1Q9FA

Nmr structure of the outer membrane protein ompx in dhpc micelles
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
148
structure length
148
Chain Sequence
ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKNDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the integral membrane protein OmpX.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Outer membrane protein X
total genus 16
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2003-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1q9fA00
4RLCA 1G90A 1QJ8A 2N2LA 1MM4A 2MNHA 1QJPA 1MM5A 2LHFA 1ORMA 3C5OA 2JMMA 3QRCA 1QJ9A 2M07A 2ERVA 2X27X 3G7GA 2K0LA 1Q9GA 1THQA 4PUXA 1Q9FA 2GE4A 1P4TA 2N2MA 2F1VA 1BXWA 2M06A 2MHLA 3GP6A 3QRAA 2F1TA
chains in the Genus database with same CATH superfamily
2Y7SA 3PF1A 1G90A 1QJ8A 3PRNA 2R88A 4LSEA 3SZDA 2PRNA 2WVPA 4O49A 4FMSA 3BRZA 4AZLA 1GFQA 1MM5A 3WI4A 4CTDA 5IYUA 3AA0B 1QJ9A 1ZHYA 3FYXA 3KZIO 3PGRA 4JCHA 3SZVA 2XE1A 3POQA 3LK2A 5KAIO 4D65A 4D64A 3SY7A 3VZWX 2XTRA 5EE2A 2KZ7B 4GCQA 2W80C 3VZTX 4PR7A 2K4TA 1THQA 1Q9FA 3PQSA 2WJRA 5AFUK 3O0EA 5ADXK 2N2MA 1BXWA 1YS5A 4E1SA 4RJXA 3QRAA 4G76A 7PRNA 2R4PA 2AXTO 3AA6B 3TZGA 4O3WA 2XE3A 3VE2A 1HXXA 5G38A 5GTHO 4N75A 4O3YA 4UB6O 4O3XB 3A0HO 4D5UA 3T20A 4FUVA 4LSIA 2MNHA 2KDYA 3SYBA 4FRTA 4G75A 4RL9A 4FRXA 5T5FA 1ZHZA 4RLBA 2Y0KA 2KZ7A 3POUA 3QRCA 6PRNA 1T16A 3AA1A 3VY9X 3JCUO 5KAFO 2ERVA 4N74A 2IWVA 2R4OA 3A0BO 4FT6A 4JFBA 4LSFA 5GV0A 4AYEC 3DWOX 4PUXA 4O4XA 2GE4A 3DWNA 4KRAA 3AAAA 1PRNA 2F1VA 2Y0HA 3AA6A 5DL7A 3NJTA 4KR4A 1ZHTA 4FZMA 4AKMA 2XG6A 2FGRA 4O4UA 3HOEA 3RBHA 4AYNA 2ZLDA 2KXPA 3SY9A 5E79O 3DA4A 5H2FO 2F1TA 4C69X 4RLCA 3BRYA 4AFKA 3T24A 5B5EO 5ADXL 1MM4A 3AA7A 5G39A 3K19A 2J4UP 1E54A 3AA1B 3PQUA 5D5DA 4E1TA 1ORMA 2LHFA 4F4BA 3HW9A 3PORA 4U9CA 3UPGA 1PHOA 4AYDC 3V8UA 2LFUA 3LK42 4UB8O 1H6S1 3AAEB 1OSMA 2XTQA 4FZNA 4AKRB 4IL6O 1ZHWA 1IZNB 3DA3A 4GCSA 5DL5A 1HXUA 5FVNA 4C4VB 2OMFA 2X27X 4O3ZA 4QQ1A 2KXPB 2QTKA 2ZFGA 2K0LA 