2R4NA

Crystal structure of the long-chain fatty acid transporter fadl mutant n33a
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
421
structure length
421
Chain Sequence
b'AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRAPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKTAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Long-chain fatty acid transport protein
publication title Transmembrane passage of hydrophobic compounds through a protein channel wall
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 103
structure length 421
sequence length 421
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 2r4nA00
1T1LA 2R8AA 2R4LA 3PGRA 3DWOX 1T16A 2R4PA 3BRYA 3DWNA 3PGSA 3PGUA 2R4NA 2R88A 3PF1A 3BS0A 2R4OA 3BRZA 2R89A
chains in the Genus database with same CATH superfamily
2OMFA 4IL6O 2KC0A 1BH3A 4C4VB 3UPGA 1IZNA 4E1SA 4XNKA 3PF1A 3AAAB 3BRZA 3AA7B 4O49A 8PRNA 2K0LA 4AUIA 2PORA 3AAEA 3GP6A 4AFKA 2KXPA 3UU2A 5E79O 2ZFGA 3AA1A 2R89A 5GTHO 1BT9A 5G39A 5PRNA 4JCHA 2F1CX 2R4PA 3BRYA 3DZMA 4E1TA 4AZLA 2IWWA 2ODJA 5G26A 2N2LA 2GE4A 4FZNA 3K19A 4FT6A 4GCPA 1MPFA 1THQA 3SY9A 2F1TA 1ZHXA 4FUVA 3VZTX 2JMMA 4U9CA 5DL5A 4O3XB 4FSPA 3AA6B 3JTYA 4N74A 5G38A 4LSHA 3WU2O 2Y0HA 5FVNA 5JDPA 4AKRA 3A2SX 5GTIO 1G90A 2FGQX 3NJTA 1T16A 3DWNA 3LK3B 4AYMC 4Z3TA 4C4VA 3KZIO 5DL8A 3A0BO 3C5OA 1HXUA 4AYID 5ADXK 5G3AA 3SYSA 3BS0A 1OSMA 4O3WA 1MM4A 1PRNA 3AAAA 4PUXA 3WI5A 2WJRA 3AA7A 2WVPA 4C69X 1MM5A 2O4VA 3LK42 4D65A 2IWVA 1ZHWA 4GF4A 2PRNA 7PRNA 1H6S1 1ZHZA 2KDYA 1ZHTA 2XE5A 3SZVA 4LSFA 3UAQA 5IYUA 2MNHA 3T24A 3O0EA 5T5FA 3PQUA 4RJXA 3VZUX 2J1NA 1OPFA 2X9KA 3HW9A 4FESA 1GFNA 2YPVA 3HOLA 5DL7A 3VE2A 2KZ7B 4O3YA 3SY7A 3PORA 3FYXA 3T0SA 4QQ1A 5GV0A 2WJQA 2QTKA 4O3ZA 4BUMX 4UB6O 1QJPA 2F1VA 3NSGA 3POUA 4PJ0O 2ERVA 5ADXL 2R4OA 2W80C 2FGRA 3AA6A 2XE1A 3PGSA 3LK41 4B61A 4KR8A 1ORMA 1BXWA 1GFMA 2R4LA 4LSEA 2W81C 4N59A 4FMSA 3G7GA 4FRXA 4AKMA 2R88A 3PQSA 2K4TA 4FQEA 5TISO 4C00A 1T1LA 4FZMA 4F4BA 3DA3A 2Y7SA 3KVDD 3POXA 2X27X 5KAIO 4CTDA 2M07A 3LK3A 1S5LO 2R4NA 2Y0KA 6PRNA 3EMNX 3VY8X 3HWBA 2XTRA 5AFUK 