1Q9FA

Nmr structure of the outer membrane protein ompx in dhpc micelles
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
148
structure length
148
Chain Sequence
ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKNDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein X
publication title NMR structure of the integral membrane protein OmpX.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 16
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2003-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1q9fA00
2N2LA 2GE4A 2N2MA 2K0LA 3G7GA 1MM4A 4PUXA 1ORMA 1P4TA 1MM5A 1QJ9A 1BXWA 2X27X 1Q9GA 1QJ8A 2LHFA 1G90A 4RLCA 3GP6A 1QJPA 2M07A 2M06A 1Q9FA 2ERVA 2F1TA 2F1VA 2JMMA 2MHLA 3QRCA 1THQA 2MNHA 3C5OA 3QRAA
chains in the Genus database with same CATH superfamily
5KAFO 3SY9A 2O4VA 5DL8A 2R4NA 5H2FO 2K0LA 2ZFGA 3G7GA 3LK41 4UB6O 3VY9X 4G76A 1MM5A 1QJ9A 4JFBA 2XMXA 3TZGA 2KXPB 3SZDA 1ZHZA 4LSEA 4D5UA 2Y2XA 4AKRB 3GP6A 4FRTA 1QJPA 4C69X 3BRZA 3WU2O 3VZWX 1HXTA 1Q9FA 1IZNA 2XG6A 2YPVA 1GFQA 1ZHWA 2Y0HA 3LK3A 3PGRA 3PQSA 4GCPA 4LSIA 4Z3TA 2F1TA 2R4LA 3LK42 2Y0KA 3PGSA 4K3CA 5FVNA 2F1VA 5AFUK 5DL7A 3POQA 5DL6A 3AA1A 4RJWA 5T5FA 1PHOA 3NJTA 4AYMC 5D5DA 2KDYA 2XE2A 1YS5A 3NSGA 4K3BA 4O4XA 3UAQA 3HW9A 4C00A 2LFUA 1BH3A 2N2LA 4GF4A 2N2MA 2PRNA 3PGUA 4FSOA 3POXA 4GCSA 4KR8A 4N58A 4RJXA 5PRNA 3AAAB 4D64A 4LSHA 4FUVA 1HXXA 4AFKA 3AA6B 3DA3A 4RL9A 4O3WA 2KZ7B 3HOLA 1OPFA 1BXWA 2X27X 3O0EA 4GHBA 3SYSA 1MPFA 4CTDA 2J1NA 5G38A 4IL6O 2LHFA 5DL5A 2Y7SA 4AUIA 1HXUA 1GFMA 3AA7B 4AKRA 5GTHO 2ERVA 3VY8X 3AAEB 5G39A 4E1TA 3PORA 4FZLA 3AA0A 4O3ZA 2JMMA 2MHLA 2WVPA 1ZHXA 4AYNA 4O49A 3QRCA 4O3YA 4AYDC 2IWWA 4B61A 1GFOA 5ADXK 2QTKA 1PRNA 3JTYA 4BUMX 2R88A 1THQA 4O3XB 3C5OA 1OSMA 3QRAA 4U9CA 2OMFA 1S5LO 3T0SA 4D65A 1T16A 4N74A 4AYEC 2J4UP 3HOEA 3BRYA 3KVDD 1MM4A 4XNLA 3SZVA 2AXTO 3HWBA 4AYID 5AFUL 1ORMA 1P4TA 1BT9A 3AAAA 3BS0A 3DZMA 5GTIO 3RBHA 1GFPA 1IZNB 2IWVA 1E54A 3AA6A 7PRNA 4QQ1A 5JDPA 2KZ7A 4RLCA 