3AA6B

Crystal structure of actin capping protein in complex with the cp-binding motif derived from cd2ap
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
242
structure length
242
Chain Sequence
b'DQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-1
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 80
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aa6B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aa6B02
3AA7B 3AA6A 1IZNA 4AKRA 3AA6B 1IZNB 4AKRB 3LK2A 3AA1A 5AFUK 5AFUL 5ADXK 2KXPA 3LK2B 3AA1B 2KZ7A 5ADXL 3LK3A 2KXPB 3AA7A 2KZ7B 3LK3B 3LK41 3AAAA 3AAEA 3AA0A 3AAAB 3AAEB 3LK42 3AA0B
chains in the Genus database with same CATH superfamily
1IJ6A 1ZEEA 2MBGA 3ZMUB 3MJXA 3K3QC 3VZWX 2R4OA 2M07A 1CUNA 2OA5A 2W80C 5HXEA 2XASB 2KXPA 1MPFA 1MM5A 4X65T 3AECA 3C51A 3Q5EA 3WAKA 3A7MA 4GHBA 2ODUA 3SS1A 3QC9A 1VRBA 4OX9T 4JI4T 2KC0A 3SZVA 4DR3T 4ZHQE 4HWHA 5J2UE 3A0BO 3G06A 3NZQA 1N34T 5FKYA 5LHGB 3ZPOA 1UX4A 4OYJA 1ZHZA 4JCHA 4TWHA 3VR9A 5LGNB 4P09A 4YTMA 1HS7A 1FEWA 3Q9DA 4D5UA 4JI1T 4PK4A 2XJ7A 2CM0A 3OYZA 1OXZA 3MACA 3AA1B 3ETUA 3H3AA 3AE4A 2IHR1 1HTJF 4LF6T 1HR0T 5JRCA 2XQ9A 4DV4T 5FL0A 3MXZA 1QJ9A 3RF1A 2C5KT 3ZYKA 5LG3A 3ZMTB 1KNRA 3I1AA 3FBLA 5G26A 2LRLA 4LSIA 3AEBA 4AKMA 4PUXA 3BQKA 5CFBA 3NVOA 5JR9A 5AQFB 3PGRA 4DV1T 4MBQA 3ZJ1A 2KNDA 4N74A 4K0KT 2V7JA 4YFSA 3HKBE 3AB3B 1YKHB 3CQGB 2CRBA 3AEGA 2LJLA 4HFEA 2YDSA 4X64T 4PAGA 4TWFA 3OYXA 4F8HA 3JCFA 3I9YA 4IIJE 2ZLDA 2VL0A 2XPKA 4BUMX 2J4GA 3VRAA 1L0VA 1KFYA 4O49A 5L3FB 5DL5A 2R6GF 1HG5A 2RA1A 1J1JA 3CIRA 2Q9QB 3ZT7A 4B3TT 2CBIA 2A9UA 2H7OA 3RQWA 3PGUA 4AQGA 2IMLA 1Y01A 2CEAA 5DL7A 1WYBA 2H3RA 5AQTB 4DBQA 2XE3A 2PORA 3SYBA 1QSDA 1M7KA 2ZM0A 3B57A 4NUVA 4ZS2A 1W0AA 1GFNA 4CN1A 4QXCB 2AXTO 5LOVE 4I55E 2F1TA 1IJ5A 2GE4A 4EGWA 3EHZA 2M6IA 2NW7A 2WWUA 3RYHE 2KZ7B 4IL4A 4ZZCA 2WAUA 2E9XB 3U78A 3L3PA 2Y0HA 4LFCT 1MMAA 2JQ9A 2RPAA 1ZOYA 3AA6A 4ERRA 2K24A 1QLBA 3P4PA 2KT9A 5HEGA 4IT4A 3CPZA 3BRYA 3WI3A 3KVBA 4AKGA 5ADXL 3UUNA 2XTLA 4UV9B 1BH3A 3VRBA 4GKKT 2ERVA 3FZMB 2Y0LA 3IEEA 3ABVA 4E7ZA 5AQSB 2L9QA 3AVSA 2J1DG 3AA7B 3ONLC 3TZGA 3I9WA 4GKJT 3PJAA 4AZLA 4JI6T 4XNLA 4N58A 4O8SA 2CLYB 5AQMB 5DQVA 2VQFT 4JV5T 4EEBA 2JQYA 3T8OA 3J7Yq 3AE1A 2R4LA 1OEDE 5PRNA 4Z90A 1W9RA 1HNZT 1W09A 1WR6A 4AQFA 4MALA 2V8SV 2VURA 3BQIA 3HOLA 4DV3T 3LK3B 5AQJB 1OWAA 4LF7T 5TAOA 3AAEB 4B6XA 3WI5A 2BDEA 3O1HA 1H6S1 4HGAA 2X9KA 2LM2A 3T20A 4NPPA 3O4XE 3ONJA 3ESLA 5H2FO 1US7B 4YTNA 4CI2B 2XM2A 4JI5T 2E5VA 2JQHA 4IE5A 2XTRA 4LSFA 2IC9A 3ETVA 2N1GA 4U7IA 1OEDB 3SFDA 2EHOA 4B3ST 4J2CA 4AXPA 4C4VA 1Z0PA 2XAJB 2XHEB 4TV9E 4IDOA 4TNWA 3PUGA 3JC6C 3AA0B 3PUSA 4GCPA 5GTIO 3UU6A 5DJQC 4QX8B 3EMNX 2ODVA 4IE0A 4U3CA 4I4TE 4B3MT 4LSEA 1T8BA 4FZNA 2B76A 4KMCA 5FXVA 3ZJ2A 2Q9QC 3AEAA 4O2BE 2V1DB 2J4UP 4XAXB 4LSHA 2YN6A 4GK0E 3PUYF 5AQHB 4PJMA 4ZXLA 2YK0A 3JTYA 4G75A 4U2YA 5FYMA 2XQ8A 4Z3TA 4H9RC 2HN2A 3RIAA 1FMVA 4IREA 1GFPA 4AKIA 3PUVF 1YKEB 4K0UA 1R8IA 2PRNA 3ANWA 3HW9A 5HYAA 2DI4A 2YINA 3VKGA 2A72A 4FRXA 2XTQA 2Y6XA 2AXDS 2V5CA 1T7SA 1UK5A 2DNXA 2LHNA 2VASA 4G63A 4MHCA 2E9XC 5DL6A 4P0AA 4CXWA 2C5IT 4Z8XA 2KDYA 1CHUA 1U4QA 3RKOA 5J2TE 1HNXT 3DJBA 2PJQA 4ZS3A 3SWHA 2QGSA 2N9DA 2WMNA 3B13A 4LF5T 5IUXA 2LE8A 4EOZB 3RKGA 4AKLA 2X9YA 1OPFA 5AQRB 3IHRA 4U2ZA 4D65A 3JCUO 1SHZC 2WS3A 3F2EA 2WJQA 2H7VC 3ZLIA 4LMJA 2WVPA 5JTGA 2UUCT 3GP6A 2JRKA 1UGOA 4FT6A 4U72A 3SOLA 2CLYC 2XQ6A 2WMOA 1H7CA 4ADZA 4CN6A 5FNVE 5EK4A 1XMQT 2YNKA 3RYFE 4FQEA 4UVBB 2OV9A 2D2SA 1LKXA 2Q9QD 3AAAB 4YXDA 1WYCA 4COFA 3O0EA 4KHZF 4WZXA 5JDMA 4HTEA 2F1CX 3WU2O 1WRDA 5L3DB 3VU7H 3ZKRA 5ABFB 2HPLA 1HXUA 2BBJA 3AEEA 3GWHA 4YT0A 2MYSA 3HOEA 4CXXA 2WU5A 2YU1A 1ZP0A 2VB6A 4FMSA 2JJ9A 4OHFA 2KLQA 2X67A 2FGRA 3ZSTA 1D0XA 4JFBA 1KF6A 2ZMAA 5KXJA 4F4BA 2R8AA 3N9OA 3RI5A 2MHLA 2X9XA 2BS3A 2W00A 3C64A 3DZMA 3RQUA 1S35A 2BKPA 2QVAA 2XE2A 4O3YA 4O4IE 4QXBB 3ZYMA 1OEDC 1IZNA 1XDPA 5LXTE 7PRNA 2R88A 4UVCB 3UQ4A 3CVRA 2FJBA 3PUQA 4ZZBA 2M06A 5L4HA 2MNHA 3RRWA 4UB8O 4X1YE 5FVKA 4MLKA 4AKHA 3P4WA 3PUAA 5DABA 1T98A 3Q5DA 2V6YB 3TLTA 4XZCA 4JUYA 3CWZB 4K3CA 3IA3A 4JI7T 3AE5A 3M65A 2KWHA 5IYUA 3N9MA 4RLCA 4CI3B 3UTKA 3Q5XA 4IHJE 1YW0A 4FRTA 4IE6A 5LNKA 4AKRB 2Y8DA 2UXXB 5AFUK 3QRAA 2W2UA 3BK9A 2WB5A 2EHOD 3RGLA 3T0SA 4QHOA 4UV8B 2R89A 3LSVA 2VQET 2UUBT 1NEKA 4ILCA 2CMRA 1XWMA 2P9BA 3C50A 3OKQA 1HNWT 5FY1A 2XSBA 2E2AA 3O1JA 2XMXA 2D5UA 2A2FX 4AI6A 5KDMC 4FUVA 3AE9A 4DBRA 3RC3A 5HCMA 4JI2T 3CK6A 2K0LA 4JYAT 2BZBA 2ACZA 4AISA 5D5DA 2W63A 3E22E 4GIWA 5FMNA 3RRCA 2DLRA 4GCSA 4O3WA 2CXFA 4A97A 2PFVA 1BR0A 4LF9T 3JAEA 4LFBT 1YS5A 3Q2MA 4Z91A 3TLVA 3RC8A 2W81C 8PRNA 4O3ZA 4IDZA 2OLTA 5KMGP 3MA9A 3RX6A 4E7SA 5IWAT 5FXZA 4TUYE 1S5LO 3UFGA 4CXYA 5B5EO 5CA1E 5AQGB 1GFMA 3N5LA 4EZ4A 4A56A 3I0OA 3AA1A 2JQQA 5AQIB 4M1PA 4QWNB 1W0BA 3R84B 4UVAB 1WLXA 2J47A 1XZYA 2H88A 4ZEYA 3N9QA 4FSOA 4JI8T 4C91A 4FZMA 4HFVA 4PJNA 3UU3A 4G76A 2QYWA 1BR4A 5J0ZA 2V26A 5ABGA 1Z8UA 4U7YA 2X0YA 2W61A 2WP9A 2WDRA 1HG2A 5CGMA 4DUZT 3ZSSA 1GQEA 3CQXC 5TISO 4MFRA 2FUPA 3EI0A 2J1NA 1N36T 2JIWA 4QXHB 5EZYE 2CXDA 2WQYA 4DR2T 4JEUB 1B7TA 4O3XB 2WDVA 4XNKA 4FOZA 2PTFA 5AQQB 5JQGE 5HWXA 4YSYA 3OTOT 2BG9E 4YJ2E 1ZHXA 1MNDA 5F8PA 4HFBA 4X1IE 3PF1A 4O4JE 3O9XA 5A1LA 3PJAJ 3A2SX 3QB5A 5CJ5A 1T72A 4BJNA 3G7GA 5LMUT 5FVLA 3UU8A 1HF8A 1E7PA 1S94A 2LFUA 3PUWF 