3AA6B

Crystal structure of actin capping protein in complex with the cp-binding motif derived from cd2ap
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
242
structure length
242
Chain Sequence
DQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
total genus 80
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aa6B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aa6B02
3AA6A 3LK2A 1IZNA 3LK3B 3AAEA 3AAAB 3AA0A 3AA0B 3AAAA 5ADXK 3AAEB 3LK42 1IZNB 3LK3A 3LK2B 3AA6B 3AA1A 2KZ7A 3AA7B 5ADXL 3LK41 5AFUL 5AFUK 4AKRB 2KXPA 2KXPB 4AKRA 3AA7A 2KZ7B 3AA1B
chains in the Genus database with same CATH superfamily
2YINA 4U2YA 5AQHB 3F2EA 2BG9A 2C0SA 2BKPA 3AE5A 2CBIA 2LT3A 1SHZC 3JC6C 1THQA 2FGRA 3POUA 4O3XB 3I9YA 5IYUA 4WBNE 5ABFA 2NW8A 2ACXA 3UTKA 1HCIA 2YPVA 4IDZA 3A5XA 4OX9T 3G06A 1OXZA 2JQ9A 2UUCT 2LKGA 1WYCA 3VY9X 5D5DA 4HFDA 3KZIO 2P9BA 3PE0A 1H7CA 1I6ZA 1E2AA 5HXRA 4ILUA 5JQGE 4O2AE 2MPKA 2Y48B 3N5LA 3RRCA 2OV9A 1J5ET 2PJQA 3C98B 4COFA 2JQKA 4QKNA 5AQFB 3AEFA 3DWNA 3L8RA 3LK41 1P4TA 1HG5A 4AQYT 2CMRA 2NP9A 4NUVA 1QLBA 3VRBA 4GK0E 3HKEE 1LVFA 4KI0F 3O1JA 4H9PC 2X0LB 4ANJA 1HF8A 1GFMA 3B13A 1KNRA 5FVKA 4QHOA 2CWYA 2A3DA 2Y8DA 4ILCA 3QB5K 2XSBA 1BXWA 4ILBA 3UU8A 1X79A 2R88A 3K8PC 2IW5B 2V6YA 2W80C 2Y0HA 4HN9A 4FUVA 2MBGA 5HXEA 4DV7T 3E0ZA 3CX7B 2PTFA 3NRYA 3OTOT 3AE2A 5FXXA 4GCQA 1T16A 3HA4A 5AQJB 3ZT6A 3AA6B 5BR8T 3PUQA 1SE7A 2MAWA 5E79O 4YSYA 4B3ST 4IL4A 4L0RA 3VZTX 2N1GA 3ZJ1A 4TUYE 2FBWA 5JTGA 3O9XA 2WS3A 5LMNT 2R89A 4EEBA 1Y01A 1BR4A 3GP6A 4O4JE 3RKGA 4P0BA 1G8XA 2LM9A 4CN4A 4ZZCA 2UUBT 4HE8A 1HR0T 5EZYE 3TLTA 4G2AA 2BVLA 4V1Av 4Z90A 3RRWA 3ABVA 2PG8A 2ERVA 2KSRA 2V7LA 4ILAA 4LF5T 1BR2A 3PUAA 2W67A 3T0SA 5LHIB 4NPPA 5JDNA 2KWIB 3P50A 5GV0A 4O2BE 4JI8T 2E5VA 4QH4A 3RIFA 2DWGA 4AIUA 2DWKA 1YS5A 3FZHB 2V5CA 2CHNA 2WMOA 2YDRA 2AXDS 3TKLB 5LB7B 1HG2A 3ONXA 3IA3A 4I0UA 3PUYF 3T1YT 3RIUA 4LMKA 1GFQA 5B5EO 5LCYA 5CA0E 4MBQA 5G3AA 1E54A 3C51A 5T5FA 4ADZA 1Q9FA 3PJAJ 1IJ5A 3ZJ2A 5JR9A 2O4VA 3PGRA 1S35A 5L3CB 2DI4A 2QRXA 3Q5DA 3CQGB 3SYBA 2VKHA 4EYYR 4YLHA 4TWDA 3QK6A 5ABHA 3EVYA 4ZXLA 3DJBA 2Q9QD 5KMGP 3EABA 3CQCB 4DIDB 4KMCA 3VKGA 4Z3TA 3BQLA 2LSJA 2LRKA 4AFKA 4ZS3A 2BS4A 2HPJA 5FY1A 2ODVA 1JNRA 2X67A 3I9WA 3PTRB 1OEDE 4EAHA 4KX6A 3UUBA 4FRXA 2LRLA 4JCHA 1FIOA 4M1PA 3GA8A 4CN6A 4D64A 3AAAB 4DBRA 3GN5A 2YDQA 2IAKA 2XQ3A 3P4WA 4UF0A 4FRTA 1MIYA 3CK6A 4O8SA 3UAQA 5JVDE 4P0AA 3QRCA 2F1CX 7PRNA 4DV3T 2XQAA 1N33T 4QQ1A 5HAXA 1ORMA 4WNKA 1KF6A 4ZEYA 1OEDC 2R6GF 4L9IA 2OLTA 2VB6A 4AYID 3OYXA 2IHR1 1W09A 3AA7B 5DL5A 3RQUA 2XHEB 4TX5A 1XZYA 2QVAA 4IHJE 4H9NC 4JUYA 5F3JA 2MYSA 3ANWA 2M6IA 4ZOLE 3SFDA 3UQ7A 3RYHE 4O3WA 3U3IA 2EHOA 4JI6T 1Z0PA 1M7KA 2WDQA 4HTEA 1BR1A 4JI3T 4HWDA 2J1DG 3IEEA 3OPCA 3GMIA 2XQ4A 2K24A 2WM9A 2Q9QC 1X9BA 4K3BA 5IHYA 4B3MT 5AQSB 2DLRA 2WWVA 2IWWA 4FZLA 3VR8A 2VK9A 2BVMA 1QUUA 4ZZBA 4X1IE 2XM2A 3OVUA 4AQFA 3B57A 2FJAA 3EAMA 1IBKT 2V8SV 3FBZA 1T1LA 4DR7T 5BMVE 2QGSA 2W4XA 4EEDA 2LHNA 5EK2A 1E7PA 2WVPA 3OKQA 2PORA 3SZVA 4HFCA 4GIWA 5LBQB 5JDGA 5LMUT 3AVRA 4GK5E 4LSEA 2D2SA 4IE5A 4E1SA 2ZLYA 3P7IA 2A2FX 2V7JA 4KP3C 2X9HA 2QYWA 5ABGA 1MM5A 3NSGA 4MLKA 4TZ4C 4EYUA 2X9KA 4FI5A 2KXPA 4UV9B 4MHCA 4AQFC 4RLBA 4EXTA 2LEHA 4AKHA 4IE0A 2YN6A 4HFIA 5CA1E 2WU5A 3GN5B 5FP3A 1KNZA 4U7IA 2BG9E 3C4XA 3SWHA 3L09A 5ABEA 3HKCE 5FKYA 3AECA 1HS7A 3JCUO 3SFEA 2Q9QA 1VCSA 1ZHCA 4TNVA 4GCPA 1HXTA 3UPGA 1ZHTA 2WB5A 3JTYA 2E9XD 1KNPA 2H7VC 4F4BA 2BKOA 4ZI2D 1MNDA 3J7Yq 2NW9A 3AAEB 3C5OA 3DA3A 4YXDA 3UUXB 3HKDE 4X66T 4FQEA 3HW9A 2IC6A 5J2UE 1S94A 1YKHB 2K9AA 2ES0A 3OJAA 5JDQA 3NWIA 3LSVA 2XTLA 3AEGA 4N58A 2ZFGA 3AE6A 1U4QA 1WLXA 2NR4A 3C64A 3M65A 2XMXA 4IE7A 4OK0A 3RYIE 3PDYA 1OEDA 5L3GB 4GKKT 5G38A 3A0BO 1G73A 5JR9B 2K48A 2WBLA 2XQYA 3KVBA 1HXXA 3AXJB 4A56A 3FZMB 3FYXA 2XUEA 4TNWA 3UU5A 3PUVF 4E1TA 2DNXA 4LSIA 3LK2A 4O4UA 3WU2O 2LE8A 2UU9T 1UX5A 2M06A 5KXJA 2W66A 1D1CA 3S4UA 3H3MA 4Q25A 4IGUA 2NWBA 4IREA 5IWAT 1QSDA 4PJMA 3QC9A 4PK4A 1D1BA 5DL8A 3PUZF 3C50A 2WP9A 5CB4E 5HXSA 3VU7H 2FJEA 3CWZB 4LF7T 4OYKA 4IDQA 1FMWA 1HNWT 3WAKA 4CXWA 1DU2A 2KNDA 2D5UA 3UQ4A 5H6RB 3FZKB 3T20A 2VWAA 2E9XC 2AXTO 5ETWA 2PRNA 5KAFO 4JI0T 2XAGB 2GE4A 4AXPA 4I4TE 5LGTB 2XQ6A 1FEWA 5G39A 2UXNB 2LOSA 4HKAA 2LJLA 5AQTB 4FOZA 1L0VA 1LVKA 4O3ZA 1XNQT 2W2UA 3SYSA 5ADXL 1D0YA 2L8KA 5HEUA 1PHOA 1MM4A 1Y64B 4DMWA 5AQNB 3UFGA 2LHRA 2KDYA 3FXEB 2XASB 5FXZA 4UB8O 5FMNA 3P8CD 4U31A 3RF1A 4LFAT 1IZNB 2HPLA 2CPTA 4HWCA 2UXCT 2UXDT 3AE7A 3UUNA 2XAJB 2J4UP 1J5WA 2VASA 4U74A 2MOZA 3T24A 2X66A 5LJNA 3ZLIA 2N2MA 2RA1A 1UK5A 3KVAA 5DQVA 4HEAA 4YHJA 2WJRA 2WY2A 4QX8B 4OYJA 3UT5E 2ODUA 3BS0A 2MNHA 4DV0T 3BQKA 3P4SA 3PURA 4HWIB 5JDPA 4K0UA 3ZC0A 3AEBA 4NXNT 2B1EA 4RL9A 4HFEA 5KDMC 3N9LA 1MMGA 4K0KT 3LDQB 4FSOA 2I6HA 4YHHT 2DL1A 2ZM8A 4LF4T 3VZWX 2Y7SA 4X5TA 2XTRA 4YJ3E 4F8HA 3RH3A 4BJNA 2XQ8A 5HXHA 2I59A 5F8PA 2VQFT 2XZEA 1ZEEA 4P09A 4AKIA 3A7MA 5AFUL 4LMJA 1GFOA 2XTQA 3A0HO 1VOMA 2BDEA 1BR0A 3H37A 2AE9A 2JQHA 4QH1A 4DR6T 2CXFA 5LYJE 2H3RA 4EIWA 4UVAB 2CWOA 4UELA 4N78D 3ZPOA 4WW0A 4AZLA 1PRNA 2E9XB 1JNZA 1ZHXA 5L3DB 4HFBA 4GHBA 5AQOB 3NBXX 1ZHYA 4YTMA 2XQ5A 2JMHA 4XZCA 3J9X1 3MZKB 1XDOA 1ZV4X 3N2KE 4UEMA 4KR8A 3VZUX 3ZMZB 2NTYA 4TV8E 3V5SA 3LK3B 5HEJA 5FY0A 3AA0A 5ADXK 2VVSA 2JPFA 2YEVC 3RYFE 5C2TA 4TV9E 5LP6E 4N75A 