3AA6B

Crystal structure of actin capping protein in complex with the cp-binding motif derived from cd2ap
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
242
structure length
242
Chain Sequence
DQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
total genus 80
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aa6B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aa6B02
3AAAA 5ADXL 1IZNA 3AAAB 2KXPA 1IZNB 5AFUL 5ADXK 4AKRB 3AA6B 3AA0A 2KZ7A 3AAEB 3AA1A 3AA7B 3LK3A 3LK2A 3LK2B 3AAEA 3AA0B 3AA6A 3LK42 3LK3B 3AA7A 3AA1B 3LK41 5AFUK 2KZ7B 2KXPB 4AKRA
chains in the Genus database with same CATH superfamily
3AEGA 4K0KT 2DLRA 1IZNB 4P1NA 4A5XA 4GKJT 1ZHXA 4NPPA 2LM9A 3P50A 3Q2MA 2IC9A 2WCAA 2PTFA 4DR5T 5AFUK 2ODUA 4O3YA 3ZYKA 2JPFA 3UU8A 3QC9A 3BQIA 3T8OA 3C4ZA 4YTPA 3FBZA 1BXWA 2YDRA 3P4QA 3U3IA 3SY7A 4IGUA 3RC3A 2H3RA 5CA0E 2YEVC 2GK9A 2LRLA 3HR0A 3NSGA 4FMSA 2CA5A 2JQ9A 3KVAA 1MNDA 2EHOD 2XAHB 4H9QC 2DI4A 2Y8DA 4IE5A 5HEJA 2VKHA 3EUHA 2Z6EA 1GFPA 3K3NA 2WU5A 3HKCE 2WAUA 5GV0A 4F4BA 2IWVA 3CX7B 4TUYE 4PUXA 5LYJE 3O1HA 4TNWA 5EZYE 3VRBA 2V1DB 2VVNA 4LF6T 4DVDA 1ORMA 1LKXA 1ZHTA 5CJ5A 4JBWF 3PUVF 3AXJB 4HWDA 1LRZA 3UPGA 5FVKA 3DWOX 1BR1A 4KI0F 1I6ZA 3FZLB 3FZMB 5HCJA 1KNZA 4C69X 1HCIA 2BKNA 3B57A 3PURA 5KAFO 1XMQT 2XAGB 4BJNA 4LF4T 4A56A 1HG5A 3DWNA 4PK4A 3QOFA 1THQA 3AE2A 3UQ4A 5FXVA 1P4TA 4DO0A 1WYBA 5L3EB 4KR8A 4Z8XA 4AQYT 1S5LO 4KBMB 3L09A 3KVBA 4IHJE 4PR7A 3A8YC 3VZTX 3ANWB 3NRXA 3HOEA 4CXXA 1V9DA 3DP7A 3CPZA 4DV4T 3ONLC 3UFGA 2Q9QA 4P09A 3SFEA 3AAAA 3N9OA 4Q25A 4EB6E 5ADXK 2V6YB 2X9XA 4ZXLA 5BMVE 4X1KE 4OFZA 4J2CA 3AB3B 3WI4A 2XPKA 4YSYA 3AA1B 2JRKA 3RYFE 2WMOA 2XQ7A 3F57A 2QRXA 3K3QC 1US7B 2MAWA 2K9AA 5M4YA 4ZZCA 4IDOA 3PTRB 3JC6D 4DR6T 4ZEYA 4HTEA 1KK7A 2MPKA 4FZMA 4B61A 3ONJA 5EK4A 3ANWA 1YKHB 2P9BA 1IJ5A 2FJAA 2E9XC 3N5LA 4AZLA 4X1IE 4AKIA 2N2MA 2QYWA 4PJ0O 4FI5A 2CXLA 5L4HA 3TLUA 3WAJA 3V5SA 7PRNA 3UU2A 3RRWA 1E54A 3QB5A 2XJ7A 2WSSV 4ILBA 4COFA 2VURA 2XQ5A 2HPJA 3QB5K 4I0UA 4E7SA 5FL1A 2YKSA 3ZT6A 4UXNB 3FZFB 5H6QB 4AKHA 2CXFA 1UX4A 2KWIB 3ZMVB 3AE1A 2C5IT 2LJLA 2WVPA 1Q9GA 4XNLA 5AQOB 5KXJA 4QH4A 4AYEC 3P8CD 4H9RC 4DBQA 3ZSSA 2BKPA 2WMNA 3ETVA 1T1LA 5TAOA 3H3MA 5FXZA 3PV0F 1QJ8A 2JJ9A 2X27X 4JI4T 4HWIB 5ABGA 2VQFT 2ZMAA 1UK5A 3AVSA 2DWKA 4E7ZA 2E9XB 3T20A 3CQGB 2VQET 4JI7T 5JH7E 3N9NA 2K3WA 4QX7B 5IYUA 4JFBA 3DA4A 4ZI7E 3TLSA 3VHLA 5ABFB 4ZOLE 2VKDA 4U7YA 3M65A 3UU4A 2LFUA 3F31A 3MJXA 4NXNT 4CN6A 2ACZA 5LXTE 5ETWA 4U9CA 3UUNA 2E5VA 3AE7A 2K0LA 1UURA 2D2SA 3EDUA 2CMRA 2FJEA 4IE0A 1FIOA 5TISO 4ADZA 4F8HA 4JI5T 5HWYA 1OXZA 1GFNA 4E1SA 4X66T 4YTMA 2W63A 4HFVA 5FVNA 2JMKA 4LFBT 5H2FO 1MMGA 2LSYA 5JR9A 3POUA 3N9QA 3PF1A 3PU3A 4JUYA 2J4GA 4EZ4A 3VKGA 2XG6A 3EDVA 2L9QA 3Q5DA 3ZC1A 3NRYA 5ABEA 3ZYLA 5KAIO 2OMFA 5L4EA 2WY2A 1UCUA 1HNWT 4RL9A 5LGUB 2QA7A 4EYUA 1W0AA 2BG9E 1XNQT 3SY9A 4FOZA 2IAKA 4LF9T 3WU2O 2E9XA 2UXBT 2LKGA 1IBLT 2ZLDA 4GKKT 2C5KT 3ZMUB 2I6HA 3LDQB 2R88A 2HPLA 5AQJB 4CI2B 3K19A 4JCHA 2XE2A 3QUJA 2CPTA 2WDRA 1KF6A 3AAEA 3VZUX 1ZV4X 5J2TE 2A3DA 4LSHA 4MLKA 3C51A 3ZN1B 3C64A 3IBPA 4OK0A 2BZBA 4AI6A 4AKMA 4QH5A 3CQCB 4IE6A 4IE4A 5AQIB 4N58A 3A5XA 4YHHT 4AKGA 5HCMA 3L3PA 2QGSA 3OPCA 2YK0A 3EHZA 4JLEA 3E22E 1N36T 4QX8B 2V7KA 5D5DA 3K1SA 1Y01A 2CLYC 5LJMA 2K5BB 5C2TA 3R6NA 2R4NA 3RX6A 6PRNA 2H89A 2E8IA 2ZM2A 4LMLA 3PUAA 3CQXC 2FGRA 3K8PC 2CEAA 5HXHA 4KX6A 2C0SA 4FSOA 3M3ZB 3QRCA 2PFVA 2IHR1 1BR2A 3HI2A 2ZM6T 2W4XA 2CWYA 3POQA 5JDLA 4IL4A 4GYSA 5HXEA 2D0TA 5LOVE 2LOPA 3MKDA 5JTGA 3VZWX 3LSVA 2EHOC 1ZHZA 2X0HA 4WBNE 4LFAT 5JVDE 4DMWA 4D64A 3UT5E 3PQSA 4C00A 4XZCA 3AE6A 2RPAA 5JDPA 2M07A 2CBJA 1WYCA 4DV1T 5F8PA 4AUIA 3HKBE 2X51A 4C90A 2LHRA 4EEBA 2D9DA 3ZC0A 2CXDA 4PFPA 3ZPOA 5KMGP 1XDOA 4LF5T 1HXUA 5BR8T 4H9NC 1J1JA 5L3BB 2AXDS 1N33T 2XQ8A 3PQUA 4LMKA 3PUZF 4G2AA 5GTHO 1OWAA 3KV5A 3SFDA 5LHGB 4ZHQE 2X0LB 4IDQA 1BR4A 1R8IA 2YINA 3KDSE 2JMMA 3IEEA 3KVDD 5JDFA 3B13A 2V5CA 2NTXA 3LK2A 4KP3C 1YS5A 2NOXA 1UGOA 1YD8G 3PGSA 3DTOA 2VB6A 2NP9A 3O4XE 3OJAA 3S4UA 1HX8A 2V7JA 4KUMB 3PU8A 3MXZA 3LFMA 4WW0A 4I4TE 4DNDA 2ZFGA 2XASB 1NWMX 4CI1B 5LP6E 2XE1A 3IHRA 1OEDE 3AEFA 4IL9A 5JDHA 2E2AA 4TX5A 5FP3A 1KNPA 1ZKEA 4FZNA 2UXNB 4WZXA 2DHRA 5HEHA 3QNUA 3UU6A 4G75A 1IAPA 4H9OC 3ABVA 4BA9A 4GHBA 4JI8T 2XSAA 3MA9A 1NENA 4I55E 4YY3T 4UV9B 2LLYA 3W15B 3C50A 2R8AA 3I1AA 4AQFC 2UU9T 1KFYA 3GA8A 3AXJA 4DR7T 5EK2A 3KZIO 3JC6C 5LG3A 4LFCT 2XM2A 2C5JA 1MM5A 2XQ6A 2IC6A 1T72A 4PNIA 3RHWA 4O8SA 4A98A 4D65A 4TV9E 1S94A 2WBLA 3N2KE 5J1GA 3ZSTA 4IDPA 3FBLA 1D1CA 1OEDC 2KMFA 1XDPA 1ZHYA 4HEAA 2X9YA 3UAQA 4ILCA 3LG7A 4TN7B 4N78D 3JTYA 4UB6O 3AA0A 4CQIA 5AQFB 2IIUA 1S35A 4N75A 3IA3A 2ACXA 3MZKB 4AXPA 4IREA 3L39A 3FYXA 2VKOA 1MMNA 4P0AA 2CCQA 2V26A 5CB4E 1MNEA 4PK5A 3ZLIA 4YJ2E 5ABFA 3HOLA 2M06A 3C4XA 2OLTA 4AISA 3AA7A 2BS2A 2NW8A 2LE8A 1GFMA 4RJWA 4FRXA 1XNRT 3Q5XA 2XAJB 1HXTA 2E9XD 3I9YA 1Z8UA 4FT6A 2OA5A 2VK9A 1NAFA 2KSRA 4DUYT 1G73A 3ZJ1A 3NZQA 1EZ3A 3B5MA 5DL5A 1LVFA 4LF7T 4LSEA 2V6XA 2EHOB 4GCQA 4IE7A 2H7VC 2Q9QB 2YPVA 3LBXB 2XQ4A 2FJBA 3TKLB 3V5UA 4BUMX 2W61A 1VCSA 3SRZA 1UX5A 2J47A 2M67A 5EE2A 2UUCT 3JAFA 2NWBA 1M7KA 3CKDA 3KV9A 2NW9A 3FHNA 4U31A 4QXCB 3C98B 2N1GA 2MBGA 3NKZA 3N2OA 3LK3B 4HN9A 2Y6XA 3OTOT 4MBQA 4LF8T 2LOSA 3GN5A 2XAQB 4PAGA 5DQVA 1PHOA 3GN5B 1WR6A 4RLCA 