2R4NA

Crystal structure of the long-chain fatty acid transporter fadl mutant n33a
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
421
structure length
421
Chain Sequence
AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRAPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKTAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Long-chain fatty acid transport protein
publication title Transmembrane passage of hydrophobic compounds through a protein channel wall
pubmed doi rcsb
source organism Escherichia coli
total genus 103
structure length 421
sequence length 421
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 2r4nA00
3PGUA 3BRZA 2R4PA 2R4NA 3DWOX 2R4OA 3PGRA 1T1LA 2R8AA 2R4LA 2R88A 3DWNA 3BS0A 3PF1A 3PGSA 2R89A 1T16A 3BRYA
chains in the Genus database with same CATH superfamily
1H6S1 3BRZA 1YS5A 3DZMA 2ERVA 4C00A 4D5UA 3EMNX 5FVNA 3A0HO 3RBHA 4U9CA 4FRXA 1IZNA 2F1TA 2ODJA 1ZHXA 3HOEA 5E79O 5KAIO 3UU2A 3AAEA 4D64A 1ZHZA 2YPVA 1BXWA 3BS0A 4LSEA 3LK42 2IWWA 3NSGA 4FT6A 5EE2A 2FGRA 3POXA 4FQEA 1ZHYA 2PRNA 3PQUA 2O4VA 5G39A 3POQA 2AXTO 1QJ8A 3AA7A 3PGSA 1PRNA 2W81C 2XMXA 1E54A 5GV0A 3KZIO 5TISO 2XE5A 3AA1A 4FOZA 3T20A 1P4TA 2R4NA 3HOLA 3WI5A 4Z3TA 2X27X 5AFUL 1IZNB 2F1CX 2M06A 4GCSA 5ADXL 3AAEB 2OMFA 3A2SX 3HW9A 4GF4A 4KR4A 4N75A 4N58A 4RLBA 2LFUA 5H2FO 3LK3A 4AKRA 1GFPA 2FGQX 4FZNA 5G38A 1OPFA 2JQYA 2Y0KA 2R88A 1ORMA 4K3BA 3SYSA 1ZHTA 2K4TA 3JTYA 4O3WA 5B66O 4FSOA 1PHOA 1Q9FA 2J1NA 3AA7B 4AKMA 4FESA 3G7GA 4G75A 3GP6A 3AA0A 4GCPA 2KXPA 3AA1B 4KRAA 4UB8O 3VZUX 1T16A 3O0EA 4RL9A 5T5FA 2Y0LA 2ZFGA 3POUA 4LSHA 5GTHO 3UPGA 4GHBA 4FUVA 1ZHWA 2N2LA 7PRNA 4G76A 2W80C 3LK41 3QRCA 3LK3B 3AAAA 4E1TA 2KZ7A 2WJQA 3PORA 3SY7A 3PGUA 4BUMX 4O49A 2M07A 5IYUA 4JCHA 3VY8X 3HWBA 2N2MA 4PJ0O 3PF1A 4UB6O 2WVPA 4JFBA 5JDPA 3AA0B 2KXPB 5DL5A 4AYMC 4LSFA 4CTDA 4IL6O 4AYID 4K3CA 4AZLA 4PUXA 4F4BA 4LSIA 2KDYA 5D5DA 2KC0A 2Y7SA 4RLCA 2K0LA 2MHLA 2X9KA 2Y0HA 3SY9A 3T0SA 4GCQA 1BT9A 3AAAB 4FRTA 4E1SA 5DL8A 4O4UA 2KZ7B 2R4OA 4FZMA 3PRNA 3LK2A 3BRYA 1QJ9A 5PRNA 3VE2A 2QTKA 4B61A 1HXUA 3DWOX 4AYEC 1MM4A 2XE3A 