2Y0LA 1Q9FA 2AXTO 2LFUA 4RL9A 5B5EO 4FOZA 2XMXA 4FSOA 4GCQA 1IZNB 5KAFO 1HXTA 5B66O 3QRAA 2J4UP 3AAEB 4RJWA 5EE2A 3TZGA 3PGRA 3DWOX 1Q9GA 3QRCA 2LHFA 4GCSA 3HOEA 4D64A 2KXPB 3AA1B 1YS5A 3WI4A 2KZ7A 2XE2A 4G76A 1GFOA 4KRAA 5DL6A 2ZLDA 3SZDA 4O4UA 3VY9X 1QJ8A 1HXXA 3POQA 2JQYA 3RBHA 4AYEC 1GFQA 4K3CA 3V8UA 1QJ9A 2XG6A 5AFUL 1PHOA 2R8AA 2YNKA 3AA0B 3DA4A 4K3BA 4XNLA 3LK2B 2M06A 3PRNA 4UB8O 3VZWX 4AYNA 3T20A 1P4TA 4PR7A 3PGUA 3JCUO 4FRTA 3VE1A 4LSIA 5D5DA 4JFBA 4RLBA 2N2MA 3AA0A 5H2FO 4FZLA 3LK2A 4AYDC 4AKRB 2XE3A 1GFPA 2MHLA 2Y2XA 3A0HO 4N58A 3SYBA 4GHBA 4KR4A 4N75A 4O4XA 4RLCA 1ZHYA 2XTQA 4D5UA 1E54A 4G75A
chains in the Genus database with same CATH topology
1T1LA 2R8AA 2R4LA 3PGRA 3DWOX 1T16A 2R4PA 3BRYA 3DWNA 3PGSA 3PGUA 2R4NA 2R88A 3PF1A 3BS0A 2R4OA 3BRZA 2R89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T1L A;  2R8A A;  2R4L A;  3PGR A;  3DWO X;  1T16 A;  2R4P A;  3BRY A;  3DWN A;  3PGS A;  3PGU A;  2R4N A;  2R88 A;  3PF1 A;  3BS0 A;  2R4O A;  3BRZ A;  2R89 A; 
#chains in the Genus database with same CATH topology
 2OMF A;  4IL6 O;  2KC0 A;  1BH3 A;  4C4V B;  3UPG A;  1IZN A;  4E1S A;  4XNK A;  3PF1 A;  3AAA B;  3BRZ A;  3AA7 B;  4O49 A;  8PRN A;  2K0L A;  4AUI A;  2POR A;  3AAE A;  3GP6 A;  4AFK A;  2KXP A;  3UU2 A;  5E79 O;  2ZFG A;  3AA1 A;  2R89 A;  5GTH O;  1BT9 A;  5G39 A;  5PRN A;  4JCH A;  2F1C X;  2R4P A;  3BRY A;  3DZM A;  4E1T A;  4AZL A;  2IWW A;  2ODJ A;  5G26 A;  2N2L A;  2GE4 A;  4FZN A;  3K19 A;  4FT6 A;  4GCP A;  1MPF A;  1THQ A;  3SY9 A;  2F1T A;  1ZHX A;  4FUV A;  3VZT X;  2JMM A;  4U9C A;  5DL5 A;  4O3X B;  4FSP A;  3AA6 B;  3JTY A;  4N74 A;  5G38 A;  4LSH A;  3WU2 O;  2Y0H A;  5FVN A;  5JDP A;  4AKR A;  3A2S X;  5GTI O;  1G90 A;  2FGQ X;  3NJT A;  1T16 A;  3DWN A;  3LK3 B;  4AYM C;  4Z3T A;  4C4V A;  3KZI O;  5DL8 A;  3A0B O;  3C5O A;  1HXU A;  4AYI D;  5ADX K;  5G3A A;  3SYS A;  3BS0 A;  1OSM A;  4O3W A;  1MM4 A;  1PRN A;  3AAA A;  4PUX A;  3WI5 A;  2WJR A;  3AA7 A;  2WVP A;  4C69 X;  1MM5 A;  2O4V A;  3LK4 2;  4D65 A;  2IWV A;  1ZHW A;  4GF4 A;  2PRN A;  7PRN