3E22E 1MIWA 4GYRA 5E0OA 2F1VA 5AFUK 5GTHO 5TISO 3TLSA 2NTXA 5HCJA 4HFHA 5EK3A 4ZI3D 4DR2T 1IBMT 2BZBA 2M67A 1QJPA 1OPFA 2X0YA 4CXYA 4CQIA 4IE4A 2C5JA 2JQYA 1Q9GA 3ETUA 5LGNB 3PQUA 2MTQA 5HXCA 4DR3T 4BAYB 5CJ5A 3CMLA 4UIGA 3NRXA 6PRNA 4EB6E 3ZYMA 4JYAT 3ETVA 4K3CA 3MACA 4GCSA 1GQEA 2BBJA 1HX8A 2R8AA 2J62A 2ZM2A 2YOEA 4PK6A 4X65T 3ZMVB 2JJ9A 1IJ6A 4U33A 4UR9A 3RC3A 2KINB 4OHFA 3RX6A 2YNKA 3KDSE 4FT6A 1N34T 3NZPA 2X9YA 3JAEA 4C69X 4JI1T 5L3BB 4PJNA 4DV2T 4IDPA 2XAHB 4G63A 2UUAT 4JI4T 2E8IA 1WCRA 2XE1A 2LFUA 5AQQB 4GF4A 3PGSA 3VRAA 4KR4A 1T8BA 1IZNA 1YQ3A 3OBVE 3WI3A 2CBJA 3K3NA 5H2FO 2VURA 5HEGA 3A2SX 2YU1A 3POXA 3UUMA 5FXVA 3ZT5A 2F4VT 2L9QA 1QJ9A 2N9DA 4J2CA 1FJGT 4GKJT 3KV5A 4PK5A 1WR6A 2JQQA 2C5KT 3JCFA 1LKXA 3K3OA 5A1LA 1YW0A 3AE4A 3ONJA 1OSMA 3CQXC 3RC8A 1HXUA 2K5BB 4I43B 5KX5E 5LG3A 2XG6A 2J47A 3HWBA 3N9QA 4U7YA 1ZKEA 5LHGB 2XPKA 5L47A 1HFAA 2C5IT 4H9SE 1YD8G 3DP7A 5KAIO 4KUMB 3PUXF 4DR1T 2R4LA 4MALA 4YTPA 5FNVE 5AQUB 3PV0F 1YQ4A 3VR9A 3TLUA 1GFNA 3AAIA 1WYBA 2V5DA 3HOLA 3V8UA 4KRAA 5JDLA 2WWUA 2LSGA 4DBQA 5AQMB 2ZM6T 3QB5A 4C90A 5AQKB 2YKSA 2WQYA 3PGUA 5FL1A 3HI2A 3RI5A 2CLYB 4H9RC 2XE3A 3LK42 2IC9A 3LK2B 4JI7T 4AISA 4EGWA 5CGMA 2QTKA 3B5MA 4NXMT 2XM1A 2J1NA 3AXJA 2K4TA 4DO0A 2A9UA 3RGLA 1KFYA 4N59A 4GOUA 1OEDB 4X20E 4BA9A 4ZS2A 2XAFB 4WBOA 1YKEB 3Q5EA 4CI1B 3DA4A 4LSFA 2XSAA 2W0GA 1W0AA 5FL0A 4ZI2C 3ZSTA 4H63V 4WYVA 4H9QC 3DTOA 3ZC1A 2J4GA 5HYAA 3JAFA 1W0BA 3N9NA 4PUXA 2X51A 3AAEA 3AEDA 3KV9A 4KBMB 1EZ3A 3ZCJA 2HHHT 4OFZA 3MJXA 2D9DA 3HOEA 2M07A 1N36T 2Q9QB 3F57A 4PFOA 3RIAA 3SY7A 1XMQT 1ZOYA 2PBIA 2V7MA 4QXHB 3TLVA 5GTIO 2XJ7A 3AB3B 5HEHA 4PJLA 4O4LE 2VKDA 4X1YE 2LSKA 1IAPA 3I1AA 5DABA 3I0QA 3FZFB 5JDHA 3KVDD 4AKRB 3HR0A 3F31A 2CA5A 2KXPB 2B76A 3BRZA 1SA0E 3PF1A 4X62T 2WDRA 5AQIB 2WMNA 4YSXA 1MNEA 2KZ7B 3CKDA 3OYZA 4JV5T 1WR0A 4QH5A 2R4PA 4TWHA 3SY9A 2FJDA 2W00A 3L3PA 5C8YE 5M4YA 5EK4A 3UU4A 5LHHB 2QA7A 4JEUB 4AKLA 5FVNA 4FMSA 4U9CA 3EDVA 3C4ZA 3AA1A 3ZMUB 1B7TA 5AQRB 3ZN0B 3GWHA 3QRAA 2YU2A 4ZHQE 4PR7A 2CXLA 2SPCA 4PW8A 3QNUA 3N9PA 2MHLA 2H7OA 1ZP0A 1NWMX 3HL6A 5DL6A 3KBTA 4ASKA 3M3ZB 2LHFA 3PRNA 5LXTE 3ZYKA 1IBLT 4KHZF 1UUSA 3ZCIA 1O3XA 2V1DB 1SUMB 2VL0A 2E5LT 5TAOA 3JC6D 3PQSA 3WI5A 3ZMTB 2BS3A 3ZT7A 3UU3A 4AYMC 2EHOB 4E7ZA 3LFMA 2KT9A 4O4XA 3CIRA 3ANWB 4XNKA 3G7GA 2CCQA 4CXXA 2LLYA 3FBLA 2F1TA 1W9RA 4LF9T 4PJ0O 2WZHA 3PJAA 3AA7A 5AQVB 2I0MA 1KEYA 3AE3A 4JI5T 3DZMA 3ZMSB 5C3JA 4XNLA 4TN7B 2ZM0A 4B61A 1HNXT 4AKGA 5J0ZA 2VKJA 3RYCE 4D65A 1UURA 3UU6A 4B6XA 1XNRT 4G76A 2D0TA 3WI4A 4C91A 4CI3B 1FMVA 1J1JA 2DHRA 4CI2B 4UF0B 3SOLA 3C4WA 2IUBA 1D0XA 1WRDA 2GK9A 4X1KE 3EDUA 3DWOX 4Z8XA 3AAAA 2XY8B 4U72A 2N2NA 1D0ZA 3KV4A 4ZI7E 2Y2XA 2A72A 4DV1T 3BQIA 1XDPA 2XQ7A 2L3LA 3POQA 1KK7A 5FVLA 4DV6T 2BBHA 5AQPB 3O4XE 5LBMA 4HWFA 5LG4A 4H9OC 3ONLC 2CXDA 3Q5XA 2NOXA 4JI2T 2JRKA 1MPFA 2YK0A 1HTJF 4UV8B 3KV6A 3KINB 3LJCA 4PNIA 3UU2A 2NW7A 1S5LO 2UXBT 4DVDA 3K19A 4IT4A 3CPZA 2OMFA 4NIQA 4ISSA 2Y0KA 5LNKA 5L3FB 3O0EA 4JBWF 3MK7C 3TLWA 3EHZA 2R4OA 4DV4T 4RJXA 1HX1B 3Q9DA 1UX4A 3ZN1B 3EI0A 3ZSSA 1AJ3A 5L3EB 2DCFA 3L39A 5GONE 4IE6A 1VCTA 5PRNA 1US7B 4A98A 1NAFA 1M62A 3VKHA 2CHOA 2CRBA 4CTDA 2IIUA 2VKOA 3RQWA 3MKDA 3VY8X 8PRNA 3WAJA 3AA1B 4KHPT 2CEAA 3V5UA 3RBHA 2V6XA 4E7SA 2X68A 1WFDA 2X9WA 5DJQC 2EHOC 3ZYLA 2WU2A 4O3YA 5DL7A 2XAQB 3IBPA 2YDSA 3SS1A 3VHLA 5CFBA 3VE1A 2KC0A 1E1HB 4AI6A 2LSYA 5H6QB 4HGAA 1VRBA 2VQET 3W15B 5AQGB 1Z8UA 2BG9C 4YTNA 2RP4A 2W63A 2WAUA 4O4HE 1XMOT 4FJOA 2R4NA 3P4RA 2WJQA 3Q2MA 2KZ7A 3CX8B 2X9XA 4A5XA 4RJWA 1BT9A 1H6S1 4AKRA 4DV5T 2IDOB 4FZMA 4XAXB 2V7KA 3TZGA 3IHRA 1XWMA 3AA6A 5LGUB 2FJBA 4I55E 2Y0LA 5L4EA 3R84B 4AYNA 5B66O 3UFEA 3KBUA 4YJ2E 4QWNB 4B3RT 2BS2A 3PUSA 2UXXB 4PJJA 4JFBA 2V6YB 4ISTA 2XE5A 5FY7A 4HFVA 3ZEFB 4DNDA 4WZXA 4DUYT 2FGQX 3AE9A 3LG7A 2N2LA 5HEOA 4DR4T 3NVOA 2LOPA 4IL9A 2KLQA 2Z6EA 1BH3A 3AE8A 4AUIA 4EZ4A 4IL6O 5IUXA 1UCUA 3P4QA 1N32T 2XE2A 2H88A 1I94T 5JREA 3PU3A 2M6BA 2VL8A 2EHOD 3CX6B 3E08A 2JMMA 1V9DA 1OWAA 1QJ8A 4N74A 3N9OA 3QUJA 3RIUC 4C00A 4XBFB 4FESA 4LMLA 3R6NA 1CUNA 1U5PA 5LJMA 2LSIA 5FYMA 4PFPA 2WCAA 4U2ZA 4Z91A 4CN1A 4EOZB 1T72A 4CZZB 2CE7A 4MFRA 3I0OA 1ZHZA 1LRZA 2HN1A 5AQLB 5ABFB 5LOVE 4IDOA 3BK9A 4B3TT 1HNZT 5FXWA 2JIWA 3O1IA 2FUPA 3EUHA 2BKNA 2LKHA 1NENA 2W62A 4LFCT 5JH7E 2VVNA 4BUMX 2BG9B 3FZLB 4G75A 3RLFF 2PFVA 4AKMA 5G26A 4PAGA 2ACZA 1T98A 2HN2A 3PU8A 5JDFA 3X1DA 4IIJE 2D0UA 3PUWF 4UVBB 3UULA 4I50E 5JR9C 3KFWX 2XQ9A 1D1AA 3U78A 4YFSA 4NUUA 2KWHA 4O49A 3N2GE 2ODJA 4YSZA 4RLCA 1UGOA 1T7SA 3IF8B 5DQWA 4AQGA 3NZQA 3H3AA 2X27X 2ZMAA 1G90A 4BJMA 4F6RC 4TWFA 3O1HA 5J1GA 3AEEA 3RKOA 3LBXA 3NJTA 4C4VB 2RPAA 3BRYA 4UVCB 5HCMA 4U3CA 1MIVA 3SZDA 5HWYA 4LSHA 4AYDC 5IYZE 3PORA 4HWHA 3FB2A 4GYSA 5JRCB 1ZHWA 4FSPA 2KMFA 3MA9A 4UB6O 2CM0A 4P1NA 4DMVA 3FHNA 2G0UA 3ESLA 3EMNX 3HKBE 4QXBB 5LA6E 2HH7A 2V26A 5JDMA 3T1HT 3Q5WA 5EE2A 5L4HA 4QXCB 4QX7B 5F5WA 5J2TE 2WSSV 4LFBT 3ZKRA 4YT0A 1MMNA 3AVSA 3QOFA 3K1SA 2K0LA 2WZIA 4O4IE 3RPUA 2JMKA 3CVRA 2LM2A 3AE1A 3P4PA 2IWVA 4YY3T 4FZNA 3RHWA 3JADA 5JRCA 2WDVA 3K3QC 3N2OA 2W81C 1CHUA 4IDNA 1R8IA 5L2LA 4DUZT 2Y6XA 4UXNB 4LF8T 1GFPA 4EZHA 1NEKA 4EV6A 4DR5T 2E2AA 1YXRA 1MMAA 4D5UA 3D0TA 4C4VA 3LBXB 4ZI3C 4L5GA 2ZLDA 4JLEA 4ERRA 3NKZA 3N9MA 3MXZA 3T8OA 4LF6T 4H63H 3VE2A 2K3WA 2CLYC 2X0HA 4A97A 2H89A 2W61A 2OA5A 3FXDB 2V7IA 3AA0B 3LK3A 3A8YC 2IMLA 4AYEC 3AEAA 3PUGA 5HWXA 4JEHB 4X64T 2E9XA 1MMDA 3SRZA