4TV8E 4C4VA 2Y0LA 4GCPA 5LGTB 2R89A 2CRBA 3OYZA 3CWZB 2YU1A 3CX8B 4EYYR 3TZGA 2IMLA 2VWAA 4YSXA 4DV2T 4B6XA 1X9BA 4U3CA 4MFRA 3LBXA 4XBFB 3PGUA 2LT3A 4EEDA 2JQHA 3BK9A 1YQ3A 1WRDA 5DL6A 2DNXA 2J62A 1FMWA 4EZHA 5AQGB 2WWVA 3AAIA 5FL0A 1CHUA 4L9IA 5C8YE 2Y2XA 1PRNA 1UUSA 2K4TA 3HKEE 3I0OA 4NIQA 2FBWA 3AAAB 5H6RB 5LBQB 2FGQX 3Q9DA 3FZHB 4O4JE 2XMXA 2LRKA 1BR0A 3T1YT 5LBMA 1DU2A 5F3JA 4L0RA 4U74A 5G38A 3UU5A 2WJRA 3A7MA 2CLYB 3RYCE 4HWFA 2W81C 4EV6A 5DL7A 3BQLA 1ZHCA 3L8RA 2LKHA 4JI3T 3SYSA 2WZHA 3PUXF 4L5GA 2XY8B 5L2LA 4ILAA 3RYIE 3JADA 2WZIA 2KT9A 2LSJA 1HTJF 2J4UP 4DV6T 2RA1A 2MNHA 1JNZA 4YTNA 3OBVE 2XQAA 2R6GF 4LSIA 3RGLA 4B3MT 1MIVA 5HAXA 4QWNB 2W66A 4O3ZA 3CVRA 3HL6A 4HFBA 5FY1A 3NBXX 5CA1E 1D1AA 4V1Av 3GWHA 2ERVA 2CHOA 5AFUL 4C91A 4U7IA 3EAMA 3RQWA 2YNKA 2CM0A 2JQQA 4LMJA 3ZKRA 4JYAT 1IJ6A 4JI1T 4YJ3E 2GE4A 1I94T 3T24A 1LVKA 1J5WA 4KRAA 1HFAA 1YW0A 3DZMA 4O4LE 2XQYA 3AVRA 3X1DA 2EHOA 3ZMSB 3V8UA 2WU2A 4AYMC 3GP6A 3R84B 2KDYA 4DV3T 1H7CA 2XQ9A 3NWIA 4TWFA 4FESA 5A1LA 3P7IA 3BRZA 4CZZB 2CBIA 5JREA 3F2EA 4KMCA 1ZP0A 1XWMA 4CN1A 1WLXA 5LMNT 2YDSA 3OKQA 4FRTA 1D0ZA 3QK6A 4ISTA 3G7GA 3DJBA 3ZCIA 2L3LA 5KX5E 4UF0B 3CX6B 2BVMA 4QKNA 3ESLA 5AQHB 3LK2B 3TLWA 3LJCA 3KBUA 2XUEA 4I43B 2X9WA 5DL8A 1D0XA 3SZDA 4O4UA 3VU7H 4AYNA 4Z90A 3E08A 4JI6T 3RBHA 4NUUA 4TWHA 3EI0A 3UQ7A 4YXDA 2V7IA 4ASKA 2LSIA 1FJGT 4AKRB 2IUBA 5DQWA 2BVLA 2I59A 4GK0E 2X9KA 3RPUA 2F4VT 3AE9A 4HE8A 2KLQA 1G90A 3AE5A 2BBJA 3ZYMA 1G8XA 2VKJA 5J0ZA 2JQYA 1T16A 3JCUO 3PGRA 2VASA 3RQUA 3HW9A 1WR0A 3ONXA 4PW8A 4HFIA 4AFKA 4UELA 1E7PA 5HXRA 4QXBB 5LG4A 2AE9A 3AA6B 3KV4A 4CXWA 4GIWA 3PUSA 5FXWA 3SS1A 4FJOA 1J5ET 4BAYB 3N2GE 2HN2A 5AQRB 3N9MA 3BS0A 4HFCA 4JEHB 2L8KA 3JAEA 4KHZF 2N2NA 4TZ4C 2DL1A 2KXPA 3NVOA 3KV6A 4FUVA 3RKGA 3N9LA 3VE2A 2BDEA 1VCTA 4KR4A 5AQLB 5FNVE 4DV5T 1W0BA 3CMLA 4KHPT 4H9PC 3PRNA 2K24A 3UUMA 3SYBA 3A0BO 4G63A 2XE5A 2CE7A 2FJDA 1OEDA 4I50E 4PJLA 3RF1A 4O4IE 5B5EO 5LJNA 2SPCA 2XTQA 3TLVA 2WDQA 5FY7A 2KNDA 5LMUT 2AXTO 4UVAB 5L3GB 2JQKA 3VY9X 3OVUA 2M6IA 4HGAA 4QH1A 5ADXL 4AQFA 1OEDB 4K3BA 3ZMZB 3BQKA 2A9UA 2PBIA 3VR9A 4BJMA 4U2ZA 3SOLA 4AYDC 1BT9A 2BG9B 3HWBA 4HWCA 2LSGA 4Z91A 3UUXB 2MHLA 2B76A 2WQYA 4O2AE 1T98A 3C4WA 4O3XB 3E0ZA 2WB5A 3RLFF 4GCSA 4P0BA 2Y48B 2PG8A 2Q9QD 2J1DG 2OV9A 2UUBT 4HWHA 5IWAT 3J9X1 1HNZT 3VE1A 4YLHA 5AQQB 4YFSA 1GFOA 2ODVA 3O1JA 1W9RA 2KZ7B 2X0YA 2R4OA 4DR2T 5PRNA 4ZZBA 4WBOA 5J2UE 2V5DA 3H3AA 3KBTA 1AJ3A 2ZM0A 5AQPB 4FZLA 3PUGA 3C5OA 3POXA 3VR8A 4ILUA 3IF8B 1SA0E 4G76A 2WS3A 3FB2A 4UB8O 5KDMC 2PJQA 4AIUA 2M6BA 4O3WA 3AE8A 2BG9A 4DIDB 3A0HO 3UUBA 4X65T 2CHNA 4PJJA 4UR9A 2WM9A 5FY0A 2KC0A 2QVAA 3QRAA 2XE3A 4U2YA 2H88A 2WJQA 4CTDA 1KNRA 1Y64B 3Q5WA 4AQGA 5IHYA 4X62T 4YHJA 2W67A 1Q9FA 2VVSA 5C3JA 1HR0T 4AKRA 5T5FA 3ZN0B 1IZNA 3AEDA 4F6RC 3EVYA 4IIJE 4CN4A 2VL8A 3MACA 4HKAA 5IYZE 4WNKA 2KZ7A 4GF4A 2ZLYA 4RLBA 1MMDA 5CFBA 3FXEB 2HN1A 4QQ1A 5AQTB 3AEAA 5HEOA 4JV5T 5HWXA 1XZYA 4Z3TA 3OYXA 2X68A 5JDMA 2UXDT 1OPFA 1MIWA 2X67A 1N34T 4UVCB 1D1BA 2X66A 5L3FB 1XMOT 2V8SV 3AE4A 2G0UA 4ZS3A 4N59A 2F1VA 2BS4A 4FSPA 3UULA 3PUYF 3ZJ2A 4A97A 3PE0A 3T1HT 2D0UA 1X79A 3CK6A 5LB7B 5E79O 2Q9QC 2FUPA 2WDVA 3RKOA 1QLBA 4DR4T 3RIUA 1IBMT 5AQUB 1VRBA 3PUQA 4PJNA 5HXSA 5HYAA 2E5LT 1O3XA 4X64T 3AEBA 1SHZC 4B3ST 4N74A 5GONE 3TLTA 4EOZB 1MMAA 2JIWA 3MK7C 2XHEB 2MTQA 3VKHA 4B3TT 3SWHA 2WP9A 2WWUA 3UTKA 4MHCA 4AKLA 2UUAT 4QHOA 1NEKA 2MOZA 2N2LA 2XTRA 2XTLA 1WFDA 3O1IA 2NR4A 2YDQA 4OHFA 1ZHWA 4JEUB 2PORA 2HHHT 2ODJA 2RP4A 4DUZT 2KINB 1E2AA 1WCRA 1U5PA 2MYSA 3AA1A 3AA7B 5IUXA 3VY8X 3Q5EA 4ZI3D 2F1CX 2XQ3A 4GOUA 3AA0B 4YSZA 1HNXT 3RIAA 4IDNA 2YN6A 4PK6A 4UV8B 2UXCT 1QJPA 1W09A 3WI3A 4LSFA 1HS7A 3ZCJA 5L3DB 4UIGA 4TNVA 5DABA 1MM4A 3O9XA 3KFWX 2W80C 5GTIO 2X9HA 3ZMTB 2Y0KA 4ZI2C 5LHHB 3BRYA 4H63H 4H9SE 4HFDA 2XZEA 1QUUA 4XAXB 4ZS2A 4AYID 3AE3A 3H37A 1FEWA 4U72A 3K3OA 2KWHA 2PRNA 8PRNA 4GK5E 5L3CB 2R4LA 3UU3A 3CIRA 5LCYA 4UVBB 2H7OA 3PUWF 1CUNA 4ISSA 1GQEA 3PJAA 5G39A 2NW7A 3G06A 4EIWA 1E1HB 3LK3A 2D5UA 4E1TA 2BG9C 4RJXA 3FXDB 4JI0T 2A2FX 3NJTA 2DCFA 1Z0PA 4O4HE 4EGWA 5HEGA 2QTKA 3P4RA 3A2SX 3ZT7A 5LGNB 4DMVA 3ZT5A 4ANJA 5JDGA 2HH7A 3ETUA 4JI2T 2W62A 4TWDA 4NUVA 4DV7T 1N32T 4O4XA 4X1YE 3T0SA 4DBRA 5LA6E 4NXMT 1M62A 2NTYA 3P4WA 5LNKA 2V6YA 3P4SA 4CI3B 4PFOA 5B66O 2IWWA 1YXRA 1BH3A 2VL0A 2DWGA 3GMIA 2R4PA 5AQNB 4X5TA 5ABHA 4DV0T 2ES0A 2BS3A 3I0QA 3NZPA 3WI5A 1SE7A 3RI5A 5JDNA 3PORA 2I0MA 4K3CA 1MPFA 3D0TA 2J1NA 5JDQA 2IDOB 3AECA 4IDZA 2W0GA 5JR9B 2W00A 3RIFA 1JNRA 3ZEFB 5CGMA 2LSKA 5JQGE 3RH3A 2JMHA 3FZKB 4ZI3C 5FVLA 5G3AA 4HFEA 4O2BE 1HX1B 2IW5B 1T7SA 2YU2A 3UFEA 3AA6A 3LK42 4EAHA 1QSDA 1YQ4A 4OYKA 4DR1T 2BKOA 5DJQC 1L0VA 4C4VB 5FYMA 1FMVA 1YKEB 4OYJA 2LM2A 1OSMA 1SUMB 3I9WA 5AQSB 5AQKB 3O0EA 1QJ9A 2LHNA 2YOEA 2LHFA 2XM1A 3HA4A 4FQEA 1ZEEA 3J7Yq 2V7LA 4H63V 4QXHB 5G26A 4GYRA 4UF0A 4ZI2D 2F1TA 2UXXB 5LHIB 4HFHA 4WYVA 3RRCA 3SZVA 4YT0A 3U78A 3EABA 4IT4A 1KEYA 5JR9C 3EMNX 5FXXA 5JRCB 2W2UA 2KXPB 3N9PA 5AQMB 5F5WA 4IL6O 2Y7SA 1HXXA 5FMNA 4B3RT 1B7TA 3AEEA 2K48A 4UEMA 2LEHA 5EK3A 3VRAA 2V7MA 3RIUC 5HEUA 4CXYA 1T8BA 3RYHE 4OX9T 4ERRA 1IBKT 3HKDE 3KINB 4XNKA 2O4VA 1GFQA 3AAEB 4M1PA 2BBHA 1U4QA 4U33A 1H6S1 1HF8A 1MIYA 5L47A 5HXCA 5FKYA 3LK41 1D0YA 2B1EA 3RC8A 1VOMA 2XSBA 4DR3T 4D5UA 4EXTA 4PJMA 5AQVB 2ZM8A 2Y0HA 4X20E 3PJAJ 2CWOA 4O49A 5JRCA 2XAFB 4K0UA 1ZOYA 3JCFA 5E0OA 2N9DA 1HG2A 4MALA 3PDYA 3P4PA 2A72A 3DA3A 3WAKA
