3AA6B

Crystal structure of actin capping protein in complex with the cp-binding motif derived from cd2ap
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
242
structure length
242
Chain Sequence
DQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
total genus 80
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aa6B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aa6B02
5AFUL 3AAEA 3LK2A 4AKRB 1IZNB 2KZ7A 3LK42 3LK41 2KXPA 3AA6A 3AAEB 3AA1A 3AA7A 3LK2B 3LK3A 2KZ7B 2KXPB 3AAAA 3AA6B 5ADXK 3AA1B 3AA7B 3AA0A 3LK3B 5AFUK 3AAAB 5ADXL 4AKRA 3AA0B 1IZNA
chains in the Genus database with same CATH superfamily
2K9AA 4JI2T 4P09A 2J4GA 3MZKB 2YPVA 2WS3A 2XM2A 2WM9A 4N58A 2JQ9A 3OBVE 4CXYA 2UUCT 4C4VB 2PJQA 5AQHB 4GIWA 4IDOA 4Z90A 2NP9A 3RBHA 3NRXA 1GFMA 1OWAA 3LBXA 2XAFB 3I0QA 1G8XA 3PJAA 4NXNT 4AYDC 3WI5A 3C4XA 4Z8XA 2W4XA 2MOZA 3AE5A 3ZLIA 4PJNA 4U7IA 4WNKA 2I59A 2NWBA 2VK9A 5LBMA 4IGUA 2WAUA 5IHYA 2RP4A 5HXEA 5E79O 2BKNA 4AKRB 4DV6T 4ZXLA 2ZM0A 4O4IE 3RKOA 2BS2A 4MBQA 4FRTA 4OYJA 5ABEA 2BVLA 2Y2XA 2XQ4A 2H89A 5FY0A 5B5EO 2XASB 4CXXA 5FMNA 3VY9X 4AKHA 2AE9A 4KR8A 5AQKB 3TLSA 2HH7A 2LHFA 3QB5A 3AA1A 3AE2A 5JDLA 2XY8B 2W00A 2C0SA 3WAKA 1WYCA 4IDNA 2FGQX 4FZMA 2LJLA 5JRCB 5IYUA 4QH4A 4WBOA 3BK9A 4FI5A 4IDQA 1E1HB 3PQUA 3RH3A 4YFSA 2WDVA 3EI0A 2F4VT 5LBQB 3O4XE 3O1HA 5GTIO 3ZT7A 4Z91A 4KHPT 3A7MA 3N9OA 4PJJA 4WZXA 2LKHA 2R8AA 3AEBA 2IUBA 2YU1A 1KFYA 2W80C 5GV0A 4DO0A 3T24A 2W61A 3VKHA 4KMCA 4COFA 2JMHA 3UU6A 2XQ9A 4JI4T 2J1DG 3HKBE 2B1EA 3OYXA 1YQ3A 3M65A 3VZUX 3H3AA 3SOLA 5HXSA 3UQ7A 1US7B 2KWIB 3JC6D 2DI4A 3FZLB 1YXRA 4U74A 1GQEA 2A9UA 4GCSA 5HWXA 3RIUC 1YS5A 4IHJE 4HWCA 4ZI2D 3VKGA 2UXXB 3NZPA 5HEHA 4QWNB 1MMGA 4B6XA 3PGUA 2EHOB 2MHLA 3VRAA 3RYFE 1MMDA 2QA7A 5ADXL 2UXDT 2AXDS 2SPCA 2XTRA 4RJXA 2M07A 1ZOYA 4JI8T 4TNVA 3DTOA 2DWKA 2X0HA 2A72A 2KT9A 1YKEB 4X65T 4I0UA 2CWOA 4GF4A 5KXJA 4LSHA 3CX6B 3PUSA 2JQQA 3NBXX 1XNQT 3AE4A 4D65A 3ZN1B 4QQ1A 3G06A 5JREA 3AA6A 2E5VA 2ZLYA 3U78A 2KXPB 5L3FB 2R4PA 4BJMA 2XE2A 3HOEA 4L9IA 2BG9C 1IJ6A 4YSZA 4PW8A 3H37A 3N2KE 4YT0A 4AQFA 2Q9QC 4JI1T 3SS1A 4BA9A 5AQPB 4F6RC 4HTEA 4FRXA 3CKDA 4HGAA 5AQTB 1ZP0A 5LXTE 3CMLA 4DV2T 1ZHTA 5AQIB 4HWDA 1NWMX 3UAQA 3BRYA 5FP3A 2XAQB 4YJ3E 1OSMA 2XHEB 3RI5A 3ZKRA 3EVYA 2M6IA 2K3WA 2IAKA 4U72A 2YOEA 4DBRA 2LSKA 4GKJT 1H6S1 5L2LA 3VHLA 5FVKA 4NXMT 2ZM2A 4D5UA 5EK3A 4CI2B 2XQAA 5LNKA 3FBLA 1LVFA 2O4VA 1W0AA 2G0UA 4NIQA 3KV6A 2WVPA 2ZLDA 4H9PC 3RLFF 2V6XA 3VZTX 3KBTA 1UX4A 1UUSA 1IZNA 4LF5T 2JMKA 3BQKA 2LOSA 2XAHB 2OV9A 3RQWA 2XZEA 2E9XA 3LK41 4AUIA 4DV0T 5DQWA 5JH7E 2KDYA 4TUYE 5ABFA 1I6ZA 2EHOD 3SFDA 5B66O 3AA7B 3LK3B 4MALA 4DNDA 3MKDA 2WBLA 2IWVA 2X0LB 4YTMA 5FXWA 4HE8A 3Q5XA 3X1DA 3V5SA 5LMNT 3VR9A 4PJ0O 2WDRA 3UU2A 5L3BB 2D5UA 4IL9A 4EYUA 5JDMA 2CA5A 2XJ7A 3KINB 2XE1A 3RF1A 5DQVA 4PJMA 2K0LA 7PRNA 2LSYA 2W66A 4JI7T 2WMNA 3HWBA 3MXZA 2LSGA 3RYIE 4QH1A 5J1GA 4DUZT 2CE7A 3ANWB 2X9YA 3NJTA 2XQ3A 5LJMA 4LF6T 5KMGP 2RPAA 2PFVA 1IJ5A 1KF6A 4IE5A 5JVDE 1VOMA 5T5FA 2A2FX 2KLQA 2DHRA 2VVSA 3ZMVB 3O1JA 5AQUB 4O49A 4UV8B 3QRAA 3LG7A 1SHZC 3IEEA 5J2TE 3AAEB 2VQFT 4KR4A 4PAGA 1D1CA 4EGWA 4KP3C 3ZN0B 2YKSA 3UU4A 5JDHA 1LVKA 4IREA 4XZCA 