chains in the Genus database with same CATH topology
4DVDA 4C69X 3K19A 2YINA 1OSMA 3F2EA 3CPZA 2OMFA 1MM5A 2C0SA 4ISSA 3NSGA 2Y0KA 5LNKA 4MLKA 4TZ4C 5L3FB 4EYUA 3O0EA 2LT3A 1SHZC 5L3BB 3JC6C 4PJNA 3MK7C 1THQA 2FGRA 2XAHB 3POUA 4O3XB 4RJXA 3I9YA 4FI5A 5IYUA 2KXPA 3Q9DA 4G63A 4UV9B 4MHCA 4AQFC 4WBNE 1UX4A 4EXTA 4RLBA 3PQSA 2LEHA 2E8IA 4AKHA 3ZN1B 2NW8A 4IE0A 2XE1A 2LFUA 2ACXA 4GF4A 5CA1E 3UTKA 3GN5B 4KR4A 5FP3A 1HCIA 1IZNA 1AJ3A 2YPVA 1KNZA 5L3EB 2DCFA 3OBVE 4IDZA 3WI3A 3A5XA 3C4XA 3K3NA 3SWHA 3L09A 5GONE 1OXZA 3HKCE 4IE6A 3A2SX 2YU1A 3POXA 5PRNA 1HS7A 1US7B 1WYCA 1NAFA 2Q9QA 1ZHCA 5FXVA 3UUMA 4GCPA 5D5DA 3VKHA 3VY9X 1HXTA 3UPGA 1ZHTA 2L9QA 2P9BA 2VKOA 3JTYA 2E9XD 3PE0A 1H7CA 2H7VC 5HXRA 4F4BA 3MKDA 4ZI2D 2N9DA 1QJ9A 4ILUA 4J2CA 3VY8X 1MNDA 8PRNA 3WAJA 3AA1B 3J7Yq 2CEAA 3V5UA 4O2AE 5JQGE 2Y48B 3RBHA 4E7SA 3N5LA 2X68A 2NW9A 3RRCA 3AAEB 3C5OA 2X9WA 2PJQA 3C98B 5DJQC 3DA3A 2EHOC 3KV5A 3UUXB 4PK5A 4QKNA 1WR6A 3HKDE 3ZYLA 2JQQA 2C5KT 3HW9A 4O3YA 5DL7A 2XAQB 1LKXA 3IBPA 3K3OA 3LK41 2IC6A 5A1LA 3SS1A 1P4TA 3VHLA 1YW0A 1HG5A 5J2UE 1S94A 2KC0A 3VE1A 1E1HB 3CQXC 2CMRA 1YKHB 3RC8A 4AI6A 2K5BB 2LSYA 5H6QB 2NP9A 4HGAA 4NUVA 1HXUA 1VRBA 2K9AA 3W15B 4GK0E 2ES0A 3OJAA 4I43B 5KX5E 3HKEE 5JDQA 2XG6A 2RP4A 1LVFA 2W63A 3O1JA 2WAUA 2XTLA 3N9QA 3HWBA 4H9PC 2ZFGA 4N58A 1U4QA 1WLXA 2X0LB 4O4HE 4ANJA 1ZKEA 1HF8A 3C64A 4FJOA 5LHGB 3M65A 1GFMA 2XMXA 3B13A 3Q2MA 4IE7A 4OK0A 2KZ7A 1HFAA 2C5IT 4QHOA 3PDYA 4H9SE 1YD8G 2CWYA 3DP7A 3RYIE 5L3GB 3CX8B 1G73A 4KUMB 2X9XA 5JR9B 2K48A 2A3DA 2WBLA 2Y8DA 2XQYA 4RJWA 4MALA 3KVBA 1HXXA 1BT9A 5FNVE 1BXWA 1H6S1 4A56A 4AKRA 1X79A 4FZMA 4XAXB 3FYXA 2V7KA 2XUEA 3K8PC 1GFNA 3TZGA 3AAIA 2IW5B 3IHRA 1WYBA 4E1TA 3HOLA 2DNXA 4LSIA 3AA6A 3LK2A 5LGUB 2W80C 3V8UA 4I55E 5JDLA 2Y0HA 4KRAA 2Y0LA 4HN9A 3R84B 4FUVA 4O4UA 2WWUA 4AYNA 2LE8A 2LSGA 2MBGA 5HXEA 3E0ZA 4DBQA 1UX5A 2M06A 3UFEA 4C90A 3CX7B 3KBUA 3NRYA 1D1CA 3S4UA 4YJ2E 4QWNB 3HI2A 5FXXA 4IGUA 2NWBA 4GCQA 1QSDA 4PJMA 3QC9A 2CLYB 3PUSA 4PK4A 2UXXB 3HA4A 4H9RC 4PJJA 2XE3A 1D1BA 5DL8A 3LK42 4JFBA 4ISTA 2IC9A 3LK2B 3AA6B 2XE5A 5FY7A 3PUQA 4HFVA 3C50A 2QTKA 5CB4E 3ZEFB 5HXSA 3VU7H 3CWZB 4DNDA 2J1NA 2FGQX 3LG7A 2N2LA 2K4TA 2LOPA 4OYKA 4DO0A 1FMWA 2KLQA 4L0RA 4N59A 3VZTX 2Z6EA 4GOUA 3WAKA 1BH3A 4CXWA 2N1GA 3ZJ1A 4AUIA 4TUYE 4X20E 4BA9A 2KNDA 4ZS2A 2D5UA 4EZ4A 2XAFB 4WBOA 1YKEB 3O9XA 4CI1B 5H6RB 3DA4A 3T20A 1BR4A 2VWAA 3GP6A 4LSFA 4O4JE 2E9XC 5ETWA 4P0BA 2W0GA 1UCUA 1G8XA 4ZI2C 2PRNA 2LM9A 4H63V 2XE2A 2XAGB 4HE8A 5EZYE 5JREA 3PU3A 2GE4A 4AXPA 4H9QC 3DTOA 3ZC1A 4G2AA 2BVLA 5HYAA 2VL8A 4I4TE 4V1Av 3RRWA 2EHOD 3CX6B 5LGTB 3E08A 1FEWA 3N9NA 2JMMA 2PG8A 2UXNB 4PUXA 2LOSA 4HKAA 2ERVA 2LJLA 1V9DA 1OWAA 4FOZA 2V7LA 1QJ8A 2X51A 1LVKA 3N9OA 3AAEA 1BR2A 3PUAA 3QUJA 3T0SA 5LHIB 4O3ZA 5JDNA 2KWIB 4XBFB 4FESA 3SYSA 3R6NA 5GV0A 1CUNA 3KV9A 4KBMB 4O2BE 1U5PA 5ADXL 1EZ3A 3ZCJA 5LJMA 2LSIA 1D0YA 2L8KA 4OFZA 5FYMA 4PFPA 3MJXA 3HOEA 2M07A 1PHOA 2DWGA 1MM4A 1Y64B 2DWKA 1YS5A 4EOZB 2Q9QB 3F57A 4PFOA 4CZZB 4DMWA 2CE7A 2LHRA 2WMOA 2KDYA 4MFRA 3TKLB 3SY7A 3FXEB 2XASB 5FXZA 1HG2A 5FMNA 2PBIA 2V7MA 3P8CD 3ONXA 3I0OA 1IZNB 1LRZA 2HPLA 4QXHB 1ZHZA 3AB3B 4PJLA 4O4LE 1GFQA 2VKDA 4X1YE 2LSKA 1IAPA 3I1AA 5DABA 5LCYA 3I0QA 5LOVE 5CA0E 4MBQA 5JDHA 3KVDD 3UUNA 3BK9A 4AKRB 3HR0A 3F31A 1E54A 2CA5A 3C51A 5T5FA 4ADZA 1Q9FA 5FXWA 1IJ5A 2KXPB 3ZJ2A 2XAJB 1SA0E 3O1IA 2J4UP 5JR9A 2O4VA 1S35A 2VASA 2WMNA 3EUHA 4U74A 2DI4A 1MNEA 2KZ7B 5L3CB 2W62A 3CKDA 3CQGB 3OYZA 4BUMX 2MOZA 5JH7E 3T24A 2X66A 4G75A 5LJNA 3ZLIA 3SYBA 2N2MA 2RA1A 2VKHA 3SY9A 3KVAA 2PFVA 2W00A 4YLHA 4EYYR 4AKMA 5DQVA 5G26A 4PAGA 3L3PA 3QK6A 4HEAA 1T98A 4YHJA 3EVYA 5C8YE 3PU8A 5JDFA 5M4YA 3DJBA 4IIJE 2D0UA 5EK4A 2Q9QD 4QX8B 4OYJA 3UT5E 5LHHB 2ODUA 4UVBB 2QA7A 2MNHA 3UULA 5KMGP 4JEUB 4I50E 5JR9C 3KFWX 3CQCB 3BQKA 3PURA 4KMCA 1D1AA 3U78A 4AKLA 4YFSA 3VKGA 3BQLA 4NUUA 2LSJA 4AFKA 5FVNA 2KWHA 4K0UA 4O49A 4Z3TA 4FMSA 4ZS3A 3N2GE 3ZC0A 2ODJA 4U9CA 3EDVA 4RLCA 2B1EA 3C4ZA 2HPJA 5FY1A 4RL9A 2ODVA 3AA1A 5KDMC 3IF8B 3ZMUB 5DQWA 3N9LA 4AQGA 2X67A 1MMGA 1B7TA 3I9WA 3NZQA 3H3AA 3PTRB 3GWHA 3ZN0B 4FSOA 4EAHA 2YU2A 3QRAA 4ZHQE 2X27X 2ZMAA 1G90A 4BJMA 2ZM8A 4F6RC 3VZWX 2CXLA 2Y7SA 2XTRA 3O1HA 5J1GA 4FRXA 3RKOA 2SPCA 4PW8A 4YJ3E 3LBXA 3RH3A 4JCHA 4BJNA 1FIOA 3N9PA 5HXHA 2I59A 5F8PA 2MHLA 4M1PA 2H7OA 1NWMX 3HL6A 3GA8A 5DL6A 4D64A 3AAAB 4DBRA 1ZEEA 3KBTA 3GN5A 4P09A 2IAKA 4ASKA 4UVCB 4UF0A 4AKIA 2LHFA 3PRNA 5LXTE 4FRTA 1MIYA 4O8SA 3ZYKA 1MIVA 3UAQA 3SZDA 5HWYA 5JVDE 5AFUL 4P0AA 1GFOA 3QRCA 5IYZE 3PORA 4LSHA 4AYDC 2XTQA 3ZCIA 4FSPA 3FB2A 4GYSA 5JRCB 1ZHWA 2KMFA 1VOMA 3MA9A 1O3XA 2V1DB 2BDEA 7PRNA 2CM0A 1BR0A 3H37A 4DMVA 5TAOA 3FHNA 2CXFA 5LYJE 4QQ1A 2H3RA 3JC6D 5HAXA 1ORMA 2G0UA 3ESLA 4UVAB 2CWOA 4WNKA 4EIWA 3EMNX 3WI5A 3ZMTB 4UELA 3HKBE 4QXBB 2EHOB 4N78D 2HH7A 5LA6E 4AYMC 4L9IA 3LFMA 2KT9A 2V26A 4E7ZA 5JDMA 4O4XA 2VB6A 3ZPOA 3Q5WA 4WW0A 4AYID 3OYXA 4AZLA 1PRNA 5EE2A 2E9XB 3AA7B 4QXCB 3ANWB 5DL5A 4QX7B 1ZHXA 2XHEB 4XNKA 3G7GA 5L3DB 2CCQA 4GHBA 4TX5A 4CXXA 5J2TE 3FBLA 2F1TA 3NBXX 1ZHYA 2WSSV 4IHJE 4H9NC 4JUYA 2JMHA 4XZCA 3J9X1 3MZKB 5F3JA 3N2KE 1ZV4X 2MYSA 1MMNA 4UEMA 3AVSA 3ANWA 4KR8A 3AA7A 4ZOLE 3VZUX 3ZMZB 2K0LA 2NTYA 