chains in the Genus database with same CATH topology
3C64A 3IBPA 2X68A 2BZBA 3HKEE 3I0OA 4OK0A 5JDMA 3AAAB 1OPFA 4AI6A 4AKMA 5H6RB 1MIWA 2X67A 5LBQB 2FGQX 2DLRA 1IZNB 3CQCB 3Q9DA 4IE6A 4IE4A 4N58A 4UVCB 1D1BA 2X66A 5L3FB 1ZHXA 4O4JE 2LM9A 2XMXA 3A5XA 1BR0A 4AKGA 3Q2MA 2G0UA 2IC9A 5LBMA 4ZS3A 4N59A 3L3PA 5F3JA 2F1VA 4FSPA 4L0RA 2QGSA 4U74A 3UULA 2YK0A 3ZJ2A 5AFUK 2ODUA 4JLEA 3E22E 2CLYB 3ZYKA 4O3YA 4QX8B 3RYCE 2JPFA 2V7KA 2W81C 3PE0A 5D5DA 3QC9A 3BQIA 2D0UA 3T8OA 5DL7A 1X79A 1ZHCA 3BQLA 2CLYC 3C4ZA 5LJMA 3FBZA 2K5BB 1BXWA 2Q9QC 3R6NA 3U3IA 3SY7A 3RKOA 3SYSA 3RX6A 6PRNA 4L5GA 2E8IA 2ZM2A 3PUAA 4IGUA 3RC3A 2H3RA 5CA0E 3CQXC 5L2LA 2FGRA 3K8PC 2YEVC 2GK9A 3HR0A 2CEAA 1VRBA 3PUQA 3NSGA 5HXHA 4FMSA 3RYIE 2CA5A 2C0SA 4FSOA 3KVAA 4PJNA 3QRCA 1MNDA 2PFVA 2EHOD 5HXSA 2XAHB 2KT9A 4H9QC 2DI4A 2LSJA 1BR2A 2Y8DA 3HI2A 4IE5A 5HYAA 1O3XA 1HTJF 2VKHA 3EUHA 2Z6EA 2J4UP 1SHZC 2CWYA 3POQA 1GFPA 5JDLA 2RA1A 5GONE 3K3NA 4EOZB 3HKCE 4GYSA 2WAUA 1MMAA 2MNHA 5GV0A 4F4BA 3MK7C 3OBVE 2XHEB 3CX7B 2MTQA 5HXEA 3VKHA 4TUYE 3SWHA 4PUXA 2D0TA 5LYJE 4LSIA 3O1HA 2WWUA 1MIVA 5HAXA 4QWNB 5EZYE 4O3ZA 5LOVE 2V1DB 3UTKA 3CVRA 3HL6A 2LOPA 3MKDA 4MHCA 4AKLA 3VZWX 5FY1A 2EHOC 4DVDA 3NBXX 1LKXA 5CA1E 1ORMA 1ZHTA 1D1AA 1ZHZA 4QHOA 4V1Av 3GWHA 2ERVA 4WBNE 5JVDE 4DMWA 5AFUL 4C91A 2MOZA 1LRZA 3UPGA 2N2LA 2XTRA 2XTLA 2YNKA 2CM0A 1BR1A 2JQQA 4D64A 3O1IA 3UT5E 1KNZA 3PQSA 4XZCA 1IJ6A 4C69X 1HCIA 4OHFA 1ZHWA 4JEUB 5JDPA 4YJ3E 3B57A 2M07A 2GE4A 3PURA 1WYCA 2PORA 3T24A 5F8PA 1LVKA 4AUIA 4KRAA 2ODJA 1HFAA 1YW0A 2XAGB 3HKBE 2X51A 4BJNA 4O4LE 4C90A 2RP4A 4A56A 2LHRA 1HG5A 2XQYA 3AVRA 2EHOA 3ZMSB 3ZC0A 3V8UA 2CXDA 4PFPA 2KINB 3ZPOA 5KMGP 4PK4A 1U5PA 1HXUA 1THQA 4AYMC 2MYSA 4H9NC 3AA1A 5L3BB 3AA7B 3GP6A 3R84B 3VY8X 4ZI3D 2KDYA 1H7CA 4GOUA 3AA0B 5FXVA 3PQUA 1P4TA 4DO0A 4G2AA 1OWAA 3KV5A 4PK6A 4UV8B 1WYBA 5L3EB 4KR8A 1QJPA 5LHGB 4Z8XA 4FESA 5A1LA 4KBMB 2X0LB 4ZHQE 3P7IA 3WI3A 3L09A 4CZZB 4LSFA 3KVBA 4IHJE 1BR4A 2YINA 3KDSE 5JREA 1HS7A 3F2EA 3IEEA 3ZCJA 5JDFA 2JMMA 3KVDD 3VZTX 3ANWB 3NRXA 4KMCA 5L3DB 3HOEA 3B13A 4UIGA 4CXXA 1V9DA 1WLXA 2NTXA 5DABA 1MM4A 3O9XA 3DP7A 3KFWX 3CPZA 2W80C 3LK2A 2X9HA 3OKQA 4KP3C 4FRTA 1YS5A 2NOXA 1YD8G 3DTOA 1D0ZA 2VB6A 2NP9A 3O4XE 3OJAA 3QK6A 3ZMTB 4ISTA 2Y0KA 3S4UA 4ZI2C 3DJBA 3G7GA 3ZCIA 1HX8A 5LHHB 2L3LA 5KX5E 2Q9QA 4UF0B 4P09A 3AAAA 4H63H 2V7JA 3CX6B 4KUMB 3PU8A 4H9SE 1QUUA 3MXZA 3N9OA 3LFMA 2BVMA 4QKNA 4EB6E 5ADXK 4WW0A 4I4TE 4DNDA 2X9XA 4XAXB 2ZFGA 2XASB 5BMVE 1NWMX 4X1KE 4ZS2A 4CI1B 5LP6E 3H37A 4AYID 1FEWA 3IHRA 3ESLA 4U72A 2XE1A 4OFZA 3K3OA 4J2CA 3AB3B 2KWHA 3LK2B 3LJCA 3KBUA 2PRNA 3WI4A 5JDHA 4TX5A 5FP3A 2XUEA 8PRNA 4I43B 2X9WA 4GK5E 5L3CB 5DL8A 1D0XA 1ZKEA 3SZDA 4FZNA 2UXNB 3AA1B 2JRKA 3RYFE 2DHRA 3VU7H 4O4UA 2WMOA 4AYNA 5LCYA 3E08A 4UVBB 3RBHA 3F57A 4NUUA 3K3QC 1US7B 2H7OA 2K9AA 4G75A 1CUNA 1IAPA 4ISSA 2V7IA 5M4YA 4H9OC 4ASKA 3PTRB 2LSIA 4BA9A 4GHBA 3JC6D 4AKRB 2NW7A 4EIWA 5DQWA 1E1HB 3MA9A 2BVLA 1KK7A 4HTEA 4I55E 3LK3A 2D5UA 4UV9B 4E1TA 2I59A 4GK0E 4RJXA 3RPUA 3W15B 4FZMA 3FXDB 4HE8A 4B61A 3C50A 2KLQA 1G90A 2A2FX 3ZYMA 1G8XA 5EK4A 2VKJA 2DCFA 1Z0PA 3I1AA 4O4HE 3ANWA 2QTKA 4AQFC 1YKHB 3A2SX 2P9BA 2VASA 1IJ5A 4DMVA 5LGNB 3HW9A 4ANJA 3GA8A 3ONXA 4PW8A 5EK2A 5JDGA 2HH7A 3ETUA 4AFKA 2E9XC 3N5LA 4UELA 3JC6C 4AZLA 5HXRA 2W62A 4X1IE 2C5JA 4NUVA 4QXBB 5LG4A 4AKIA 1MM5A 3AA6B 3KV4A 4X1YE 4CXWA 4O4XA 2N2MA 3T0SA 4DBRA 5LA6E 2IC6A 4GIWA 3PUSA 4FI5A 4PNIA 2CXLA 4O8SA 5FXWA 3SS1A 4D65A 4FJOA 4TV9E 2NTYA 1S94A 3N2GE 3V5SA 4BAYB 3WAJA 7PRNA 2WBLA 3N2KE 3N9MA 5J1GA 5LNKA 3UU2A 4JEHB 2L8KA 3RRWA 4PFOA 4CI3B 1E54A 3FBLA 2N2NA 1D1CA 1BH3A 2DWGA 3GMIA 2KMFA 4TZ4C 2WSSV 4Z3TA 1ZHYA 4HEAA 2X9YA 2KXPA 3UAQA 3KV6A 2ES0A 4FUVA 3LG7A 4TN7B 2HPJA 3I0QA 3NZPA 3N9LA 3WI5A 4N78D 3VE2A 3JTYA 5JDNA 3PORA 3AA0A 4E7SA 4CQIA 1MPFA 2BDEA 1S35A 4KR4A 4UXNB 3D0TA 5H6QB 2J1NA 5JDQA 4AKHA 5FNVE 2ACXA 3MZKB 2W0GA 4IDZA 4AXPA 2CXFA 1UX4A 2KWIB 3CMLA 5JR9B 2W00A 3ZMVB 4H9PC 2C5IT 2K24A 3UUMA 2LJLA 3PRNA 3SYBA 3FYXA 4G63A 2VKOA 2XE5A 1MMNA 3ZEFB 4P0AA 1Q9GA 4XNLA 2LSKA 5JQGE 3RH3A 4AYEC 2CE7A 2CCQA 3P8CD 4H9RC 4DBQA 2V26A 5CB4E 1MNEA 2JMHA 4I50E 2WMNA 3ETVA 4PJLA 4PK5A 3ZLIA 4ZI3C 4O4IE 4YJ2E 5TAOA 3HOLA 5LJNA 2M06A 2SPCA 3C4XA 4O2BE 2XTQA 5FXZA 1QJ8A 5FY7A 2JJ9A 2X27X 2KNDA 2IW5B 2YU2A 3AA6A 3UFEA 3LK42 4EAHA 3AA7A 1QSDA 4UVAB 2NW8A 5L3GB 2LE8A 4OYKA 1GFMA 5DJQC 2ZMAA 1FMVA 5FYMA 1YKEB 3AVSA 4OYJA 1OSMA 3VY9X 4HGAA 3I9WA 4RJWA 2DWKA 4FRXA 4E7ZA 3Q5XA 5ADXL 2XAJB 3O0EA 1QJ9A 4AQFA 2E9XB 3T20A 3CQGB 1HXTA 3ZMZB 3BQKA 2E9XD 2PBIA 3I9YA 2LHNA 4BJMA 3SOLA 4AYDC 1BT9A 5JH7E 3HWBA 3N9NA 2OA5A 2VK9A 4FT6A 1NAFA 4QX7B 2LHFA 5IYUA 3HA4A 1G73A 3ZJ1A 3DA4A 4JFBA 2LSGA 3NZQA 4ZI7E 1EZ3A 3UUXB 2MHLA 5DL5A 1LVFA 3VHLA 4O2AE 4ZOLE 1ZEEA 1T98A 3J7Yq 4LSEA 2VKDA 2V7LA 4H63V 2EHOB 3M65A 4QXHB 3C4WA 4O3XB 2LFUA 4GCQA 5G26A 3E0ZA 4GYRA 4IE7A 4P0BA 4GCSA 2H7VC 3F31A 2Y48B 3MJXA 2Q9QB 4UF0A 4ZI2D 2F1TA 2UXXB 5LHIB 2YPVA 2PG8A 2Q9QD 5LXTE 5ETWA 2J1DG 3RRCA 4U9CA 3UUNA 3LBXB 3SZVA 3U78A 3TKLB 3J9X1 3V5UA 4YLHA 3VE1A 4BUMX 2W61A 2K0LA 2D2SA 3EDUA 2CMRA 4IE0A 4YFSA 1GFOA 2ODVA 1FIOA 4ADZA 3O1JA 3SRZA 1UX5A 5JR9C 2KZ7B 3EMNX 2M67A 5FXXA 5JRCB 5EE2A 