3VZWX 1HXTA 4N74A 2Y2XA 3PQSA 1Q9GA 2LHFA 3C5OA 4KR8A 3SYBA 4O3ZA 4AKRB 3TZGA 3V8UA 4D65A 1THQA 5AFUK 4XNKA 3AA6A 3WU2O 2JMMA 2R4LA 4XNLA 4FMSA 4PR7A 2XTQA 4RJWA 2R89A 5G26A 2WJRA 3VY9X 3UAQA 6PRNA 3WI4A 3FYXA 4O4XA 5B5EO 3LK2B 4C4VA 3DWNA 1MM5A 2MNHA 4AFKA 1QJPA 4O3YA 3NJTA 5KAFO 4C69X 1GFOA 8PRNA 3T24A 2XE1A 1MPFA 3JCUO 2IWVA 4FZLA 4RJXA 3DA3A 3PGRA 2XG6A 1GFMA 3VZTX 3DA4A 2ZLDA 4QQ1A 5ADXK 1G90A 1GFQA 3QRAA 4AYNA 5GTIO 3AA6B 1BH3A 3SZVA 4N59A 3KVDD 2R4PA 2XTRA 1S5LO 5DL7A 4AYDC 5G3AA 3K19A 3A0BO 1GFNA 5DL6A 2YNKA 4C4VB 3SZDA 1OSMA 2J4UP 4AUIA 2F1VA 4O3XB 2GE4A 1T1LA 2R8AA 3VE1A 4FSPA 2PORA 1HXXA 2XE2A
chains in the Genus database with same CATH topology
3PGUA 3BRZA 2R4PA 2R4NA 3DWOX 2R4OA 3PGRA 1T1LA 2R8AA 2R4LA 2R88A 3DWNA 3BS0A 3PF1A 3PGSA 2R89A 1T16A 3BRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PGU A;  3BRZ A;  2R4P A;  2R4N A;  3DWO X;  2R4O A;  3PGR A;  1T1L A;  2R8A A;  2R4L A;  2R88 A;  3DWN A;  3BS0 A;  3PF1 A;  3PGS A;  2R89 A;  1T16 A;  3BRY A; 
#chains in the Genus database with same CATH topology
 1H6S 1;  3BRZ A;  1YS5 A;  3DZM A;  2ERV A;  4C00 A;  4D5U A;  3EMN X;  5FVN A;  3A0H O;  3RBH A;  4U9C A;  4FRX A;  1IZN A;  2F1T A;  2ODJ A;  1ZHX A;  3HOE A;  5E79 O;  5KAI O;  3UU2 A;  3AAE A;  4D64 A;  1ZHZ A;  2YPV A;  1BXW A;  3BS0 A;  4LSE A;  3LK4 2;  2IWW A;  3NSG A;  4FT6 A;  5EE2 A;  2FGR A;  3POX A;  4FQE A;  1ZHY A;  2PRN A;  3PQU A;  2O4V A;  5G39 A;  3POQ A;  2AXT O;  1QJ8 A;  3AA7 A;  3PGS A;  1PRN A;  2W81 C;  2XMX A;  1E54 A;  5GV0 A;  3KZI O;  5TIS O;  2XE5 A;  3AA1 A;  4FOZ A;  3T20 A;  1P4T A;  2R4N A;  3HOL A;  3WI5 A;  4Z3T A;  2X27 X;  5AFU L;  1IZN B;  2F1C X;  2M06 A;  4GCS A;  5ADX L;  3AAE B;  2OMF A;  3A2S X;  3HW9 A;  4GF4 A;  4KR4 A;  4N75 A;  4N58 A;  4RLB A;  2LFU A;  5H2F O;  3LK3 A;  4AKR A;  1GFP A;  2FGQ X;  4FZN A;  5G38 A;  1OPF A;  2JQY A;  2Y0K A;  2R88 A;  1ORM A;  4K3B A;  3SYS A;  1ZHT A;  2K4T A;  3JTY A;  4O3W A;  5B66 O;  4FSO A;  1PHO A;  1Q9F A;  2J1N A;  3AA7 B;  4AKM A;  4FES A;  3G7G A;  4G75 A;  3GP6 A;  3AA0 A;  4GCP