4O4IE 4TV8E 3V5SA 3RYHE 4O3WA 3RPUA 3ZMSB 3LK3B 2JMKA 5FY0A 3AA0A 5ADXK 3U3IA 3CVRA 2JPFA 2EHOA 2YEVC 3RYFE 4TV9E 5LP6E 3E22E 4XNLA 4TN7B 1MIWA 1Z0PA 2ZM0A 4GYRA 5E0OA 2F1VA 4B61A 4HTEA 4AKGA 4FZNA 5AFUK 2VKJA 1BR1A 3RYCE 4D65A 4B6XA 5JRCA 2J1DG 3K3QC 3N2OA 4G76A 3IEEA 2W81C 2D0TA 3GMIA 4C91A 4CI3B 3WI4A 1FMVA 2NTXA 5L2LA 2DHRA 2Y6XA 4UXNB 5EK3A 4CI2B 4UF0B 3SOLA 2K24A 3C4WA 2WM9A 1D0XA 2Q9QC 4ZI3D 1GFPA 1WRDA 2BZBA 2GK9A 4X1KE 3EDUA 2M67A 4EZHA 1QJPA 5IHYA 5JDPA 1OPFA 4Z8XA 3AAAA 4CXYA 2DLRA 4CQIA 4U72A 4IE4A 2C5JA 4FZLA 1MMAA 2N2NA 4D5UA 3D0TA 1D0ZA 1Q9GA 3LBXB 4ZI3C 3ETUA 5LGNB 3PQUA 2MTQA 2VK9A 4L5GA 2BVMA 5HXCA 2ZLDA 3KV4A 4JLEA 4ZI7E 4BAYB 4ERRA 2Y2XA 1QUUA 2A72A 3CMLA 3MXZA 3N9MA 4UIGA 4X1IE 3T8OA 3NRXA 4AQFA 3B57A 3BQIA 3ZYMA 4EB6E 6PRNA 4H63H 3VE2A 3ETVA 2CLYC 3MACA 3FBZA 4GCSA 2L3LA 3POQA 1KK7A 2W61A 2OA5A 3FXDB 5BMVE 2QGSA 2V7IA 3AA0B 1HX8A 3O4XE 3LK3A 2LHNA 5EK2A 5LBMA 2ZM2A 3OKQA 4PK6A 5LG4A 4H9OC 2PORA 3SZVA 4GIWA 5LBQB 5JDGA 4AYEC 3ZMVB 2CXDA 3AVRA 3Q5XA 4GK5E 4LSEA 2D2SA 2JJ9A 3PUGA 4IE5A 4E1SA 1IJ6A 2ZLYA 3RC3A 3P7IA 2KINB 2A2FX 2NOXA 2V7JA 4OHFA 5HWXA 2JRKA 1MPFA 2YK0A 4JEHB 4KP3C 3RX6A 3KDSE 2YNKA 4FT6A 1HTJF 2X9HA 4UV8B 3KV6A 3NZPA 2E9XA 1MMDA 3KINB 3LJCA 4PNIA 2X9YA 3SRZA 3UU2A 2NW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AA6 A;  3LK2 A;  1IZN A;  3LK3 B;  3AAE A;  3AAA B;  3AA0 A;  3AA0 B;  3AAA A;  5ADX K;  3AAE B;  3LK4 2;  1IZN B;  3LK3 A;  3LK2 B;  3AA6 B;  3AA1 A;  2KZ7 A;  3AA7 B;  5ADX L;  3LK4 1;  5AFU L;  5AFU K;  4AKR B;  2KXP A;  2KXP B;  4AKR A;  3AA7 A;  2KZ7 B;  3AA1 B; 
#chains in the Genus database with same CATH topology
 2YIN A;  4U2Y A;  5AQH B;  3F2E A;  2BG9 A;  2C0S A;  2BKP A;  3AE5 A;  2CBI A;  2LT3 A;  1SHZ C;  3JC6 C;  1THQ A;  2FGR A;  3POU A;  4O3X B;  3I9Y A;  5IYU A;  4WBN E;  5ABF A;  2NW8 A;  2ACX A;  3UTK A;  1HCI A;  2YPV A;  4IDZ A;  3A5X A;  4OX9 T;  3G06 A;  1OXZ A;  2JQ9 A;  2UUC T;  2LKG A;  1WYC A;  3VY9 X;  5D5D A;  4HFD A;  3KZI O;  2P9B A;  3PE0 A;  1H7C A;  1I6Z A;  1E2A A;  5HXR A;  4ILU A;  5JQG E;  4O2A E;  2MPK A;  2Y48 B;  3N5L A;  3RRC A;  2OV9 A;  1J5E T;  2PJQ A;  3C98 B;  4COF A;  2JQK A;  4QKN A;  5AQF B;  3AEF A;  3DWN A;  3L8R A;  3LK4 1;  1P4T A;  1HG5 A;  4AQY T;  2CMR A;  2NP9 A;  4NUV A;  1QLB A;  3VRB A;  4GK0 E;  3HKE E;  1LVF A;  4KI0 F;  3O1J A;  4H9P C;  2X0L B;  4ANJ A;  1HF8 A;  1GFM A;  3B13 A;  1KNR A;  5FVK A;  4QHO A;  2CWY A;  2A3D A;  2Y8D A;  4ILC A;  3QB5 K;  2XSB A;  1BXW A;  4ILB A;  3UU8 A;  1X79 A;  2R88 A;  3K8P C;  2IW5 B;  2V6Y A;  2W80 C;  2Y0H A;  4HN9 A;  4FUV A;  2MBG A;  5HXE A;  4DV7 T;  3E0Z A;  3CX7 B;  2PTF A;  3NRY A;  3OTO T;  3AE2 A;  5FXX A;  4GCQ A;  1T16 A;  3HA4 A;  5AQJ B;  3ZT6 A;  3AA6 B;  5BR8 T;  3PUQ A;  1SE7 A;  2MAW A;  5E79 O;  4YSY A;  4B3S T;  4IL4 A;  4L0R A;  3VZT X;  2N1G A;  3ZJ1 A;  4TUY E;  2FBW A;  5JTG A;  3O9X A;  2WS3 A;  5LMN T;  2R89 A;  4EEB A;  1Y01 A;  1BR4 A;  3GP6 A;  4O4J E;  3RKG A;  4P0B A;  1G8X A;  2LM9 A;  4CN4 A;  4ZZC A;  2UUB T;  4HE8 A;  1HR0 T;  5EZY E;  3TLT A;  4G2A A;  2BVL A;  4V1A v;  4Z90 A;  3RRW A;  3ABV A;  2PG8 A;  2ERV A;  2KSR A;  2V7L A;  4ILA A;  4LF5 T;  1BR2 A;  3PUA A;  2W67 A;  3T0S A;  5LHI B;  4NPP A;  5JDN A;  2KWI B;  3P50 A;  5GV0 A;  4O2B E;  4JI8 T;  2E5V A;  4QH4 A;  3RIF A;  2DWG A;  4AIU A;  2DWK A;  1YS5 A;  3FZH B;  2V5C A;  2CHN A;  2WMO A;  2YDR A;  2AXD S;  3TKL B;  5LB7 B;  1HG2 A;  3ONX A;  3IA3 A;  4I0U A;  3PUY F;  3T1Y T;  3RIU A;  4LMK A;  1GFQ A;  5B5E O;  5LCY A;  5CA0 E;  4MBQ A;  5G3A A;  1E54 A;  3C51 A;  5T5F A;  4ADZ A;  1Q9F A;  3PJA J;  1IJ5 A;  3ZJ2 A;  5JR9 A;  2O4V A;  3PGR A;  1S35 A;  5L3C B;  2DI4 A;  2QRX A;  3Q5D A;  3CQG B;  3SYB A;  2VKH A;  4EYY R;  4YLH A;  4TWD A;  3QK6 A;  5ABH A;  3EVY A;  4ZXL A;  3DJB A;  2Q9Q D;  5KMG P;  3EAB A;  3CQC B;  4DID B;  4KMC A;  3VKG A;  4Z3T A;  3BQL A;  2LSJ A;  2LRK A;  4AFK A;  4ZS3 A;  2BS4 A;  2HPJ A;  5FY1 A;  2ODV A;  1JNR A;  2X67 A;  3I9W A;  3PTR B;  1OED E;  4EAH A;  4KX6 A;  3UUB A;  4FRX A;  2LRL A;  4JCH A;  1FIO A;  4M1P A;  3GA8 A;  4CN6 A;  4D64 A;  3AAA B;  4DBR A;  3GN5 A;  2YDQ A;  2IAK A;  2XQ3 A;  3P4W A;  4UF0 A;  4FRT A;  1MIY A;  3CK6 A;  4O8S A;  3UAQ A;  5JVD E;  4P0A A;  3QRC A;  2F1C X;  7PRN A;  4DV3 T;  2XQA A;  1N33 T;  4QQ1 A;  5HAX A;  1ORM A;  4WNK A;  1KF6 A;  4ZEY A;  1OED C;  2R6G F;  4L9I A;  2OLT A;  2VB6 A;  4AYI D;  3OYX A;  2IHR 1;  1W09 A;  3AA7 B;  5DL5 A;  3RQU A;  2XHE B;  4TX5 A;  1XZY A;  2QVA A;  4IHJ E;  4H9N C;  4JUY A;  5F3J A;  2MYS A;  3ANW A;  2M6I A;  4ZOL E;  3SFD A;  3UQ7 A;  3RYH E;  4O3W A;  3U3I A;  2EHO A;  4JI6 T;  1Z0P A;  1M7K A;  2WDQ A;  4HTE A;  1BR1 A;  4JI3 T;  4HWD A;  2J1D G;  3IEE A;  3OPC A;  3GMI A;  2XQ4 A;  2K24 A;  2WM9 A;  2Q9Q C;  1X9B A;  4K3B A;  5IHY A;  4B3M T;  5AQS B;  2DLR A;  2WWV A;  2IWW A;  4FZL A;  3VR8 A;  2VK9 A;  2BVM A;  1QUU A;  4ZZB A;  4X1I E;  2XM2 A;  3OVU A;  4AQF A;  3B57 A;  2FJA A;  3EAM A;  1IBK T;  2V8S V;  3FBZ A;  1T1L A;  4DR7 T;  5BMV E;  2QGS A;  2W4X A;  4EED A;  2LHN A;  5EK2 A;  1E7P A;  2WVP A;  3OKQ A;  2POR A;  3SZV A;  4HFC A;  4GIW A;  5LBQ B;  5JDG A;  5LMU T;  3AVR A;  4GK5 