2R4NA

Crystal structure of the long-chain fatty acid transporter fadl mutant n33a
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
421
structure length
421
Chain Sequence
AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRAPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKTAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Long-chain fatty acid transport protein
publication title Transmembrane passage of hydrophobic compounds through a protein channel wall
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 103
structure length 421
sequence length 421
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 2r4nA00
3PGSA 1T1LA 1T16A 2R88A 3BS0A 2R4PA 3DWOX 3PF1A 3DWNA 3PGUA 3PGRA 2R4OA 3BRYA 2R4NA 2R8AA 3BRZA 2R89A 2R4LA
chains in the Genus database with same CATH superfamily
2F1CX 3SY7A 1Q9FA 5DL8A 5H2FO 2XE3A 8PRNA 7PRNA 1Q9GA 1GFPA 3QRCA 5G39A 1ORMA 3AA7A 5PRNA 1OSMA 2N2LA 1HXUA 4GCPA 4AYMC 2FGQX 1THQA 4C69X 1GFOA 3BRYA 2JQYA 3POXA 4GHBA 4JCHA 1G90A 4K3CA 5KAIO 4AYEC 2KZ7A 3LK2A 1S5LO 3LK41 4FSPA 2MNHA 2XMXA 3DZMA 4IL6O 2K0LA 5T5FA 3AA1A 3HOEA 5DL5A 4FESA 2ODJA 4KR8A 4AZLA 4O49A 4E1TA 2X27X 3SZDA 5JDPA 3WU2O 4D5UA 2LHFA 4PUXA 1T1LA 4O3WA 2YNKA 4AYDC 3DWNA 3TZGA 3LK3A 4AKRB 2Y0HA 4C4VB 3PGSA 4C00A 2XE1A 2W81C 3HW9A 3QRAA 4FQEA 3A0BO 2MHLA 3NJTA 1ZHWA 3UPGA 3JCUO 2K4TA 2F1VA 2XTQA 2J1NA 3SYBA 3VY9X 1GFMA 5DL7A 1HXTA 3VZUX 4GF4A 4BUMX 3VZWX 3GP6A 4G76A 3VZTX 5D5DA 1MPFA 3PGUA 2LFUA 2KZ7B 3LK2B 3VE1A 4D65A 3PQUA 4AUIA 5IYUA 5G38A 4LSEA 4U9CA 3EMNX 3C5OA 3V8UA 2XG6A 3AA1B 3AA6B 1QJ8A 1IZNA 3PGRA 3T0SA 5FVNA 3K19A 3HOLA 2IWWA 2KXPA 4FRXA 4UB8O 1YS5A 3KZIO 1HXXA 2R88A 2AXTO 2ERVA 3AAAA 3PF1A 3SYSA 3WI5A 5GTHO 3SY9A 1E54A 2R4NA 1ZHYA 3AA0A 3AAEB 4PR7A 2Y7SA 4FZMA 4LSIA 2XE5A 2YPVA 4FT6A 4O4UA 4N75A 4AYNA 3DA4A 1PHOA 3DA3A 4O3YA 3PORA 5ADXK 4F4BA 2R4OA 3AA7B 3KVDD 4JFBA 1PRNA 4RLCA 5AFUK 4RL9A 2R4LA 2PRNA 4XNLA 3FYXA 5B5EO 2Y0KA 4FZLA 6PRNA 4G75A 2JMMA 2W80C 1ZHZA 1GFNA 3T20A 4B61A 5GTIO 2PORA 3BS0A 5KAFO 2KDYA 1BH3A 2X9KA 5G3AA 3RBHA 3UAQA 2M06A 4GCQA 4GCSA 1MM5A 4KR4A 1QJ9A 