2Q9QA 2QA7A 3OVUA 4L0RA 3FYXA 3ZC0A 4DNDA 3WAJA 4FESA 1WCRA 3VZTX 3CQCB 4DVDA 1U5PA 4UB6O 1Y64B 5LP6E 3KVDD 2NW9A 3KV4A 2WY2A 2V7MA 2HPJA 5LBQB 3BQLA 3PTRB 2IWWA 2JMHA 4WYVA 3MKDA 5IYZE 5L3CB 3VHLA 2BG9B 3LBXA 3GN5B 1LVFA 3EABA 5C2TA 4ZI7E 4FI5A 1ZKEA 5FP3A 3R6NA 1E1HB 5LHIB 3O1IA 1WFDA 3K8PC 3ZCIA 2KZ7A 2E9XA 4BJMA 1PRNA 1XNQT 3AEFA 2W62A 2ACXA 5LBMA 2IC6A 1YQ3A 2N2NA 1X9BA 4HKAA 5T5FA 3EVYA 2BBHA 2J62A 2WDQA 2ES0A 4Q25A 3UU4A 3EAMA 1N33T 3QK6A 5KAIO 1UX5A 3JADA 3UT5E 3VR8A 4EIWA 1BXWA 3AA7A 3DWNA 4QX7B 3KV6A 4HEAA 4UELA 2N2MA 4EZHA 2FGQX 4HWCA 3N2OA 1PHOA 3N2GE 4I0UA 3PU8A 3NZPA 5LYJE 3LFMA 4A98A 4RL9A 1X79A 1D1CA 4H9QC 4ISTA 3P4RA 4O4HE 3KDSE 4EV6A 3SRZA 2UXCT 2XE5A 2WBLA 3DWOX 4ILBA 4X1KE 2LSJA 4OFZA 5AQVB 3UULA 3UPGA 3E0ZA 5LJNA 2WJRA 3LK2B 3LK3A 3NKZA 3LK41 2KINB 3AAEA 4LMKA 2E5LT 1MMNA 4FSPA 3FBZA 3HKCE 3FZFB 3VY9X 4E1SA 4PR7A 2L8KA 5LGUB 2V7LA 4HFIA 2X27X 2CA5A 2NWBA 2M6BA 4OK0A 5ADXK 3FZKB 3RBHA 4UF0B 4H63V 4K3BA 3V5UA 3POUA 2CWYA 2CXLA 3UU2A 4DR4T 2DL1A 4UIGA 2D0TA 2Y7SA 3OPCA 1FJGT 1JNZA 3H3MA 2W67A 2NR4A 5HAXA 3KINB 5AQPB 3RIUC 4TZ4C 1HX1B 4TNVA 1OEDA 5L3BB 3NRYA 2K3WA 2XE1A 5KX5E 2VKDA 4OYKA 2I59A 3AA0A 3JAFA 5KAFO 1MMGA 3AE3A 1ZV4X 4ZI2C 3HWBA 5HXHA 3N9PA 3P4QA 2WWVA 3LG7A 3PQUA 5HEOA 2KMFA 3C98B 3FXDB 2FJEA 4PJJA 3QB5K 4IE4A 4IGUA 2GK9A 1QJPA 4BA9A 1T16A 5HEJA 2LHRA 3MZKB 5ABHA 1I94T 1OSMA 3C4XA 4L9IA 2CE7A 2FBWA 4X66T 5JDHA 2K48A 3C4WA 3RYCE 3TLWA 2BG9C 4DO0A 2DWKA 1IAPA 3AXJB 2PBIA 3N9NA 5FXXA 3UUMA 5HCJA 1GFQA 1G73A 1WR0A 4I50E 2W66A 2WCAA 3KFWX 4AUIA 1FIOA 3JC6D 3DA4A 2LT3A 2XQ3A 1O3XA 1YQ4A 4EAHA 2JMMA 2NOXA 3AE6A 4DR7T 1YD8G 2LM9A 2LOPA 5L3GB 1D1AA 2Y0KA 5AQOB 3ZC1A 2V5DA 4YJ3E 2LKGA 3N9LA 3UAQA 4KRAA 6PRNA 3K19A 2K4TA 3QOFA 1V9DA 2CHNA 5HXRA 1MNEA 4TN7B 4WW0A 2FJDA 1XNRT 1ZHYA 4QQ1A 3VY8X 4YLHA 3RLFF 4HFDA 4V1Av 4H9PC 1ORMA 2CWOA 1SA0E 4DV6T 3MK7C 2Y2XA 2V6XA 4CTDA 1MIVA 2FJAA 4LFAT 3ZCJA 5JVDE 5L3EB 2X0LB 3UQ7A 2E9XD 3AAAA 4CN4A 2I6HA 3FZHB 2BS4A 2NTXA 5LMNT 1XDOA 2NW8A 3P50A 2DHRA 3H37A 5ETWA 3T1HT 3CX8B 5ABFA 4PFOA 3KBTA 3GA8A 3VE1A 3F57A 4AYNA 4IL9A 5G39A 4H9NC 2KXPB 4WBOA 3V5SA 3PORA 3KZIO 2F4VT 4GF4A 4ZI3C 3P4SA 5AQUB 2LSGA 4PNIA 3PE0A 5LB7B 1THQA 4EXTA 4DV7T 3GMIA 5J1GA 5GTHO 2W0GA 2A3DA 5JDPA 2C0SA 5AQLB 3CX7B 4CZZB 3CX6B 2CCQA 2IUBA 1KNPA 3TLSA 2UUAT 1G90A 2CHOA 1D1BA 2WM9A 4QKNA 3L09A 2XZEA 1IBMT 3TKLB 1HXXA 4N59A 4LMLA 4KHPT 5E79O 5EE2A 5JRCB 1UUSA 4IDNA 4WNKA 5JREA 5L47A 4GYRA 2V6YA 4AYMC 2CPTA 3SZDA 2IDOB 2AE9A 3K3NA 3SY7A 2LKHA 3F31A 3K3OA 2SPCA 4KX6A 5JR9B 1ZHWA 2XAQB 3BRZA 1D0YA 5AQKB 4HFHA 4AKRA 2LSKA 4IDPA 3LJCA 3AE7A 4RJWA 5ABEA 3QNUA 4LF4T 3ZMVB 1VCSA 3ZMSB 2HN1A 2ZM6T 2HHHT 4AYEC 1LVKA 1IBLT 5H6RB 3VZUX 1T1LA 1BR2A 3OJAA 4XBFB 4X5TA 3BS0A 4ZI3D 4WBNE 1QUUA 2M67A 3I0QA 4O4LE 5CB4E 4NUUA 4DR6T 3UU5A 2XG6A 2K5BB 3V8UA 3UFEA 2X66A 5FL1A 4KBMB 2DWGA 3RIFA 5G3AA 2KWIB 2WU2A 3VKHA 5EK2A 3ZEFB 2UXBT 2HH7A 2UU9T 5AQNB 4ANJA 4AFKA 3FZLB 3U3IA 2XQYA 4PJLA 4F6RC 2XUEA 4JI0T 3J9X1 2XQAA 5GONE 4GYSA 2C5JA 4PJ0O 3AE2A 4G2AA 1HXTA 4KI0F 2YU2A 2LLYA 3L39A 3L8RA 2NTYA 1KEYA 2V7KA 5IHYA 2X9WA 4EYUA 2B1EA 2VVNA 3RYIE 4NXMT 3M3ZB 5JH7E 1HX8A 3EDUA 3A0HO 4P1NA 4AQYT 2KSRA 2IAKA 3AA6B 3POQA 3KBUA 4FZLA 5B66O 5M4YA 3ZYLA 1J5ET 5C3JA 2UXDT 4HN9A 3HA4A 4QH1A 5FY7A 3FHNA 4O4XA 4B3RT 5GV0A 1E54A 4X20E 5H6QB 3POXA 2BVMA 3LBXB 1I6ZA 1M62A 3PDYA 4U31A 4DR5T 3A5XA 4AIUA 3X1DA 2XY8B 2F1VA 3RIUA 4UEMA 5LJMA 3IF8B 3RHWA 4B61A 4YSZA 3HI2A 5G38A 1FMWA 5LGTB 1SE7A 3E08A 1XMOT 2R4NA 3QRCA 3PUXF 4O4UA 3D0TA 1NENA 4YSXA 3KVAA 2JMKA 3A8YC 4CI1B 5FY0A 2QRXA 1UCUA 2IW5B 4TWDA 3FXEB 2UXNB 2WZIA 3EUHA 4KR8A 3T1YT 4PK5A 1VCTA 3LDQB 1ZHCA 3S4UA 4U9CA 4TX5A 2V7IA 4UXNB 5JR9C 5L2LA 3CMLA 2DCFA 4PFPA 1MIWA 3UUBA 2BG9A 2H89A 4H9OC 3QUJA 3GN5A 4U33A 4PW8A 5DL8A 3P8CD 4ZOLE 4P0BA 1ZHTA 3PURA 2EHOB 4C4VB 4HWDA 3ZN1B 1UURA 4JBWF 4GCQA 3EDVA 1HCIA 2XQ5A 3NSGA 1BT9A 3PGSA 3ONXA 4YHHT 4HFCA 3DA3A 4HWFA 1BR1A 3RPUA 2K9AA 5BMVE 1LRZA 2MAWA 4E1TA 4YTPA 2XAFB 4HWIB 3ZN0B 5L4EA 1SUMB 2BKOA 2OMFA 4YY3T 2MPKA 2XSAA 1GFOA 2ZM8A 2XAGB 1YXRA 2LHFA 2WSSV 5FXWA 2R4PA 3C5OA 5JDQA 4X62T 2X51A 1EZ3A 3HL6A 4LF8T 3UUXB 4RLBA 3PV0F 2X68A 4JLEA 3ANWB 2YKSA 3SYSA 4C90A 1QJ8A 2VVSA 3W15B 3B5MA 3LK2A 4AYDC 2ODJA 2MTQA 3K1SA 5LHHB 2Y48B 4DIDB 3SY9A 5HXCA 2VK9A 5F3JA 1KK7A 3AEDA 4U74A 5F5WA 3KV9A 3NRXA 4FJOA 4AYID 4L5GA 2VL8A 4C69X 2XAHB 4A5XA 4H63H 2NP9A 4UF0A 5LA6E 3HR0A 3CKDA 5C8YE 2IIUA 4IDQA 4H9SE 4EEDA 4C00A 4CQIA 2YDQA 4NXNT 4KP3C 3N2KE 4KUMB 4DUYT 1Q9GA 2LSIA 1KNZA 3DP7A 2D9DA 4QH5A 5BR8T 2CBJA 2VWAA 2YPVA 4O2AE 3HKDE 4ASKA 4I43B 3T24A 1N32T 5HXSA 2D0UA 1JNRA 2X0HA 4ISSA 2MOZA 4EB6E 4NIQA 2LSYA 2O4VA 2X9HA 3TLUA 4IE7A 2ZLYA 1AJ3A 1NWMX 3SFEA 5JDNA 4RJXA 1G8XA 2W4XA 2ZM2A 2WZHA 4AQFC 3HKEE 2YDRA 2I0MA 3OBVE 3PRNA 3RH3A 3C4ZA 5JDFA 4PK6A 5JDLA 4JI3T 3NJTA 1D0ZA 2E8IA 5JDGA 4GK5E 4N78D 2YOEA 3WI4A 1MIYA 2QTKA 3LK42 2LOSA 4JEHB 4IL6O 1E2AA 5AFUL 2XQ7A 1Q9FA 1HFAA 4N75A 1P4TA 4DV0T 3AXJA 5LCYA 4DV2T 3AAIA 3Q5WA 5CA0E 2VKHA 1MM4A 5LG4A 4QH4A 5HWYA 2G0UA 3PU3A 1MMDA 4DR1T 1IZNB 2EHOC 4ZI2D 4YHJA 4GOUA 5HEHA 4ILAA 4BAYB 3IBPA 1IBKT 2XQ4A 3PUZF 4HE8A 2JPFA 2L3LA 4DMVA 2RP4A 2XM1A 3ZMZB 4DMWA 3ZT6A 4DV5T 2PG8A 4UR9A 3VE2A 4KR4A 4D64A 2YEVC 3AE8A 2BS2A 3NBXX 3ZT5A 2ZFGA 3P7IA 1J5WA 4EYYR 2JQKA 2Z6EA 5HEUA 3PQSA 5DQWA 5E0OA 2N2LA 5FVNA 3AVRA 4TV8E 3FB2A 1DU2A 2IWVA 4ILUA 3DTOA 1NAFA 2LRKA 2LEHA 1VOMA 2BVLA 5EK3A 3KV5A 2VKOA 3NWIA 2BKNA 2VKJA