E;  4LSE A;  2D2S A;  4IE5 A;  4E1S A;  2ZLY A;  3P7I A;  2A2F X;  2V7J A;  4KP3 C;  2X9H A;  2QYW A;  5ABG A;  1MM5 A;  3NSG A;  4MLK A;  4TZ4 C;  4EYU A;  2X9K A;  4FI5 A;  2KXP A;  4UV9 B;  4MHC A;  4AQF C;  4RLB A;  4EXT A;  2LEH A;  4AKH A;  4IE0 A;  2YN6 A;  4HFI A;  5CA1 E;  2WU5 A;  3GN5 B;  5FP3 A;  1KNZ A;  4U7I A;  2BG9 E;  3C4X A;  3SWH A;  3L09 A;  5ABE A;  3HKC E;  5FKY A;  3AEC A;  1HS7 A;  3JCU O;  3SFE A;  2Q9Q A;  1VCS A;  1ZHC A;  4TNV A;  4GCP A;  1HXT A;  3UPG A;  1ZHT A;  2WB5 A;  3JTY A;  2E9X D;  1KNP A;  2H7V C;  4F4B A;  2BKO A;  4ZI2 D;  1MND A;  3J7Y q;  2NW9 A;  3AAE B;  3C5O A;  3DA3 A;  4YXD A;  3UUX B;  3HKD E;  4X66 T;  4FQE A;  3HW9 A;  2IC6 A;  5J2U E;  1S94 A;  1YKH B;  2K9A A;  2ES0 A;  3OJA A;  5JDQ A;  3NWI A;  3LSV A;  2XTL A;  3AEG A;  4N58 A;  2ZFG A;  3AE6 A;  1U4Q A;  1WLX A;  2NR4 A;  3C64 A;  3M65 A;  2XMX A;  4IE7 A;  4OK0 A;  3RYI E;  3PDY A;  1OED A;  5L3G B;  4GKK T;  5G38 A;  3A0B O;  1G73 A;  5JR9 B;  2K48 A;  2WBL A;  2XQY A;  3KVB A;  1HXX A;  3AXJ B;  4A56 A;  3FZM B;  3FYX A;  2XUE A;  4TNW A;  3UU5 A;  3PUV F;  4E1T A;  2DNX A;  4LSI A;  3LK2 A;  4O4U A;  3WU2 O;  2LE8 A;  2UU9 T;  1UX5 A;  2M06 A;  5KXJ A;  2W66 A;  1D1C A;  3S4U A;  3H3M A;  4Q25 A;  4IGU A;  2NWB A;  4IRE A;  5IWA T;  1QSD A;  4PJM A;  3QC9 A;  4PK4 A;  1D1B A;  5DL8 A;  3PUZ F;  3C50 A;  2WP9 A;  5CB4 E;  5HXS A;  3VU7 H;  2FJE A;  3CWZ B;  4LF7 T;  4OYK A;  4IDQ A;  1FMW A;  1HNW T;  3WAK A;  4CXW A;  1DU2 A;  2KND A;  2D5U A;  3UQ4 A;  5H6R B;  3FZK B;  3T20 A;  2VWA A;  2E9X C;  2AXT O;  5ETW A;  2PRN A;  5KAF O;  4JI0 T;  2XAG B;  2GE4 A;  4AXP A;  4I4T E;  5LGT B;  2XQ6 A;  1FEW A;  5G39 A;  2UXN B;  2LOS A;  4HKA A;  2LJL A;  5AQT B;  4FOZ A;  1L0V A;  1LVK A;  4O3Z A;  1XNQ T;  2W2U A;  3SYS A;  5ADX L;  1D0Y A;  2L8K A;  5HEU A;  1PHO A;  1MM4 A;  1Y64 B;  4DMW A;  5AQN B;  3UFG A;  2LHR A;  2KDY A;  3FXE B;  2XAS B;  5FXZ A;  4UB8 O;  5FMN A;  3P8C D;  4U31 A;  3RF1 A;  4LFA T;  1IZN B;  2HPL A;  2CPT A;  4HWC A;  2UXC T;  2UXD T;  3AE7 A;  3UUN A;  2XAJ B;  2J4U P;  1J5W A;  2VAS A;  4U74 A;  2MOZ A;  3T24 A;  2X66 A;  5LJN A;  3ZLI A;  2N2M A;  2RA1 A;  1UK5 A;  3KVA A;  5DQV A;  4HEA A;  4YHJ A;  2WJR A;  2WY2 A;  4QX8 B;  4OYJ A;  3UT5 E;  2ODU A;  3BS0 A;  2MNH A;  4DV0 T;  3BQK A;  3P4S A;  3PUR A;  4HWI B;  5JDP A;  4K0U A;  3ZC0 A;  3AEB A;  4NXN T;  2B1E A;  4RL9 A;  4HFE A;  5KDM C;  3N9L A;  1MMG A;  4K0K T;  3LDQ B;  4FSO A;  2I6H A;  4YHH T;  2DL1 A;  2ZM8 A;  4LF4 T;  3VZW X;  2Y7S A;  4X5T A;  2XTR A;  4YJ3 E;  4F8H A;  3RH3 A;  4BJN A;  2XQ8 A;  5HXH A;  2I59 A;  5F8P A;  2VQF T;  2XZE A;  1ZEE A;  4P09 A;  4AKI A;  3A7M A;  5AFU L;  4LMJ A;  1GFO A;  2XTQ A;  3A0H O;  1VOM A;  2BDE A;  1BR0 A;  3H37 A;  2AE9 A;  2JQH A;  4QH1 A;  4DR6 T;  2CXF A;  5LYJ E;  2H3R A;  4EIW A;  4UVA B;  2CWO A;  4UEL A;  4N78 D;  3ZPO A;  4WW0 A;  4AZL A;  1PRN A;  2E9X B;  1JNZ A;  1ZHX A;  5L3D B;  4HFB A;  4GHB A;  5AQO B;  3NBX X;  1ZHY A;  4YTM A;  2XQ5 A;  2JMH A;  4XZC A;  3J9X 1;  3MZK B;  1XDO A;  1ZV4 X;  3N2K E;  4UEM A;  4KR8 A;  3VZU X;  3ZMZ B;  2NTY A;  4TV8 E;  3V5S A;  3LK3 B;  5HEJ A;  5FY0 A;  3AA0 A;  5ADX K;  2VVS A;  2JPF A;  2YEV C;  3RYF E;  5C2T A;  4TV9 E;  5LP6 E;  4N75 A;  3E22 E;  1MIW A;  4GYR A;  5E0O A;  2F1V A;  5AFU K;  5GTH O;  5TIS O;  3TLS A;  2NTX A;  5HCJ A;  4HFH A;  5EK3 A;  4ZI3 D;  4DR2 T;  1IBM T;  2BZB A;  2M67 A;  1QJP A;  1OPF A;  2X0Y A;  4CXY A;  4CQI A;  4IE4 A;  2C5J A;  2JQY A;  1Q9G A;  3ETU A;  5LGN B;  3PQU A;  2MTQ A;  5HXC A;  4DR3 T;  4BAY B;  5CJ5 A;  3CML A;  4UIG A;  3NRX A;  6PRN A;  4EB6 E;  3ZYM A;  4JYA T;  3ETV A;  4K3C A;  3MAC A;  4GCS A;  1GQE A;  2BBJ A;  1HX8 A;  2R8A A;  2J62 A;  2ZM2 A;  2YOE A;  4PK6 A;  4X65 T;  3ZMV B;  2JJ9 A;  1IJ6 A;  4U33 A;  4UR9 A;  3RC3 A;  2KIN B;  4OHF A;  3RX6 A;  2YNK A;  3KDS E;  4FT6 A;  1N34 T;  3NZP A;  2X9Y A;  3JAE A;  4C69 X;  4JI1 T;  5L3B B;  4PJN A;  4DV2 T;  4IDP A;  2XAH B;  4G63 A;  2UUA T;  4JI4 T;  2E8I A;  1WCR A;  2XE1 A;  2LFU A;  5AQQ B;  4GF4 A;  3PGS A;  3VRA A;  4KR4 A;  1T8B A;  1IZN A;  1YQ3 A;  3OBV E;  3WI3 A;  2CBJ A;  3K3N A;  5H2F O;  2VUR A;  5HEG A;  3A2S X;  2YU1 A;  3POX A;  3UUM A;  5FXV A;  3ZT5 A;  2F4V T;  2L9Q A;  1QJ9 A;  2N9D A;  4J2C A;  1FJG T;  4GKJ T;  3KV5 A;  4PK5 A;  1WR6 A;  2JQQ A;  2C5K T;  3JCF A;  1LKX A;  3K3O A;  5A1L A;  1YW0 A;  3AE4 A;  3ONJ A;  1OSM A;  3CQX C;  3RC8 A;  1HXU A;  2K5B B;  4I43 B;  5KX5 E;  5LG3 A;  2XG6 A;  2J47 A;  3HWB A;  3N9Q A;  4U7Y A;  1ZKE A;  5LHG B;  2XPK A;  5L47 A;  1HFA A;  2C5I T;  4H9S E;  1YD8 G;  3DP7 A;  5KAI O;  4KUM B;  3PUX F;  4DR1 T;  2R4L A;  4MAL A;  4YTP A;  5FNV E;  5AQU B;  3PV0 F;  1YQ4 A;  3VR9 A;  3TLU A;  1GFN A;  3AAI A;  1WYB A;  2V5D A;  3HOL A;  3V8U A;  4KRA A;  5JDL A;  2WWU A;  2LSG A;  4DBQ A;  5AQM B;  2ZM6 T;  3QB5 A;  4C90 A;  5AQK B;  2YKS A;  2WQY A;  3PGU A;  5FL1 A;  3HI2 A;  3RI5 A;  2CLY B;  4H9R C;  2XE3 A;  3LK4 2;  2IC9 A;  3LK2 B;  4JI7 T;  4AIS A;  4EGW A;  5CGM A;  2QTK A;  3B5M A;  4NXM T;  2XM1 A;  2J1N A;  3AXJ A;  2K4T A;  4DO0 A;  2A9U A;  3RGL A;  1KFY A;  4N59 A;  4GOU A;  1OED B;  4X20 E;  