1W9RA 3U3IA 2WB5A 5BMVE 5HEUA 3PUWF 5FVNA 2HN1A 5LMUT 1OEDA 3Q5WA 2CHOA 3JAEA 2CHNA 3JADA 5FY7A 3SRZA 3AAAA 5EZYE 4L0RA 3C98B 1CUNA 4DR7T 1R8IA 4ILAA 2BKOA 4AYNA 2UXNB 2BKPA 2R4LA 4PNIA 3NRYA 3ZSTA 3L8RA 3IBPA 2Y7SA 2XM1A 2L3LA 3RYHE 4U33A 3KFWX 4JI0T 1N33T 4UVAB 5C8YE 3HW9A 4FZNA 2R6GF 2JQYA 5ADXK 1GFPA 3PUVF 5HXCA 4RL9A 4I55E 2CWYA 4EIWA 4UF0B 2FBWA 3HOLA 4O3XB 4F8HA 2ODVA 3KBUA 4OFZA 2VKOA 4DR2T 3SYSA 4TX5A 4TWHA 2VQET 1N34T 3AAIA 2XE3A 3Q5EA 5AQMB 3L39A 3I9YA 5AQGB 4AQFC 3UUXB 2V6YA 4ZHQE 4CI1B 1ZEEA 2IC9A 1M7KA 4V1Av 3DWOX 4FOZA 3RC8A 4HFIA 1NENA 2QTKA 5D5DA 4FJOA 4HFCA 3OJAA 3RYCE 2CXFA 4X20E 2Y8DA 1XZYA 4IDZA 4O8SA 4ZI7E 3G7GA 2H7OA 4G63A 3E08A 2E5LT 2HPJA 1T16A 2LHNA 5JDQA 2UUAT 3VR8A 4PK4A 2IMLA 5LA6E 2WMOA 4EEDA 1MIWA 2LSJA 3I0OA 3JAFA 4IL4A 4YY3T 3SFEA 1FMWA 1MIVA 5LOVE 3P4RA 5EK4A 3ZJ2A 3DA3A 1HF8A 4OHFA 4DV3T 4AXPA 2BS4A 2W81C 2B76A 1FIOA 3UFEA 2J1NA 5LGNB 1QUUA 3FZFB 4EAHA 3UPGA 4JI5T 4AI6A 4N74A 1IBKT 3JTYA 2E9XC 5LCYA 3CQCB 1D1BA 1HXTA 2HPLA 2K48A 4QXCB 2VKDA 1LKXA 3LK42 5JDGA 2K4TA 2C5JA 4BJNA 4TNWA 4B3ST 4HFBA 4MFRA 2IC6A 3TLUA 4EOZB 3RIFA 2XQ8A 5DL8A 5H6QB 3QRCA 3AE7A 2LRKA 4ZI3D 2AXTO 2YU2A 3UUMA 4NUUA 4BUMX 2V7KA 4KHZF 3K8PC 5DL5A 3AEGA 2XUEA 1XWMA 4ASKA 2KC0A 1IBLT 4X62T 2UUBT 4CI3B 3HKEE 3VE2A 2PBIA 3LK2B 4B3RT 4UEMA 2NW9A 3ZYMA 2X0YA 1S35A 4TWFA 3AECA 4DV4T 4DMVA 1DU2A 4LF4T 5AFUL 4E7ZA 3FXDB 1YQ4A 2XAGB 2FJDA 1ORMA 3ZYKA 4ANJA 3AE8A 2UXBT 3T20A 1LRZA 2CEAA 2Y0HA 1I94T 4CTDA 1OEDC 2X9KA 4GYRA 5L3DB 3EHZA 4K3BA 3VZWX 3EDVA 3RX6A 4FSOA 4O3ZA 3P8CD 4FQEA 3W15B 2XSBA 1HS7A 3ZT6A 3V8UA 2R4NA 2V7MA 3RRWA 3ONXA 4GCQA 1ZHCA 3AA0A 4GK5E 4GCPA 2PTFA 4TV8E 4LFBT 2XE5A 3UU5A 5TISO 1E7PA 2ZM6T 4QXBB 2KZ7A 4LSIA 1HG2A 3AE9A 4EV6A 5LG4A 5AQQB 2QRXA 4E7SA 4H9SE 4YHJA 2Y48B 3PTRB 3RQUA 2E2AA 3T8OA 3O9XA 2LM9A 5CB4E 4X66T 4YTNA 2XG6A 3AE3A 3P4PA 1BT9A 4U9CA 6PRNA 1FEWA 3ZCJA 3AE6A 1ZHWA 4XNLA 3ZMUB 2OLTA 4U2YA 3ZMTB 5JTGA 2UU9T 4O2AE 1MM5A 2V26A 3PGRA 5FXZA 3OKQA 1AJ3A 3P50A 5JDNA 5ABHA 4PUXA 3UULA 2FJEA 2WJQA 5JR9A 2XMXA 2JPFA 5H2FO 2X9XA 4E1SA 5C2TA 4OYKA 4GK0E 5A1LA 3AEFA 3N5LA 5F5WA 4PJLA 4H9NC 4DR1T 5KAIO 4C91A 3AVSA 2RA1A 2CXLA 3AE1A 4AKLA 3T0SA 4RLBA 4C4VA 4H63H 4PR7A 2LOPA 4ZOLE 1HNZT 2GE4A 5HXRA 1OPFA 1IAPA 5ABGA 4JCHA 4AYID 2E8IA 3DJBA 4YJ2E 4ZZBA 1FMVA 3UFGA 5DABA 4C90A 1U5PA 4X64T 1KEYA 4ISTA 4KX6A 3DWNA 3AXJB 5IWAT 1MPFA 2L9QA 3NVOA 4H9OC 4G76A 2N2LA 2LLYA 2FJAA 1H7CA 1E2AA 4AKRA 1J5WA 1VCTA 5FVLA 4KBMB 4KI0F 3GN5B 5HAXA 1HXUA 1IBMT 1YKHB 2F1TA 4JI6T 4DIDB 1S5LO 1HX1B 3B13A 2ZM8A 4J2CA 5JQGE 4QH5A 3QNUA 4XAXB 3T1HT 4O4LE 2YNKA 5DJQC 1U4QA 2XQ7A 3VY8X 5LHIB 5AQRB 2Y0KA 3JCUO 1HX8A 5H6RB 1HCIA 3LFMA 2VURA 2JIWA 4G75A 3CIRA 4IE0A 3C51A 5JRCA 3C50A 2BG9B 2VL0A 3K3OA 2XQ6A 2M67A 3OVUA 4UVBB 3FYXA 4PFPA 2Q9QB 5J0ZA 2V5DA 4UV9B 3GMIA 2NW8A 4DV1T 5CGMA 5L3CB 4X1IE 4JI3T 2W62A 1JNZA 4O4JE 1B7TA 2I6HA 4U7YA 4G2AA 3LDQB 4LMLA 1YW0A 1Q9FA 4KUMB 2XSAA 3N9MA 4N75A 4YHHT 2LHRA 2BBHA 3HA4A 3HR0A 3UU3A 4QXHB 3N2GE 4C69X 1X79A 4IE7A 4HEAA 4EB6E 3LBXB 3UTKA 4LF9T 4NUVA 1X9BA 3QK6A 5AQOB 3K19A 4CN1A 2K5BB 1XMOT 1OXZA 2WZIA 4E1TA 1SE7A 4TWDA 3N9QA 5L47A 5AFUK 3J9X1 2NW7A 1ZHYA 4FUVA 4QX8B 5AQNB 