3A0HO 4FRXA 2R8AA 4FOZA 2FGQX 4JCHA 2M07A 2M06A 2WJRA 2KXPA 4FT6A 2W80C 2R4OA 2Y0LA 2FGRA 4N75A 5G3AA 3WI4A 4C4VB 3SYBA 4RLBA 1GFNA 5G26A 4PJ0O 3A2SX 3PQUA 4PR7A 3V8UA 3VZTX 2F1CX 3EMNX 4AZLA 2XE5A 3T20A 1ZHYA 2X9KA 3LK2B 3K19A 4FZNA 1ZHTA 5KAIO 2MNHA 4XNKA 4FMSA 4KRAA 1T1LA 2R4PA 2K4TA 2XTRA 3SY7A 2GE4A 2YNKA 4FSPA 2WJQA 4PUXA 5B66O 1H6S1 3DWOX 2KC0A 2XE3A 6PRNA 8PRNA 3POUA 5ADXL 4O4UA 1Q9GA 2XTQA 1QJ8A 4G75A 3UPGA 5TISO 4AKMA 2ODJA 3PRNA 5B5EO 3FYXA 1G90A 3LK3B 3UU2A 4F4BA 2XE1A 3AA0B 2ZLDA 3VE2A 4E1SA 3WI5A 5EE2A 3JCUO 4LSFA 3AA1B 5IYUA 2W81C 2JQYA 4UB8O 2R89A 5E79O 4C4VA 3AA7A 3KZIO 3VE1A 5GV0A 4FQEA 4N59A 3PF1A 3AAEA 4FESA 3VZUX 3A0BO 4GCQA 3DA4A 3DWNA 2PORA 4KR4A 3T24A 4FZMA 3LK2A
chains in the Genus database with same CATH topology
3SY9A 2O4VA 5DL8A 2K0LA 2ZFGA 3G7GA 3LK41 3VY9X 4G76A 1MM5A 1QJ9A 4JFBA 2XMXA 3TZGA 2KXPB 3SZDA 1ZHZA 4LSEA 4D5UA 2Y2XA 4AKRB 3GP6A 4FRTA 1QJPA 4C69X 3VZWX 1HXTA 1Q9FA 1IZNA 2XG6A 2YPVA 1GFQA 1ZHWA 2Y0HA 3LK3A 3PQSA 4GCPA 4LSIA 4Z3TA 2F1TA 3LK42 2Y0KA 5FVNA 2F1VA 5AFUK 5DL7A 3POQA 5DL6A 3AA1A 4RJWA 5T5FA 1PHOA 4AYMC 5D5DA 2KDYA 2XE2A 1YS5A 3NSGA 4O4XA 3UAQA 3HW9A 2LFUA 1BH3A 2N2LA 4GF4A 2N2MA 2PRNA 4KR8A 4FSOA 3POXA 4GCSA 4N58A 4RJXA 5PRNA 4D64A 3AAAB 2J4UP 4LSHA 4FUVA 1HXXA 3AA6B 3DA3A 4RL9A 4O3WA 2KZ7B 3HOLA 1OPFA 1BXWA 2X27X 3O0EA 4GHBA 3SYSA 1MPFA 2J1NA 2LHFA 5DL5A 2Y7SA 4AUIA 1HXUA 1GFMA 3AA7B 4AKRA 2ERVA 3VY8X 3AAEB 4E1TA 3PORA 4FZLA 3AA0A 4O3ZA 2JMMA 2MHLA 4AYNA 1ZHXA 4O49A 3QRCA 4O3YA 4AYDC 4B61A 1GFOA 5ADXK 2QTKA 1PRNA 3JTYA 4BUMX 1THQA 4O3XB 3C5OA 1OSMA 3QRAA 4U9CA 2OMFA 3T0SA 4D65A 4AYEC 3HOEA 3KVDD 4XNLA 1MM4A 3SZVA 3HWBA 5AFUL 4AYID 1ORMA 1P4TA 1BT9A 3AAAA 3RBHA 1GFPA 1IZNB 3AA6A 1E54A 7PRNA 4QQ1A 5JDPA 2KZ7A 4RLCA 4FRXA 4FOZA 2FGQX 4JCHA 2M07A 2M06A 4AFKA 2KXPA 4FT6A 2W80C 2Y0LA 3WI4A 2FGRA 3SYBA 4RLBA 1GFNA 5G26A 3A2SX 3PQUA 3V8UA 3VZTX 3EMNX 4AZLA 2XE5A 3T20A 1ZHYA 3LK2B 3K19A 4FZNA 1ZHTA 2MNHA 4XNKA 4FMSA 4KRAA 2XTRA 2K4TA 3SY7A 