2Y2XA 4Z3TA 4CTDA 3PRNA 3AAAB 4O4XA 4AYID 1GFQA 2ZLDA 4K3BA 3POQA 1OPFA 2R4PA 1P4TA 3LK3B 5E79O 4LSFA 3VY8X 4XNKA 2KC0A 2OMFA 1ZHXA 3O0EA 4FMSA 4AKRA 1BT9A 4C4VA 4AFKA 2Y0LA 4E1SA 4FUVA 2XTRA 4LSHA 1ZHTA 2WJRA 4N74A 3DWOX 2F1TA 3A0HO 3HWBA 4RJWA 4FOZA 4QQ1A 4PJ0O 4N58A 3VE2A 4FRTA 2J4UP 2IWVA 1T16A 5DL6A 2O4VA 4RJXA 4FZNA 1H6S1 3UU2A 4AKMA 2WVPA 3G7GA 4UB6O 3JTYA 4O3XB 4D64A 2ZFGA 3T24A 1IZNB 3AA6A 2N2MA 5TISO 5ADXL 1BXWA 3A2SX 5EE2A 2FGRA 4N59A 3BRZA 2KXPB 2R89A 5AFUL 1QJPA 3NSGA 5GV0A 3POUA 5B66O 4FSOA 4RLBA 3LK42 3SZVA 3WI4A 3AA0B 1MM4A 2WJQA 2GE4A 3PQSA 2QTKA 4O3ZA 4KRAA 2M07A 2R8AA 2XE2A 3AAEA 5G26A
chains in the Genus database with same CATH topology
3PGSA 1T1LA 1T16A 2R88A 3BS0A 2R4PA 3DWOX 3PF1A 3DWNA 3PGUA 3PGRA 2R4OA 3BRYA 2R4NA 2R8AA 3BRZA 2R89A 2R4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PGS A;  1T1L A;  1T16 A;  2R88 A;  3BS0 A;  2R4P A;  3DWO X;  3PF1 A;  3DWN A;  3PGU A;  3PGR A;  2R4O A;  3BRY A;  2R4N A;  2R8A A;  3BRZ A;  2R89 A;  2R4L A; 
#chains in the Genus database with same CATH topology
 2F1C X;  3SY7 A;  1Q9F A;  5DL8 A;  5H2F O;  2XE3 A;  8PRN A;  7PRN A;  1Q9G A;  1GFP A;  3QRC A;  5G39 A;  1ORM A;  3AA7 A;  5PRN A;  1OSM A;  2N2L A;  1HXU A;  4GCP A;  4AYM C;  2FGQ X;  1THQ A;  4C69 X;  1GFO A;  3BRY A;  2JQY A;  3POX A;  4GHB A;  4JCH A;  1G90 A;  4K3C A;  5KAI O;  4AYE C;  2KZ7 A;  3LK2 A;  1S5L O;  3LK4 1;  4FSP A;  2MNH A;  2XMX A;  3DZM A;  4IL6 O;  2K0L A;  5T5F A;  3AA1 A;  3HOE A;  5DL5 A;  4FES A;  2ODJ A;  4KR8 A;  4AZL A;  4O49 A;  4E1T A;  2X27 X;  3SZD A;  5JDP A;  3WU2 O;  4D5U A;  2LHF A;  4PUX A;  1T1L A;  4O3W A;  2YNK A;  4AYD C;  3DWN A;  3TZG A;  3LK3 A;  4AKR B;  2Y0H A;  4C4V B;  3PGS A;  4C00 A;  2XE1 A;  2W81 C;  3HW9 A;  3QRA A;  4FQE A;  3A0B O;  2MHL A;  3NJT A;  1ZHW A;  3UPG A;  3JCU O;  2K4T A;  2F1V A;  2XTQ A;  2J1N A;  3SYB A;  3VY9 X;  1GFM A;  5DL7 A;  1HXT A;  3VZU X;  4GF4 A;  4BUM X;  3VZW X;  3GP6 A;  4G76 A;  3VZT X;  5D5D A;  1MPF A;  3PGU A;  2LFU A;  2KZ7 B;  3LK2 B;  3VE1 A;  4D65 A;  3PQU A;  4AUI A;  5IYU