5DL8A 4Z3TA 2R8AA 4RJWA 5TISO 2Y2XA 3VY8X 3VZUX 4FQEA 4AYID 4AUIA 3A2SX 5AFUL 3SYSA 2IWWA 2M06A 3WI5A 2JQYA 4FOZA 4LSHA 1T1LA 3AAAB 5B66O 4GCPA 2J1NA 2PORA 4N59A 1HXTA 2FGQX 4XNLA 3VE1A 3AA7B 1BH3A 8PRNA 3WU2O 2O4VA 3AAEA 2N2LA 3LK3A 2W81C 5G3AA 4N58A 4PJ0O 3AA0A 3UU2A 4KR8A 1MPFA 1QJPA 4GHBA 4B61A 4C4VA 2X9KA 5DL6A 4AKRA 3C5OA 2JMMA 2M07A 3UAQA 4FZLA 4BUMX 2Y0LA 4K3BA 5JDPA 3BS0A 2R89A 3PGSA 1GFMA 3NSGA 3HOLA 2YNKA 2R4LA 3G7GA 3HWBA 3KVDD 3PGUA 4FSOA 2XE5A 5G26A 1IZNA 1Q9GA 4FESA 5GTIO 3DZMA 1BT9A 2ODJA 4AYMC 2YPVA 1OPFA 1P4TA 3LK2B 4K3CA 1ZHXA 2XMXA 4GF4A 2KC0A 3POXA 1GFOA 2MHLA 2WJQA 3JTYA 3GP6A 4FSPA 2F1CX 5PRNA 4XNKA 3T0SA 1GFPA 1GFNA 3LK41 2XE2A 1S5LO 3LK3B 3EMNX 4C00A 2R4NA
chains in the Genus database with same CATH topology
2Y7SA 1G90A 1QJ8A 3PRNA 4LSEA 3SZDA 2PRNA 4O49A 4FMSA 4AZLA 1GFQA 1MM5A 5IYUA 3AA0B 1QJ9A 1ZHYA 3FYXA 4JCHA 3SZVA 2XE1A 3POQA 3LK2A 4D65A 4D64A 3SY7A 3VZWX 2XTRA 5EE2A 2KZ7B 4GCQA 2W80C 3VZTX 2K4TA 1THQA 1Q9FA 3PQSA 5AFUK 5ADXK 3O0EA 2N2MA 1BXWA 1YS5A 4E1SA 4RJXA 3QRAA 4G76A 7PRNA 3TZGA 3VE2A 3AA6B 4O3WA 2XE3A 1HXXA 4O3YA 4O3XB 4D5UA 3T20A 4FUVA 4LSIA 2MNHA 2KDYA 3SYBA 4FRTA 4G75A 4RL9A 4FRXA 5T5FA 1ZHZA 4RLBA 2Y0KA 2KZ7A 3POUA 3QRCA 6PRNA 3AA1A 3VY9X 2ERVA 4LSFA 5GV0A 4FT6A 4JFBA 4PUXA 4O4XA 2GE4A 4KRAA 3AAAA 1PRNA 2F1VA 2Y0HA 3AA6A 5DL7A 4KR4A 1ZHTA 4AKMA 2XG6A 2FGRA 4O4UA 3HOEA 3RBHA 4AYNA 2ZLDA 2KXPA 3SY9A 3DA4A 2F1TA 4C69X 4RLCA 4AFKA 3T24A 1MM4A 3AA7A 2J4UP 3K19A 1E54A 3AA1B 3PQUA 5D5DA 4E1TA 1ORMA 2LHFA 4F4BA 3HW9A 3PORA 4U9CA 3UPGA 1PHOA 4AYDC 3V8UA 2LFUA 3LK42 1H6S1 3AAEB 1OSMA 2XTQA 4FZNA 4AKRB 1ZHWA 1IZNB 3DA3A 4GCSA 5DL5A 1HXUA 5FVNA 2OMFA 2X27X 4O3ZA 4QQ1A 2KXPB 2QTKA 2ZFGA 2K0LA 5DL8A 4Z3TA 4RJWA 3VY8X 3VZUX 2Y2XA 5AFUL 4AYID 5ADXL 4AUIA 3A2SX 3SYSA 2M06A 3WI5A 4FOZA 4LSHA 3AAAB 4GCPA 2J1NA 2PORA 4N59A 1HXTA 2FGQX 4XNLA 3VE1A 3AA7B 1BH3A 8PRNA 2O4VA 3AAEA 2N2LA 3LK3A 2W81C 4N58A 3AA0A 3UU2A 4KR8A 1MPFA 1QJPA 4GHBA 4B61A 5DL6A 3C5OA 2JMMA 