2GE4A 2YNKA 4FSPA 4PUXA 1H6S1 2KC0A 2XE3A 6PRNA 8PRNA 3POUA 5ADXL 4O4UA 1Q9GA 2XTQA 1QJ8A 4G75A 3UPGA 4AKMA 2ODJA 3PRNA 1G90A 3FYXA 3LK3B 3UU2A 4F4BA 2XE1A 3AA0B 2ZLDA 3VE2A 4E1SA 3WI5A 5EE2A 4LSFA 3AA1B 5IYUA 2W81C 3AA7A 3VE1A 5GV0A 4N59A 3AAEA 4FESA 3VZUX 4GCQA 3DA4A 2PORA 4KR4A 3T24A 4FZMA 3LK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N2L A;  2GE4 A;  2N2M A;  2K0L A;  3G7G A;  1MM4 A;  4PUX A;  1ORM A;  1P4T A;  1MM5 A;  1QJ9 A;  1BXW A;  2X27 X;  1Q9G A;  1QJ8 A;  2LHF A;  1G90 A;  4RLC A;  3GP6 A;  1QJP A;  2M07 A;  2M06 A;  1Q9F A;  2ERV A;  2F1T A;  2F1V A;  2JMM A;  2MHL A;  3QRC A;  1THQ A;  2MNH A;  3C5O A;  3QRA A; 
#chains in the Genus database with same CATH topology
 5KAF O;  3SY9 A;  2O4V A;  5DL8 A;  2R4N A;  5H2F O;  2K0L A;  2ZFG A;  3G7G A;  3LK4 1;  4UB6 O;  3VY9 X;  4G76 A;  1MM5 A;  1QJ9 A;  4JFB A;  2XMX A;  3TZG A;  2KXP B;  3SZD A;  1ZHZ A;  4LSE A;  4D5U A;  2Y2X A;  4AKR B;  3GP6 A;  4FRT A;  1QJP A;  4C69 X;  3BRZ A;  3WU2 O;  3VZW X;  1HXT A;  1Q9F A;  1IZN A;  2XG6 A;  2YPV A;  1GFQ A;  1ZHW A;  2Y0H A;  3LK3 A;  3PGR A;  3PQS A;  4GCP A;  4LSI A;  4Z3T A;  2F1T A;  2R4L A;  3LK4 2;  2Y0K A;  3PGS A;  4K3C A;  5FVN A;  2F1V A;  5AFU K;  5DL7 A;  3POQ A;  5DL6 A;  3AA1 A;  4RJW A;  5T5F A;  1PHO A;  3NJT A;  4AYM C;  5D5D A;  2KDY A;  2XE2 A;  1YS5 A;  3NSG A;  4K3B A;  4O4X A;  3UAQ A;  3HW9 A;  4C00 A;  2LFU A;  1BH3 A;  2N2L A;  4GF4 A;  2N2M A;  2PRN A;  3PGU A;  4FSO A;  3POX A;  4GCS A;  4KR8 A;  4N58 A;  4RJX A;  5PRN A;  3AAA B;  4D64 A;  4LSH A;  4FUV A;  1HXX A;  4AFK A;  3AA6 B;  3DA3 A;  4RL9 A;  4O3W A;  2KZ7 B;  3HOL A;  1OPF A;  1BXW A;  2X27 X;  3O0E A;  4GHB A;  3SYS A;  1MPF A;  4CTD A;  2J1N A;  5G38 A;  4IL6 O;  2LHF A;  5DL5 A;  2Y7S A;  4AUI A;  1HXU A;  1GFM A;  3AA7 B;  4AKR A;  5GTH O;  2ERV A;  3VY8 X;  3AAE B;  5G39 A;  4E1T A;  3POR A;  4FZL A;  3AA0 A;  4O3Z A;  2JMM A;  2MHL A;  2WVP A;  1ZHX A;  4AYN A;  4O49 A;  