2KXPB 5PRNA 5HWYA 1OXZA 1GFNA 4E1SA 2W63A 4WBOA 5J2UE 3N9PA 3H3AA 3KBTA 4HFVA 1AJ3A 2NWBA 2ZM0A 5FMNA 2JMKA 1HXXA 2Y7SA 5FVNA 1B7TA 4FZLA 3PUGA 3CKDA 1MMGA 3KV9A 3C5OA 3POXA 4ILUA 3IF8B 1SA0E 2NW9A 2LSYA 4G76A 3FB2A 5JR9A 3POUA 3FHNA 4QXCB 3N9QA 2K48A 3PU3A 4UEMA 3C98B 5KDMC 2N1GA 2MBGA 2LEHA 4JUYA 2PJQA 3N2OA 5EK3A 3LK3B 4HN9A 4O3WA 2V7MA 4EZ4A 2Y6XA 3VKGA 2XG6A 4MBQA 3EDVA 4CXYA 4PJJA 2WM9A 5FY0A 2LOSA 2L9QA 3RYHE 3GN5A 3ZC1A 4ERRA 2XAQB 2KC0A 2XE3A 3QRAA 3HKDE 3KINB 3NRYA 4PAGA 3ZYLA 5DQVA 1PHOA 3GN5B 1WR6A 4RLCA 2OMFA 4TV8E 1UCUA 4XNKA 4RL9A 1Y64B 3Q5WA 2O4VA 2Y0LA 1GFQA 5LGUB 3AAEB 2QA7A 4M1PA 4EYUA 4GCPA 1U4QA 5LGTB 4AQGA 5IHYA 1H6S1 1HF8A 3OYZA 3SY9A 3CWZB 1MIYA 4FOZA 3CX8B 2IAKA 2YU1A 4YHJA 5HXCA 4EYYR 1Q9FA 3LK41 2VWAA 3TZGA 1D0YA 4B6XA 2B1EA 4MFRA 2E9XA 3LBXA 3RC8A 1VOMA 4XBFB 4AKRA 2ZLDA 2LT3A 5T5FA 3ZN0B 1IZNA 4D5UA 4EXTA 2C5KT 4F6RC 3EVYA 4PJMA 4IIJE 3BK9A 3ZMUB 2Y0HA 2ZM8A 4X20E 1WRDA 5DL6A 2DNXA 2VL8A 3MACA 4HKAA 2HPLA 2CWOA 5IYZE 4O49A 5JRCA 2XAFB 4WNKA 4CI2B 3K19A 2KZ7A 4K0UA 1FMWA 4GF4A 4JCHA 2ZLYA 2XE2A 3QUJA 4EZHA 5E0OA 4RLBA 1MMDA 3AAEA 3VZUX 2N9DA 1ZV4X 5J2TE 3FXEB 2A3DA 3AAIA 4QQ1A 1HG2A 4LSHA 4L9IA 4MLKA 5C8YE 4MALA 3PDYA 2Y2XA 1PRNA 2A72A 5HWXA 3DA3A 2K4TA 3OYXA 3WAKA 3C51A 3ZN1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAA A;  5ADX L;  1IZN A;  3AAA B;  2KXP A;  1IZN B;  5AFU L;  5ADX K;  4AKR B;  3AA6 B;  3AA0 A;  2KZ7 A;  3AAE B;  3AA1 A;  3AA7 B;  3LK3 A;  3LK2 A;  3LK2 B;  3AAE A;  3AA0 B;  3AA6 A;  3LK4 2;  3LK3 B;  3AA7 A;  3AA1 B;  3LK4 1;  5AFU K;  2KZ7 B;  2KXP B;  4AKR A; 
#chains in the Genus database with same CATH topology
 3AEG A;  4K0K T;  2DLR A;  1IZN B;  4P1N A;  4A5X A;  4GKJ T;  1ZHX A;  4NPP A;  2LM9 A;  3P50 A;  3Q2M A;  2IC9 A;  2WCA A;  2PTF A;  4DR5 T;  5AFU K;  2ODU A;  4O3Y A;  3ZYK A;  2JPF A;  3UU8 A;  3QC9 A;  3BQI A;  3T8O A;  3C4Z A;  4YTP A;  3FBZ A;  1BXW A;  2YDR A;  3P4Q A;  3U3I A;  3SY7 A;  4IGU A;  3RC3 A;  2H3R A;  5CA0 E;  2YEV C;  2GK9 A;  2LRL A;  3HR0 A;  3NSG A;  4FMS A;  2CA5 A;  2JQ9 A;  3KVA A;  1MND A;  2EHO D;  2XAH B;  4H9Q C;  2DI4 A;  2Y8D A;  4IE5 A;  5HEJ A;  2VKH A;  3EUH A;  2Z6E A;  1GFP A;  3K3N A;  2WU5 A;  3HKC E;  2WAU A;  5GV0 A;  4F4B A;  2IWV A;  3CX7 B;  4TUY E;  4PUX A;  5LYJ E;  3O1H A;  4TNW A;  5EZY E;  3VRB A;  2V1D B;  2VVN A;  4LF6 T;  4DVD A;  1ORM A;  1LKX A;  1ZHT A;  5CJ5 A;  4JBW F;  3PUV F;  3AXJ B;  4HWD A;  1LRZ A;  3UPG A;  5FVK A;  3DWO X;  1BR1 A;  4KI0 F;  1I6Z A;  3FZL B;  3FZM B;  5HCJ A;  1KNZ A;  4C69 X;  1HCI A;  2BKN A;  3B57 A;  3PUR A;  5KAF O;  1XMQ T;  2XAG B;  4BJN A;  4LF4 T;  4A56 A;  1HG5 A;  3DWN A;  4PK4 A;  3QOF A;  1THQ A;  3AE2 A;  3UQ4 A;  5FXV A;  1P4T A;  4DO0 A;  1WYB A;  5L3E B;  4KR8 A;  4Z8X A;  4AQY T;  1S5L O;  4KBM B;  3L09 A;  3KVB A;  4IHJ E;  4PR7 A;  3A8Y C;  3VZT X;  3ANW B;  3NRX A;  3HOE A;  4CXX A;  1V9D A;  3DP7 A;  3CPZ A;  4DV4 T;  3ONL C;  3UFG A;  2Q9Q A;  4P09 A;  3SFE A;  3AAA A;  3N9O A;  4Q25 A;  4EB6 E;  5ADX K;  2V6Y B;  2X9X A;  4ZXL A;  5BMV E;  4X1K E;  4OFZ A;  4J2C A;  3AB3 B;  3WI4 A;  2XPK A;  4YSY A;  3AA1 B;  2JRK A;  3RYF E;  2WMO A;  2XQ7 A;  3F57 A;  2QRX A;  3K3Q C;  1US7 B;  2MAW A;  2K9A A;  5M4Y A;  4ZZC A;  4IDO A;  3PTR B;  3JC6 D;  4DR6 T;  4ZEY A;  4HTE A;  1KK7 A;  2MPK A;  4FZM A;  4B61 A;  3ONJ A;  5EK4 A;  3ANW A;  1YKH B;  2P9B A;  1IJ5 A;  2FJA A;  2E9X C;  3N5L A;  4AZL A;  4X1I E;  4AKI A;  2N2M A;  2QYW A;  4PJ0 O;  4FI5 A;  2CXL A;  5L4H A;  3TLU A;  3WAJ A;  3V5S A;  7PRN A;  3UU2 A;  3RRW A;  1E54 A;  3QB5 A;  2XJ7 A;  2WSS V;  4ILB A;  4COF A;  2VUR A;  2XQ5 A;  2HPJ A;  3QB5 K;  4I0U A;  4E7S A;  5FL1 A;  2YKS A;  3ZT6 A;  4UXN B;  3FZF B;  5H6Q B;  4AKH A;  2CXF A;  1UX4 A;  2KWI B;  3ZMV B;  3AE1 A;  2C5I T;  2LJL A;  2WVP A;  1Q9G A;  4XNL A;  5AQO B;  5KXJ A;  4QH4 A;  4AYE C;  3P8C D;  4H9R C;  4DBQ A;  3ZSS A;  2BKP A;  2WMN A;  3ETV A;  1T1L A;  5TAO A;  3H3M A;  5FXZ A;  3PV0 F;  1QJ8 A;  2JJ9 A;  2X27 X;  4JI4 T;  4HWI B;  5ABG A;  2VQF T;  2ZMA A;  1UK5 A;  3AVS A;  2DWK A;  4E7Z A;  2E9X B;  3T20 A;  3CQG B;  2VQE T;  4JI7 T;  5JH7 E;  3N9N A;  2K3W A;  4QX7 B;  5IYU A;  4JFB A;  3DA4 A;  4ZI7 E;  3TLS A;  3VHL A;  5ABF B;  4ZOL E;  2VKD A;  4U7Y A;  3M65 A;  3UU4 A;  2LFU A;  3F31 A;  3MJX A;  4NXN T;  4CN6 A;  2ACZ A;  5LXT E;  5ETW A;  4U9C A;  3UUN A;  2E5V A;  3AE7 A;  2K0L A;  1UUR A;  2D2S A;  3EDU A;  2CMR A;  2FJE A;  4IE0 A;  1FIO A;  5TIS O;  4ADZ A;  4F8H A;  4JI5 T;  5HWY A;  1OXZ A;  1GFN A;  4E1S A;  4X66 T;  4YTM A;  2W63 A;  4HFV A;  5FVN A;  2JMK A;  4LFB T;  5H2F O;  1MMG A;  2LSY A;  5JR9 A;  3POU A;  3N9Q A;  3PF1 A;  3PU3 A;  4JUY A;  2J4G A;  4EZ4 A;  3VKG A;  2XG6 A;  3EDV A;  2L9Q A;  3Q5D A;  3ZC1 A;  3NRY A;  5ABE A;  3ZYL A;  5KAI O;  2OMF A;  5L4E A;  2WY2 A;  1UCU A;  1HNW T;  4RL9 A;  5LGU B;  2QA7 A;  4EYU A;  1W0A A;  2BG9 E;  1XNQ T;  3SY9 A;  4FOZ A;  2IAK A;  4LF9 T;  3WU2 O;  2E9X A;  2UXB T;  2LKG A;  1IBL T;  2ZLD A;  4GKK T;  2C5K T;  3ZMU B;  2I6H A;  3LDQ B;  2R88 A;  2HPL A;  5AQJ B;  4CI2 B;  3K19 A;  4JCH A;  2XE2 A;  3QUJ A;  2CPT A;  2WDR A;  1KF6 A;  3AAE A;  3VZU X;  1ZV4 X;  5J2T E;  2A3D A;  4LSH A;  