4X5TA 5DL6A 2Y6XA 4YTPA 4DR4T 3KV5A 1D1AA 2CRBA 2V5CA 2EHOA 2N9DA 2CPTA 4XNKA 1NAFA 2CLYC 3DP7A 3PE0A 1VCSA 4FSPA 2DNXA 3L09A 3RHWA 5F3JA 5L3EB 3PUGA 4HFEA 1MMAA 3AA1B 1KNRA 3PUQA 3WI3A 4AYEC 2ACZA 4DVDA 4AKGA 3FBZA 3CQXC 3SY9A 4FESA 3UUNA 3A0BO 4FMSA 2DCFA 1Y64B 2LM2A 3ESLA 5FL0A 2N2MA 2IHR1 2IWWA 2KXPA 5FL1A 1T1LA 1XDOA 2YDQA 4H9RC 1N36T 5AQSB 4XBFB 5LHGB 3H3MA 2J4UP 3KZIO 3WU2O 3TLWA 3TKLB 5JR9C 5L4EA 4I43B 1MMNA 1XMQT 4HN9A 1KNPA 3ZPOA 3IHRA 3A0HO 1J1JA 2LFUA 3R84B 4H9QC 5KDMC 3OTOT 1BH3A 3QB5K 3RRCA 1BR0A 2XQYA 2VKJA 2Q9QD 3F57A 4U3CA 5HCJA 2PRNA 4ZI2C 4EYYR 1S94A 4WW0A 3SZDA 2PG8A 4O2BE 5AQVB 3F2EA 3C5OA 3BQLA 2IDOB 1WRDA 2OA5A 3ZMSB 5FY1A 3P4SA 1MM4A 5JDFA 5M4YA 3KVAA 5KAFO 1QLBA 5HEGA 2BG9E 5HYAA 5HCMA 3ZYLA 2VVNA 3D0TA 2MYSA 5F8PA 2JJ9A 3PUZF 4ZS2A 5ETWA 1T98A 4HFHA 4WBNE 1THQA 4JBWF 5G38A 2MTQA 5IYZE 4AKMA 1NEKA 3Q5DA 3KVBA 1T8BA 4AKIA 1WCRA 4TZ4C 3KDSE 2XPKA 5E0OA 3P4QA 3Q9DA 2WY2A 3IF8B 3UQ4A 3L3PA 5L4HA 3UU8A 4HKAA 4LFAT 5JDPA 4O4UA 3P4WA 3N9NA 3EDUA 3UUBA 5G39A 3ZC1A 3AA7A 3LK3A 4AQGA 3KVDD 2M6BA 3AA6B 4ERRA 3BQIA 1W0BA 4GYSA 3A5XA 5CJ5A 2LSIA 2UXCT 4A97A 3DA4A 4ISSA 5DL7A 2HN2A 3EUHA 1CHUA 5G26A 1SA0E 2YDRA 1QJPA 2WZHA 2WU2A 5HEOA 5IUXA 2W67A 1WFDA 4CN4A 2NTXA 3ZCIA 4P1NA 3WAJA 3SYBA 2LEHA 4K0UA 1XDPA 1HNWT 3CWZB 3CVRA 4IE4A 3ANWA 2WQYA 3CX8B 5TAOA 2MPKA 3NWIA 3ZC0A 5FNVE 4YSYA 5LJNA 2D9DA 1G90A 4LF7T 2FJBA 5EE2A 4TV9E 3S4UA 1UX5A 4UELA 4AIUA 1T72A 5LB7B 3AAEA 3TZGA 2ACXA 2QYWA 4DMWA 2R89A 3N9PA 2A3DA 4NPPA 2YN6A 1QJ8A 2MNHA 1T7SA 4AQYT 2ES0A 2XTLA 2EHOC 3FZMB 4PK6A 3MK7C 1N32T 3B5MA 1IZNB 3ONLC 3KV4A 2ZFGA 4CQIA 1Y01A 4P0BA 2E9XB 4WYVA 2J47A 4ZS3A 2WWUA 2KMFA 3QUJA 3PUYF 1Q9GA 5ABFB 2C5IT 3I1AA 1W09A 2YEVC 2N1GA 4B3MT 3SY7A 2BVMA 3FB2A 3MACA 3QC9A 2X9HA 4IT4A 4UIGA 2YK0A 3PURA 4IL6O 2DWGA 4OK0A 3AEDA 4LSFA 4UF0A 1ZV4X 3Q2MA 4EZ4A 4ILCA 4A5XA 4KRAA 4O3YA 3PQSA 1KK7A 4FT6A 3RKGA 8PRNA 2X68A 3CQGB 3PGSA 1D0XA 2D0UA 3PUAA 2I0MA 1WR0A 2Z6EA 4X1KE 1XNRT 5CA0E 3PUXF 1HXXA 4ADZA 2IIUA 2JQKA 3POUA 3HI2A 3GA8A 3VE1A 3GP6A 3FXEB 2ODJA 1V9DA 4K0KT 2D2SA 2R88A 2W0GA 1HTJF 4CZZB 1D0ZA 2BS3A 5FXXA 3HL6A 3AVRA 2X51A 2CBJA 3ZT5A 5LP6E 2V7LA 1EZ3A 2ZMAA 5LYJE 5EK2A 3A2SX 4AFKA 3N2OA 1OEDB 3I9WA 3DZMA 2KNDA 1Z8UA 2YINA 5FXVA 4JYAT 1FJGT 2YDSA 5KX5E 2DLRA 3F31A 3POQA 2CM0A 3AAAB 3PF1A 4UR9A 4A98A 2DL1A 5G3AA 1BR4A 2KINB 1HG5A 4P0AA 3FHNA 4AISA 2V7JA 1UGOA 4HWHA 2NTYA 3SWHA 3ETVA 4DR3T 4N78D 5LG3A 4HWFA 3CX7B 4N59A 2VB6A 3UT5E 4DR6T 5FKYA 4DV5T 1ZKEA 3GWHA 2KWHA 1L0VA 5C3JA 5L3GB 2V7IA 4I4TE 3WI4A 2E9XD 5J2UE 2GK9A 4YLHA 4DR5T 3CPZA 3ZMZB 4ILBA 1GFOA 3C4ZA 4OX9T 4JV5T 3E0ZA 2CBIA 1BR1A 4YSXA 2WJRA 4ZZCA 4C00A 2ODUA 2V6YB 2LKGA 3C4WA 3O1IA 4I50E 2NOXA 2X66A 4M1PA 3A8YC 2QVAA 4IE6A 3EABA 1UURA 1WR6A 3ZSSA 5BR8T 3VU7H 4B61A 4UVCB 2LT3A 3TLVA 4U31A 2K24A 3QOFA 5AQLB 3PV0F 4IIJE 3V5UA 2Y0LA 1G73A 3RPUA 4DV7T 1HR0T 1E54A 2PORA 2VWAA 3LK2A 3C64A 3FZKB 3IA3A 4JEHB 1WYBA 4QKNA 5CFBA 1UK5A 3ZJ1A 2FUPA 3AEEA 1HNXT 2BDEA 4YXDA 2M06A 3PORA 3PDYA 3CK6A 3PU3A 2FGRA 2X27X 3LSVA 5AQJB 1J5ET 3RIAA 1MNDA 3HKCE 4D64A 4GKKT 4EEBA 2D0TA 4A56A 3AB3B 4DUYT 1HFAA 2VKHA 3LJCA 3NZQA 5LHHB 2H7VC 2L8KA 4JLEA 1SUMB 2XTQA 5HEJA 