFN A;  1HXX A;  1PHO A;  4RJX A; 
#chains in the Genus database with same CATH topology
 3LK4 1;  4O4U A;  5DL8 A;  3NSG A;  1T16 A;  3KZI O;  5EE2 A;  3FYX A;  1YS5 A;  4N75 A;  1E54 A;  2KC0 A;  2R4P A;  1S5L O;  1BH3 A;  1OSM A;  3UPG A;  4AFK A;  3DA4 A;  4D65 A;  2F1C X;  5DL7 A;  1HXU A;  3SY9 A;  4FSP A;  2IWW A;  2KZ7 A;  2J1N A;  2ZFG A;  2O4V A;  4F4B A;  1ZHW A;  2WJQ A;  3DWO X;  5D5D A;  2R4L A;  3PGS A;  2XG6 A;  3NJT A;  4AKR A;  5B66 O;  2MNH A;  3T0S A;  2J4U P;  4C4V A;  1PRN A;  3AA7 B;  2M07 A;  2W81 C;  3VE1 A;  3SZD A;  3VY8 X;  3VZT X;  4AZL A;  2XTQ A;  4O3Z A;  3QRA A;  4LSI A;  2Y0K A;  4O49 A;  2R8A A;  4G76 A;  4FRX A;  3POU A;  5G3A A;  2M06 A;  2POR A;  2JMM A;  3AAE B;  1QJP A;  3KVD D;  4FUV A;  4XNL A;  4IL6 O;  3GP6 A;  4CTD A;  2FGQ X;  3BS0 A;  4GF4 A;  4FES A;  4RJW A;  2JQY A;  4LSH A;  1BT9 A;  2XMX A;  1GFO A;  3POX A;  3POQ A;  1ORM A;  4PJ0 O;  2Y7S A;  2KXP B;  2X27 X;  4FZL A;  3UU2 A;  3LK2 A;  7PRN A;  5G26 A;  4RLC A;  4Z3T A;  4JFB A;  5FVN A;  1ZHZ A;  3HOL A;  4E1S A;  1IZN A;  2QTK A;  1Q9F A;  4GCS A;  3PGU A;  2WJR A;  4XNK A;  1QJ8 A;  3SYS A;  3A0H O;  3LK3 B;  4QQ1 A;  3SYB A;  1OPF A;  3EMN X;  3BRZ A;  3PQS A;  4PR7 A;  5ADX K;  8PRN A;  3POR A;  3AA6 B;  5DL5 A;  5AFU L;  2Y0L A;  5G38 A;  1MPF A;  4AYD C;  5GV0 A;  5GTI O;  3AA7 A;  3A0B O;  3AAA B;  4FQE A;  4KR8 A;  2ERV A;  4C00 A;  5JDP A;  5B5E O;  5ADX L;  2PRN A;  2Y2X A;  4FRT A;  4GHB A;  2XE2 A;  1QJ9 A;  4GCQ A;  2LHF A;  4AYI D;  2R4O A;  3PF1 A;  5PRN A;  3AA1 B;  1GFQ A;  5DL6 A;  3AAE A;  5T5F A;  3VY9 X;  4KRA A;  2R89 A;  3C5O A;  4AKR B;  2AXT O;  1T1L A;  1Q9G A;  3UAQ A;  5IYU A;  2K4T A;  3JTY A;  2X9K A;  1G90 A;  4C4V B;  3LK4 2;  2R88 A;  4PUX A;  5G39 A;  4D64 A;  2YPV A;  2XE3 A;  3G7G A;  4C69 X;  2LFU A;  4AUI A;  1H6S 1;  3VE2 A;  3PQU A;  3HW9 A;  4U9C A;  3K19 A;  1BXW A;  1THQ A;  4O3Y A;  3HWB A;  5KAI O;  4GCP A;  3TZG A;  2F1T A;  3AA0 B;  4LSF A;  3JCU O;  1ZHT A;  3SY7 A;  3WI4 A;  2XE5 A;  4KR4 A;  3LK3 A;  1GFM A;  4AYE C;  2IWV A;  3PRN A;  3QRC A;  4FMS A;  5GTH O;  4FSO A;  4N74 A;  1ZHX A;  2FGR A;  3LK2 B;  3AA6 A;  4K3C A;  4O3X B;  2KDY A;  2ODJ A;  3T24 A;  4D5U A;  3O0E A;  1ZHY A;  5E79 O;  3SZV A;  1GFP A;  2ZLD A;  3WI5 A;  5TIS O;  3AAA A;  4N58 A;  4RLB A;  1HXT A;  1IZN B;  2KZ7 B;  4O4X A;  4RL9 A;  4FZM A;  2YNK A;  4UB8 O;  2GE4 A;  4N59 A;  4E1T A;  4G75 A;  4LSE A;  3T20 A;  1MM4 A;  2XE1 A;  4FOZ A;  4UB6 O;  2XTR A;  3AA1 A;  3WU2 O;  4AKM A;  3VZU X;  3PGR A;  1MM5 A;  2N2L A;  4FT6 A;  4AYM C;  2OMF A;  1P4T A;  2KXP A;  3VZW X;  5AFU K;  2R4N A;  2F1V A;  2K0L A;  3A2S X;  4BUM X;  3HOE A;  2Y0H A;  6PRN A;  1GFN A;  4K3B A;  2W80 C;  3V8U A;  4B61 A;  1HXX A;  3DA3 A;  4AYN A;  4FZN A;  4JCH A;  3RBH A;  5H2F O;  1PHO A;  2WVP A;  4O3W A;  3AA0 A;  3DZM A;  3DWN A;  2N2M A;  3BRY A;  2MHL A;  4RJX A;  5KAF O; 