A;  1H6S 1;  1ZHZ A;  2KDY A;  1ZHT A;  2XE5 A;  3SZV A;  4LSF A;  3UAQ A;  5IYU A;  2MNH A;  3T24 A;  3O0E A;  5T5F A;  3PQU A;  4RJX A;  3VZU X;  2J1N A;  1OPF A;  2X9K A;  3HW9 A;  4FES A;  1GFN A;  2YPV A;  3HOL A;  5DL7 A;  3VE2 A;  2KZ7 B;  4O3Y A;  3SY7 A;  3POR A;  3FYX A;  3T0S A;  4QQ1 A;  5GV0 A;  2WJQ A;  2QTK A;  4O3Z A;  4BUM X;  4UB6 O;  1QJP A;  2F1V A;  3NSG A;  3POU A;  4PJ0 O;  2ERV A;  5ADX L;  2R4O A;  2W80 C;  2FGR A;  3AA6 A;  2XE1 A;  3PGS A;  3LK4 1;  4B61 A;  4KR8 A;  1ORM A;  1BXW A;  1GFM A;  2R4L A;  4LSE A;  2W81 C;  4N59 A;  4FMS A;  3G7G A;  4FRX A;  4AKM A;  2R88 A;  3PQS A;  2K4T A;  4FQE A;  5TIS O;  4C00 A;  1T1L A;  4FZM A;  4F4B A;  3DA3 A;  2Y7S A;  3KVD D;  3POX A;  2X27 X;  5KAI O;  4CTD A;  2M07 A;  3LK3 A;  1S5L O;  2R4N A;  2Y0K A;  6PRN A;  3EMN X;  3VY8 X;  3HWB A;  2XTR A;  5AFU K;  2Y0L A;  1Q9F A;  2AXT O;  2LFU A;  4RL9 A;  5B5E O;  4FOZ A;  2XMX A;  4FSO A;  4GCQ A;  1IZN B;  5KAF O;  1HXT A;  5B66 O;  3QRA A;  2J4U P;  3AAE B;  4RJW A;  5EE2 A;  3TZG A;  3PGR A;  3DWO X;  1Q9G A;  3QRC A;  2LHF A;  4GCS A;  3HOE A;  4D64 A;  2KXP B;  3AA1 B;  1YS5 A;  3WI4 A;  2KZ7 A;  2XE2 A;  4G76 A;  1GFO A;  4KRA A;  5DL6 A;  2ZLD A;  3SZD A;  4O4U A;  3VY9 X;  1QJ8 A;  1HXX A;  3POQ A;  2JQY A;  3RBH A;  4AYE C;  1GFQ A;  4K3C A;  3V8U A;  1QJ9 A;  2XG6 A;  5AFU L;  1PHO A;  2R8A A;  2YNK A;  3AA0 B;  3DA4 A;  4K3B A;  4XNL A;  3LK2 B;  2M06 A;  3PRN A;  4UB8 O;  3VZW X;  4AYN A;  3T20 A;  1P4T A;  4PR7 A;  3PGU A;  3JCU O;  4FRT A;  3VE1 A;  4LSI A;  5D5D A;  4JFB A;  4RLB A;  2N2M A;  3AA0 A;  5H2F O;  4FZL A;  3LK2 A;  4AYD C;  4AKR B;  2XE3 A;  1GFP A;  2MHL A;  2Y2X A;  3A0H O;  4N58 A;  3SYB A;  4GHB A;  4KR4 A;  4N75 A;  4O4X A;  4RLC A;  1ZHY A;  2XTQ A;  4D5U A;  1E54 A;  4G75 A; 
#chains in the Genus database with same CATH homology
 1T1L A;  2R8A A;  2R4L A;  3PGR A;  3DWO X;  1T16 A;  2R4P A;  3BRY A;  3DWN A;  3PGS A;  3PGU A;  2R4N A;  2R88 A;  3PF1 A;  3BS0 A;  2R4O A;  3BRZ A;  2R89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...