chains in the Genus database with same CATH topology
1IJ6A 2C5JA 1ZEEA 4QX7B 2MBGA 3KV6A 2LE8A 4HEAA 4UELA 3ZMUB 4EOZB 2N2MA 3MJXA 2X9YA 4G2AA 3K3QC 4AKLA 4EZHA 1HXTA 1OPFA 2FGQX 3VZWX 3N2OA 3IHRA 2M07A 1CUNA 2YU2A 1PHOA 4D65A 2OA5A 3N2GE 1SHZC 3F2EA 3PU8A 5HXEA 2NTYA 3NZPA 5LYJE 3LFMA 2XASB 2W80C 2H7VC 3ZLIA 2V7KA 2KXPA 1MPFA 5IHYA 1MM5A 4RL9A 3C51A 1X79A 1D1CA 4H9QC 2X9WA 4ISTA 4O4HE 4EYUA 2B1EA 3WAKA 4GHBA 3KDSE 3RYIE 3SRZA 2ODUA 3GP6A 3SS1A 5JH7E 3QC9A 2XE5A 2JRKA 1HX8A 2WBLA 3EDUA 4FT6A 1VRBA 4X1KE 2LSJA 4U72A 3SOLA 2CLYC 2KC0A 5GONE 2WMOA 4OFZA 1H7CA 2IAKA 3AA6B 3UULA 5FNVE 4ADZA 3SZVA 3E0ZA 3UPGA 3POQA 3KBUA 5EK4A 4FZLA 5LJNA 4ZHQE 2YNKA 5M4YA 3ZYLA 3RYFE 3LK2B 5J2UE 3LK3A 3NZQA 4UVBB 4HN9A 3HA4A 3LK41 5LHGB 2KINB 2D2SA 5FY7A 3ZPOA 1UX4A 4OYJA 1ZHZA 3AAEA 1LKXA 4JCHA 2Q9QD 3AAAB 3FHNA 1MMNA 4FSPA 4O4XA 3FBZA 5GV0A 3HKCE 1WYCA 4X20E 1E54A 3VY9X 5H6QB 3O0EA 3POXA 2BVMA 5LGNB 4E1SA 2L8KA 4P09A 5JDMA 4HTEA 3LBXB 5LGUB 1WRDA 3PDYA 1HS7A 2V7LA 1FEWA 3Q9DA 2X27X 4D5UA 2CA5A 5L3DB 3VU7H 3A5XA 2NWBA 4PK4A 4OK0A 2CM0A 3OYZA 5ADXK 2F1VA 1OXZA 2HPLA 3MACA 4UEMA 3AA1B 3ETUA 3H3AA 1HXUA 3RBHA 4UF0B 5LJMA 3IF8B 3GWHA 4H63V 2MYSA 4B61A 3HI2A 1HTJF 3HOEA 1FMWA 3V5UA 5JRCA 3POUA 2CWYA 4CXXA 2CXLA 5LGTB 2YU1A 3E08A 3UU2A 3MXZA 3QRCA 2VB6A 1QJ9A 4O4UA 4UIGA 3D0TA 2D0TA 2C5KT 2Y7SA 4FMSA 3ZYKA 3ZMTB 2JJ9A 3KVAA 4OHFA 2JMKA 3I1AA 2KLQA 2X67A 3FBLA 2FGRA 5G26A 5HAXA 4CI1B 3KINB 4LSIA 1D0XA 4TZ4C 5FY0A 5L3BB 2ZMAA 3NRYA 4JFBA 4AKMA 4PUXA 4F4BA 2XE1A 3N9OA 3BQKA 2MHLA 2X9XA 1UCUA 3C64A 2W00A 2IW5B 3FXEB 5KX5E 2VKDA 4OYKA 2UXNB 2I59A 5JR9A 4KR8A 3EUHA 3AA0A 1S35A 4MBQA 3ZJ1A 1MMGA 2XE2A 4O3YA 4O4IE 4PK5A 1ZV4X 4ZI2C 2KNDA 4QXBB 3HWBA 3ZYMA 5HXHA 3N9PA 3PQUA 2V7JA 3LG7A 4YFSA 1IZNA 3HKBE 5LXTE 1ZHCA 3AB3B 7PRNA 1YKHB 3S4UA 3CQGB 2KMFA 3C98B 4U9CA 4UVCB 4TX5A 2LJLA 3FXDB 2V7IA 3CVRA 4PAGA 4PJJA 4UXNB 3PUQA 5JR9C 2M06A 5L2LA 3CMLA 2DCFA 4IE4A 3OYXA 4IGUA 2MNHA 4PFPA 3RRWA 1MIWA 4X1YE 2GK9A 3I9YA 1QJPA 4IIJE 2ZLDA 4H9OC 3QUJA 4MLKA 4BA9A 3GN5A 4AKHA 4BUMX 3PUAA 2LHRA 3MZKB 5DABA 1OSMA 3C4XA 4PW8A 5DL8A 4L9IA 1T98A 2CE7A 4XZCA 3P8CD 4ZOLE 5L3FB 4O49A 5DL5A 5JDHA 2K48A 4JUYA 4P0BA 3C4WA 3PURA 3RYCE 1ZHTA 3CWZB 1HG5A 2EHOB 2RA1A 4DO0A 3ZN1B 2DWKA 1IAPA 3M65A 2KWHA 4GCQA 3EDVA 2Q9QB 1HCIA 2PBIA 2VKJA 5IYUA 3N9NA 3N9MA 5FXXA 4RLCA 4CI3B 3UUMA 1GFQA 3UTKA 1G73A 2H7OA 4I50E 3Q5XA 4IHJE 3NSGA 1BT9A 4AQGA 1YW0A 3KFWX 4AUIA 1FIOA 2CEAA 4FRTA 3JC6D 4IE6A 5LNKA 4AKRB 3DA4A 2Y8DA 5DL7A 2LT3A 1WYBA 2H3RA 3ONXA 4DBQA 2UXXB 2PORA 2XE3A 5AFUK 3DA3A 1BR1A 3RPUA 1O3XA 2K9AA 3QRAA 4EAHA 5BMVE 3BK9A 3SYBA 1LRZA 1QSDA 2EHOD 3T0SA 4E1TA 2XAFB 2JMMA 2ZM0A 4QHOA 2NOXA 4UV8B 3ZN0B 2OMFA 3B57A 1YD8G 4NUVA 2LM9A 4ZS2A 2LOPA 5L3GB 1D1AA 2Y0KA 1GFNA 1GFOA 2ZM8A 2CMRA 2XAGB 3ZC1A 4QXCB 4YJ3E 2LHFA 2P9BA 3C50A 3OKQA 5LOVE 5FY1A 2WSSV 3N9LA 5FXWA 4I55E 2F1TA 1IJ5A 3C5OA 2GE4A 5JDQA 3UAQA 3O1JA 2XMXA 4KRAA 6PRNA 2D5UA 2A2FX 3K19A 2X51A 1EZ3A 3HL6A 4AI6A 2NW7A 2K4TA 2WWUA 1V9DA 3UUXB 5KDMC 3RYHE 4FUVA 5HXRA 4DBRA 1MNEA 2KZ7B 4TN7B 2WAUA 2E9XB 3U78A 3RC3A 4N58A 3L3PA 4RLBA 4WW0A 2Y0HA 2X68A 4JLEA 2K0LA 1ZHYA 4QQ1A 2BZBA 3ANWB 1MMAA 3VY8X 5D5DA 4YLHA 4V1Av 4C90A 3SYSA 3AA6A 2W63A 2K24A 3E22E 4GIWA 5FMNA 3RRCA 4ERRA 2DLRA 2KT9A 1QJ8A 4GCSA 4O3WA 2CXFA 2PFVA 1BR0A 4H9PC 3W15B 2CWOA 1ORMA 1YS5A 3LK2A 4AYDC 1SA0E 3CPZA 2ODJA 3Q2MA 3WI3A 3KVBA 3MK7C 2Y2XA 4AKGA 1MIVA 3RC8A 2W81C 5ADXL 2MTQA 3ZCJA 5JVDE 5L3EB 3UUNA 8PRNA 4O3ZA 2X0LB 2XTLA 4IDZA 5LHHB 5KMGP 2E9XD 2Y48B 4UV9B 3AAAA 1BH3A 3MA9A 3SY9A 3RX6A 4E7SA 5HXCA 5FXZA 2VK9A 2ERVA 2NTXA 4TUYE 1KK7A 3IEEA 5F3JA 2Y0LA 4U74A 3KV9A 4E7ZA 3NRXA 4FJOA 2L9QA 3AVSA 2J1DG 2NW8A 4CXYA 4AYID 3AA7B 3TZGA 2DHRA 3H37A 2VL8A 3I9WA 4L5GA 4AZLA 5ETWA 2XAHB 5CA1E 4C69X 4XNLA 3CX8B 1GFMA 3N5LA 4H63H 4EZ4A 2NP9A 4A56A 3I0OA 4PFOA 2JQQA 3AA1A 4UF0A 5LA6E 3HR0A 3KBTA 3GA8A 4O8SA 2CLYB 4M1PA 3CKDA 3F57A 4QWNB 3VE1A 5C8YE 3R84B 4AYNA 5DQVA 4H9NC 4UVAB 2KXPB 4WBOA 3V5SA 4H9SE 1WLXA 4CQIA 3PORA 3N9QA 3VZUX 4KP3C 4FSOA 3N2KE 4KUMB 4GF4A 4C91A 4ZI3C 4FZMA 1Q9GA 2LSGA 4HFVA 4PJNA 4PNIA 3T8OA 4G76A 2LSIA 3J7Yq 1KNZA 3DP7A 1BR4A 3PE0A 1THQA 4EXTA 2VWAA 2YPVA 4O2AE 3GMIA 3HKDE 5PRNA 4ASKA 2V26A 4I43B 3T24A 5J1GA 1WR6A 4AQFA 2W0GA 5HXSA 2D0UA 4MALA 2A3DA 5JDPA 2C0SA 4ISSA 2MOZA 4EB6E 3BQIA 3CX7B 2W61A 4CZZB 3HOLA 1HG2A 3LK3B 1OWAA 2LSYA 3CX6B 2X9HA 2O4VA 3CQXC 2CCQA 4MFRA 4IE7A 2ZLYA 1G90A 1AJ3A 5TAOA 3AAEB 1NWMX 5JDNA 4B6XA 2J1NA 4RJXA 1G8XA 2ZM2A 1D1BA 2WM9A 2BDEA 4QKNA 4QXHB 3WI5A 3O1HA 3L09A 5EZYE 2CXDA 4HGAA 4AQFC 1H6S1 4JEUB 1B7TA 3HKEE 4O3XB 4XNKA 3TKLB 4FOZA 3OBVE 3PRNA 3RH3A 5JQGE 3C4ZA 5JDFA 1HXXA 4N59A 5HWXA 3T20A 4PK6A 5JDLA 3O4XE 1D0ZA 2E8IA 3ESLA 5EE2A 1US7B 5JDGA 4GK5E 4N78D 5JRCB 4CI2B 4YJ2E 3WI4A 1ZHXA 1MIYA 1MNDA 4IE5A 3LK42 4X1IE 5F8PA 2QTKA 2IC9A 2XTRA 4LSFA 3ETVA 4WNKA 4O4JE 5JREA 2N1GA 2LOSA 3O9XA 4JEHB 5A1LA 4GYRA 3A2SX 4AYMC 4BJNA 3SZDA 3G7GA 5AFUL 3K3NA 2EHOA 4J2CA 4AXPA 3SY7A 1Q9FA 1Z0PA 1HFAA 1HF8A 1S94A 2LFUA 2XAJB 2XHEB 1P4TA 5LCYA 2Q9QA 4TV9E 2QA7A 4L0RA 3AAIA 3F31A 3K3OA 2SPCA 2VKHA 3PUGA 3Q5WA 5CA0E 3JC6C 5JR9B 1MM4A 5LG4A 3AA0B 3PUSA 2XAQB 