4MLK A;  3C51 A;  3ZN1 B;  3C64 A;  3IBP A;  4OK0 A;  2BZB A;  4AI6 A;  4AKM A;  4QH5 A;  3CQC B;  4IE6 A;  4IE4 A;  5AQI B;  4N58 A;  3A5X A;  4YHH T;  4AKG A;  5HCM A;  3L3P A;  2QGS A;  3OPC A;  2YK0 A;  3EHZ A;  4JLE A;  3E22 E;  1N36 T;  4QX8 B;  2V7K A;  5D5D A;  3K1S A;  1Y01 A;  2CLY C;  5LJM A;  2K5B B;  5C2T A;  3R6N A;  2R4N A;  3RX6 A;  6PRN A;  2H89 A;  2E8I A;  2ZM2 A;  4LML A;  3PUA A;  3CQX C;  2FGR A;  3K8P C;  2CEA A;  5HXH A;  4KX6 A;  2C0S A;  4FSO A;  3M3Z B;  3QRC A;  2PFV A;  2IHR 1;  1BR2 A;  3HI2 A;  2ZM6 T;  2W4X A;  2CWY A;  3POQ A;  5JDL A;  4IL4 A;  4GYS A;  5HXE A;  2D0T A;  5LOV E;  2LOP A;  3MKD A;  5JTG A;  3VZW X;  3LSV A;  2EHO C;  1ZHZ A;  2X0H A;  4WBN E;  4LFA T;  5JVD E;  4DMW A;  4D64 A;  3UT5 E;  3PQS A;  4C00 A;  4XZC A;  3AE6 A;  2RPA A;  5JDP A;  2M07 A;  2CBJ A;  1WYC A;  4DV1 T;  5F8P A;  4AUI A;  3HKB E;  2X51 A;  4C90 A;  2LHR A;  4EEB A;  2D9D A;  3ZC0 A;  2CXD A;  4PFP A;  3ZPO A;  5KMG P;  1XDO A;  4LF5 T;  1HXU A;  5BR8 T;  4H9N C;  1J1J A;  5L3B B;  2AXD S;  1N33 T;  2XQ8 A;  3PQU A;  4LMK A;  3PUZ F;  4G2A A;  5GTH O;  1OWA A;  3KV5 A;  3SFD A;  5LHG B;  4ZHQ E;  2X0L B;  4IDQ A;  1BR4 A;  1R8I A;  2YIN A;  3KDS E;  2JMM A;  3IEE A;  3KVD D;  5JDF A;  3B13 A;  2V5C A;  2NTX A;  3LK2 A;  4KP3 C;  1YS5 A;  2NOX A;  1UGO A;  1YD8 G;  3PGS A;  3DTO A;  2VB6 A;  2NP9 A;  3O4X E;  3OJA A;  3S4U A;  1HX8 A;  2V7J A;  4KUM B;  3PU8 A;  3MXZ A;  3LFM A;  4WW0 A;  4I4T E;  4DND A;  2ZFG A;  2XAS B;  1NWM X;  4CI1 B;  5LP6 E;  2XE1 A;  3IHR A;  1OED E;  3AEF A;  4IL9 A;  5JDH A;  2E2A A;  4TX5 A;  5FP3 A;  1KNP A;  1ZKE A;  4FZN A;  2UXN B;  4WZX A;  2DHR A;  5HEH A;  3QNU A;  3UU6 A;  4G75 A;  1IAP A;  4H9O C;  3ABV A;  4BA9 A;  4GHB A;  4JI8 T;  2XSA A;  3MA9 A;  1NEN A;  4I55 E;  4YY3 T;  4UV9 B;  2LLY A;  3W15 B;  3C50 A;  2R8A A;  3I1A A;  4AQF C;  2UU9 T;  1KFY A;  3GA8 A;  3AXJ A;  4DR7 T;  5EK2 A;  3KZI O;  3JC6 C;  5LG3 A;  4LFC T;  2XM2 A;  2C5J A;  1MM5 A;  2XQ6 A;  2IC6 A;  1T72 A;  4PNI A;  3RHW A;  4O8S A;  4A98 A;  4D65 A;  4TV9 E;  1S94 A;  2WBL A;  3N2K E;  5J1G A;  3ZST A;  4IDP A;  3FBL A;  1D1C A;  1OED C;  2KMF A;  1XDP A;  1ZHY A;  4HEA A;  2X9Y A;  3UAQ A;  4ILC A;  3LG7 A;  4TN7 B;  4N78 D;  3JTY A;  4UB6 O;  3AA0 A;  4CQI A;  5AQF B;  2IIU A;  1S35 A;  4N75 A;  3IA3 A;  2ACX A;  3MZK B;  4AXP A;  4IRE A;  3L39 A;  3FYX A;  2VKO A;  1MMN A;  4P0A A;  2CCQ A;  2V26 A;  5CB4 E;  1MNE A;  4PK5 A;  3ZLI A;  4YJ2 E;  5ABF A;  3HOL A;  2M06 A;  3C4X A;  2OLT A;  4AIS A;  3AA7 A;  2BS2 A;  2NW8 A;  2LE8 A;  1GFM A;  4RJW A;  4FRX A;  1XNR T;  3Q5X A;  2XAJ B;  1HXT A;  2E9X D;  3I9Y A;  1Z8U A;  4FT6 A;  2OA5 A;  2VK9 A;  1NAF A;  2KSR A;  4DUY T;  1G73 A;  3ZJ1 A;  3NZQ A;  1EZ3 A;  3B5M A;  5DL5 A;  1LVF A;  4LF7 T;  4LSE A;  2V6X A;  2EHO B;  4GCQ A;  4IE7 A;  2H7V C;  2Q9Q B;  2YPV A;  3LBX B;  2XQ4 A;  2FJB A;  3TKL B;  3V5U A;  4BUM X;  2W61 A;  1VCS A;  3SRZ A;  1UX5 A;  2J47 A;  2M67 A;  5EE2 A;  2UUC T;  3JAF A;  2NWB A;  1M7K A;  3CKD A;  3KV9 A;  2NW9 A;  3FHN A;  4U31 A;  4QXC B;  3C98 B;  2N1G A;  2MBG A;  3NKZ A;  3N2O A;  3LK3 B;  4HN9 A;  2Y6X A;  3OTO T;  4MBQ A;  4LF8 T;  2LOS A;  3GN5 A;  2XAQ B;  4PAG A;  5DQV A;  1PHO A;  3GN5 B;  1WR6 A;  4RLC A;  4TV8 E;  4C4V A;  2Y0L A;  4GCP A;  5LGT B;  2R89 A;  2CRB A;  3OYZ A;  3CWZ B;  2YU1 A;  3CX8 B;  4EYY R;  3TZG A;  2IML A;  2VWA A;  4YSX A;  4DV2 T;  4B6X A;  1X9B A;  4U3C A;  4MFR A;  3LBX A;  4XBF B;  3PGU A;  2LT3 A;  4EED A;  2JQH A;  3BK9 A;  1YQ3 A;  1WRD A;  5DL6 A;  2DNX A;  2J62 A;  1FMW A;  4EZH A;  5AQG B;  2WWV A;  3AAI A;  5FL0 A;  1CHU A;  4L9I A;  5C8Y E;  2Y2X A;  1PRN A;  1UUS A;  2K4T A;  3HKE E;  3I0O A;  4NIQ A;  2FBW A;  3AAA B;  5H6R B;  5LBQ B;  2FGQ X;  3Q9D A;  3FZH B;  4O4J E;  2XMX A;  2LRK A;  1BR0 A;  3T1Y T;  5LBM A;  1DU2 A;  5F3J A;  4L0R A;  4U74 A;  5G38 A;  3UU5 A;  2WJR A;  3A7M A;  2CLY B;  3RYC E;  4HWF A;  2W81 C;  4EV6 A;  5DL7 A;  3BQL A;  1ZHC A;  3L8R A;  2LKH A;  4JI3 T;  3SYS A;  2WZH A;  3PUX F;  4L5G A;  2XY8 B;  5L2L A;  4ILA A;  3RYI E;  3JAD A;  2WZI A;  2KT9 A;  2LSJ A;  1HTJ F;  2J4U P;  4DV6 T;  2RA1 A;  2MNH A;  1JNZ A;  4YTN A;  3OBV E;  2XQA A;  2R6G F;  4LSI A;  3RGL A;  4B3M T;  1MIV A;  5HAX A;  4QWN B;  2W66 A;  4O3Z A;  3CVR A;  3HL6 A;  4HFB A;  5FY1 A;  3NBX X;  5CA1 E;  1D1A A;  4V1A v;  3GWH A;  2ERV A;  2CHO A;  5AFU L;  4C91 A;  4U7I A;  3EAM A;  3RQW A;  2YNK A;  2CM0 A;  2JQQ A;  4LMJ A;  3ZKR A;  4JYA T;  1IJ6 A;  4JI1 T;  4YJ3 E;  2GE4 A;  1I94 T;  3T24 A;  1LVK A;  1J5W A;  4KRA A;  1HFA A;  1YW0 A;  3DZM A;  4O4L E;  2XQY A;  3AVR A;  3X1D A;  2EHO A;  3ZMS B;  3V8U A;  2WU2 A;  4AYM C;  3GP6 A;  3R84 B;  2KDY A;  4DV3 T;  1H7C A;  2XQ9 A;  3NWI A;  4TWF A;  4FES A;  5A1L A;  3P7I A;  3BRZ A;  4CZZ B;  2CBI A;  5JRE A;  3F2E A;  4KMC A;  1ZP0 A;  1XWM A;  4CN1 A;  1WLX A;  5LMN T;  2YDS A;  3OKQ A;  4FRT A;  1D0Z A;  3QK6 A;  4IST A;  3G7G A;  3DJB A;  3ZCI A;  2L3L A;  5KX5 E;  4UF0 B;  3CX6 B;  2BVM A;  4QKN A;  3ESL A;  5AQH B;  3LK2 B;  3TLW A;  3LJC A;  3KBU A;  2XUE A;  4I43 B;  2X9W A;  5DL8 A;  1D0X A;  3SZD A;  4O4U A;  3VU7 H;  4AYN A;  4Z90 A;  3E08 