4BA9 A;  4ZS2 A;  2XAF B;  4WBO A;  1YKE B;  3Q5E A;  4CI1 B;  3DA4 A;  4LSF A;  2XSA A;  2W0G A;  1W0A A;  5FL0 A;  4ZI2 C;  3ZST A;  4H63 V;  4WYV A;  4H9Q C;  3DTO A;  3ZC1 A;  2J4G A;  5HYA A;  3JAF A;  1W0B A;  3N9N A;  4PUX A;  2X51 A;  3AAE A;  3AED A;  3KV9 A;  4KBM B;  1EZ3 A;  3ZCJ A;  2HHH T;  4OFZ A;  3MJX A;  2D9D A;  3HOE A;  2M07 A;  1N36 T;  2Q9Q B;  3F57 A;  4PFO A;  3RIA A;  3SY7 A;  1XMQ T;  1ZOY A;  2PBI A;  2V7M A;  4QXH B;  3TLV A;  5GTI O;  2XJ7 A;  3AB3 B;  5HEH A;  4PJL A;  4O4L E;  2VKD A;  4X1Y E;  2LSK A;  1IAP A;  3I1A A;  5DAB A;  3I0Q A;  3FZF B;  5JDH A;  3KVD D;  4AKR B;  3HR0 A;  3F31 A;  2CA5 A;  2KXP B;  2B76 A;  3BRZ A;  1SA0 E;  3PF1 A;  4X62 T;  2WDR A;  5AQI B;  2WMN A;  4YSX A;  1MNE A;  2KZ7 B;  3CKD A;  3OYZ A;  4JV5 T;  1WR0 A;  4QH5 A;  2R4P A;  4TWH A;  3SY9 A;  2FJD A;  2W00 A;  3L3P A;  5C8Y E;  5M4Y A;  5EK4 A;  3UU4 A;  5LHH B;  2QA7 A;  4JEU B;  4AKL A;  5FVN A;  4FMS A;  4U9C A;  3EDV A;  3C4Z A;  3AA1 A;  3ZMU B;  1B7T A;  5AQR B;  3ZN0 B;  3GWH A;  3QRA A;  2YU2 A;  4ZHQ E;  4PR7 A;  2CXL A;  2SPC A;  4PW8 A;  3QNU A;  3N9P A;  2MHL A;  2H7O A;  1ZP0 A;  1NWM X;  3HL6 A;  5DL6 A;  3KBT A;  4ASK A;  3M3Z B;  2LHF A;  3PRN A;  5LXT E;  3ZYK A;  1IBL T;  4KHZ F;  1UUS A;  3ZCI A;  1O3X A;  2V1D B;  1SUM B;  2VL0 A;  2E5L T;  5TAO A;  3JC6 D;  3PQS A;  3WI5 A;  3ZMT B;  2BS3 A;  3ZT7 A;  3UU3 A;  4AYM C;  2EHO B;  4E7Z A;  3LFM A;  2KT9 A;  4O4X A;  3CIR A;  3ANW B;  4XNK A;  3G7G A;  2CCQ A;  4CXX A;  2LLY A;  3FBL A;  2F1T A;  1W9R A;  4LF9 T;  4PJ0 O;  2WZH A;  3PJA A;  3AA7 A;  5AQV B;  2I0M A;  1KEY A;  3AE3 A;  4JI5 T;  3DZM A;  3ZMS B;  5C3J A;  4XNL A;  4TN7 B;  2ZM0 A;  4B61 A;  1HNX T;  4AKG A;  5J0Z A;  2VKJ A;  3RYC E;  4D65 A;  1UUR A;  3UU6 A;  4B6X A;  1XNR T;  4G76 A;  2D0T A;  3WI4 A;  4C91 A;  4CI3 B;  1FMV A;  1J1J A;  2DHR A;  4CI2 B;  4UF0 B;  3SOL A;  3C4W A;  2IUB A;  1D0X A;  1WRD A;  2GK9 A;  4X1K E;  3EDU A;  3DWO X;  4Z8X A;  3AAA A;  2XY8 B;  4U72 A;  2N2N A;  1D0Z A;  3KV4 A;  4ZI7 E;  2Y2X A;  2A72 A;  4DV1 T;  3BQI A;  1XDP A;  2XQ7 A;  2L3L A;  3POQ A;  1KK7 A;  5FVL A;  4DV6 T;  2BBH A;  5AQP B;  3O4X E;  5LBM A;  4HWF A;  5LG4 A;  4H9O C;  3ONL C;  2CXD A;  3Q5X A;  2NOX A;  4JI2 T;  2JRK A;  1MPF A;  2YK0 A;  1HTJ F;  4UV8 B;  3KV6 A;  3KIN B;  3LJC A;  4PNI A;  3UU2 A;  2NW7 A;  1S5L O;  2UXB T;  4DVD A;  3K19 A;  4IT4 A;  3CPZ A;  2OMF A;  4NIQ A;  4ISS A;  2Y0K A;  5LNK A;  5L3F B;  3O0E A;  4JBW F;  3MK7 C;  3TLW A;  3EHZ A;  2R4O A;  4DV4 T;  4RJX A;  1HX1 B;  3Q9D A;  1UX4 A;  3ZN1 B;  3EI0 A;  3ZSS A;  1AJ3 A;  5L3E B;  2DCF A;  3L39 A;  5GON E;  4IE6 A;  1VCT A;  5PRN A;  1US7 B;  4A98 A;  1NAF A;  1M62 A;  3VKH A;  2CHO A;  2CRB A;  4CTD A;  2IIU A;  2VKO A;  3RQW A;  3MKD A;  3VY8 X;  8PRN A;  3WAJ A;  3AA1 B;  4KHP T;  2CEA A;  3V5U A;  3RBH A;  2V6X A;  4E7S A;  2X68 A;  1WFD A;  2X9W A;  5DJQ C;  2EHO C;  3ZYL A;  2WU2 A;  4O3Y A;  5DL7 A;  2XAQ B;  3IBP A;  2YDS A;  3SS1 A;  3VHL A;  5CFB A;  3VE1 A;  2KC0 A;  1E1H B;  4AI6 A;  2LSY A;  5H6Q B;  4HGA A;  1VRB A;  2VQE T;  3W15 B;  5AQG B;  1Z8U A;  2BG9 C;  4YTN A;  2RP4 A;  2W63 A;  2WAU A;  4O4H E;  1XMO T;  4FJO A;  2R4N A;  3P4R A;  2WJQ A;  3Q2M A;  2KZ7 A;  3CX8 B;  2X9X A;  4A5X A;  4RJW A;  1BT9 A;  1H6S 1;  4AKR A;  4DV5 T;  2IDO B;  4FZM A;  4XAX B;  2V7K A;  3TZG A;  3IHR A;  1XWM A;  3AA6 A;  5LGU B;  2FJB A;  4I55 E;  2Y0L A;  5L4E A;  3R84 B;  4AYN A;  5B66 O;  3UFE A;  3KBU A;  4YJ2 E;  4QWN B;  4B3R T;  2BS2 A;  3PUS A;  2UXX B;  4PJJ A;  4JFB A;  2V6Y B;  4IST A;  2XE5 A;  5FY7 A;  4HFV A;  3ZEF B;  4DND A;  4WZX A;  4DUY T;  2FGQ X;  3AE9 A;  3LG7 A;  2N2L A;  5HEO A;  4DR4 T;  3NVO A;  2LOP A;  4IL9 A;  2KLQ A;  2Z6E A;  1BH3 A;  3AE8 A;  4AUI A;  4EZ4 A;  4IL6 O;  5IUX A;  1UCU A;  3P4Q A;  1N32 T;  2XE2 A;  2H88 A;  1I94 T;  5JRE A;  3PU3 A;  2M6B A;  2VL8 A;  2EHO D;  3CX6 B;  3E08 A;  2JMM A;  1V9D A;  1OWA A;  1QJ8 A;  4N74 A;  3N9O A;  3QUJ A;  3RIU C;  4C00 A;  4XBF B;  4FES A;  4LML A;  3R6N A;  1CUN A;  1U5P A;  5LJM A;  2LSI A;  5FYM A;  4PFP A;  2WCA A;  4U2Z A;  4Z91 A;  4CN1 A;  4EOZ B;  1T72 A;  4CZZ B;  2CE7 A;  4MFR A;  3I0O A;  1ZHZ A;  1LRZ A;  2HN1 A;  5AQL B;  5ABF B;  5LOV E;  4IDO A;  3BK9 A;  4B3T T;  1HNZ T;  5FXW A;  2JIW A;  3O1I A;  2FUP A;  3EUH A;  2BKN A;  2LKH A;  1NEN A;  2W62 A;  4LFC T;  5JH7 E;  2VVN A;  4BUM X;  2BG9 B;  3FZL B;  4G75 A;  3RLF F;  2PFV A;  4AKM A;  5G26 A;  4PAG A;  2ACZ A;  1T98 A;  2HN2 A;  3PU8 A;  5JDF A;  3X1D A;  4IIJ E;  2D0U A;  3PUW F;  4UVB B;  3UUL A;  4I50 E;  5JR9 C;  3KFW X;  2XQ9 A;  1D1A A;  3U78 A;  4YFS A;  4NUU A;  2KWH A;  4O49 A;  3N2G E;  2ODJ A;  4YSZ A;  4RLC A;  1UGO A;  1T7S A;  3IF8 B;  5DQW A;  4AQG A;  3NZQ A;  3H3A A;  2X27 X;  2ZMA A;  1G90 A;  4BJM A;  4F6R C;  4TWF A;  3O1H A;  5J1G A;  3AEE A;  3RKO A;  3LBX A;  3NJT A;  4C4V B;  2RPA A;  3BRY A;  4UVC B;  5HCM A;  4U3C A;  1MIV A;  3SZD A;  5HWY A;  4LSH A;  4AYD C;  5IYZ E;  3POR A;  4HWH A;  3FB2 A;  4GYS A;  5JRC B;  1ZHW A;  4FSP A;  2KMF A;  3MA9 A;  4UB6 O;  2CM0 A;  4P1N A;  4DMV A;  3FHN A;  2G0U A;  3ESL A;  3EMN X;  3HKB E;  4QXB B;  5LA6 E;  2HH7 