2M07A 3UAQA 4FZLA 4BUMX 2Y0LA 5JDPA 1GFMA 3NSGA 3HOLA 2YNKA 3HWBA 3G7GA 3KVDD 4FSOA 4FZMA 3WI4A 2XE5A 5G26A 1IZNA 1Q9GA 4FESA 4AKRA 4AYEC 1BT9A 2ODJA 4AYMC 2YPVA 1OPFA 1P4TA 3LK2B 1ZHXA 2XMXA 4GF4A 2KC0A 3POXA 1GFOA 2MHLA 3JTYA 4FSPA 3GP6A 5PRNA 4XNKA 1GFPA 1GFNA 3LK41 2XE2A 3LK3B 3T0SA 3EMNX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RLC A;  1G90 A;  1QJ8 A;  2N2L A;  1MM4 A;  2MNH A;  1QJP A;  1MM5 A;  2LHF A;  1ORM A;  3C5O A;  2JMM A;  3QRC A;  1QJ9 A;  2M07 A;  2ERV A;  2X27 X;  3G7G A;  2K0L A;  1Q9G A;  1THQ A;  4PUX A;  1Q9F A;  2GE4 A;  1P4T A;  2N2M A;  2F1V A;  1BXW A;  2M06 A;  2MHL A;  3GP6 A;  3QRA A;  2F1T A; 
#chains in the Genus database with same CATH topology
 2Y7S A;  3PF1 A;  1G90 A;  1QJ8 A;  3PRN A;  2R88 A;  4LSE A;  3SZD A;  2PRN A;  2WVP A;  4O49 A;  4FMS A;  3BRZ A;  4AZL A;  1GFQ A;  1MM5 A;  3WI4 A;  4CTD A;  5IYU A;  3AA0 B;  1QJ9 A;  1ZHY A;  3FYX A;  3KZI O;  3PGR A;  4JCH A;  3SZV A;  2XE1 A;  3POQ A;  3LK2 A;  5KAI O;  4D65 A;  4D64 A;  3SY7 A;  3VZW X;  2XTR A;  5EE2 A;  2KZ7 B;  4GCQ A;  2W80 C;  3VZT X;  4PR7 A;  2K4T A;  1THQ A;  1Q9F A;  3PQS A;  2WJR A;  5AFU K;  3O0E A;  5ADX K;  2N2M A;  1BXW A;  1YS5 A;  4E1S A;  4RJX A;  3QRA A;  4G76 A;  7PRN A;  2R4P A;  2AXT O;  3AA6 B;  3TZG A;  4O3W A;  2XE3 A;  3VE2 A;  1HXX A;  5G38 A;  5GTH O;  4N75 A;  4O3Y A;  4UB6 O;  4O3X B;  3A0H O;  4D5U A;  3T20 A;  4FUV A;  4LSI A;  2MNH A;  2KDY A;  3SYB A;  4FRT A;  4G75 A;  4RL9 A;  4FRX A;  5T5F A;  1ZHZ A;  4RLB A;  2Y0K A;  2KZ7 A;  3POU A;  3QRC A;  6PRN A;  1T16 A;  3AA1 A;  3VY9 X;  3JCU O;  5KAF O;  2ERV A;  4N74 A;  2IWV A;  2R4O A;  3A0B O;  4FT6 A;  4JFB A;  4LSF A;  5GV0 A;  4AYE C;  3DWO X;  4PUX A;  4O4X A;  2GE4 A;  3DWN A;  4KRA A;  3AAA A;  1PRN A;  2F1V A;  2Y0H A;  3AA6 A;  5DL7 A;  3NJT A;  4KR4 A;  1ZHT A;  4FZM A;  4AKM A;  2XG6 A;  2FGR A;  4O4U A;  3HOE A;  3RBH A;  4AYN A;  2ZLD A;  2KXP A;  3SY9 A;  5E79 O;  3DA4 A;  5H2F