3OPCA 4IDPA 4PFOA 2C5KT 4K3CA 4B3TT 4CN6A 5CA1E 4DBQA 2BZBA 2CXDA 2V1DB 4TN7B 4UB8O 1MNEA 4ZI3C 2X67A 1MIYA 4ILUA 2WP9A 4AZLA 4O4XA 4H63V 3K1SA 2XAJB 4LFCT 4MHCA 5GONE 4JUYA 2F1CX 4LMJA 2JRKA 1M62A 3BRZA 2WDQA 2HHHT 3JCFA 4LMKA 1P4TA 4UB6O 2R4OA 2V8SV 2W2UA 1OEDE 4GOUA 1KNZA 3EMNX 4FZLA 4RLCA 3RC3A 4EZHA 1PRNA 4U2ZA 5FYMA 2QGSA 4HFDA 1JNRA 2MAWA 3N9LA 1BR2A 4HFVA 1BXWA 2F1VA 5HWYA 4O4HE 1O3XA 3ABVA 2KSRA 1YD8G 1GFQA 3KV9A 3PU8A 4LSEA 4AYMC 3K3QC 4F4BA 3O0EA 5PRNA 3J7Yq 2WSSV 3ZEFB 3MA9A 5GTHO 3RGLA 5LGTB 2X9WA 4O3WA 2N2NA 3E22E 5AQFB 1ZHXA 1PHOA 5LGUB 3NKZA 5HXHA 2H3RA 2BBJA 4RJWA 4Q25A 3JC6C 3ONJA 1WLXA 4EXTA 2CMRA 2P9BA 2H88A 3K3NA 2VL8A 3RIUA 2LE8A 3AA0B 3T1YT 4JFBA 2WWVA 4UXNB 3AXJA 2OMFA 4L5GA 1QSDA 4X1YE 2NR4A 2KZ7B 3POXA 2WU5A 2JQHA 4QX7B 2WCAA 3M3ZB 3GN5A 2VASA 2CLYB 1UCUA 4HWIB 3NSGA 3OYZA 1VRBA 2J62A 4JEUB 2IW5B 4QHOA 3TLTA 3BS0A 3ETUA 3HKDE 1GFNA 4ZEYA 1QJ9A 3P7IA 1Z0PA 3B57A 3PRNA 4LF8T 4PK5A 3FZHB 4GHBA 3EAMA 2W63A 4CXWA 4Z3TA 1ZHZA 3MJXA 4MLKA 2ERVA 2BG9A 3AEAA 2CCQA 3PJAJ 3R6NA 2XQ5A 2LRLA 2MBGA 1D0YA 2JMMA 2Q9QA 3SZVA 5JR9B 4BAYB 3VRBA
chains in the Genus database with same CATH topology
1KK7A 2K9AA 3GN5B 5HAXA 1HXUA 4FT6A 5BMVE 8PRNA 1YKHB 5FVNA 2F1TA 2X68A 3CQGB 4P09A 3B13A 1D0XA 3Q5WA 2ZM8A 3MZKB 4J2CA 5JQGE 2D0UA 4XAXB 3PUAA 2YPVA 4O4LE 5FY7A 3SRZA 2WM9A 3AAAA 5EZYE 4N58A 4L0RA 2Z6EA 2YNKA 5DJQC 4X1KE 1U4QA 3C98B 1CUNA 3OBVE 4CXYA 5CA0E 1HXXA 4ADZA 2PJQA 4GIWA 4AYNA 2NP9A 2UXNB 3POUA 3VY8X 3HI2A 5LHIB 3GA8A 3RBHA 3NRXA 1GFMA 1OWAA 3LBXA 4PNIA 3FXEB 3NRYA 3GP6A 2Y0KA 2XAFB 3VE1A 2ODJA 3I0QA 1G8XA 1HX8A 1V9DA 5H6RB 3IBPA 1HCIA 2D2SA 2Y7SA 3LFMA 2W0GA 2L3LA 1HTJF 3RYHE 4AYDC 3KFWX 4CZZB 1D0ZA 4G75A 3WI5A 4UVAB 5C8YE 3HW9A 4FZNA 4IE0A 5FXXA 3C4XA 3C51A 3HL6A 4Z8XA 5JRCA 3C50A 5ADXK 2MOZA 1GFPA 3AVRA 2X51A 4PJNA 5HXCA 3ZLIA 3K3OA 4WNKA 5LP6E 2I59A 2V7LA 1EZ3A 2M67A 2CWYA 2ZMAA 2NWBA 2VK9A 4I55E 4EIWA 4RL9A 5LYJE 4UF0B 4UVBB 3FYXA 4PFPA 5LBMA 3HOLA 4IGUA 5EK2A 4O3XB 2WAUA 2Q9QB 2RP4A 5IHYA 4UV9B 5HXEA 3GMIA 3A2SX 4AFKA 2ODVA 3KBUA 4AKRB 4OFZA 2NW8A 2ZM0A 2VKOA 4O4IE 3RKOA 5L3CB 4X1IE 3N2OA 4MBQA 2W62A 3SYSA 4FRTA 4TX5A 4O4JE 1B7TA 3I9WA 4OYJA 2BVLA 2KNDA 4G2AA 2YINA 3AAIA 5FXVA 2XE3A 2Y2XA 1YW0A 1Q9FA 3I9YA 4KUMB 5KX5E 2DLRA 3F31A 4AQFC 3UUXB 3N9MA 3POQA 5FY0A 2CM0A 3AAAB 2LHRA 4ZHQE 4CI1B 3HA4A 3HR0A 2XASB 4CXXA 5FMNA 1ZEEA 4QXHB 3VY9X 2IC9A 4N59A 1BR4A 2KINB 3N2GE 1HG5A 4AKHA 4P0AA 4C69X 3FHNA 1X79A 4IE7A 4HEAA 4EB6E 2V7JA 3LBXB 4V1Av 3UTKA 4FOZA 4KR8A 4NUVA 2NTYA 2HH7A 3RC8A 2LHFA 3AA1A 5JDLA 3SWHA 3QK6A 2QTKA 3K19A 5D5DA 3ETVA 4N78D 2K5BB 2W00A 4FJOA 3CX7B 3OJAA 2C0SA 2CXFA 1OXZA 4X20E 2VB6A 2Y8DA 3RYCE 3UT5E 3WAKA 4IDZA 1WYCA 4E1TA 2FGQX 4FZMA 4O8SA 4ZI7E 3N9QA 2LJLA 3G7GA 5AFUK 2H7OA 4G63A 5JRCB 5IYUA 3J9X1 3E08A 4WBOA 2NW7A 1ZKEA 3GWHA 2HPJA 1ZHYA 4FUVA 2KWHA 4QX8B 2LHNA 5JDQA 5DL6A 3BK9A 2Y6XA 4FI5A 4PK4A 5LA6E 5L3GB 2WMOA 1E1HB 3KV5A 3PQUA 3RH3A 1D1AA 2V7IA 4I4TE 4YFSA 3WI4A 1MIWA 2E9XD 5J2UE 5LBQB 3O4XE 2EHOA 3O1HA 2N9DA 2LSJA 2GK9A 4YLHA 3N9OA 3CPZA 3I0OA 4PJJA 3ZMZB 1GFOA 3C4ZA 3E0ZA 1FMWA 1BR1A 2YU1A 2W80C 1MIVA 5LOVE 5GV0A 5EK4A 4DO0A 3ZJ2A 4XNKA 3T24A 2W61A 3DA3A 