A;  4JI6 T;  3RBH A;  4NUU A;  4TWH A;  3EI0 A;  3UQ7 A;  4YXD A;  2V7I A;  4ASK A;  2LSI A;  1FJG T;  4AKR B;  2IUB A;  5DQW A;  2BVL A;  2I59 A;  4GK0 E;  2X9K A;  3RPU A;  2F4V T;  3AE9 A;  4HE8 A;  2KLQ A;  1G90 A;  3AE5 A;  2BBJ A;  3ZYM A;  1G8X A;  2VKJ A;  5J0Z A;  2JQY A;  1T16 A;  3JCU O;  3PGR A;  2VAS A;  3RQU A;  3HW9 A;  1WR0 A;  3ONX A;  4PW8 A;  4HFI A;  4AFK A;  4UEL A;  1E7P A;  5HXR A;  4QXB B;  5LG4 A;  2AE9 A;  3AA6 B;  3KV4 A;  4CXW A;  4GIW A;  3PUS A;  5FXW A;  3SS1 A;  4FJO A;  1J5E T;  4BAY B;  3N2G E;  2HN2 A;  5AQR B;  3N9M A;  3BS0 A;  4HFC A;  4JEH B;  2L8K A;  3JAE A;  4KHZ F;  2N2N A;  4TZ4 C;  2DL1 A;  2KXP A;  3NVO A;  3KV6 A;  4FUV A;  3RKG A;  3N9L A;  3VE2 A;  2BDE A;  1VCT A;  4KR4 A;  5AQL B;  5FNV E;  4DV5 T;  1W0B A;  3CML A;  4KHP T;  4H9P C;  3PRN A;  2K24 A;  3UUM A;  3SYB A;  3A0B O;  4G63 A;  2XE5 A;  2CE7 A;  2FJD A;  1OED A;  4I50 E;  4PJL A;  3RF1 A;  4O4I E;  5B5E O;  5LJN A;  2SPC A;  2XTQ A;  3TLV A;  2WDQ A;  5FY7 A;  2KND A;  5LMU T;  2AXT O;  4UVA B;  5L3G B;  2JQK A;  3VY9 X;  3OVU A;  2M6I A;  4HGA A;  4QH1 A;  5ADX L;  4AQF A;  1OED B;  4K3B A;  3ZMZ B;  3BQK A;  2A9U A;  2PBI A;  3VR9 A;  4BJM A;  4U2Z A;  3SOL A;  4AYD C;  1BT9 A;  2BG9 B;  3HWB A;  4HWC A;  2LSG A;  4Z91 A;  3UUX B;  2MHL A;  2B76 A;  2WQY A;  4O2A E;  1T98 A;  3C4W A;  4O3X B;  3E0Z A;  2WB5 A;  3RLF F;  4GCS A;  4P0B A;  2Y48 B;  2PG8 A;  2Q9Q D;  2J1D G;  2OV9 A;  2UUB T;  4HWH A;  5IWA T;  3J9X 1;  1HNZ T;  3VE1 A;  4YLH A;  5AQQ B;  4YFS A;  1GFO A;  2ODV A;  3O1J A;  1W9R A;  2KZ7 B;  2X0Y A;  2R4O A;  4DR2 T;  5PRN A;  4ZZB A;  4WBO A;  5J2U E;  2V5D A;  3H3A A;  3KBT A;  1AJ3 A;  2ZM0 A;  5AQP B;  4FZL A;  3PUG A;  3C5O A;  3POX A;  3VR8 A;  4ILU A;  3IF8 B;  1SA0 E;  4G76 A;  2WS3 A;  3FB2 A;  4UB8 O;  5KDM C;  2PJQ A;  4AIU A;  2M6B A;  4O3W A;  3AE8 A;  2BG9 A;  4DID B;  3A0H O;  3UUB A;  4X65 T;  2CHN A;  4PJJ A;  4UR9 A;  2WM9 A;  5FY0 A;  2KC0 A;  2QVA A;  3QRA A;  2XE3 A;  4U2Y A;  2H88 A;  2WJQ A;  4CTD A;  1KNR A;  1Y64 B;  3Q5W A;  4AQG A;  5IHY A;  4X62 T;  4YHJ A;  2W67 A;  1Q9F A;  2VVS A;  5C3J A;  1HR0 T;  4AKR A;  5T5F A;  3ZN0 B;  1IZN A;  3AED A;  4F6R C;  3EVY A;  4IIJ E;  4CN4 A;  2VL8 A;  3MAC A;  4HKA A;  5IYZ E;  4WNK A;  2KZ7 A;  4GF4 A;  2ZLY A;  4RLB A;  1MMD A;  5CFB A;  3FXE B;  2HN1 A;  4QQ1 A;  5AQT B;  3AEA A;  5HEO A;  4JV5 T;  5HWX A;  1XZY A;  4Z3T A;  3OYX A;  2X68 A;  5JDM A;  2UXD T;  1OPF A;  1MIW A;  2X67 A;  1N34 T;  4UVC B;  1D1B A;  2X66 A;  5L3F B;  1XMO T;  2V8S V;  3AE4 A;  2G0U A;  4ZS3 A;  4N59 A;  2F1V A;  2BS4 A;  4FSP A;  3UUL A;  3PUY F;  3ZJ2 A;  4A97 A;  3PE0 A;  3T1H T;  2D0U A;  1X79 A;  3CK6 A;  5LB7 B;  5E79 O;  2Q9Q C;  2FUP A;  2WDV A;  3RKO A;  1QLB A;  4DR4 T;  3RIU A;  1IBM T;  5AQU B;  1VRB A;  3PUQ A;  4PJN A;  5HXS A;  5HYA A;  2E5L T;  1O3X A;  4X64 T;  3AEB A;  1SHZ C;  4B3S T;  4N74 A;  5GON E;  3TLT A;  4EOZ B;  1MMA A;  2JIW A;  3MK7 C;  2XHE B;  2MTQ A;  3VKH A;  4B3T T;  3SWH A;  2WP9 A;  2WWU A;  3UTK A;  4MHC A;  4AKL A;  2UUA T;  4QHO A;  1NEK A;  2MOZ A;  2N2L A;  2XTR A;  2XTL A;  1WFD A;  3O1I A;  2NR4 A;  2YDQ A;  4OHF A;  1ZHW A;  4JEU B;  2POR A;  2HHH T;  2ODJ A;  2RP4 A;  4DUZ T;  2KIN B;  1E2A A;  1WCR A;  1U5P A;  2MYS A;  3AA1 A;  3AA7 B;  5IUX A;  3VY8 X;  3Q5E A;  4ZI3 D;  2F1C X;  2XQ3 A;  4GOU A;  3AA0 B;  4YSZ A;  1HNX T;  3RIA A;  4IDN A;  2YN6 A;  4PK6 A;  4UV8 B;  2UXC T;  1QJP A;  1W09 A;  3WI3 A;  4LSF A;  1HS7 A;  3ZCJ A;  5L3D B;  4UIG A;  4TNV A;  5DAB A;  1MM4 A;  3O9X A;  3KFW X;  2W80 C;  5GTI O;  2X9H A;  3ZMT B;  2Y0K A;  4ZI2 C;  5LHH B;  3BRY A;  4H63 H;  4H9S E;  4HFD A;  2XZE A;  1QUU A;  4XAX B;  4ZS2 A;  4AYI D;  3AE3 A;  3H37 A;  1FEW A;  4U72 A;  3K3O A;  2KWH A;  2PRN A;  8PRN A;  4GK5 E;  5L3C B;  2R4L A;  3UU3 A;  3CIR A;  5LCY A;  4UVB B;  2H7O A;  3PUW F;  1CUN A;  4ISS A;  1GQE A;  3PJA A;  5G39 A;  2NW7 A;  3G06 A;  4EIW A;  1E1H B;  3LK3 A;  2D5U A;  4E1T A;  2BG9 C;  4RJX A;  3FXD B;  4JI0 T;  2A2F X;  3NJT A;  2DCF A;  1Z0P A;  4O4H E;  4EGW A;  5HEG A;  2QTK A;  3P4R A;  3A2S X;  3ZT7 A;  5LGN B;  4DMV A;  3ZT5 A;  4ANJ A;  5JDG A;  2HH7 A;  3ETU A;  4JI2 T;  2W62 A;  4TWD A;  4NUV A;  4DV7 T;  1N32 T;  4O4X A;  4X1Y E;  3T0S A;  4DBR A;  5LA6 E;  4NXM T;  1M62 A;  2NTY A;  3P4W A;  5LNK A;  2V6Y A;  3P4S A;  4CI3 B;  4PFO A;  5B66 O;  2IWW A;  1YXR A;  1BH3 A;  2VL0 A;  2DWG A;  3GMI A;  2R4P A;  5AQN B;  4X5T A;  5ABH A;  4DV0 T;  2ES0 A;  2BS3 A;  3I0Q A;  3NZP A;  3WI5 A;  1SE7 A;  3RI5 A;  5JDN A;  3POR A;  2I0M A;  4K3C A;  1MPF A;  3D0T A;  2J1N A;  5JDQ A;  2IDO B;  3AEC A;  4IDZ A;  2W0G A;  5JR9 B;  2W00 A;  3RIF A;  1JNR A;  3ZEF B;  5CGM A;  2LSK A;  5JQG E;  3RH3 A;  2JMH A;  3FZK B;  4ZI3 C;  5FVL A;  5G3A A;  4HFE A;  4O2B E;  1HX1 B;  2IW5 B;  1T7S A;  2YU2 A;  3UFE A;  3AA6 A;  3LK4 2;  4EAH A;  1QSD A;  1YQ4 A;  4OYK A;  4DR1 T;  2BKO A;  5DJQ C;  1L0V A;  4C4V B;  5FYM A;  1FMV A;  1YKE B;  4OYJ A;  2LM2 A;  1OSM A;  1SUM B;  3I9W A;  5AQS B;  5AQK B;  3O0E A;  1QJ9 A;  2LHN A;  2YOE A;  2LHF A;  2XM1 A;  3HA4 A;  4FQE A;  1ZEE A;  3J7Y q;  2V7L A;  4H63 V;  4QXH B;  5G26 A;  4GYR A;  