1ZHWA 3FYXA 4GCPA 3ZC0A 4DNDA 3WAJA 1D0YA 5HWYA 2G0UA 3EMNX 5DJQC 4QX8B 4FESA 2ODVA 3PU3A 4IE0A 4AKRA 3VZTX 1MMDA 4I4TE 2LSKA 3CQCB 1IZNB 2EHOC 4DVDA 1U5PA 4LSEA 4ZI2D 4FZNA 3LJCA 4YHJA 4GOUA 4KMCA 5FXVA 3ZJ2A 4RJWA 1Y64B 5LP6E 2Q9QC 3KVDD 4O2BE 2NW9A 3KV4A 2V1DB 3IBPA 3ZMVB 2V7MA 4BAYB 2J4UP 4XAXB 2HPJA 5LBQB 3BQLA 3PTRB 3ZMSB 4LSHA 4HE8A 2JMHA 2JPFA 3MKDA 5IYZE 5L3CB 4AYEC 4GK0E 3VHLA 2L3LA 4DMVA 1LVKA 2RP4A 3LBXA 5H6RB 3ZMZB 1BR2A 3GN5B 1LVFA 3OJAA 4PJMA 4DMWA 2YK0A 4ZI7E 4XBFB 4FI5A 4ZI3D 3JTYA 2PG8A 4WBNE 1ZKEA 4G75A 5FP3A 1QUUA 2M67A 3I0QA 4O4LE 5FYMA 5CB4E 3R6NA 1E1HB 4Z3TA 4NUUA 3VE2A 4H9RC 4KR4A 5LHIB 3O1IA 1FMVA 3K8PC 3ZCIA 1GFPA 4AKIA 2KZ7A 4D64A 2YEVC 2E9XA 1YKEB 3NBXX 2XG6A 2K5BB 4K0UA 2PRNA 3P7IA 2ZFGA 3ANWA 3HW9A 3V8UA 5HYAA 4BJMA 2DI4A 2YINA 3VKGA 3UFEA 2X66A 2W62A 4KBMB 2Z6EA 4EYYR 1PRNA 2A72A 2DWGA 2ACXA 3PQSA 4FRXA 2KWIB 2XTQA 5DQWA 2Y6XA 5LBMA 3VKHA 5EK2A 2IC6A 5E0OA 2N2LA 5FVNA 3AVRA 4TV8E 3ZEFB 3FB2A 2N2NA 4HKAA 5T5FA 3EVYA 2DNXA 2LHNA 2VASA 4G63A 4MHCA 4ILUA 2E9XC 2HH7A 3DTOA 5DL6A 4P0AA 2ES0A 4CXWA 2C5IT 4Z8XA 1NAFA 2KDYA 1U4QA 3QK6A 3RKOA 4ANJA 5J2TE 4AFKA 2LEHA 3U3IA 1VOMA 2BVLA 3DJBA 1UX5A 2XQYA 4PJLA 5EK3A 2PJQA 4ZS3A 4F6RC 2XUEA 3KV5A 3SWHA 2QGSA 2N9DA 3UT5E 4EIWA 3J9X1 2WMNA 1BXWA 2VKOA 3AA7A 4GYSA 3B13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AA7 B;  3AA6 A;  1IZN A;  4AKR A;  3AA6 B;  1IZN B;  4AKR B;  3LK2 A;  3AA1 A;  5AFU K;  5AFU L;  5ADX K;  2KXP A;  3LK2 B;  3AA1 B;  2KZ7 A;  5ADX L;  3LK3 A;  2KXP B;  3AA7 A;  2KZ7 B;  3LK3 B;  3LK4 1;  3AAA A;  3AAE A;  3AA0 A;  3AAA B;  3AAE B;  3LK4 2;  3AA0 B; 
#chains in the Genus database with same CATH topology
 1IJ6 A;  1ZEE A;  2MBG A;  3ZMU B;  3MJX A;  3K3Q C;  3VZW X;  2R4O A;  2M07 A;  1CUN A;  2OA5 A;  2W80 C;  5HXE A;  2XAS B;  2KXP A;  1MPF A;  1MM5 A;  4X65 T;  3AEC A;  3C51 A;  3Q5E A;  3WAK A;  3A7M A;  4GHB A;  2ODU A;  3SS1 A;  3QC9 A;  1VRB A;  4OX9 T;  4JI4 T;  2KC0 A;  3SZV A;  4DR3 T;  4ZHQ E;  4HWH A;  5J2U E;  3A0B O;  3G06 A;  3NZQ A;  1N34 T;  5FKY A;  5LHG B;  3ZPO A;  1UX4 A;  4OYJ A;  1ZHZ A;  4JCH A;  4TWH A;  3VR9 A;  5LGN B;  4P09 A;  4YTM A;  1HS7 A;  1FEW A;  3Q9D A;  4D5U A;  4JI1 T;  4PK4 A;  2XJ7 A;  2CM0 A;  3OYZ A;  1OXZ A;  3MAC A;  3AA1 B;  3ETU A;  3H3A A;  3AE4 A;  2IHR 1;  1HTJ F;  4LF6 T;  1HR0 T;  5JRC A;  2XQ9 A;  4DV4 T;  5FL0 A;  3MXZ A;  1QJ9 A;  3RF1 A;  2C5K T;  3ZYK A;  5LG3 A;  3ZMT B;  1KNR A;  3I1A A;  3FBL A;  5G26 A;  2LRL A;  4LSI A;  3AEB A;  4AKM A;  4PUX A;  3BQK A;  5CFB A;  3NVO A;  5JR9 A;  5AQF B;  3PGR A;  4DV1 T;  4MBQ A;  3ZJ1 A;  2KND A;  4N74 A;  4K0K T;  2V7J A;  4YFS A;  3HKB E;  3AB3 B;  1YKH B;  3CQG B;  2CRB A;  3AEG A;  2LJL A;  4HFE A;  2YDS A;  4X64 T;  4PAG A;  4TWF A;  3OYX A;  4F8H A;  3JCF A;  3I9Y A;  4IIJ E;  2ZLD A;  2VL0 A;  2XPK A;  4BUM X;  2J4G A;  3VRA A;  1L0V A;  1KFY A;  4O49 A;  5L3F B;  5DL5 A;  2R6G F;  1HG5 A;  2RA1 A;  1J1J A;  3CIR A;  2Q9Q B;  3ZT7 A;  4B3T T;  2CBI A;  2A9U A;  2H7O A;  3RQW A;  3PGU A;  4AQG A;  2IML A;  1Y01 A;  2CEA A;  5DL7 A;  1WYB A;  2H3R A;  5AQT B;  4DBQ A;  2XE3 A;  2POR A;  3SYB A;  1QSD A;  1M7K A;  2ZM0 A;  3B57 A;  4NUV A;  4ZS2 A;  1W0A A;  1GFN A;  4CN1 A;  4QXC B;  2AXT O;  5LOV E;  4I55 E;  2F1T A;  1IJ5 A;  2GE4 A;  4EGW A;  3EHZ A;  2M6I A;  2NW7 A;  2WWU A;  3RYH E;  2KZ7 B;  4IL4 A;  4ZZC A;  2WAU A;  2E9X B;  3U78 A;  3L3P A;  2Y0H A;  4LFC T;  1MMA A;  2JQ9 A;  2RPA A;  1ZOY A;  3AA6 A;  4ERR A;  2K24 A;  1QLB A;  3P4P A;  2KT9 A;  5HEG A;  4IT4 A;  3CPZ A;  3BRY A;  3WI3 A;  3KVB A;  4AKG A;  5ADX L;  3UUN A;  2XTL A;  4UV9 B;  1BH3 A;  3VRB A;  4GKK T;  2ERV A;  3FZM B;  2Y0L A;  3IEE A;  3ABV A;  4E7Z A;  5AQS B;  2L9Q A;  3AVS A;  2J1D G;  3AA7 B;  3ONL C;  3TZG A;  3I9W A;  4GKJ T;  3PJA A;  4AZL A;  4JI6 T;  4XNL A;  4N58 A;  4O8S A;  2CLY B;  5AQM B;  5DQV A;  2VQF T;  4JV5 T;  4EEB A;  2JQY A;  3T8O A;  3J7Y q;  3AE1 A;  2R4L A;  1OED E;  5PRN A;  4Z90 A;  1W9R A;  1HNZ T;  1W09 A;  1WR6 A;  4AQF A;  4MAL A;  2V8S V;  2VUR A;  3BQI A;  3HOL A;  4DV3 T;  3LK3 B;  5AQJ B;  1OWA A;  4LF7 T;  5TAO A;  3AAE B;  4B6X A;  3WI5 A;  2BDE A;  3O1H A;  1H6S 1;  4HGA A;  2X9K A;  2LM2 A;  3T20 A;  4NPP A;  3O4X E;  3ONJ A;  3ESL A;  5H2F O;  1US7 B;  4YTN A;  4CI2 B;  2XM2 A;  4JI5 T;  2E5V A;  2JQH A;  4IE5 A;  2XTR A;  4LSF A;  2IC9 A;  3ETV A;  2N1G A;  4U7I A;  1OED B;  3SFD A;  2EHO A;  4B3S T;  4J2C A;  4AXP A;  4C4V A;  1Z0P A;  2XAJ B;  2XHE B;  4TV9 E;  4IDO A;  4TNW A;  3PUG A;  3JC6 C;  3AA0 B;  3PUS A;  4GCP A;  5GTI O;  3UU6 A;  5DJQ C;  4QX8 B;  3EMN X;  2ODV A;  4IE0 A;  4U3C A;  4I4T E;  4B3M T;  4LSE A;  1T8B A;  4FZN A;  2B76 A;  4KMC A;  5FXV A;  3ZJ2 A;  2Q9Q C;  3AEA A;  4O2B E;  2V1D B;  2J4U P;  4XAX B;  4LSH A;  2YN6 A;  4GK0 E;  3PUY F;  5AQH B;  4PJM A;  4ZXL A;  2YK0 A;  3JTY A;  4G75 A;  4U2Y A;  5FYM A;  2XQ8 A;  4Z3T A;  4H9R C;  2HN2 A;  3RIA A;  1FMV A;  4IRE A;  1GFP A;  4AKI A;  3PUV F;  1YKE B;  4K0U A;  1R8I A;  2PRN A;  3ANW A;  3HW9 A;  5HYA A;  2DI4 A;  2YIN A;  3VKG A;  2A72 A;  4FRX A;  2XTQ A;  2Y6X A;  2AXD S;  2V5C A;  1T7S A;  1UK5 A;  2DNX A;  2LHN A;  2VAS A;  4G63 A;  4MHC A;  2E9X C;  5DL6 A;  