1HF8A 4OHFA 3VKHA 1NAFA 2ODUA 4AXPA 3C4WA 3O1IA 4I50E 2CLYC 2W81C 2NOXA 2X66A 1FIOA 4M1PA 3UFEA 4KMCA 3DP7A 2JMHA 2J1NA 3PE0A 4FSPA 2J1DG 3HKBE 2DNXA 3L09A 5LGNB 4IE6A 1QUUA 2B1EA 5F3JA 5L3EB 1WR6A 3PUGA 3OYXA 1MMAA 3VU7H 4EAHA 4B61A 3UPGA 3AA1B 4AI6A 3M65A 3VZUX 4UVCB 3JTYA 2LT3A 3H3AA 3SOLA 5HXSA 3PUQA 1US7B 2E9XC 2KWIB 3WI3A 4AYEC 2K24A 3JC6D 4DVDA 4AKGA 3FBZA 3CQXC 5LCYA 4IIJE 3SY9A 4FESA 3CQCB 2DI4A 1D1BA 3UUNA 3V5UA 2Y0LA 1HXTA 2HPLA 1G73A 4FMSA 4U74A 2K48A 2DCFA 4QXCB 1Y64B 3RPUA 3ESLA 2VKDA 2PORA 1E54A 3LK2A 2VWAA 4GCSA 5HWXA 3C64A 1LKXA 3LK42 2N2MA 2KXPA 4JEHB 1WYBA 4QKNA 1YS5A 4IHJE 5JDGA 3ZJ1A 2K4TA 4ZI2D 2C5JA 3VKGA 2UXXB 2BDEA 4BJNA 4H9RC 3NZPA 4QWNB 2M06A 3PORA 1MMGA 4B6XA 2EHOB 4MFRA 2IC6A 2MHLA 3PDYA 4XBFB 3PU3A 5LHGB 2FGRA 4EOZB 3RYFE 2X27X 1MMDA 2QA7A 2J4UP 5ADXL 5DL8A 5H6QB 3QRCA 2SPCA 2XTRA 5JR9C 3TKLB 4RJXA 1MNDA 3HKCE 4ZI3D 4D64A 2M07A 2D0TA 2YU2A 4I43B 1MMNA 3UUMA 4HN9A 3DTOA 4A56A 3AB3B 2DWKA 1HFAA 2VKHA 4NUUA 3LJCA 3NZQA 5LHHB 2A72A 2V7KA 3IHRA 2KT9A 3ZPOA 4BUMX 1YKEB 2LFUA 3R84B 2CWOA 3K8PC 4H9QC 5KDMC 4GF4A 2H7VC 5DL5A 4LSHA 2L8KA 1BH3A 4JLEA 2XTQA 2XUEA 3CX6B 3PUSA 3RRCA 1BR0A 2JQQA 2XQYA 2VKJA 4PFOA 4ASKA 2KC0A 2Q9QD 2C5KT 3F57A 3NBXX 2PRNA 4ZI2C 4D65A 3ZN1B 4EYYR 1S94A 4CI3B 4WW0A 2BZBA 2CXDA 4DBQA 5CA1E 3SZDA 2V1DB 4QQ1A 2PG8A 4O2BE 3F2EA 4TN7B 3HKEE 3C5OA 3BQLA 3ZMSB 1WRDA 2OA5A 5JREA 3AA6A 3VE2A 5FY1A 2PBIA 3LK2B 1MM4A 2ZLYA 4UEMA 5JDFA 2NW9A 1MNEA 3U78A 2KXPB 4ZI3C 2X67A 1MIYA 3ZYMA 5L3FB 4ILUA 5M4YA 4AZLA 4O4XA 4BJMA 3KVAA 4H63V 2XE2A 1S35A 4L9IA 3HOEA 2XAJB 1IJ6A 4DMVA 4MHCA 5HYAA 4PW8A 5GONE 3ZYLA 5AFUL 4E7ZA 3H37A 3D0TA 2XAGB 3FXDB 2MYSA 3N2KE 4JUYA 5F8PA 2JJ9A 4AQFA 1ORMA 3ZYKA 4ANJA 2Q9QC 4ZS2A 2JRKA 5ETWA 3SS1A 1T98A 3T20A 4BA9A 1LRZA 2CEAA 2Y0HA 4WBNE 1THQA 2MTQA 4F6RC 1P4TA 5IYZE 4HTEA 4FRXA 4AKMA 3CKDA 4HGAA 3KVBA 4AKIA 4GYRA 5L3DB 1KNZA 4GOUA 4TZ4C 3EMNX 3KDSE 5LXTE 4FZLA 3CMLA 5E0OA 4RLCA 3VZWX 3Q9DA 3RC3A 3EDVA 3RX6A 3IF8B 4EZHA 1ZHTA 1NWMX 3L3PA 1PRNA 4HKAA 5JDPA 4FSOA 3UAQA 4O4UA 5FYMA 4O3ZA 3P8CD 3N9NA 5FP3A 2XAQB 2QGSA 3EDUA 3W15B 1HS7A 4YJ3E 1OSMA 2XHEB 3ZC1A 3AA7A 3V8UA 3LK3A 3N9LA 1BR2A 2V7MA 4HFVA 3RRWA 4AQGA 3KVDD 3EVYA 3AA6B 4ERRA 1BXWA 3ONXA 3BQIA 2F1VA 5HWYA 4GYSA 1ZHCA 3A5XA 4O4HE 2IAKA 3AA0A 4GK5E 4U72A 4GCQA 1O3XA 4DBRA 2LSIA 4GCPA 4TV8E 2LSKA 1H6S1 2XE5A 3DA4A 4ISSA 5L2LA 1YD8G 3VHLA 5DL7A 1GFQA 2ZM2A 3KV9A 4D5UA 3EUHA 3PU8A 5EK3A 5G26A 1SA0E 4LSEA 4CI2B 5LNKA 1QJPA 4AYMC 3FBLA 3K3QC 4F4BA 4QXBB 3O0EA 1LVFA 2O4VA 2KZ7A 5PRNA 3J7Yq 2WSSV 4LSIA 3ZEFB 1HG2A 3MA9A 2G0UA 5LG4A 3KV6A 4E7SA 2X9WA 5LGTB 4O3WA 2N2NA 2ZLDA 3E22E 4H9SE 4YHJA 4H9PC 2NTXA 3ZCIA 3WAJA 1ZHXA 1PHOA 3VZTX 2Y48B 3KBTA 5LGUB 3SYBA 2LEHA 4K0UA 3PTRB 1UX4A 5HXHA 3CWZB 1IZNA 2JMKA 3CVRA 4IE4A 3T8OA 2H3RA 3BQKA 2LM9A 2LOSA 3ANWA 5CB4E 3CX8B 5TAOA 3O9XA 2XAHB 3ZC0A 4RJWA 5FNVE 2XG6A 2E9XA 3LK41 3JC6C 5LJNA 1BT9A 4AUIA 4U9CA 6PRNA 1G90A 1FEWA 5DQWA 5JH7E 2KDYA 4TUYE 3ZCJA 1WLXA 1ZHWA 4XNLA 2EHOD 3ZMUB 3ZMTB 4EXTA 2CMRA 2P9BA 3AA7B 3K3NA 4O2AE 1MM5A 2V26A 3LK3B 4MALA 5EE2A 4DNDA 3MKDA 5FXZA 2VL8A 3OKQA 4TV9E 2WBLA 3S4UA 1UX5A 2LE8A 4UELA 3AA0B 2X0LB 1AJ3A 5JDNA 5FXWA 4HE8A 3Q5XA 