A;  2KXP A;  3AA1 B;  4KRA A;  4UB8 O;  3VZU X;  1T16 A;  3O0E A;  4RL9 A;  5T5F A;  2Y0L A;  2ZFG A;  3POU A;  4LSH A;  5GTH O;  3UPG A;  4GHB A;  4FUV A;  1ZHW A;  2N2L A;  7PRN A;  4G76 A;  2W80 C;  3LK4 1;  3QRC A;  3LK3 B;  3AAA A;  4E1T A;  2KZ7 A;  2WJQ A;  3POR A;  3SY7 A;  3PGU A;  4BUM X;  4O49 A;  2M07 A;  5IYU A;  4JCH A;  3VY8 X;  3HWB A;  2N2M A;  4PJ0 O;  3PF1 A;  4UB6 O;  2WVP A;  4JFB A;  5JDP A;  3AA0 B;  2KXP B;  5DL5 A;  4AYM C;  4LSF A;  4CTD A;  4IL6 O;  4AYI D;  4K3C A;  4AZL A;  4PUX A;  4F4B A;  4LSI A;  2KDY A;  5D5D A;  2KC0 A;  2Y7S A;  4RLC A;  2K0L A;  2MHL A;  2X9K A;  2Y0H A;  3SY9 A;  3T0S A;  4GCQ A;  1BT9 A;  3AAA B;  4FRT A;  4E1S A;  5DL8 A;  4O4U A;  2KZ7 B;  2R4O A;  4FZM A;  3PRN A;  3LK2 A;  3BRY A;  1QJ9 A;  5PRN A;  3VE2 A;  2QTK A;  4B61 A;  1HXU A;  3DWO X;  4AYE C;  1MM4 A;  2XE3 A;  3VZW X;  1HXT A;  4N74 A;  2Y2X A;  3PQS A;  1Q9G A;  2LHF A;  3C5O A;  4KR8 A;  3SYB A;  4O3Z A;  4AKR B;  3TZG A;  3V8U A;  4D65 A;  1THQ A;  5AFU K;  4XNK A;  3AA6 A;  3WU2 O;  2JMM A;  2R4L A;  4XNL A;  4FMS A;  4PR7 A;  2XTQ A;  4RJW A;  2R89 A;  5G26 A;  2WJR A;  3VY9 X;  3UAQ A;  6PRN A;  3WI4 A;  3FYX A;  4O4X A;  5B5E O;  3LK2 B;  4C4V A;  3DWN A;  1MM5 A;  2MNH A;  4AFK A;  1QJP A;  4O3Y A;  3NJT A;  5KAF O;  4C69 X;  1GFO A;  8PRN A;  3T24 A;  2XE1 A;  1MPF A;  3JCU O;  2IWV A;  4FZL A;  4RJX A;  3DA3 A;  3PGR A;  2XG6 A;  1GFM A;  3VZT X;  3DA4 A;  2ZLD A;  4QQ1 A;  5ADX K;  1G90 A;  1GFQ A;  3QRA A;  4AYN A;  5GTI O;  3AA6 B;  1BH3 A;  3SZV A;  4N59 A;  3KVD D;  2R4P A;  2XTR A;  1S5L O;  5DL7 A;  4AYD C;  5G3A A;  3K19 A;  3A0B O;  1GFN A;  5DL6 A;  2YNK A;  4C4V B;  3SZD A;  1OSM A;  2J4U P;  4AUI A;  2F1V A;  4O3X B;  2GE4 A;  1T1L A;  2R8A A;  3VE1 A;  4FSP A;  2POR A;  1HXX A;  2XE2 A; 
#chains in the Genus database with same CATH homology
 3PGU A;  3BRZ A;  2R4P A;  2R4N A;  3DWO X;  2R4O A;  3PGR A;  1T1L A;  2R8A A;  2R4L A;  2R88 A;  3DWN A;  3BS0 A;  3PF1 A;  3PGS A;  2R89 A;  1T16 A;  3BRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...