A;  2V26 A;  5JDM A;  3T1H T;  3Q5W A;  5EE2 A;  5L4H A;  4QXC B;  4QX7 B;  5F5W A;  5J2T E;  2WSS V;  4LFB T;  3ZKR A;  4YT0 A;  1MMN A;  3AVS A;  3QOF A;  3K1S A;  2K0L A;  2WZI A;  4O4I E;  3RPU A;  2JMK A;  3CVR A;  2LM2 A;  3AE1 A;  3P4P A;  2IWV A;  4YY3 T;  4FZN A;  3RHW A;  3JAD A;  5JRC A;  2WDV A;  3K3Q C;  3N2O A;  2W81 C;  1CHU A;  4IDN A;  1R8I A;  5L2L A;  4DUZ T;  2Y6X A;  4UXN B;  4LF8 T;  1GFP A;  4EZH A;  1NEK A;  4EV6 A;  4DR5 T;  2E2A A;  1YXR A;  1MMA A;  4D5U A;  3D0T A;  4C4V A;  3LBX B;  4ZI3 C;  4L5G A;  2ZLD A;  4JLE A;  4ERR A;  3NKZ A;  3N9M A;  3MXZ A;  3T8O A;  4LF6 T;  4H63 H;  3VE2 A;  2K3W A;  2CLY C;  2X0H A;  4A97 A;  2H89 A;  2W61 A;  2OA5 A;  3FXD B;  2V7I A;  3AA0 B;  3LK3 A;  3A8Y C;  2IML A;  4AYE C;  3AEA A;  3PUG A;  5HWX A;  4JEH B;  4X64 T;  2E9X A;  1MMD A;  3SRZ A; 
#chains in the Genus database with same CATH homology
 4DVD A;  4C69 X;  3K19 A;  2YIN A;  1OSM A;  3F2E A;  3CPZ A;  2OMF A;  1MM5 A;  2C0S A;  4ISS A;  3NSG A;  2Y0K A;  5LNK A;  4MLK A;  4TZ4 C;  5L3F B;  4EYU A;  3O0E A;  2LT3 A;  1SHZ C;  5L3B B;  3JC6 C;  4PJN A;  3MK7 C;  1THQ A;  2FGR A;  2XAH B;  3POU A;  4O3X B;  4RJX A;  3I9Y A;  4FI5 A;  5IYU A;  2KXP A;  3Q9D A;  4G63 A;  4UV9 B;  4MHC A;  4AQF C;  4WBN E;  1UX4 A;  4EXT A;  4RLB A;  3PQS A;  2LEH A;  2E8I A;  4AKH A;  3ZN1 B;  2NW8 A;  4IE0 A;  2XE1 A;  2LFU A;  2ACX A;  4GF4 A;  5CA1 E;  3UTK A;  3GN5 B;  4KR4 A;  5FP3 A;  1HCI A;  1IZN A;  1AJ3 A;  2YPV A;  1KNZ A;  5L3E B;  2DCF A;  3OBV E;  4IDZ A;  3WI3 A;  3A5X A;  3C4X A;  3K3N A;  3SWH A;  3L09 A;  5GON E;  1OXZ A;  3HKC E;  4IE6 A;  3A2S X;  2YU1 A;  3POX A;  5PRN A;  1HS7 A;  1US7 B;  1WYC A;  1NAF A;  2Q9Q A;  1ZHC A;  5FXV A;  3UUM A;  4GCP A;  5D5D A;  3VKH A;  3VY9 X;  1HXT A;  3UPG A;  1ZHT A;  2L9Q A;  2P9B A;  2VKO A;  3JTY A;  2E9X D;  3PE0 A;  1H7C A;  2H7V C;  5HXR A;  4F4B A;  3MKD A;  4ZI2 D;  2N9D A;  1QJ9 A;  4ILU A;  4J2C A;  3VY8 X;  1MND A;  8PRN A;  3WAJ A;  3AA1 B;  3J7Y q;  2CEA A;  3V5U A;  4O2A E;  5JQG E;  2Y48 B;  3RBH A;  4E7S A;  3N5L A;  2X68 A;  2NW9 A;  3RRC A;  3AAE B;  3C5O A;  2X9W A;  2PJQ A;  3C98 B;  5DJQ C;  3DA3 A;  2EHO C;  3KV5 A;  3UUX B;  4PK5 A;  4QKN A;  1WR6 A;  3HKD E;  3ZYL A;  2JQQ A;  2C5K T;  3HW9 A;  4O3Y A;  5DL7 A;  2XAQ B;  1LKX A;  3IBP A;  3K3O A;  3LK4 1;  2IC6 A;  5A1L A;  3SS1 A;  1P4T A;  3VHL A;  1YW0 A;  1HG5 A;  5J2U E;  1S94 A;  2KC0 A;  3VE1 A;  1E1H B;  3CQX C;  2CMR A;  1YKH B;  3RC8 A;  4AI6 A;  2K5B B;  2LSY A;  5H6Q B;  2NP9 A;  4HGA A;  4NUV A;  1HXU A;  1VRB A;  2K9A A;  3W15 B;  4GK0 E;  2ES0 A;  3OJA A;  4I43 B;  5KX5 E;  3HKE E;  5JDQ A;  2XG6 A;  2RP4 A;  1LVF A;  2W63 A;  3O1J A;  2WAU A;  2XTL A;  3N9Q A;  3HWB A;  4H9P C;  2ZFG A;  4N58 A;  1U4Q A;  1WLX A;  2X0L B;  4O4H E;  4ANJ A;  1ZKE A;  1HF8 A;  3C64 A;  4FJO A;  5LHG B;  3M65 A;  1GFM A;  2XMX A;  3B13 A;  3Q2M A;  4IE7 A;  4OK0 A;  2KZ7 A;  1HFA A;  2C5I T;  4QHO A;  3PDY A;  4H9S E;  1YD8 G;  2CWY A;  3DP7 A;  3RYI E;  5L3G B;  3CX8 B;  1G73 A;  4KUM B;  2X9X A;  5JR9 B;  2K48 A;  2A3D A;  2WBL A;  2Y8D A;  2XQY A;  4RJW A;  4MAL A;  3KVB A;  1HXX A;  1BT9 A;  5FNV E;  1BXW A;  1H6S 1;  4A56 A;  4AKR A;  1X79 A;  4FZM A;  4XAX B;  3FYX A;  2V7K A;  2XUE A;  3K8P C;  1GFN A;  3TZG A;  3AAI A;  2IW5 B;  3IHR A;  1WYB A;  4E1T A;  3HOL A;  2DNX A;  4LSI A;  3AA6 A;  3LK2 A;  5LGU B;  2W80 C;  3V8U A;  4I55 E;  5JDL A;  2Y0H A;  4KRA A;  2Y0L A;  4HN9 A;  3R84 B;  4FUV A;  4O4U A;  2WWU A;  4AYN A;  2LE8 A;  2LSG A;  2MBG A;  5HXE A;  3E0Z A;  4DBQ A;  1UX5 A;  2M06 A;  3UFE A;  4C90 A;  3CX7 B;  3KBU A;  3NRY A;  1D1C A;  3S4U A;  4YJ2 E;  4QWN B;  3HI2 A;  5FXX A;  4IGU A;  2NWB A;  4GCQ A;  1QSD A;  4PJM A;  3QC9 A;  2CLY B;  3PUS A;  4PK4 A;  2UXX B;  3HA4 A;  4H9R C;  4PJJ A;  2XE3 A;  1D1B A;  5DL8 A;  3LK4 2;  4JFB A;  4IST A;  2IC9 A;  3LK2 B;  3AA6 B;  2XE5 A;  5FY7 A;  3PUQ A;  4HFV A;  3C50 A;  2QTK A;  5CB4 E;  3ZEF B;  5HXS A;  3VU7 H;  3CWZ B;  4DND A;  2J1N A;  2FGQ X;  3LG7 A;  2N2L A;  2K4T A;  2LOP A;  4OYK A;  4DO0 A;  1FMW A;  2KLQ A;  4L0R A;  4N59 A;  3VZT X;  2Z6E A;  4GOU A;  3WAK A;  1BH3 A;  4CXW A;  2N1G A;  3ZJ1 A;  4AUI A;  4TUY E;  4X20 E;  4BA9 A;  2KND A;  4ZS2 A;  2D5U A;  4EZ4 A;  2XAF B;  4WBO A;  1YKE B;  3O9X A;  4CI1 B;  5H6R B;  3DA4 A;  3T20 A;  1BR4 A;  2VWA A;  3GP6 A;  4LSF A;  4O4J E;  2E9X C;  5ETW A;  4P0B A;  2W0G A;  1UCU A;  1G8X A;  4ZI2 C;  2PRN A;  2LM9 A;  4H63 V;  2XE2 A;  2XAG B;  4HE8 A;  5EZY E;  5JRE A;  3PU3 A;  2GE4 A;  4AXP A;  4H9Q C;  3DTO A;  3ZC1 A;  4G2A A;  2BVL A;  5HYA A;  2VL8 A;  4I4T E;  4V1A v;  3RRW A;  2EHO D;  3CX6 B;  5LGT B;  3E08 A;  1FEW A;  3N9N A;  2JMM A;  2PG8 A;  2UXN B;  4PUX A;  2LOS A;  4HKA A;  2ERV A;  2LJL A;  1V9D A;  1OWA A;  4FOZ A;  2V7L A;  1QJ8 A;  2X51 A;  1LVK A;  3N9O A;  3AAE A;  1BR2 A;  3PUA A;  3QUJ A;  3T0S A;  5LHI B;  4O3Z A;  5JDN A;  2KWI B;  4XBF B;  4FES A;  3SYS A;  3R6N A;  5GV0 A;  1CUN A;  3KV9 A;  4KBM B;  4O2B E;  1U5P A;  5ADX L;  1EZ3 A;  3ZCJ A;  5LJM A;  2LSI A;  1D0Y A;  2L8K A;  4OFZ A;  5FYM A;  4PFP A;  3MJX A;  3HOE A;  2M07 A;  1PHO A;  2DWG A;  1MM4 A;  1Y64 B;  2DWK A;  