3V5SA 3AAEA 3TZGA 4JFBA 4UXNB 2ACXA 4DMWA 2D5UA 5L3BB 2OMFA 4PUXA 3UU2A 3UULA 4EYUA 3N9PA 5JDMA 4L5GA 1QSDA 2CA5A 4X1YE 3KINB 2XE1A 2KZ7B 3POXA 2A3DA 5JR9A 2XMXA 4QX7B 5DQVA 2JPFA 1QJ8A 4PJMA 2MNHA 2K0LA 3GN5A 2X9XA 7PRNA 2LSYA 2ES0A 3HWBA 2WMNA 2VASA 2XTLA 4E1SA 2CLYB 1UCUA 3MXZA 4OYKA 2EHOC 2LSGA 3RYIE 3NSGA 4GK0E 3OYZA 1VRBA 4PK6A 5A1LA 3N5LA 4JEUB 5J1GA 4PJLA 2IW5B 3MK7C 4H9NC 4QHOA 4C91A 1IZNB 2CE7A 3AVSA 3ETUA 3ANWB 2X9YA 3KV4A 2RA1A 2CXLA 3HKDE 1GFNA 2ZFGA 4CQIA 5LJMA 4AKLA 3T0SA 4RLBA 5KMGP 1QJ9A 3P7IA 4P0BA 2E9XB 1Z0PA 3B57A 3PRNA 4ZS3A 2PFVA 2WWUA 4PK5A 2KMFA 1IJ5A 3QUJA 4H63H 4IE5A 1Q9GA 5JVDE 1VOMA 2LOPA 4ZOLE 2A2FX 5T5FA 2KLQA 2C5IT 3I1AA 4GHBA 2DHRA 2YEVC 5HXRA 2GE4A 1OPFA 3ZMVB 1IAPA 2N1GA 2W63A 4CXWA 3O1JA 3SY7A 2BVMA 4JCHA 4Z3TA 3FB2A 1ZHZA 3MACA 4UV8B 4O49A 4AYID 2E8IA 3MJXA 4MLKA 3DJBA 3QC9A 4YJ2E 2ERVA 3QRAA 1FMVA 3LG7A 1SHZC 3IEEA 5J2TE 2X9HA 4UIGA 3AAEB 5DABA 2YK0A 3PURA 4C90A 1U5PA 2CCQA 3R6NA 4KR4A 4PAGA 1D1CA 2DWGA 4ISTA 4OK0A 4KP3C 4LSFA 4UF0A 2MBGA 1ZV4X 1MPFA 3Q2MA 2L9QA 4H9OC 3ZN0B 1D0YA 2JMMA 4EZ4A 4G76A 2Q9QA 2N2LA 3SZVA 5JR9B 4KRAA 4BAYB 1H7CA 5JDHA 1LVKA 4O3YA 4AKRA 4XZCA 3PQSA 4KBMB 3U3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFU L;  3AAE A;  3LK2 A;  4AKR B;  1IZN B;  2KZ7 A;  3LK4 2;  3LK4 1;  2KXP A;  3AA6 A;  3AAE B;  3AA1 A;  3AA7 A;  3LK2 B;  3LK3 A;  2KZ7 B;  2KXP B;  3AAA A;  3AA6 B;  5ADX K;  3AA1 B;  3AA7 B;  3AA0 A;  3LK3 B;  5AFU K;  3AAA B;  5ADX L;  4AKR A;  3AA0 B;  1IZN A; 
#chains in the Genus database with same CATH topology
 2K9A A;  4JI2 T;  4P09 A;  2J4G A;  3MZK B;  2YPV A;  2WS3 A;  2XM2 A;  2WM9 A;  4N58 A;  2JQ9 A;  3OBV E;  4CXY A;  2UUC T;  4C4V B;  2PJQ A;  5AQH B;  4GIW A;  4IDO A;  4Z90 A;  2NP9 A;  3RBH A;  3NRX A;  1GFM A;  1OWA A;  3LBX A;  2XAF B;  3I0Q A;  1G8X A;  3PJA A;  4NXN T;  4AYD C;  3WI5 A;  3C4X A;  4Z8X A;  2W4X A;  2MOZ A;  3AE5 A;  3ZLI A;  4PJN A;  4U7I A;  4WNK A;  2I59 A;  2NWB A;  2VK9 A;  5LBM A;  4IGU A;  2WAU A;  5IHY A;  2RP4 A;  5HXE A;  5E79 O;  2BKN A;  4AKR B;  4DV6 T;  4ZXL A;  2ZM0 A;  4O4I E;  3RKO A;  2BS2 A;  4MBQ A;  4FRT A;  4OYJ A;  5ABE A;  2BVL A;  2Y2X A;  2XQ4 A;  2H89 A;  5FY0 A;  5B5E O;  2XAS B;  4CXX A;  5FMN A;  3VY9 X;  4AKH A;  2AE9 A;  4KR8 A;  5AQK B;  3TLS A;  2HH7 A;  2LHF A;  3QB5 A;  3AA1 A;  3AE2 A;  5JDL A;  2XY8 B;  2W00 A;  2C0S A;  3WAK A;  1WYC A;  4IDN A;  2FGQ X;  4FZM A;  2LJL A;  5JRC B;  5IYU A;  4QH4 A;  4WBO A;  3BK9 A;  4FI5 A;  4IDQ A;  1E1H B;  3PQU A;  3RH3 A;  4YFS A;  2WDV A;  3EI0 A;  2F4V T;  5LBQ B;  3O4X E;  3O1H A;  5GTI O;  3ZT7 A;  4Z91 A;  4KHP T;  3A7M A;  3N9O A;  4PJJ A;  4WZX A;  2LKH A;  2R8A A;  3AEB A;  2IUB A;  2YU1 A;  1KFY A;  2W80 C;  5GV0 A;  4DO0 A;  3T24 A;  2W61 A;  3VKH A;  4KMC A;  4COF A;  2JMH A;  3UU6 A;  2XQ9 A;  4JI4 T;  2J1D G;  3HKB E;  2B1E A;  3OYX A;  1YQ3 A;  3M65 A;  3VZU X;  3H3A A;  3SOL A;  5HXS A;  3UQ7 A;  1US7 B;  2KWI B;  3JC6 D;  2DI4 A;  3FZL B;  1YXR A;  4U74 A;  1GQE A;  2A9U A;  4GCS A;  5HWX A;  3RIU C;  1YS5 A;  4IHJ E;  4HWC A;  4ZI2 D;  3VKG A;  2UXX B;  3NZP A;  5HEH A;  4QWN B;  1MMG A;  4B6X