4UF0 A;  4ZI2 D;  2F1T A;  2UXX B;  5LHI B;  4HFH A;  4WYV A;  3RRC A;  3SZV A;  4YT0 A;  3U78 A;  3EAB A;  4IT4 A;  1KEY A;  5JR9 C;  3EMN X;  5FXX A;  5JRC B;  2W2U A;  2KXP B;  3N9P A;  5AQM B;  5F5W A;  4IL6 O;  2Y7S A;  1HXX A;  5FMN A;  4B3R T;  1B7T A;  3AEE A;  2K48 A;  4UEM A;  2LEH A;  5EK3 A;  3VRA A;  2V7M A;  3RIU C;  5HEU A;  4CXY A;  1T8B A;  3RYH E;  4OX9 T;  4ERR A;  1IBK T;  3HKD E;  3KIN B;  4XNK A;  2O4V A;  1GFQ A;  3AAE B;  4M1P A;  2BBH A;  1U4Q A;  4U33 A;  1H6S 1;  1HF8 A;  1MIY A;  5L47 A;  5HXC A;  5FKY A;  3LK4 1;  1D0Y A;  2B1E A;  3RC8 A;  1VOM A;  2XSB A;  4DR3 T;  4D5U A;  4EXT A;  4PJM A;  5AQV B;  2ZM8 A;  2Y0H A;  4X20 E;  3PJA J;  2CWO A;  4O49 A;  5JRC A;  2XAF B;  4K0U A;  1ZOY A;  3JCF A;  5E0O A;  2N9D A;  1HG2 A;  4MAL A;  3PDY A;  3P4P A;  2A72 A;  3DA3 A;  3WAK A; 
#chains in the Genus database with same CATH homology
 3C64 A;  3IBP A;  2X68 A;  2BZB A;  3HKE E;  3I0O A;  4OK0 A;  5JDM A;  3AAA B;  1OPF A;  4AI6 A;  4AKM A;  5H6R B;  1MIW A;  2X67 A;  5LBQ B;  2FGQ X;  2DLR A;  1IZN B;  3CQC B;  3Q9D A;  4IE6 A;  4IE4 A;  4N58 A;  4UVC B;  1D1B A;  2X66 A;  5L3F B;  1ZHX A;  4O4J E;  2LM9 A;  2XMX A;  3A5X A;  1BR0 A;  4AKG A;  3Q2M A;  2G0U A;  2IC9 A;  5LBM A;  4ZS3 A;  4N59 A;  3L3P A;  5F3J A;  2F1V A;  4FSP A;  4L0R A;  2QGS A;  4U74 A;  3UUL A;  2YK0 A;  3ZJ2 A;  5AFU K;  2ODU A;  4JLE A;  3E22 E;  2CLY B;  3ZYK A;  4O3Y A;  4QX8 B;  3RYC E;  2JPF A;  2V7K A;  2W81 C;  3PE0 A;  5D5D A;  3QC9 A;  3BQI A;  2D0U A;  3T8O A;  5DL7 A;  1X79 A;  1ZHC A;  3BQL A;  2CLY C;  3C4Z A;  5LJM A;  3FBZ A;  2K5B B;  1BXW A;  2Q9Q C;  3R6N A;  3U3I A;  3SY7 A;  3RKO A;  3SYS A;  3RX6 A;  6PRN A;  4L5G A;  2E8I A;  2ZM2 A;  3PUA A;  4IGU A;  3RC3 A;  2H3R A;  5CA0 E;  3CQX C;  5L2L A;  2FGR A;  3K8P C;  2YEV C;  2GK9 A;  3HR0 A;  2CEA A;  1VRB A;  3PUQ A;  3NSG A;  5HXH A;  4FMS A;  3RYI E;  2CA5 A;  2C0S A;  4FSO A;  3KVA A;  4PJN A;  3QRC A;  1MND A;  2PFV A;  2EHO D;  5HXS A;  2XAH B;  2KT9 A;  4H9Q C;  2DI4 A;  2LSJ A;  1BR2 A;  2Y8D A;  3HI2 A;  4IE5 A;  5HYA A;  1O3X A;  1HTJ F;  2VKH A;  3EUH A;  2Z6E A;  2J4U P;  1SHZ C;  2CWY A;  3POQ A;  1GFP A;  5JDL A;  2RA1 A;  5GON E;  3K3N A;  4EOZ B;  3HKC E;  4GYS A;  2WAU A;  1MMA A;  2MNH A;  5GV0 A;  4F4B A;  3MK7 C;  3OBV E;  2XHE B;  3CX7 B;  2MTQ A;  5HXE A;  3VKH A;  4TUY E;  3SWH A;  4PUX A;  2D0T A;  5LYJ E;  4LSI A;  3O1H A;  2WWU A;  1MIV A;  5HAX A;  4QWN B;  5EZY E;  4O3Z A;  5LOV E;  2V1D B;  3UTK A;  3CVR A;  3HL6 A;  2LOP A;  3MKD A;  4MHC A;  4AKL A;  3VZW X;  5FY1 A;  2EHO C;  4DVD A;  3NBX X;  1LKX A;  5CA1 E;  1ORM A;  1ZHT A;  1D1A A;  1ZHZ A;  4QHO A;  4V1A v;  3GWH A;  2ERV A;  4WBN E;  5JVD E;  4DMW A;  5AFU L;  4C91 A;  2MOZ A;  1LRZ A;  3UPG A;  2N2L A;  2XTR A;  2XTL A;  2YNK A;  2CM0 A;  1BR1 A;  2JQQ A;  4D64 A;  3O1I A;  3UT5 E;  1KNZ A;  3PQS A;  4XZC A;  1IJ6 A;  4C69 X;  1HCI A;  4OHF A;  1ZHW A;  4JEU B;  5JDP A;  4YJ3 E;  3B57 A;  2M07 A;  2GE4 A;  3PUR A;  1WYC A;  2POR A;  3T24 A;  5F8P A;  1LVK A;  4AUI A;  4KRA A;  2ODJ A;  1HFA A;  1YW0 A;  2XAG B;  3HKB E;  2X51 A;  4BJN A;  4O4L E;  4C90 A;  2RP4 A;  4A56 A;  2LHR A;  1HG5 A;  2XQY A;  3AVR A;  2EHO A;  3ZMS B;  3ZC0 A;  3V8U A;  2CXD A;  4PFP A;  2KIN B;  3ZPO A;  5KMG P;  4PK4 A;  1U5P A;  1HXU A;  1THQ A;  4AYM C;  2MYS A;  4H9N C;  3AA1 A;  5L3B B;  3AA7 B;  3GP6 A;  3R84 B;  3VY8 X;  4ZI3 D;  2KDY A;  1H7C A;  4GOU A;  3AA0 B;  5FXV A;  3PQU A;  1P4T A;  4DO0 A;  4G2A A;  1OWA A;  3KV5 A;  4PK6 A;  4UV8 B;  1WYB A;  5L3E B;  4KR8 A;  1QJP A;  5LHG B;  4Z8X A;  4FES A;  5A1L A;  4KBM B;  2X0L B;  4ZHQ E;  3P7I A;  3WI3 A;  3L09 A;  4CZZ B;  4LSF A;  3KVB A;  4IHJ E;  1BR4 A;  2YIN A;  3KDS E;  5JRE A;  1HS7 A;  3F2E A;  3IEE A;  3ZCJ A;  5JDF A;  2JMM A;  3KVD D;  3VZT X;  3ANW B;  3NRX A;  4KMC A;  5L3D B;  3HOE A;  3B13 A;  4UIG A;  4CXX A;  1V9D A;  1WLX A;  2NTX A;  5DAB A;  1MM4 A;  3O9X A;  3DP7 A;  3KFW X;  3CPZ A;  2W80 C;  3LK2 A;  2X9H A;  3OKQ A;  4KP3 C;  4FRT A;  1YS5 A;  2NOX A;  1YD8 G;  3DTO A;  1D0Z A;  2VB6 A;  2NP9 A;  3O4X E;  3OJA A;  3QK6 A;  3ZMT B;  4IST A;  2Y0K A;  3S4U A;  4ZI2 C;  3DJB A;  3G7G A;  3ZCI A;  1HX8 A;  5LHH B;  2L3L A;  5KX5 E;  2Q9Q A;  4UF0 B;  4P09 A;  3AAA A;  4H63 H;  2V7J A;  3CX6 B;  4KUM B;  3PU8 A;  4H9S E;  1QUU A;  3MXZ A;  3N9O A;  3LFM A;  2BVM A;  4QKN A;  4EB6 E;  5ADX K;  4WW0 A;  4I4T E;  4DND A;  2X9X A;  4XAX B;  2ZFG A;  2XAS B;  5BMV E;  1NWM X;  4X1K E;  4ZS2 A;  4CI1 B;  5LP6 E;  3H37 A;  4AYI D;  1FEW A;  3IHR A;  3ESL A;  4U72 A;  2XE1 A;  4OFZ A;  3K3O A;  4J2C A;  3AB3 B;  2KWH A;  3LK2 B;  3LJC A;  3KBU A;  2PRN A;  3WI4 A;  5JDH A;  4TX5 A;  5FP3 A;  2XUE A;  8PRN A;  4I43 B;  2X9W A;  4GK5 E;  5L3C B;  5DL8 A;  1D0X A;  1ZKE A;  3SZD A;  4FZN A;  2UXN B;  3AA1 B;  2JRK A;  3RYF E;  2DHR A;  3VU7 H;  4O4U A;  2WMO A;  4AYN A;  5LCY A;  3E08 A;  4UVB B;  3RBH A;  3F57 A;  4NUU A;  3K3Q C;  1US7 B;  2H7O A;  2K9A A;  4G75 A;  1CUN A;  1IAP A;  4ISS A;  2V7I A;  5M4Y A;  4H9O C;  4ASK A;  3PTR B;  2LSI A;  4BA9 A;  4GHB A;  3JC6 D;  4AKR B;  2NW7 A;  4EIW A;  5DQW A;  1E1H B;  3MA9 A;  2BVL A;  1KK7 A;  4HTE A;  