O;  2F1T A;  4C69 X;  4RLC A;  3BRY A;  4AFK A;  3T24 A;  5B5E O;  5ADX L;  1MM4 A;  3AA7 A;  5G39 A;  3K19 A;  2J4U P;  1E54 A;  3AA1 B;  3PQU A;  5D5D A;  4E1T A;  1ORM A;  2LHF A;  4F4B A;  3HW9 A;  3POR A;  4U9C A;  3UPG A;  1PHO A;  4AYD C;  3V8U A;  2LFU A;  3LK4 2;  4UB8 O;  1H6S 1;  3AAE B;  1OSM A;  2XTQ A;  4FZN A;  4AKR B;  4IL6 O;  1ZHW A;  1IZN B;  3DA3 A;  4GCS A;  5DL5 A;  1HXU A;  5FVN A;  4C4V B;  2OMF A;  2X27 X;  4O3Z A;  4QQ1 A;  2KXP B;  2QTK A;  2ZFG A;  2K0L A;  5DL8 A;  4Z3T A;  2R8A A;  4RJW A;  5TIS O;  2Y2X A;  3VY8 X;  3VZU X;  4FQE A;  4AYI D;  4AUI A;  3A2S X;  5AFU L;  3SYS A;  2IWW A;  2M06 A;  3WI5 A;  2JQY A;  4FOZ A;  4LSH A;  1T1L A;  3AAA B;  5B66 O;  4GCP A;  2J1N A;  2POR A;  4N59 A;  1HXT A;  2FGQ X;  4XNL A;  3VE1 A;  3AA7 B;  1BH3 A;  8PRN A;  3WU2 O;  2O4V A;  3AAE A;  2N2L A;  3LK3 A;  2W81 C;  5G3A A;  4N58 A;  4PJ0 O;  3AA0 A;  3UU2 A;  4KR8 A;  1MPF A;  1QJP A;  4GHB A;  4B61 A;  4C4V A;  2X9K A;  5DL6 A;  4AKR A;  3C5O A;  2JMM A;  2M07 A;  3UAQ A;  4FZL A;  4BUM X;  2Y0L A;  4K3B A;  5JDP A;  3BS0 A;  2R89 A;  3PGS A;  1GFM A;  3NSG A;  3HOL A;  2YNK A;  2R4L A;  3G7G A;  3HWB A;  3KVD D;  3PGU A;  4FSO A;  2XE5 A;  5G26 A;  1IZN A;  1Q9G A;  4FES A;  5GTI O;  3DZM A;  1BT9 A;  2ODJ A;  4AYM C;  2YPV A;  1OPF A;  1P4T A;  3LK2 B;  4K3C A;  1ZHX A;  2XMX A;  4GF4 A;  2KC0 A;  3POX A;  1GFO A;  2MHL A;  2WJQ A;  3JTY A;  3GP6 A;  4FSP A;  2F1C X;  5PRN A;  4XNK A;  3T0S A;  1GFP A;  1GFN A;  3LK4 1;  2XE2 A;  1S5L O;  3LK3 B;  3EMN X;  4C00 A;  2R4N A; 
#chains in the Genus database with same CATH homology
 2Y7S A;  1G90 A;  1QJ8 A;  3PRN A;  4LSE A;  3SZD A;  2PRN A;  4O49 A;  4FMS A;  4AZL A;  1GFQ A;  1MM5 A;  5IYU A;  3AA0 B;  1QJ9 A;  1ZHY A;  3FYX A;  4JCH A;  3SZV A;  2XE1 A;  3POQ A;  3LK2 A;  4D65 A;  4D64 A;  3SY7 A;  3VZW X;  2XTR A;  5EE2 A;  2KZ7 B;  4GCQ A;  2W80 C;  3VZT X;  2K4T A;  1THQ A;  1Q9F A;  3PQS A;  5AFU K;  