A;  3PGU A;  2EHO B;  2MHL A;  3VRA A;  3RYF E;  1MMD A;  2QA7 A;  5ADX L;  2UXD T;  2AXD S;  2SPC A;  2XTR A;  4RJX A;  2M07 A;  1ZOY A;  4JI8 T;  4TNV A;  3DTO A;  2DWK A;  2X0H A;  2A72 A;  2KT9 A;  1YKE B;  4X65 T;  4I0U A;  2CWO A;  4GF4 A;  5KXJ A;  4LSH A;  3CX6 B;  3PUS A;  2JQQ A;  3NBX X;  1XNQ T;  3AE4 A;  4D65 A;  3ZN1 B;  4QQ1 A;  3G06 A;  5JRE A;  3AA6 A;  2E5V A;  2ZLY A;  3U78 A;  2KXP B;  5L3F B;  2R4P A;  4BJM A;  2XE2 A;  3HOE A;  4L9I A;  2BG9 C;  1IJ6 A;  4YSZ A;  4PW8 A;  3H37 A;  3N2K E;  4YT0 A;  4AQF A;  2Q9Q C;  4JI1 T;  3SS1 A;  4BA9 A;  5AQP B;  4F6R C;  4HTE A;  4FRX A;  3CKD A;  4HGA A;  5AQT B;  1ZP0 A;  5LXT E;  3CML A;  4DV2 T;  1ZHT A;  5AQI B;  4HWD A;  1NWM X;  3UAQ A;  3BRY A;  5FP3 A;  2XAQ B;  4YJ3 E;  1OSM A;  2XHE B;  3RI5 A;  3ZKR A;  3EVY A;  2M6I A;  2K3W A;  2IAK A;  4U72 A;  2YOE A;  4DBR A;  2LSK A;  4GKJ T;  1H6S 1;  5L2L A;  3VHL A;  5FVK A;  4NXM T;  2ZM2 A;  4D5U A;  5EK3 A;  4CI2 B;  2XQA A;  5LNK A;  3FBL A;  1LVF A;  2O4V A;  1W0A A;  2G0U A;  4NIQ A;  3KV6 A;  2WVP A;  2ZLD A;  4H9P C;  3RLF F;  2V6X A;  3VZT X;  3KBT A;  1UX4 A;  1UUS A;  1IZN A;  4LF5 T;  2JMK A;  3BQK A;  2LOS A;  2XAH B;  2OV9 A;  3RQW A;  2XZE A;  2E9X A;  3LK4 1;  4AUI A;  4DV0 T;  5DQW A;  5JH7 E;  2KDY A;  4TUY E;  5ABF A;  1I6Z A;  2EHO D;  3SFD A;  5B66 O;  3AA7 B;  3LK3 B;  4MAL A;  4DND A;  3MKD A;  2WBL A;  2IWV A;  2X0L B;  4YTM A;  5FXW A;  4HE8 A;  3Q5X A;  3X1D A;  3V5S A;  5LMN T;  3VR9 A;  4PJ0 O;  2WDR A;  3UU2 A;  5L3B B;  2D5U A;  4IL9 A;  4EYU A;  5JDM A;  2CA5 A;  2XJ7 A;  3KIN B;  2XE1 A;  3RF1 A;  5DQV A;  4PJM A;  2K0L A;  7PRN A;  2LSY A;  2W66 A;  4JI7 T;  2WMN A;  3HWB A;  3MXZ A;  2LSG A;  3RYI E;  4QH1 A;  5J1G A;  4DUZ T;  2CE7 A;  3ANW B;  2X9Y A;  3NJT A;  2XQ3 A;  5LJM A;  4LF6 T;  5KMG P;  2RPA A;  2PFV A;  1IJ5 A;  1KF6 A;  4IE5 A;  5JVD E;  1VOM A;  5T5F A;  2A2F X;  2KLQ A;  2DHR A;  2VVS A;  3ZMV B;  3O1J A;  5AQU B;  4O49 A;  4UV8 B;  3QRA A;  3LG7 A;  1SHZ C;  3IEE A;  5J2T E;  3AAE B;  2VQF T;  4KR4 A;  4PAG A;  1D1C A;  4EGW A;  4KP3 C;  3ZN0 B;  2YKS A;  3UU4 A;  5JDH A;  1LVK A;  4IRE A;  4XZC A;  1W9R A;  3U3I A;  2WB5 A;  5BMV E;  5HEU A;  3PUW F;  5FVN A;  2HN1 A;  5LMU T;  1OED A;  3Q5W A;  2CHO A;  3JAE A;  2CHN A;  3JAD A;  5FY7 A;  3SRZ A;  3AAA A;  5EZY E;  4L0R A;  3C98 B;  1CUN A;  4DR7 T;  1R8I A;  4ILA A;  2BKO A;  4AYN A;  2UXN B;  2BKP A;  2R4L A;  4PNI A;  3NRY A;  3ZST A;  3L8R A;  3IBP A;  2Y7S A;  2XM1 A;  2L3L A;  3RYH E;  4U33 A;  3KFW X;  4JI0 T;  1N33 T;  4UVA B;  5C8Y E;  3HW9 A;  4FZN A;  2R6G F;  2JQY A;  5ADX K;  1GFP A;  3PUV F;  5HXC A;  4RL9 A;  4I55 E;  2CWY A;  4EIW A;  4UF0 B;  2FBW A;  3HOL A;  4O3X B;  4F8H A;  2ODV A;  3KBU A;  4OFZ A;  2VKO A;  4DR2 T;  3SYS A;  4TX5 A;  4TWH A;  2VQE T;  1N34 T;  3AAI A;  2XE3 A;  3Q5E A;  5AQM B;  3L39 A;  3I9Y A;  5AQG B;  4AQF C;  3UUX B;  2V6Y A;  4ZHQ E;  4CI1 B;  1ZEE A;  2IC9 A;  1M7K A;  4V1A v;  3DWO X;  4FOZ A;  3RC8 A;  4HFI A;  1NEN A;  2QTK A;  5D5D A;  4FJO A;  4HFC A;  3OJA A;  3RYC E;  2CXF A;  4X20 E;  2Y8D A;  1XZY A;  4IDZ A;  4O8S A;  