4P0A A;  4CXW A;  2C5I T;  4Z8X A;  2KDY A;  1CHU A;  1U4Q A;  3RKO A;  5J2T E;  1HNX T;  3DJB A;  2PJQ A;  4ZS3 A;  3SWH A;  2QGS A;  2N9D A;  2WMN A;  3B13 A;  4LF5 T;  5IUX A;  2LE8 A;  4EOZ B;  3RKG A;  4AKL A;  2X9Y A;  1OPF A;  5AQR B;  3IHR A;  4U2Z A;  4D65 A;  3JCU O;  1SHZ C;  2WS3 A;  3F2E A;  2WJQ A;  2H7V C;  3ZLI A;  4LMJ A;  2WVP A;  5JTG A;  2UUC T;  3GP6 A;  2JRK A;  1UGO A;  4FT6 A;  4U72 A;  3SOL A;  2CLY C;  2XQ6 A;  2WMO A;  1H7C A;  4ADZ A;  4CN6 A;  5FNV E;  5EK4 A;  1XMQ T;  2YNK A;  3RYF E;  4FQE A;  4UVB B;  2OV9 A;  2D2S A;  1LKX A;  2Q9Q D;  3AAA B;  4YXD A;  1WYC A;  4COF A;  3O0E A;  4KHZ F;  4WZX A;  5JDM A;  4HTE A;  2F1C X;  3WU2 O;  1WRD A;  5L3D B;  3VU7 H;  3ZKR A;  5ABF B;  2HPL A;  1HXU A;  2BBJ A;  3AEE A;  3GWH A;  4YT0 A;  2MYS A;  3HOE A;  4CXX A;  2WU5 A;  2YU1 A;  1ZP0 A;  2VB6 A;  4FMS A;  2JJ9 A;  4OHF A;  2KLQ A;  2X67 A;  2FGR A;  3ZST A;  1D0X A;  4JFB A;  1KF6 A;  2ZMA A;  5KXJ A;  4F4B A;  2R8A A;  3N9O A;  3RI5 A;  2MHL A;  2X9X A;  2BS3 A;  2W00 A;  3C64 A;  3DZM A;  3RQU A;  1S35 A;  2BKP A;  2QVA A;  2XE2 A;  4O3Y A;  4O4I E;  4QXB B;  3ZYM A;  1OED C;  1IZN A;  1XDP A;  5LXT E;  7PRN A;  2R88 A;  4UVC B;  3UQ4 A;  3CVR A;  2FJB A;  3PUQ A;  4ZZB A;  2M06 A;  5L4H A;  2MNH A;  3RRW A;  4UB8 O;  4X1Y E;  5FVK A;  4MLK A;  4AKH A;  3P4W A;  3PUA A;  5DAB A;  1T98 A;  3Q5D A;  2V6Y B;  3TLT A;  4XZC A;  4JUY A;  3CWZ B;  4K3C A;  3IA3 A;  4JI7 T;  3AE5 A;  3M65 A;  2KWH A;  5IYU A;  3N9M A;  4RLC A;  4CI3 B;  3UTK A;  3Q5X A;  4IHJ E;  1YW0 A;  4FRT A;  4IE6 A;  5LNK A;  4AKR B;  2Y8D A;  2UXX B;  5AFU K;  3QRA A;  2W2U A;  3BK9 A;  2WB5 A;  2EHO D;  3RGL A;  3T0S A;  4QHO A;  4UV8 B;  2R89 A;  3LSV A;  2VQE T;  2UUB T;  1NEK A;  4ILC A;  2CMR A;  1XWM A;  2P9B A;  3C50 A;  3OKQ A;  1HNW T;  5FY1 A;  2XSB A;  2E2A A;  3O1J A;  2XMX A;  2D5U A;  2A2F X;  4AI6 A;  5KDM C;  4FUV A;  3AE9 A;  4DBR A;  3RC3 A;  5HCM A;  4JI2 T;  3CK6 A;  2K0L A;  4JYA T;  2BZB A;  2ACZ A;  4AIS A;  5D5D A;  2W63 A;  3E22 E;  4GIW A;  5FMN A;  3RRC A;  2DLR A;  4GCS A;  4O3W A;  2CXF A;  4A97 A;  2PFV A;  1BR0 A;  4LF9 T;  3JAE A;  4LFB T;  1YS5 A;  3Q2M A;  4Z91 A;  3TLV A;  3RC8 A;  2W81 C;  8PRN A;  4O3Z A;  4IDZ A;  2OLT A;  5KMG P;  3MA9 A;  3RX6 A;  4E7S A;  5IWA T;  5FXZ A;  4TUY E;  1S5L O;  3UFG A;  4CXY A;  5B5E O;  5CA1 E;  5AQG B;  1GFM A;  3N5L A;  4EZ4 A;  4A56 A;  3I0O A;  3AA1 A;  2JQQ A;  5AQI B;  4M1P A;  4QWN B;  1W0B A;  3R84 B;  4UVA B;  1WLX A;  2J47 A;  1XZY A;  2H88 A;  4ZEY A;  3N9Q A;  4FSO A;  4JI8 T;  4C91 A;  4FZM A;  4HFV A;  4PJN A;  3UU3 A;  4G76 A;  2QYW A;  1BR4 A;  5J0Z A;  2V26 A;  5ABG A;  1Z8U A;  4U7Y A;  2X0Y A;  2W61 A;  2WP9 A;  2WDR A;  1HG2 A;  5CGM A;  4DUZ T;  3ZSS A;  1GQE A;  3CQX C;  5TIS O;  4MFR A;  2FUP A;  3EI0 A;  2J1N A;  1N36 T;  2JIW A;  4QXH B;  5EZY E;  2CXD A;  2WQY A;  4DR2 T;  4JEU B;  1B7T A;  4O3X B;  2WDV A;  4XNK A;  4FOZ A;  2PTF A;  5AQQ B;  5JQG E;  5HWX A;  4YSY A;  3OTO T;  2BG9 E;  4YJ2 E;  1ZHX A;  1MND A;  5F8P A;  4HFB A;  4X1I E;  3PF1 A;  4O4J E;  3O9X A;  5A1L A;  3PJA J;  3A2S X;  3QB5 A;  5CJ5 A;  1T72 A;  4BJN A;  3G7G A;  5LMU T;  5FVL A;  3UU8 A;  1HF8 A;  1E7P A;  1S94 A;  2LFU A;  3PUW F;  2Q9Q A;  2QA7 A;  3OVU A;  4L0R A;  3FYX A;  3ZC0 A;  4DND A;  3WAJ A;  4FES A;  1WCR A;  3VZT X;  3CQC B;  4DVD A;  1U5P A;  4UB6 O;  1Y64 B;  5LP6 E;  3KVD D;  2NW9 A;  3KV4 A;  2WY2 A;  2V7M A;  2HPJ A;  5LBQ B;  3BQL A;  3PTR B;  2IWW A;  2JMH A;  4WYV A;  3MKD A;  5IYZ E;  5L3C B;  3VHL A;  2BG9 B;  3LBX A;  3GN5 B;  1LVF A;  3EAB A;  5C2T A;  4ZI7 E;  4FI5 A;  1ZKE A;  5FP3 A;  3R6N A;  1E1H B;  5LHI B;  3O1I A;  1WFD A;  3K8P C;  3ZCI A;  2KZ7 A;  2E9X A;  4BJM A;  1PRN A;  1XNQ T;  3AEF A;  2W62 A;  2ACX A;  5LBM A;  2IC6 A;  1YQ3 A;  2N2N A;  1X9B A;  4HKA A;  5T5F A;  3EVY A;  2BBH A;  2J62 A;  2WDQ A;  2ES0 A;  4Q25 A;  3UU4 A;  3EAM A;  1N33 T;  3QK6 A;  5KAI O;  1UX5 A;  3JAD A;  3UT5 E;  3VR8 A;  4EIW A;  1BXW A;  3AA7 A;  3DWN A;  4QX7 B;  3KV6 A;  4HEA A;  4UEL A;  2N2M A;  4EZH A;  2FGQ X;  4HWC A;  3N2O A;  1PHO A;  3N2G E;  4I0U A;  3PU8 A;  3NZP A;  5LYJ E;  3LFM A;  4A98 A;  4RL9 A;  1X79 A;  1D1C A;  4H9Q C;  4IST A;  3P4R A;  4O4H E;  3KDS E;  4EV6 A;  3SRZ A;  2UXC T;  2XE5 A;  2WBL A;  3DWO X;  4ILB A;  4X1K E;  2LSJ A;  4OFZ A;  5AQV B;  3UUL A;  3UPG A;  3E0Z A;  5LJN A;  2WJR A;  3LK2 B;  3LK3 A;  3NKZ A;  3LK4 1;  2KIN B;  3AAE A;  4LMK A;  2E5L T;  1MMN A;  4FSP A;  3FBZ A;  3HKC E;  3FZF B;  3VY9 X;  4E1S A;  4PR7 A;  2L8K A;  5LGU B;  2V7L A;  4HFI A;  2X27 X;  2CA5 A;  2NWB A;  2M6B A;  4OK0 A;  5ADX K;  3FZK B;  3RBH A;  4UF0 B;  4H63 V;  4K3B A;  3V5U A;  3POU A;  2CWY A;  2CXL A;  3UU2 A;  4DR4 T;  2DL1 A;  4UIG A;  2D0T A;  2Y7S A;  3OPC A;  1FJG T;  1JNZ A;  3H3M A;  2W67 A;  2NR4 A;  5HAX A;  3KIN B;  5AQP B;  3RIU C;  4TZ4 C;  1HX1 B;  4TNV A;  1OED A;  5L3B B;  3NRY A;  2K3W A;  2XE1 A;  5KX5 E;  2VKD A;  4OYK A;  2I59 A;  3AA0 A;  3JAF A;  5KAF O;  1MMG A;  3AE3 A;  1ZV4 X;  4ZI2 C;  3HWB A;  5HXH A;  3N9P A;  3P4Q A;  2WWV A;  3LG7 A;  3PQU A;  5HEO A;  2KMF A;  3C98 B;  3FXD B;  2FJE A;  4PJJ A;  3QB5 K;  4IE4 A;  4IGU A;  2GK9 