A;  5G38 A;  4LSE A;  4U9C A;  3EMN X;  3C5O A;  3V8U A;  2XG6 A;  3AA1 B;  3AA6 B;  1QJ8 A;  1IZN A;  3PGR A;  3T0S A;  5FVN A;  3K19 A;  3HOL A;  2IWW A;  2KXP A;  4FRX A;  4UB8 O;  1YS5 A;  3KZI O;  1HXX A;  2R88 A;  2AXT O;  2ERV A;  3AAA A;  3PF1 A;  3SYS A;  3WI5 A;  5GTH O;  3SY9 A;  1E54 A;  2R4N A;  1ZHY A;  3AA0 A;  3AAE B;  4PR7 A;  2Y7S A;  4FZM A;  4LSI A;  2XE5 A;  2YPV A;  4FT6 A;  4O4U A;  4N75 A;  4AYN A;  3DA4 A;  1PHO A;  3DA3 A;  4O3Y A;  3POR A;  5ADX K;  4F4B A;  2R4O A;  3AA7 B;  3KVD D;  4JFB A;  1PRN A;  4RLC A;  5AFU K;  4RL9 A;  2R4L A;  2PRN A;  4XNL A;  3FYX A;  5B5E O;  2Y0K A;  4FZL A;  6PRN A;  4G75 A;  2JMM A;  2W80 C;  1ZHZ A;  1GFN A;  3T20 A;  4B61 A;  5GTI O;  2POR A;  3BS0 A;  5KAF O;  2KDY A;  1BH3 A;  2X9K A;  5G3A A;  3RBH A;  3UAQ A;  2M06 A;  4GCQ A;  4GCS A;  1MM5 A;  4KR4 A;  1QJ9 A;  2Y2X A;  4Z3T A;  4CTD A;  3PRN A;  3AAA B;  4O4X A;  4AYI D;  1GFQ A;  2ZLD A;  4K3B A;  3POQ A;  1OPF A;  2R4P A;  1P4T A;  3LK3 B;  5E79 O;  4LSF A;  3VY8 X;  4XNK A;  2KC0 A;  2OMF A;  1ZHX A;  3O0E A;  4FMS A;  4AKR A;  1BT9 A;  4C4V A;  4AFK A;  2Y0L A;  4E1S A;  4FUV A;  2XTR A;  4LSH A;  1ZHT A;  2WJR A;  4N74 A;  3DWO X;  2F1T A;  3A0H O;  3HWB A;  4RJW A;  4FOZ A;  4QQ1 A;  4PJ0 O;  4N58 A;  3VE2 A;  4FRT A;  2J4U P;  2IWV A;  1T16 A;  5DL6 A;  2O4V A;  4RJX A;  4FZN A;  1H6S 1;  3UU2 A;  4AKM A;  2WVP A;  3G7G A;  4UB6 O;  3JTY A;  4O3X B;  4D64 A;  2ZFG A;  3T24 A;  1IZN B;  3AA6 A;  2N2M A;  5TIS O;  5ADX L;  1BXW A;  3A2S X;  5EE2 A;  2FGR A;  4N59 A;  3BRZ A;  2KXP B;  2R89 A;  5AFU L;  1QJP A;  3NSG A;  5GV0 A;  3POU A;  5B66 O;  4FSO A;  4RLB A;  3LK4 2;  3SZV A;  3WI4 A;  3AA0 B;  1MM4 A;  2WJQ A;  2GE4 A;  3PQS A;  2QTK A;  4O3Z A;  4KRA A;  2M07 A;  2R8A A;  2XE2 A;  3AAE A;  5G26 A; 
#chains in the Genus database with same CATH homology
 3PGS A;  1T1L A;  1T16 A;  2R88 A;  3BS0 A;  2R4P A;  3DWO X;  3PF1 A;  3DWN A;  3PGU A;  3PGR A;  2R4O A;  3BRY A;  2R4N A;  2R8A A;  3BRZ A;  2R89 A;  2R4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...