5ADX K;  3O0E A;  2N2M A;  1BXW A;  1YS5 A;  4E1S A;  4RJX A;  3QRA A;  4G76 A;  7PRN A;  3TZG A;  3VE2 A;  3AA6 B;  4O3W A;  2XE3 A;  1HXX A;  4O3Y A;  4O3X B;  4D5U A;  3T20 A;  4FUV A;  4LSI A;  2MNH A;  2KDY A;  3SYB A;  4FRT A;  4G75 A;  4RL9 A;  4FRX A;  5T5F A;  1ZHZ A;  4RLB A;  2Y0K A;  2KZ7 A;  3POU A;  3QRC A;  6PRN A;  3AA1 A;  3VY9 X;  2ERV A;  4LSF A;  5GV0 A;  4FT6 A;  4JFB A;  4PUX A;  4O4X A;  2GE4 A;  4KRA A;  3AAA A;  1PRN A;  2F1V A;  2Y0H A;  3AA6 A;  5DL7 A;  4KR4 A;  1ZHT A;  4AKM A;  2XG6 A;  2FGR A;  4O4U A;  3HOE A;  3RBH A;  4AYN A;  2ZLD A;  2KXP A;  3SY9 A;  3DA4 A;  2F1T A;  4C69 X;  4RLC A;  4AFK A;  3T24 A;  1MM4 A;  3AA7 A;  2J4U P;  3K19 A;  1E54 A;  3AA1 B;  3PQU A;  5D5D A;  4E1T A;  1ORM A;  2LHF A;  4F4B A;  3HW9 A;  3POR A;  4U9C A;  3UPG A;  1PHO A;  4AYD C;  3V8U A;  2LFU A;  3LK4 2;  1H6S 1;  3AAE B;  1OSM A;  2XTQ A;  4FZN A;  4AKR B;  1ZHW A;  1IZN B;  3DA3 A;  4GCS A;  5DL5 A;  1HXU A;  5FVN A;  2OMF A;  2X27 X;  4O3Z A;  4QQ1 A;  2KXP B;  2QTK A;  2ZFG A;  2K0L A;  5DL8 A;  4Z3T A;  4RJW A;  3VY8 X;  3VZU X;  2Y2X A;  5AFU L;  4AYI D;  5ADX L;  4AUI A;  3A2S X;  3SYS A;  2M06 A;  3WI5 A;  4FOZ A;  4LSH A;  3AAA B;  4GCP A;  2J1N A;  2POR A;  4N59 A;  1HXT A;  2FGQ X;  4XNL A;  3VE1 A;  3AA7 B;  1BH3 A;  8PRN A;  2O4V A;  3AAE A;  2N2L A;  3LK3 A;  2W81 C;  4N58 A;  3AA0 A;  3UU2 A;  4KR8 A;  1MPF A;  1QJP A;  4GHB A;  4B61 A;  5DL6 A;  3C5O A;  2JMM A;  2M07 A;  3UAQ A;  4FZL A;  4BUM X;  2Y0L A;  5JDP A;  1GFM A;  3NSG A;  3HOL A;  2YNK A;  3HWB A;  3G7G A;  3KVD D;  4FSO A;  4FZM A;  3WI4 A;  2XE5 A;  5G26 A;  1IZN A;  1Q9G A;  4FES A;  4AKR A;  4AYE C;  1BT9 A;  2ODJ A;  4AYM C;  2YPV A;  1OPF A;  1P4T A;  3LK2 B;  1ZHX A;  2XMX A;  4GF4 A;  2KC0 A;  3POX A;  1GFO A;  2MHL A;  3JTY A;  4FSP A;  3GP6 A;  5PRN A;  4XNK A;  1GFP A;  1GFN A;  3LK4 1;  2XE2 A;  3LK3 B;  3T0S A;  3EMN X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...