1YS5 A;  4EOZ B;  2Q9Q B;  3F57 A;  4PFO A;  4CZZ B;  4DMW A;  2CE7 A;  2LHR A;  2WMO A;  2KDY A;  4MFR A;  3TKL B;  3SY7 A;  3FXE B;  2XAS B;  5FXZ A;  1HG2 A;  5FMN A;  2PBI A;  2V7M A;  3P8C D;  3ONX A;  3I0O A;  1IZN B;  1LRZ A;  2HPL A;  4QXH B;  1ZHZ A;  3AB3 B;  4PJL A;  4O4L E;  1GFQ A;  2VKD A;  4X1Y E;  2LSK A;  1IAP A;  3I1A A;  5DAB A;  5LCY A;  3I0Q A;  5LOV E;  5CA0 E;  4MBQ A;  5JDH A;  3KVD D;  3UUN A;  3BK9 A;  4AKR B;  3HR0 A;  3F31 A;  1E54 A;  2CA5 A;  3C51 A;  5T5F A;  4ADZ A;  1Q9F A;  5FXW A;  1IJ5 A;  2KXP B;  3ZJ2 A;  2XAJ B;  1SA0 E;  3O1I A;  2J4U P;  5JR9 A;  2O4V A;  1S35 A;  2VAS A;  2WMN A;  3EUH A;  4U74 A;  2DI4 A;  1MNE A;  2KZ7 B;  5L3C B;  2W62 A;  3CKD A;  3CQG B;  3OYZ A;  4BUM X;  2MOZ A;  5JH7 E;  3T24 A;  2X66 A;  4G75 A;  5LJN A;  3ZLI A;  3SYB A;  2N2M A;  2RA1 A;  2VKH A;  3SY9 A;  3KVA A;  2PFV A;  2W00 A;  4YLH A;  4EYY R;  4AKM A;  5DQV A;  5G26 A;  4PAG A;  3L3P A;  3QK6 A;  4HEA A;  1T98 A;  4YHJ A;  3EVY A;  5C8Y E;  3PU8 A;  5JDF A;  5M4Y A;  3DJB A;  4IIJ E;  2D0U A;  5EK4 A;  2Q9Q D;  4QX8 B;  4OYJ A;  3UT5 E;  5LHH B;  2ODU A;  4UVB B;  2QA7 A;  2MNH A;  3UUL A;  5KMG P;  4JEU B;  4I50 E;  5JR9 C;  3KFW X;  3CQC B;  3BQK A;  3PUR A;  4KMC A;  1D1A A;  3U78 A;  4AKL A;  4YFS A;  3VKG A;  3BQL A;  4NUU A;  2LSJ A;  4AFK A;  5FVN A;  2KWH A;  4K0U A;  4O49 A;  4Z3T A;  4FMS A;  4ZS3 A;  3N2G E;  3ZC0 A;  2ODJ A;  4U9C A;  3EDV A;  4RLC A;  2B1E A;  3C4Z A;  2HPJ A;  5FY1 A;  4RL9 A;  2ODV A;  3AA1 A;  5KDM C;  3IF8 B;  3ZMU B;  5DQW A;  3N9L A;  4AQG A;  2X67 A;  1MMG A;  1B7T A;  3I9W A;  3NZQ A;  3H3A A;  3PTR B;  3GWH A;  3ZN0 B;  4FSO A;  4EAH A;  2YU2 A;  3QRA A;  4ZHQ E;  2X27 X;  2ZMA A;  1G90 A;  4BJM A;  2ZM8 A;  4F6R C;  3VZW X;  2CXL A;  2Y7S A;  2XTR A;  3O1H A;  5J1G A;  4FRX A;  3RKO A;  2SPC A;  4PW8 A;  4YJ3 E;  3LBX A;  3RH3 A;  4JCH A;  4BJN A;  1FIO A;  3N9P A;  5HXH A;  2I59 A;  5F8P A;  2MHL A;  4M1P A;  2H7O A;  1NWM X;  3HL6 A;  3GA8 A;  5DL6 A;  4D64 A;  3AAA B;  4DBR A;  1ZEE A;  3KBT A;  3GN5 A;  4P09 A;  2IAK A;  4ASK A;  4UVC B;  4UF0 A;  4AKI A;  2LHF A;  3PRN A;  5LXT E;  4FRT A;  1MIY A;  4O8S A;  3ZYK A;  1MIV A;  3UAQ A;  3SZD A;  5HWY A;  5JVD E;  5AFU L;  4P0A A;  1GFO A;  3QRC A;  5IYZ E;  3POR A;  4LSH A;  4AYD C;  2XTQ A;  3ZCI A;  4FSP A;  3FB2 A;  4GYS A;  5JRC B;  1ZHW A;  2KMF A;  1VOM A;  3MA9 A;  1O3X A;  2V1D B;  2BDE A;  7PRN A;  2CM0 A;  1BR0 A;  3H37 A;  4DMV A;  5TAO A;  3FHN A;  2CXF A;  5LYJ E;  4QQ1 A;  2H3R A;  3JC6 D;  5HAX A;  1ORM A;  2G0U A;  3ESL A;  4UVA B;  2CWO A;  4WNK A;  4EIW A;  3EMN X;  3WI5 A;  3ZMT B;  4UEL A;  3HKB E;  4QXB B;  2EHO B;  4N78 D;  2HH7 A;  5LA6 E;  4AYM C;  4L9I A;  3LFM A;  2KT9 A;  2V26 A;  4E7Z A;  5JDM A;  4O4X A;  2VB6 A;  3ZPO A;  3Q5W A;  4WW0 A;  4AYI D;  3OYX A;  4AZL A;  1PRN A;  5EE2 A;  2E9X B;  3AA7 B;  4QXC B;  3ANW B;  5DL5 A;  4QX7 B;  1ZHX A;  2XHE B;  4XNK A;  3G7G A;  5L3D B;  2CCQ A;  4GHB A;  4TX5 A;  4CXX A;  5J2T E;  3FBL A;  2F1T A;  3NBX X;  1ZHY A;  2WSS V;  4IHJ E;  4H9N C;  4JUY A;  2JMH A;  4XZC A;  3J9X 1;  3MZK B;  5F3J A;  3N2K E;  1ZV4 X;  2MYS A;  1MMN A;  4UEM A;  3AVS A;  3ANW A;  4KR8 A;  3AA7 A;  4ZOL E;  3VZU X;  3ZMZ B;  2K0L A;  2NTY A;  4O4I E;  4TV8 E;  3V5S A;  3RYH E;  4O3W A;  3RPU A;  3ZMS B;  3LK3 B;  2JMK A;  5FY0 A;  3AA0 A;  5ADX K;  3U3I A;  3CVR A;  2JPF A;  2EHO A;  2YEV C;  3RYF E;  4TV9 E;  5LP6 E;  3E22 E;  4XNL A;  4TN7 B;  1MIW A;  1Z0P A;  2ZM0 A;  4GYR A;  5E0O A;  2F1V A;  4B61 A;  4HTE A;  4AKG A;  4FZN A;  5AFU K;  2VKJ A;  1BR1 A;  3RYC E;  4D65 A;  4B6X A;  5JRC A;  2J1D G;  3K3Q C;  3N2O A;  4G76 A;  3IEE A;  2W81 C;  2D0T A;  3GMI A;  4C91 A;  4CI3 B;  3WI4 A;  1FMV A;  2NTX A;  5L2L A;  2DHR A;  2Y6X A;  4UXN B;  5EK3 A;  4CI2 B;  4UF0 B;  3SOL A;  2K24 A;  3C4W A;  2WM9 A;  1D0X A;  2Q9Q C;  4ZI3 D;  1GFP A;  1WRD A;  2BZB A;  2GK9 A;  4X1K E;  3EDU A;  2M67 A;  4EZH A;  1QJP A;  5IHY A;  5JDP A;  1OPF A;  4Z8X A;  3AAA A;  4CXY A;  2DLR A;  4CQI A;  4U72 A;  4IE4 A;  2C5J A;  4FZL A;  1MMA A;  2N2N A;  4D5U A;  3D0T A;  1D0Z A;  1Q9G A;  3LBX B;  4ZI3 C;  3ETU A;  5LGN B;  3PQU A;  2MTQ A;  2VK9 A;  4L5G A;  2BVM A;  5HXC A;  2ZLD A;  3KV4 A;  4JLE A;  4ZI7 E;  4BAY B;  4ERR A;  2Y2X A;  1QUU A;  2A72 A;  3CML A;  3MXZ A;  3N9M A;  4UIG A;  4X1I E;  3T8O A;  3NRX A;  4AQF A;  3B57 A;  3BQI A;  3ZYM A;  4EB6 E;  6PRN A;  4H63 H;  3VE2 A;  3ETV A;  2CLY C;  3MAC A;  3FBZ A;  4GCS A;  2L3L A;  3POQ A;  1KK7 A;  2W61 A;  2OA5 A;  3FXD B;  5BMV E;  2QGS A;  2V7I A;  3AA0 B;  1HX8 A;  3O4X E;  3LK3 A;  2LHN A;  5EK2 A;  5LBM A;  2ZM2 A;  3OKQ A;  4PK6 A;  5LG4 A;  4H9O C;  2POR A;  3SZV A;  4GIW A;  5LBQ B;  5JDG A;  4AYE C;  3ZMV B;  2CXD A;  3AVR A;  3Q5X A;  4GK5 E;  4LSE A;  2D2S A;  2JJ9 A;  3PUG A;  4IE5 A;  4E1S A;  1IJ6 A;  2ZLY A;  3RC3 A;  3P7I A;  2KIN B;  2A2F X;  2NOX A;  2V7J A;  4OHF A;  5HWX A;  2JRK A;  1MPF A;  2YK0 A;  4JEH B;  4KP3 C;  3RX6 A;  3KDS E;  2YNK A;  4FT6 A;  1HTJ F;  2X9H A;  4UV8 B;  3KV6 A;  3NZP A;  2E9X A;  1MMD A;  3KIN B;  3LJC A;  4PNI A;  2X9Y A;  3SRZ A;  3UU2 A;  2NW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...