#chains in the Genus database with same CATH homology
 3LK4 1;  4O4U A;  5DL8 A;  3NSG A;  5EE2 A;  3FYX A;  1YS5 A;  1E54 A;  2KC0 A;  1BH3 A;  1OSM A;  3UPG A;  4AFK A;  3DA4 A;  4D65 A;  5DL7 A;  1HXU A;  3SY9 A;  4FSP A;  2KZ7 A;  2J1N A;  2ZFG A;  2O4V A;  4F4B A;  1ZHW A;  5D5D A;  2XG6 A;  4AKR A;  2J4U P;  2MNH A;  3T0S A;  1PRN A;  3AA7 B;  2M07 A;  2W81 C;  3VE1 A;  3SZD A;  3VY8 X;  3VZT X;  4AZL A;  2XTQ A;  4O3Z A;  3QRA A;  4LSI A;  2Y0K A;  4O49 A;  4G76 A;  4FRX A;  3POU A;  2M06 A;  2POR A;  2JMM A;  3AAE B;  1QJP A;  3KVD D;  4FUV A;  4XNL A;  3GP6 A;  2FGQ X;  4GF4 A;  4FES A;  4RJW A;  4LSH A;  1BT9 A;  2XMX A;  1GFO A;  3POX A;  3POQ A;  1ORM A;  7PRN A;  2Y7S A;  2KXP B;  2X27 X;  4FZL A;  3UU2 A;  3LK2 A;  5G26 A;  4RLC A;  4Z3T A;  4JFB A;  5FVN A;  1ZHZ A;  3HOL A;  4E1S A;  1IZN A;  2QTK A;  1Q9F A;  4GCS A;  4XNK A;  1QJ8 A;  3SYS A;  3LK3 B;  4QQ1 A;  3SYB A;  1OPF A;  3EMN X;  3PQS A;  5ADX K;  8PRN A;  3POR A;  3AA6 B;  5DL5 A;  5AFU L;  2Y0L A;  1MPF A;  4AYD C;  5GV0 A;  3AA7 A;  3AAA B;  4KR8 A;  2ERV A;  5JDP A;  5ADX L;  2PRN A;  2Y2X A;  4FRT A;  4GHB A;  2XE2 A;  1QJ9 A;  4GCQ A;  2LHF A;  4AYI D;  3VY9 X;  5PRN A;  3AA1 B;  1GFQ A;  5DL6 A;  3AAE A;  5T5F A;  4KRA A;  3C5O A;  4AKR B;  3UAQ A;  1Q9G A;  5IYU A;  1G90 A;  2K4T A;  3JTY A;  3LK4 2;  4PUX A;  4D64 A;  2YPV A;  2XE3 A;  3G7G A;  4C69 X;  2LFU A;  4AUI A;  1H6S 1;  3VE2 A;  3PQU A;  3HW9 A;  4U9C A;  3K19 A;  1BXW A;  1THQ A;  4O3Y A;  3HWB A;  3TZG A;  4GCP A;  2F1T A;  3AA0 B;  4LSF A;  1ZHT A;  3SY7 A;  3WI4 A;  2XE5 A;  4KR4 A;  3LK3 A;  1GFM A;  4AYE C;  3PRN A;  3QRC A;  4FMS A;  4FSO A;  1ZHX A;  2FGR A;  3LK2 B;  3AA6 A;  4D5U A;  4O3X B;  2KDY A;  2ODJ A;  3T24 A;  3O0E A;  1ZHY A;  3SZV A;  1GFP A;  2ZLD A;  3WI5 A;  3AAA A;  4N58 A;  4RLB A;  1HXT A;  1IZN B;  2KZ7 B;  4O4X A;  4RL9 A;  4FZM A;  2YNK A;  4E1T A;  2GE4 A;  4N59 A;  4G75 A;  4LSE A;  3T20 A;  1MM4 A;  2XE1 A;  4FOZ A;  2XTR A;  3AA1 A;  4AKM A;  3VZU X;  1MM5 A;  2N2L A;  4FT6 A;  4AYM C;  2OMF A;  1P4T A;  2KXP A;  3VZW X;  5AFU K;  2F1V A;  2K0L A;  3A2S X;  4BUM X;  3HOE A;  2Y0H A;  6PRN A;  1GFN A;  2W80 C;  3V8U A;  4B61 A;  1HXX A;  3DA3 A;  4AYN A;  4FZN A;  4JCH A;  3RBH A;  1PHO A;  4O3W A;  3AA0 A;  2N2M A;  2MHL A;  4RJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...