A;  1QJP A;  4BA9 A;  1T16 A;  5HEJ A;  2LHR A;  3MZK B;  5ABH A;  1I94 T;  1OSM A;  3C4X A;  4L9I A;  2CE7 A;  2FBW A;  4X66 T;  5JDH A;  2K48 A;  3C4W A;  3RYC E;  3TLW A;  2BG9 C;  4DO0 A;  2DWK A;  1IAP A;  3AXJ B;  2PBI A;  3N9N A;  5FXX A;  3UUM A;  5HCJ A;  1GFQ A;  1G73 A;  1WR0 A;  4I50 E;  2W66 A;  2WCA A;  3KFW X;  4AUI A;  1FIO A;  3JC6 D;  3DA4 A;  2LT3 A;  2XQ3 A;  1O3X A;  1YQ4 A;  4EAH A;  2JMM A;  2NOX A;  3AE6 A;  4DR7 T;  1YD8 G;  2LM9 A;  2LOP A;  5L3G B;  1D1A A;  2Y0K A;  5AQO B;  3ZC1 A;  2V5D A;  4YJ3 E;  2LKG A;  3N9L A;  3UAQ A;  4KRA A;  6PRN A;  3K19 A;  2K4T A;  3QOF A;  1V9D A;  2CHN A;  5HXR A;  1MNE A;  4TN7 B;  4WW0 A;  2FJD A;  1XNR T;  1ZHY A;  4QQ1 A;  3VY8 X;  4YLH A;  3RLF F;  4HFD A;  4V1A v;  4H9P C;  1ORM A;  2CWO A;  1SA0 E;  4DV6 T;  3MK7 C;  2Y2X A;  2V6X A;  4CTD A;  1MIV A;  2FJA A;  4LFA T;  3ZCJ A;  5JVD E;  5L3E B;  2X0L B;  3UQ7 A;  2E9X D;  3AAA A;  4CN4 A;  2I6H A;  3FZH B;  2BS4 A;  2NTX A;  5LMN T;  1XDO A;  2NW8 A;  3P50 A;  2DHR A;  3H37 A;  5ETW A;  3T1H T;  3CX8 B;  5ABF A;  4PFO A;  3KBT A;  3GA8 A;  3VE1 A;  3F57 A;  4AYN A;  4IL9 A;  5G39 A;  4H9N C;  2KXP B;  4WBO A;  3V5S A;  3POR A;  3KZI O;  2F4V T;  4GF4 A;  4ZI3 C;  3P4S A;  5AQU B;  2LSG A;  4PNI A;  3PE0 A;  5LB7 B;  1THQ A;  4EXT A;  4DV7 T;  3GMI A;  5J1G A;  5GTH O;  2W0G A;  2A3D A;  5JDP A;  2C0S A;  5AQL B;  3CX7 B;  4CZZ B;  3CX6 B;  2CCQ A;  2IUB A;  1KNP A;  3TLS A;  2UUA T;  1G90 A;  2CHO A;  1D1B A;  2WM9 A;  4QKN A;  3L09 A;  2XZE A;  1IBM T;  3TKL B;  1HXX A;  4N59 A;  4LML A;  4KHP T;  5E79 O;  5EE2 A;  5JRC B;  1UUS A;  4IDN A;  4WNK A;  5JRE A;  5L47 A;  4GYR A;  2V6Y A;  4AYM C;  2CPT A;  3SZD A;  2IDO B;  2AE9 A;  3K3N A;  3SY7 A;  2LKH A;  3F31 A;  3K3O A;  2SPC A;  4KX6 A;  5JR9 B;  1ZHW A;  2XAQ B;  3BRZ A;  1D0Y A;  5AQK B;  4HFH A;  4AKR A;  2LSK A;  4IDP A;  3LJC A;  3AE7 A;  4RJW A;  5ABE A;  3QNU A;  4LF4 T;  3ZMV B;  1VCS A;  3ZMS B;  2HN1 A;  2ZM6 T;  2HHH T;  4AYE C;  1LVK A;  1IBL T;  5H6R B;  3VZU X;  1T1L A;  1BR2 A;  3OJA A;  4XBF B;  4X5T A;  3BS0 A;  4ZI3 D;  4WBN E;  1QUU A;  2M67 A;  3I0Q A;  4O4L E;  5CB4 E;  4NUU A;  4DR6 T;  3UU5 A;  2XG6 A;  2K5B B;  3V8U A;  3UFE A;  2X66 A;  5FL1 A;  4KBM B;  2DWG A;  3RIF A;  5G3A A;  2KWI B;  2WU2 A;  3VKH A;  5EK2 A;  3ZEF B;  2UXB T;  2HH7 A;  2UU9 T;  5AQN B;  4ANJ A;  4AFK A;  3FZL B;  3U3I A;  2XQY A;  4PJL A;  4F6R C;  2XUE A;  4JI0 T;  3J9X 1;  2XQA A;  5GON E;  4GYS A;  2C5J A;  4PJ0 O;  3AE2 A;  4G2A A;  1HXT A;  4KI0 F;  2YU2 A;  2LLY A;  3L39 A;  3L8R A;  2NTY A;  1KEY A;  2V7K A;  5IHY A;  2X9W A;  4EYU A;  2B1E A;  2VVN A;  3RYI E;  4NXM T;  3M3Z B;  5JH7 E;  1HX8 A;  3EDU A;  3A0H O;  4P1N A;  4AQY T;  2KSR A;  2IAK A;  3AA6 B;  3POQ A;  3KBU A;  4FZL A;  5B66 O;  5M4Y A;  3ZYL A;  1J5E T;  5C3J A;  2UXD T;  4HN9 A;  3HA4 A;  4QH1 A;  5FY7 A;  3FHN A;  4O4X A;  4B3R T;  5GV0 A;  1E54 A;  4X20 E;  5H6Q B;  3POX A;  2BVM A;  3LBX B;  1I6Z A;  1M62 A;  3PDY A;  4U31 A;  4DR5 T;  3A5X A;  4AIU A;  3X1D A;  2XY8 B;  2F1V A;  3RIU A;  4UEM A;  5LJM A;  3IF8 B;  3RHW A;  4B61 A;  4YSZ A;  3HI2 A;  5G38 A;  1FMW A;  5LGT B;  1SE7 A;  3E08 A;  1XMO T;  2R4N A;  3QRC A;  3PUX F;  4O4U A;  3D0T A;  1NEN A;  4YSX A;  3KVA A;  2JMK A;  3A8Y C;  4CI1 B;  5FY0 A;  2QRX A;  1UCU A;  2IW5 B;  4TWD A;  3FXE B;  2UXN B;  2WZI A;  3EUH A;  4KR8 A;  3T1Y T;  4PK5 A;  1VCT A;  3LDQ B;  1ZHC A;  3S4U A;  4U9C A;  4TX5 A;  2V7I A;  4UXN B;  5JR9 C;  5L2L A;  3CML A;  2DCF A;  4PFP A;  1MIW A;  3UUB A;  2BG9 A;  2H89 A;  4H9O C;  3QUJ A;  3GN5 A;  4U33 A;  4PW8 A;  5DL8 A;  3P8C D;  4ZOL E;  4P0B A;  1ZHT A;  3PUR A;  2EHO B;  4C4V B;  4HWD A;  3ZN1 B;  1UUR A;  4JBW F;  4GCQ A;  3EDV A;  1HCI A;  2XQ5 A;  3NSG A;  1BT9 A;  3PGS A;  3ONX A;  4YHH T;  4HFC A;  3DA3 A;  4HWF A;  1BR1 A;  3RPU A;  2K9A A;  5BMV E;  1LRZ A;  2MAW A;  4E1T A;  4YTP A;  2XAF B;  4HWI B;  3ZN0 B;  5L4E A;  1SUM B;  2BKO A;  2OMF A;  4YY3 T;  2MPK A;  2XSA A;  1GFO A;  2ZM8 A;  2XAG B;  1YXR A;  2LHF A;  2WSS V;  5FXW A;  2R4P A;  3C5O A;  5JDQ A;  4X62 T;  2X51 A;  1EZ3 A;  3HL6 A;  4LF8 T;  3UUX B;  4RLB A;  3PV0 F;  2X68 A;  4JLE A;  3ANW B;  2YKS A;  3SYS A;  4C90 A;  1QJ8 A;  2VVS A;  3W15 B;  3B5M A;  3LK2 A;  4AYD C;  2ODJ A;  2MTQ A;  3K1S A;  5LHH B;  2Y48 B;  4DID B;  3SY9 A;  5HXC A;  2VK9 A;  5F3J A;  1KK7 A;  3AED A;  4U74 A;  5F5W A;  3KV9 A;  3NRX A;  4FJO A;  4AYI D;  4L5G A;  2VL8 A;  4C69 X;  2XAH B;  4A5X A;  4H63 H;  2NP9 A;  4UF0 A;  5LA6 E;  3HR0 A;  3CKD A;  5C8Y E;  2IIU A;  4IDQ A;  4H9S E;  4EED A;  4C00 A;  4CQI A;  2YDQ A;  4NXN T;  4KP3 C;  3N2K E;  4KUM B;  4DUY T;  1Q9G A;  2LSI A;  1KNZ A;  3DP7 A;  2D9D A;  4QH5 A;  5BR8 T;  2CBJ A;  2VWA A;  2YPV A;  4O2A E;  3HKD E;  4ASK A;  4I43 B;  3T24 A;  1N32 T;  5HXS A;  2D0U A;  1JNR A;  2X0H A;  4ISS A;  2MOZ A;  4EB6 E;  4NIQ A;  2LSY A;  2O4V A;  2X9H A;  3TLU A;  4IE7 A;  2ZLY A;  1AJ3 A;  1NWM X;  3SFE A;  5JDN A;  4RJX A;  1G8X A;  2W4X A;  2ZM2 A;  2WZH A;  4AQF C;  3HKE E;  2YDR A;  2I0M A;  3OBV E;  3PRN A;  3RH3 A;  3C4Z A;  5JDF A;  4PK6 A;  5JDL A;  4JI3 T;  3NJT A;  1D0Z A;  2E8I A;  5JDG A;  4GK5 E;  4N78 D;  2YOE