3QRC A;  4O3Y A;  4AYD C;  2IWW A;  4B61 A;  1GFO A;  5ADX K;  2QTK A;  1PRN A;  3JTY A;  4BUM X;  2R88 A;  1THQ A;  4O3X B;  3C5O A;  1OSM A;  3QRA A;  4U9C A;  2OMF A;  1S5L O;  3T0S A;  4D65 A;  1T16 A;  4N74 A;  4AYE C;  2J4U P;  3HOE A;  3BRY A;  3KVD D;  1MM4 A;  4XNL A;  3SZV A;  2AXT O;  3HWB A;  4AYI D;  5AFU L;  1ORM A;  1P4T A;  1BT9 A;  3AAA A;  3BS0 A;  3DZM A;  5GTI O;  3RBH A;  1GFP A;  1IZN B;  2IWV A;  1E54 A;  3AA6 A;  7PRN A;  4QQ1 A;  5JDP A;  2KZ7 A;  4RLC A;  3A0H O;  4FRX A;  2R8A A;  4FOZ A;  2FGQ X;  4JCH A;  2M07 A;  2M06 A;  2WJR A;  2KXP A;  4FT6 A;  2W80 C;  2R4O A;  2Y0L A;  2FGR A;  4N75 A;  5G3A A;  3WI4 A;  4C4V B;  3SYB A;  4RLB A;  1GFN A;  5G26 A;  4PJ0 O;  3A2S X;  3PQU A;  4PR7 A;  3V8U A;  3VZT X;  2F1C X;  3EMN X;  4AZL A;  2XE5 A;  3T20 A;  1ZHY A;  2X9K A;  3LK2 B;  3K19 A;  4FZN A;  1ZHT A;  5KAI O;  2MNH A;  4XNK A;  4FMS A;  4KRA A;  1T1L A;  2R4P A;  2K4T A;  2XTR A;  3SY7 A;  2GE4 A;  2YNK A;  4FSP A;  2WJQ A;  4PUX A;  5B66 O;  1H6S 1;  3DWO X;  2KC0 A;  2XE3 A;  6PRN A;  8PRN A;  3POU A;  5ADX L;  4O4U A;  1Q9G A;  2XTQ A;  1QJ8 A;  4G75 A;  3UPG A;  5TIS O;  4AKM A;  2ODJ A;  3PRN A;  5B5E O;  3FYX A;  1G90 A;  3LK3 B;  3UU2 A;  4F4B A;  2XE1 A;  3AA0 B;  2ZLD A;  3VE2 A;  4E1S A;  3WI5 A;  5EE2 A;  3JCU O;  4LSF A;  3AA1 B;  5IYU A;  2W81 C;  2JQY A;  4UB8 O;  2R89 A;  5E79 O;  4C4V A;  3AA7 A;  3KZI O;  3VE1 A;  5GV0 A;  4FQE A;  4N59 A;  3PF1 A;  3AAE A;  4FES A;  3VZU X;  3A0B O;  4GCQ A;  3DA4 A;  3DWN A;  2POR A;  4KR4 A;  3T24 A;  4FZM A;  3LK2 A; 
#chains in the Genus database with same CATH homology
 3SY9 A;  2O4V A;  5DL8 A;  2K0L A;  2ZFG A;  3G7G A;  3LK4 1;  3VY9 X;  4G76 A;  1MM5 A;  1QJ9 A;  4JFB A;  2XMX A;  3TZG A;  2KXP B;  3SZD A;  1ZHZ A;  4LSE A;  4D5U A;  2Y2X A;  4AKR B;  3GP6 A;  4FRT A;  1QJP A;  4C69 X;  3VZW X;  1HXT A;  1Q9F A;  1IZN A;  2XG6 A;  2YPV A;  1GFQ A;  1ZHW A;  2Y0H A;  3LK3 A;  3PQS A;  4GCP