4I55 E;  3LK3 A;  2D5U A;  4UV9 B;  4E1T A;  2I59 A;  4GK0 E;  4RJX A;  3RPU A;  3W15 B;  4FZM A;  3FXD B;  4HE8 A;  4B61 A;  3C50 A;  2KLQ A;  1G90 A;  2A2F X;  3ZYM A;  1G8X A;  5EK4 A;  2VKJ A;  2DCF A;  1Z0P A;  3I1A A;  4O4H E;  3ANW A;  2QTK A;  4AQF C;  1YKH B;  3A2S X;  2P9B A;  2VAS A;  1IJ5 A;  4DMV A;  5LGN B;  3HW9 A;  4ANJ A;  3GA8 A;  3ONX A;  4PW8 A;  5EK2 A;  5JDG A;  2HH7 A;  3ETU A;  4AFK A;  2E9X C;  3N5L A;  4UEL A;  3JC6 C;  4AZL A;  5HXR A;  2W62 A;  4X1I E;  2C5J A;  4NUV A;  4QXB B;  5LG4 A;  4AKI A;  1MM5 A;  3AA6 B;  3KV4 A;  4X1Y E;  4CXW A;  4O4X A;  2N2M A;  3T0S A;  4DBR A;  5LA6 E;  2IC6 A;  4GIW A;  3PUS A;  4FI5 A;  4PNI A;  2CXL A;  4O8S A;  5FXW A;  3SS1 A;  4D65 A;  4FJO A;  4TV9 E;  2NTY A;  1S94 A;  3N2G E;  3V5S A;  4BAY B;  3WAJ A;  7PRN A;  2WBL A;  3N2K E;  3N9M A;  5J1G A;  5LNK A;  3UU2 A;  4JEH B;  2L8K A;  3RRW A;  4PFO A;  4CI3 B;  1E54 A;  3FBL A;  2N2N A;  1D1C A;  1BH3 A;  2DWG A;  3GMI A;  2KMF A;  4TZ4 C;  2WSS V;  4Z3T A;  1ZHY A;  4HEA A;  2X9Y A;  2KXP A;  3UAQ A;  3KV6 A;  2ES0 A;  4FUV A;  3LG7 A;  4TN7 B;  2HPJ A;  3I0Q A;  3NZP A;  3N9L A;  3WI5 A;  4N78 D;  3VE2 A;  3JTY A;  5JDN A;  3POR A;  3AA0 A;  4E7S A;  4CQI A;  1MPF A;  2BDE A;  1S35 A;  4KR4 A;  4UXN B;  3D0T A;  5H6Q B;  2J1N A;  5JDQ A;  4AKH A;  5FNV E;  2ACX A;  3MZK B;  2W0G A;  4IDZ A;  4AXP A;  2CXF A;  1UX4 A;  2KWI B;  3CML A;  5JR9 B;  2W00 A;  3ZMV B;  4H9P C;  2C5I T;  2K24 A;  3UUM A;  2LJL A;  3PRN A;  3SYB A;  3FYX A;  4G63 A;  2VKO A;  2XE5 A;  1MMN A;  3ZEF B;  4P0A A;  1Q9G A;  4XNL A;  2LSK A;  5JQG E;  3RH3 A;  4AYE C;  2CE7 A;  2CCQ A;  3P8C D;  4H9R C;  4DBQ A;  2V26 A;  5CB4 E;  1MNE A;  2JMH A;  4I50 E;  2WMN A;  3ETV A;  4PJL A;  4PK5 A;  3ZLI A;  4ZI3 C;  4O4I E;  4YJ2 E;  5TAO A;  3HOL A;  5LJN A;  2M06 A;  2SPC A;  3C4X A;  4O2B E;  2XTQ A;  5FXZ A;  1QJ8 A;  5FY7 A;  2JJ9 A;  2X27 X;  2KND A;  2IW5 B;  2YU2 A;  3AA6 A;  3UFE A;  3LK4 2;  4EAH A;  3AA7 A;  1QSD A;  4UVA B;  2NW8 A;  5L3G B;  2LE8 A;  4OYK A;  1GFM A;  5DJQ C;  2ZMA A;  1FMV A;  5FYM A;  1YKE B;  3AVS A;  4OYJ A;  1OSM A;  3VY9 X;  4HGA A;  3I9W A;  4RJW A;  2DWK A;  4FRX A;  4E7Z A;  3Q5X A;  5ADX L;  2XAJ B;  3O0E A;  1QJ9 A;  4AQF A;  2E9X B;  3T20 A;  3CQG B;  1HXT A;  3ZMZ B;  3BQK A;  2E9X D;  2PBI A;  3I9Y A;  2LHN A;  4BJM A;  3SOL A;  4AYD C;  1BT9 A;  5JH7 E;  3HWB A;  3N9N A;  2OA5 A;  2VK9 A;  4FT6 A;  1NAF A;  4QX7 B;  2LHF A;  5IYU A;  3HA4 A;  1G73 A;  3ZJ1 A;  3DA4 A;  4JFB A;  2LSG A;  3NZQ A;  4ZI7 E;  1EZ3 A;  3UUX B;  2MHL A;  5DL5 A;  1LVF A;  3VHL A;  4O2A E;  4ZOL E;  1ZEE A;  1T98 A;  3J7Y q;  4LSE A;  2VKD A;  2V7L A;  4H63 V;  2EHO B;  3M65 A;  4QXH B;  3C4W A;  4O3X B;  2LFU A;  4GCQ A;  5G26 A;  3E0Z A;  4GYR A;  4IE7 A;  4P0B A;  4GCS A;  2H7V C;  3F31 A;  2Y48 B;  3MJX A;  2Q9Q B;  4UF0 A;  4ZI2 D;  2F1T A;  2UXX B;  5LHI B;  2YPV A;  2PG8 A;  2Q9Q D;  5LXT E;  5ETW A;  2J1D G;  3RRC A;  4U9C A;  3UUN A;  3LBX B;  3SZV A;  3U78 A;  3TKL B;  3J9X 1;  3V5U A;  4YLH A;  3VE1 A;  4BUM X;  2W61 A;  2K0L A;  2D2S A;  3EDU A;  2CMR A;  4IE0 A;  4YFS A;  1GFO A;  2ODV A;  1FIO A;  4ADZ A;  3O1J A;  3SRZ A;  1UX5 A;  5JR9 C;  2KZ7 B;  3EMN X;  2M67 A;  5FXX A;  5JRC B;  5EE2 A;  2KXP B;  5PRN A;  5HWY A;  1OXZ A;  1GFN A;  4E1S A;  2W63 A;  4WBO A;  5J2U E;  3N9P A;  3H3A A;  3KBT A;  4HFV A;  1AJ3 A;  2NWB A;  2ZM0 A;  5FMN A;  2JMK A;  1HXX A;  2Y7S A;  5FVN A;  1B7T A;  4FZL A;  3PUG A;  3CKD A;  1MMG A;  3KV9 A;  3C5O A;  3POX A;  4ILU A;  3IF8 B;  1SA0 E;  2NW9 A;  2LSY A;  4G76 A;  3FB2 A;  5JR9 A;  3POU A;  3FHN A;  4QXC B;  3N9Q A;  2K48 A;  3PU3 A;  4UEM A;  3C98 B;  5KDM C;  2N1G A;  2MBG A;  2LEH A;  4JUY A;  2PJQ A;  3N2O A;  5EK3 A;  3LK3 B;  4HN9 A;  4O3W A;  2V7M A;  4EZ4 A;  2Y6X A;  3VKG A;  2XG6 A;  4MBQ A;  3EDV A;  4CXY A;  4PJJ A;  2WM9 A;  5FY0 A;  2LOS A;  2L9Q A;  3RYH E;  3GN5 A;  3ZC1 A;  4ERR A;  2XAQ B;  2KC0 A;  2XE3 A;  3QRA A;  3HKD E;  3KIN B;  3NRY A;  4PAG A;  3ZYL A;  5DQV A;  1PHO A;  3GN5 B;  1WR6 A;  4RLC A;  2OMF A;  4TV8 E;  1UCU A;  4XNK A;  4RL9 A;  1Y64 B;  3Q5W A;  2O4V A;  2Y0L A;  1GFQ A;  5LGU B;  3AAE B;  2QA7 A;  4M1P A;  4EYU A;  4GCP A;  1U4Q A;  5LGT B;  4AQG A;  5IHY A;  1H6S 1;  1HF8 A;  3OYZ A;  3SY9 A;  3CWZ B;  1MIY A;  4FOZ A;  3CX8 B;  2IAK A;  2YU1 A;  4YHJ A;  5HXC A;  4EYY R;  1Q9F A;  3LK4 1;  2VWA A;  3TZG A;  1D0Y A;  4B6X A;  2B1E A;  4MFR A;  2E9X A;  3LBX A;  3RC8 A;  1VOM A;  4XBF B;  4AKR A;  2ZLD A;  2LT3 A;  5T5F A;  3ZN0 B;  1IZN A;  4D5U A;  4EXT A;  2C5K T;  4F6R C;  3EVY A;  4PJM A;  4IIJ E;  3BK9 A;  3ZMU B;  2Y0H A;  2ZM8 A;  4X20 E;  1WRD A;  5DL6 A;  2DNX A;  2VL8 A;  3MAC A;  4HKA A;  2HPL A;  2CWO A;  5IYZ E;  4O49 A;  5JRC A;  2XAF B;  4WNK A;  4CI2 B;  3K19 A;  2KZ7 A;  4K0U A;  1FMW A;  4GF4 A;  4JCH A;  2ZLY A;  2XE2 A;  3QUJ A;  4EZH A;  5E0O A;  4RLB A;  1MMD A;  3AAE A;  3VZU X;  2N9D A;  1ZV4 X;  5J2T E;  3FXE B;  2A3D A;  3AAI A;  4QQ1 A;  1HG2 A;  4LSH A;  4L9I A;  4MLK A;  5C8Y E;  4MAL A;  3PDY A;  2Y2X A;  1PRN A;  2A72 A;  5HWX A;  3DA3 A;  2K4T A;  3OYX A;  3WAK A;  3C51 A;  3ZN1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...