A;  3WI4 A;  1MIY A;  2QTK A;  3LK4 2;  2LOS A;  4JEH B;  4IL6 O;  1E2A A;  5AFU L;  2XQ7 A;  1Q9F A;  1HFA A;  4N75 A;  1P4T A;  4DV0 T;  3AXJ A;  5LCY A;  4DV2 T;  3AAI A;  3Q5W A;  5CA0 E;  2VKH A;  1MM4 A;  5LG4 A;  4QH4 A;  5HWY A;  2G0U A;  3PU3 A;  1MMD A;  4DR1 T;  1IZN B;  2EHO C;  4ZI2 D;  4YHJ A;  4GOU A;  5HEH A;  4ILA A;  4BAY B;  3IBP A;  1IBK T;  2XQ4 A;  3PUZ F;  4HE8 A;  2JPF A;  2L3L A;  4DMV A;  2RP4 A;  2XM1 A;  3ZMZ B;  4DMW A;  3ZT6 A;  4DV5 T;  2PG8 A;  4UR9 A;  3VE2 A;  4KR4 A;  4D64 A;  2YEV C;  3AE8 A;  2BS2 A;  3NBX X;  3ZT5 A;  2ZFG A;  3P7I A;  1J5W A;  4EYY R;  2JQK A;  2Z6E A;  5HEU A;  3PQS A;  5DQW A;  5E0O A;  2N2L A;  5FVN A;  3AVR A;  4TV8 E;  3FB2 A;  1DU2 A;  2IWV A;  4ILU A;  3DTO A;  1NAF A;  2LRK A;  2LEH A;  1VOM A;  2BVL A;  5EK3 A;  3KV5 A;  2VKO A;  3NWI A;  2BKN A;  2VKJ A; 
#chains in the Genus database with same CATH homology
 1IJ6 A;  2C5J A;  1ZEE A;  4QX7 B;  2MBG A;  3KV6 A;  2LE8 A;  4HEA A;  4UEL A;  3ZMU B;  4EOZ B;  2N2M A;  3MJX A;  2X9Y A;  4G2A A;  3K3Q C;  4AKL A;  4EZH A;  1HXT A;  1OPF A;  2FGQ X;  3VZW X;  3N2O A;  3IHR A;  2M07 A;  1CUN A;  2YU2 A;  1PHO A;  4D65 A;  2OA5 A;  3N2G E;  1SHZ C;  3F2E A;  3PU8 A;  5HXE A;  2NTY A;  3NZP A;  5LYJ E;  3LFM A;  2XAS B;  2W80 C;  2H7V C;  3ZLI A;  2V7K A;  2KXP A;  1MPF A;  5IHY A;  1MM5 A;  4RL9 A;  3C51 A;  1X79 A;  1D1C A;  4H9Q C;  2X9W A;  4IST A;  4O4H E;  4EYU A;  2B1E A;  3WAK A;  4GHB A;  3KDS E;  3RYI E;  3SRZ A;  2ODU A;  3GP6 A;  3SS1 A;  5JH7 E;  3QC9 A;  2XE5 A;  2JRK A;  1HX8 A;  2WBL A;  3EDU A;  4FT6 A;  1VRB A;  4X1K E;  2LSJ A;  4U72 A;  3SOL A;  2CLY C;  2KC0 A;  5GON E;  2WMO A;  4OFZ A;  1H7C A;  2IAK A;  3AA6 B;  3UUL A;  5FNV E;  4ADZ A;  3SZV A;  3E0Z A;  3UPG A;  3POQ A;  3KBU A;  5EK4 A;  4FZL A;  5LJN A;  4ZHQ E;  2YNK A;  5M4Y A;  3ZYL A;  3RYF E;  3LK2 B;  5J2U E;  3LK3 A;  3NZQ A;  4UVB B;  4HN9 A;  3HA4 A;  3LK4 1;  5LHG B;  2KIN B;  2D2S A;  5FY7 A;  3ZPO A;  1UX4 A;  4OYJ A;  1ZHZ A;  3AAE A;  1LKX A;  4JCH A;  2Q9Q D;  3AAA B;  3FHN A;  1MMN A;  4FSP A;  4O4X A;  3FBZ A;  5GV0 A;  3HKC E;  1WYC A;  4X20 E;  1E54 A;  3VY9 X;  5H6Q B;  3O0E A;  3POX A;  2BVM A;  5LGN B;  4E1S A;  2L8K A;  4P09 A;  5JDM A;  4HTE A;  3LBX B;  5LGU B;  1WRD A;  3PDY A;  1HS7 A;  2V7L A;  1FEW A;  3Q9D A;  2X27 X;  4D5U A;  2CA5 A;  5L3D B;  3VU7 H;  3A5X A;  2NWB A;  4PK4 A;  4OK0 A;  2CM0 A;  3OYZ A;  5ADX K;  2F1V A;  1OXZ A;  2HPL A;  3MAC A;  4UEM A;  3AA1 B;  3ETU A;  3H3A A;  1HXU A;  3RBH A;  4UF0 B;  5LJM A;  3IF8 B;  3GWH A;  4H63 V;  2MYS A;  4B61 A;  3HI2 A;  1HTJ F;  3HOE A;  1FMW A;  3V5U A;  5JRC A;  3POU A;  2CWY A;  4CXX A;  2CXL A;  5LGT B;  2YU1 A;  3E08 A;  3UU2 A;  3MXZ A;  3QRC A;  2VB6 A;  1QJ9 A;  4O4U A;  4UIG A;  3D0T A;  2D0T A;  2C5K T;  2Y7S A;  4FMS A;  3ZYK A;  3ZMT B;  2JJ9 A;  3KVA A;  4OHF A;  2JMK A;  3I1A A;  2KLQ A;  2X67 A;  3FBL A;  2FGR A;  5G26 A;  5HAX A;  4CI1 B;  3KIN B;  4LSI A;  1D0X A;  4TZ4 C;  5FY0 A;  5L3B B;  2ZMA A;  3NRY A;  4JFB A;  4AKM A;  4PUX A;  4F4B A;  2XE1 A;  3N9O A;  3BQK A;  2MHL A;  2X9X A;  1UCU A;  3C64 A;  2W00 A;  2IW5 B;  3FXE B;  5KX5 E;  2VKD A;  4OYK A;  2UXN B;  2I59 A;  5JR9 A;  4KR8 A;  3EUH A;  3AA0 A;  1S35 A;  4MBQ A;  3ZJ1 A;  1MMG A;  2XE2 A;  4O3Y A;  4O4I E;  4PK5 A;  1ZV4 X;  4ZI2 C;  2KND A;  4QXB B;  3HWB A;  3ZYM A;  5HXH A;  3N9P A;  3PQU A;  2V7J A;  3LG7 A;  4YFS A;  1IZN A;  3HKB E;  5LXT E;  1ZHC A;  3AB3 B;  7PRN A;  1YKH B;  3S4U A;  3CQG B;  2KMF A;  3C98 B;  4U9C A;  4UVC B;  4TX5 A;  2LJL A;  3FXD B;  2V7I A;  3CVR A;  4PAG A;  4PJJ A;  4UXN B;  3PUQ A;  5JR9 C;  2M06 A;  5L2L A;  3CML A;  2DCF A;  4IE4 A;  3OYX A;  4IGU A;  2MNH A;  4PFP A;  3RRW A;  1MIW A;  4X1Y E;  2GK9 A;  3I9Y A;  1QJP A;  4IIJ E;  2ZLD A;  4H9O C;  3QUJ A;  4MLK A;  4BA9 A;  3GN5 A;  4AKH A;  4BUM X;  3PUA A;  2LHR A;  3MZK B;  5DAB A;  1OSM A;  3C4X A;  4PW8 A;  5DL8 A;  4L9I A;  1T98 A;  2CE7 A;  4XZC A;  3P8C D;  4ZOL E;  5L3F B;  4O49 A;  5DL5 A;  5JDH A;  2K48 A;  4JUY A;  4P0B A;  3C4W A;  3PUR A;  3RYC E;  1ZHT A;  3CWZ B;  1HG5 A;  2EHO B;  2RA1 A;  4DO0 A;  3ZN1 B;  2DWK A;  1IAP A;  3M65 A;  2KWH A;  4GCQ A;  3EDV A;  2Q9Q B;  1HCI A;  2PBI A;  2VKJ A;  5IYU A;  3N9N A;  3N9M A;  5FXX A;  4RLC A;  4CI3 B;  3UUM A;  1GFQ A;  3UTK A;  1G73 A;  2H7O A;  4I50 E;  3Q5X A;  4IHJ E;  3NSG A;  1BT9 A;  4AQG A;  1YW0 A;  3KFW X;  4AUI A;  1FIO A;  2CEA A;  4FRT A;  3JC6 D;  4IE6 A;  5LNK A;  4AKR B;  3DA4 A;  2Y8D A;  5DL7 A;  2LT3 A;  1WYB A;  2H3R A;  3ONX A;  4DBQ A;  2UXX B;  2POR A;  2XE3 A;  5AFU K;  3DA3 A;  1BR1 A;  3RPU A;  1O3X A;  2K9A A;  3QRA A;  4EAH A;  5BMV E;  3BK9 A;  3SYB A;  1LRZ A;  1QSD A;  2EHO D;  3T0S A;  4E1T A;  2XAF B;  2JMM A;  2ZM0 A;  4QHO A;  2NOX A;  4UV8 B;  3ZN0 B;  2OMF A;  3B57 A;  1YD8 G;  4NUV A;  2LM9 A;  4ZS2 A;  2LOP A;  5L3G B;  1D1A A;  2Y0K A;  1GFN A;  1GFO A;  2ZM8 A;  2CMR A;  2XAG B;  3ZC1 A;  4QXC B;  4YJ3 E;  2LHF A;  2P9B A;  3C50 A;  3OKQ A;  5LOV E;  5FY1 A;  2WSS V;  3N9L A;  5FXW A;  4I55 E;  2F1T A;  1IJ5 A;  3C5O A;  2GE4 A;  5JDQ A;  3UAQ A;  3O1J A;  2XMX A;  4KRA A;  6PRN A;  2D5U A;  2A2F X;  3K19 A;  2X51 A;  1EZ3 