A;  4LSI A;  4Z3T A;  2F1T A;  3LK4 2;  2Y0K A;  5FVN A;  2F1V A;  5AFU K;  5DL7 A;  3POQ A;  5DL6 A;  3AA1 A;  4RJW A;  5T5F A;  1PHO A;  4AYM C;  5D5D A;  2KDY A;  2XE2 A;  1YS5 A;  3NSG A;  4O4X A;  3UAQ A;  3HW9 A;  2LFU A;  1BH3 A;  2N2L A;  4GF4 A;  2N2M A;  2PRN A;  4KR8 A;  4FSO A;  3POX A;  4GCS A;  4N58 A;  4RJX A;  5PRN A;  4D64 A;  3AAA B;  2J4U P;  4LSH A;  4FUV A;  1HXX A;  3AA6 B;  3DA3 A;  4RL9 A;  4O3W A;  2KZ7 B;  3HOL A;  1OPF A;  1BXW A;  2X27 X;  3O0E A;  4GHB A;  3SYS A;  1MPF A;  2J1N A;  2LHF A;  5DL5 A;  2Y7S A;  4AUI A;  1HXU A;  1GFM A;  3AA7 B;  4AKR A;  2ERV A;  3VY8 X;  3AAE B;  4E1T A;  3POR A;  4FZL A;  3AA0 A;  4O3Z A;  2JMM A;  2MHL A;  4AYN A;  1ZHX A;  4O49 A;  3QRC A;  4O3Y A;  4AYD C;  4B61 A;  1GFO A;  5ADX K;  2QTK A;  1PRN A;  3JTY A;  4BUM X;  1THQ A;  4O3X B;  3C5O A;  1OSM A;  3QRA A;  4U9C A;  2OMF A;  3T0S A;  4D65 A;  4AYE C;  3HOE A;  3KVD D;  4XNL A;  1MM4 A;  3SZV A;  3HWB A;  5AFU L;  4AYI D;  1ORM A;  1P4T A;  1BT9 A;  3AAA A;  3RBH A;  1GFP A;  1IZN B;  3AA6 A;  1E54 A;  7PRN A;  4QQ1 A;  5JDP A;  2KZ7 A;  4RLC A;  4FRX A;  4FOZ A;  2FGQ X;  4JCH A;  2M07 A;  2M06 A;  4AFK A;  2KXP A;  4FT6 A;  2W80 C;  2Y0L A;  3WI4 A;  2FGR A;  3SYB A;  4RLB A;  1GFN A;  5G26 A;  3A2S X;  3PQU A;  3V8U A;  3VZT X;  3EMN X;  4AZL A;  2XE5 A;  3T20 A;  1ZHY A;  3LK2 B;  3K19 A;  4FZN A;  1ZHT A;  2MNH A;  4XNK A;  4FMS A;  4KRA A;  2XTR A;  2K4T A;  3SY7 A;  2GE4 A;  2YNK A;  4FSP A;  4PUX A;  1H6S 1;  2KC0 A;  2XE3 A;  6PRN A;  8PRN A;  3POU A;  5ADX L;  4O4U A;  1Q9G A;  2XTQ A;  1QJ8 A;  4G75 A;  3UPG A;  4AKM A;  2ODJ A;  3PRN A;  1G90 A;  3FYX A;  3LK3 B;  3UU2 A;  4F4B A;  2XE1 A;  3AA0 B;  2ZLD A;  3VE2 A;  4E1S A;  3WI5 A;  5EE2 A;  4LSF A;  3AA1 B;  5IYU A;  2W81 C;  3AA7 A;  3VE1 A;  5GV0 A;  4N59 A;  3AAE A;  4FES A;  3VZU X;  4GCQ A;  3DA4 A;  2POR A;  4KR4 A;  3T24 A;  4FZM A;  3LK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...