A;  3HL6 A;  4AI6 A;  2NW7 A;  2K4T A;  2WWU A;  1V9D A;  3UUX B;  5KDM C;  3RYH E;  4FUV A;  5HXR A;  4DBR A;  1MNE A;  2KZ7 B;  4TN7 B;  2WAU A;  2E9X B;  3U78 A;  3RC3 A;  4N58 A;  3L3P A;  4RLB A;  4WW0 A;  2Y0H A;  2X68 A;  4JLE A;  2K0L A;  1ZHY A;  4QQ1 A;  2BZB A;  3ANW B;  1MMA A;  3VY8 X;  5D5D A;  4YLH A;  4V1A v;  4C90 A;  3SYS A;  3AA6 A;  2W63 A;  2K24 A;  3E22 E;  4GIW A;  5FMN A;  3RRC A;  4ERR A;  2DLR A;  2KT9 A;  1QJ8 A;  4GCS A;  4O3W A;  2CXF A;  2PFV A;  1BR0 A;  4H9P C;  3W15 B;  2CWO A;  1ORM A;  1YS5 A;  3LK2 A;  4AYD C;  1SA0 E;  3CPZ A;  2ODJ A;  3Q2M A;  3WI3 A;  3KVB A;  3MK7 C;  2Y2X A;  4AKG A;  1MIV A;  3RC8 A;  2W81 C;  5ADX L;  2MTQ A;  3ZCJ A;  5JVD E;  5L3E B;  3UUN A;  8PRN A;  4O3Z A;  2X0L B;  2XTL A;  4IDZ A;  5LHH B;  5KMG P;  2E9X D;  2Y48 B;  4UV9 B;  3AAA A;  1BH3 A;  3MA9 A;  3SY9 A;  3RX6 A;  4E7S A;  5HXC A;  5FXZ A;  2VK9 A;  2ERV A;  2NTX A;  4TUY E;  1KK7 A;  3IEE A;  5F3J A;  2Y0L A;  4U74 A;  3KV9 A;  4E7Z A;  3NRX A;  4FJO A;  2L9Q A;  3AVS A;  2J1D G;  2NW8 A;  4CXY A;  4AYI D;  3AA7 B;  3TZG A;  2DHR A;  3H37 A;  2VL8 A;  3I9W A;  4L5G A;  4AZL A;  5ETW A;  2XAH B;  5CA1 E;  4C69 X;  4XNL A;  3CX8 B;  1GFM A;  3N5L A;  4H63 H;  4EZ4 A;  2NP9 A;  4A56 A;  3I0O A;  4PFO A;  2JQQ A;  3AA1 A;  4UF0 A;  5LA6 E;  3HR0 A;  3KBT A;  3GA8 A;  4O8S A;  2CLY B;  4M1P A;  3CKD A;  3F57 A;  4QWN B;  3VE1 A;  5C8Y E;  3R84 B;  4AYN A;  5DQV A;  4H9N C;  4UVA B;  2KXP B;  4WBO A;  3V5S A;  4H9S E;  1WLX A;  4CQI A;  3POR A;  3N9Q A;  3VZU X;  4KP3 C;  4FSO A;  3N2K E;  4KUM B;  4GF4 A;  4C91 A;  4ZI3 C;  4FZM A;  1Q9G A;  2LSG A;  4HFV A;  4PJN A;  4PNI A;  3T8O A;  4G76 A;  2LSI A;  3J7Y q;  1KNZ A;  3DP7 A;  1BR4 A;  3PE0 A;  1THQ A;  4EXT A;  2VWA A;  2YPV A;  4O2A E;  3GMI A;  3HKD E;  5PRN A;  4ASK A;  2V26 A;  4I43 B;  3T24 A;  5J1G A;  1WR6 A;  4AQF A;  2W0G A;  5HXS A;  2D0U A;  4MAL A;  2A3D A;  5JDP A;  2C0S A;  4ISS A;  2MOZ A;  4EB6 E;  3BQI A;  3CX7 B;  2W61 A;  4CZZ B;  3HOL A;  1HG2 A;  3LK3 B;  1OWA A;  2LSY A;  3CX6 B;  2X9H A;  2O4V A;  3CQX C;  2CCQ A;  4MFR A;  4IE7 A;  2ZLY A;  1G90 A;  1AJ3 A;  5TAO A;  3AAE B;  1NWM X;  5JDN A;  4B6X A;  2J1N A;  4RJX A;  1G8X A;  2ZM2 A;  1D1B A;  2WM9 A;  2BDE A;  4QKN A;  4QXH B;  3WI5 A;  3O1H A;  3L09 A;  5EZY E;  2CXD A;  4HGA A;  4AQF C;  1H6S 1;  4JEU B;  1B7T A;  3HKE E;  4O3X B;  4XNK A;  3TKL B;  4FOZ A;  3OBV E;  3PRN A;  3RH3 A;  5JQG E;  3C4Z A;  5JDF A;  1HXX A;  4N59 A;  5HWX A;  3T20 A;  4PK6 A;  5JDL A;  3O4X E;  1D0Z A;  2E8I A;  3ESL A;  5EE2 A;  1US7 B;  5JDG A;  4GK5 E;  4N78 D;  5JRC B;  4CI2 B;  4YJ2 E;  3WI4 A;  1ZHX A;  1MIY A;  1MND A;  4IE5 A;  3LK4 2;  4X1I E;  5F8P A;  2QTK A;  2IC9 A;  2XTR A;  4LSF A;  3ETV A;  4WNK A;  4O4J E;  5JRE A;  2N1G A;  2LOS A;  3O9X A;  4JEH B;  5A1L A;  4GYR A;  3A2S X;  4AYM C;  4BJN A;  3SZD A;  3G7G A;  5AFU L;  3K3N A;  2EHO A;  4J2C A;  4AXP A;  3SY7 A;  1Q9F A;  1Z0P A;  1HFA A;  1HF8 A;  1S94 A;  2LFU A;  2XAJ B;  2XHE B;  1P4T A;  5LCY A;  2Q9Q A;  4TV9 E;  2QA7 A;  4L0R A;  3AAI A;  3F31 A;  3K3O A;  2SPC A;  2VKH A;  3PUG A;  3Q5W A;  5CA0 E;  3JC6 C;  5JR9 B;  1MM4 A;  5LG4 A;  3AA0 B;  3PUS A;  2XAQ B;  1ZHW A;  3FYX A;  4GCP A;  3ZC0 A;  4DND A;  3WAJ A;  1D0Y A;  5HWY A;  2G0U A;  3EMN X;  5DJQ C;  4QX8 B;  4FES A;  2ODV A;  3PU3 A;  4IE0 A;  4AKR A;  3VZT X;  1MMD A;  4I4T E;  2LSK A;  3CQC B;  1IZN B;  2EHO C;  4DVD A;  1U5P A;  4LSE A;  4ZI2 D;  4FZN A;  3LJC A;  4YHJ A;  4GOU A;  4KMC A;  5FXV A;  3ZJ2 A;  4RJW A;  1Y64 B;  5LP6 E;  2Q9Q C;  3KVD D;  4O2B E;  2NW9 A;  3KV4 A;  2V1D B;  3IBP A;  3ZMV B;  2V7M A;  4BAY B;  2J4U P;  4XAX B;  2HPJ A;  5LBQ B;  3BQL A;  3PTR B;  3ZMS B;  4LSH A;  4HE8 A;  2JMH A;  2JPF A;  3MKD A;  5IYZ E;  5L3C B;  4AYE C;  4GK0 E;  3VHL A;  2L3L A;  4DMV A;  1LVK A;  2RP4 A;  3LBX A;  5H6R B;  3ZMZ B;  1BR2 A;  3GN5 B;  1LVF A;  3OJA A;  4PJM A;  4DMW A;  2YK0 A;  4ZI7 E;  4XBF B;  4FI5 A;  4ZI3 D;  3JTY A;  2PG8 A;  4WBN E;  1ZKE A;  4G75 A;  5FP3 A;  1QUU A;  2M67 A;  3I0Q A;  4O4L E;  5FYM A;  5CB4 E;  3R6N A;  1E1H B;  4Z3T A;  4NUU A;  3VE2 A;  4H9R C;  4KR4 A;  5LHI B;  3O1I A;  1FMV A;  3K8P C;  3ZCI A;  1GFP A;  4AKI A;  2KZ7 A;  4D64 A;  2YEV C;  2E9X A;  1YKE B;  3NBX X;  2XG6 A;  2K5B B;  4K0U A;  2PRN A;  3P7I A;  2ZFG A;  3ANW A;  3HW9 A;  3V8U A;  5HYA A;  4BJM A;  2DI4 A;  2YIN A;  3VKG A;  3UFE A;  2X66 A;  2W62 A;  4KBM B;  2Z6E A;  4EYY R;  1PRN A;  2A72 A;  2DWG A;  2ACX A;  3PQS A;  4FRX A;  2KWI B;  2XTQ A;  5DQW A;  2Y6X A;  5LBM A;  3VKH A;  5EK2 A;  2IC6 A;  5E0O A;  2N2L A;  5FVN A;  3AVR A;  4TV8 E;  3ZEF B;  3FB2 A;  2N2N A;  4HKA A;  5T5F A;  3EVY A;  2DNX A;  2LHN A;  2VAS A;  4G63 A;  4MHC A;  4ILU A;  2E9X C;  2HH7 A;  3DTO A;  5DL6 A;  4P0A A;  2ES0 A;  4CXW A;  2C5I T;  4Z8X A;  1NAF A;  2KDY A;  1U4Q A;  3QK6 A;  3RKO A;  4ANJ A;  5J2T E;  4AFK A;  2LEH A;  3U3I A;  1VOM A;  2BVL A;  3DJB A;  1UX5 A;  2XQY A;  4PJL A;  5EK3 A;  2PJQ A;  4ZS3 A;  4F6R C;  2XUE A;  3KV5 A;  3SWH A;  2QGS A;  2N9D A;  3UT5 E;  4EIW A;  3J9X 1;  2WMN A;  1BXW A;  2VKO A;  3AA7 A;  4GYS A;  3B13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...