4ZI7 E;  3G7G A;  2H7O A;  4G63 A;  3E08 A;  2E5L T;  2HPJ A;  1T16 A;  2LHN A;  5JDQ A;  2UUA T;  3VR8 A;  4PK4 A;  2IML A;  5LA6 E;  2WMO A;  4EED A;  1MIW A;  2LSJ A;  3I0O A;  3JAF A;  4IL4 A;  4YY3 T;  3SFE A;  1FMW A;  1MIV A;  5LOV E;  3P4R A;  5EK4 A;  3ZJ2 A;  3DA3 A;  1HF8 A;  4OHF A;  4DV3 T;  4AXP A;  2BS4 A;  2W81 C;  2B76 A;  1FIO A;  3UFE A;  2J1N A;  5LGN B;  1QUU A;  3FZF B;  4EAH A;  3UPG A;  4JI5 T;  4AI6 A;  4N74 A;  1IBK T;  3JTY A;  2E9X C;  5LCY A;  3CQC B;  1D1B A;  1HXT A;  2HPL A;  2K48 A;  4QXC B;  2VKD A;  1LKX A;  3LK4 2;  5JDG A;  2K4T A;  2C5J A;  4BJN A;  4TNW A;  4B3S T;  4HFB A;  4MFR A;  2IC6 A;  3TLU A;  4EOZ B;  3RIF A;  2XQ8 A;  5DL8 A;  5H6Q B;  3QRC A;  3AE7 A;  2LRK A;  4ZI3 D;  2AXT O;  2YU2 A;  3UUM A;  4NUU A;  4BUM X;  2V7K A;  4KHZ F;  3K8P C;  5DL5 A;  3AEG A;  2XUE A;  1XWM A;  4ASK A;  2KC0 A;  1IBL T;  4X62 T;  2UUB T;  4CI3 B;  3HKE E;  3VE2 A;  2PBI A;  3LK2 B;  4B3R T;  4UEM A;  2NW9 A;  3ZYM A;  2X0Y A;  1S35 A;  4TWF A;  3AEC A;  4DV4 T;  4DMV A;  1DU2 A;  4LF4 T;  5AFU L;  4E7Z A;  3FXD B;  1YQ4 A;  2XAG B;  2FJD A;  1ORM A;  3ZYK A;  4ANJ A;  3AE8 A;  2UXB T;  3T20 A;  1LRZ A;  2CEA A;  2Y0H A;  1I94 T;  4CTD A;  1OED C;  2X9K A;  4GYR A;  5L3D B;  3EHZ A;  4K3B A;  3VZW X;  3EDV A;  3RX6 A;  4FSO A;  4O3Z A;  3P8C D;  4FQE A;  3W15 B;  2XSB A;  1HS7 A;  3ZT6 A;  3V8U A;  2R4N A;  2V7M A;  3RRW A;  3ONX A;  4GCQ A;  1ZHC A;  3AA0 A;  4GK5 E;  4GCP A;  2PTF A;  4TV8 E;  4LFB T;  2XE5 A;  3UU5 A;  5TIS O;  1E7P A;  2ZM6 T;  4QXB B;  2KZ7 A;  4LSI A;  1HG2 A;  3AE9 A;  4EV6 A;  5LG4 A;  5AQQ B;  2QRX A;  4E7S A;  4H9S E;  4YHJ A;  2Y48 B;  3PTR B;  3RQU A;  2E2A A;  3T8O A;  3O9X A;  2LM9 A;  5CB4 E;  4X66 T;  4YTN A;  2XG6 A;  3AE3 A;  3P4P A;  1BT9 A;  4U9C A;  6PRN A;  1FEW A;  3ZCJ A;  3AE6 A;  1ZHW A;  4XNL A;  3ZMU B;  2OLT A;  4U2Y A;  3ZMT B;  5JTG A;  2UU9 T;  4O2A E;  1MM5 A;  2V26 A;  3PGR A;  5FXZ A;  3OKQ A;  1AJ3 A;  3P50 A;  5JDN A;  5ABH A;  4PUX A;  3UUL A;  2FJE A;  2WJQ A;  5JR9 A;  2XMX A;  2JPF A;  5H2F O;  2X9X A;  4E1S A;  5C2T A;  4OYK A;  4GK0 E;  5A1L A;  3AEF A;  3N5L A;  5F5W A;  4PJL A;  4H9N C;  4DR1 T;  5KAI O;  4C91 A;  3AVS A;  2RA1 A;  2CXL A;  3AE1 A;  4AKL A;  3T0S A;  4RLB A;  4C4V A;  4H63 H;  4PR7 A;  2LOP A;  4ZOL E;  1HNZ T;  2GE4 A;  5HXR A;  1OPF A;  1IAP A;  5ABG A;  4JCH A;  4AYI D;  2E8I A;  3DJB A;  4YJ2 E;  4ZZB A;  1FMV A;  3UFG A;  5DAB A;  4C90 A;  1U5P A;  4X64 T;  1KEY A;  4IST A;  4KX6 A;  3DWN A;  3AXJ B;  5IWA T;  1MPF A;  2L9Q A;  3NVO A;  4H9O C;  4G76 A;  2N2L A;  2LLY A;  2FJA A;  1H7C A;  1E2A A;  4AKR A;  1J5W A;  1VCT A;  5FVL A;  4KBM B;  4KI0 F;  3GN5 B;  5HAX A;  1HXU A;  1IBM T;  1YKH B;  2F1T A;  4JI6 T;  4DID B;  1S5L O;  1HX1 B;  3B13 A;  2ZM8 A;  4J2C A;  5JQG E;  4QH5 A;  3QNU A;  4XAX B;  3T1H T;  4O4L E;  2YNK A;  5DJQ C;  1U4Q A;  2XQ7 A;  3VY8 X;  5LHI B;  5AQR B;  2Y0K A;  3JCU O;  1HX8 A;  5H6R B;  1HCI A;  3LFM A;  2VUR A;  2JIW A;  4G75 A;  3CIR A;  4IE0 A;  3C51 A;  5JRC A;  3C50 A;  2BG9 B;  2VL0 A;  3K3O A;  2XQ6 A;  2M67 A;  3OVU A;  4UVB B;  3FYX A;  4PFP A;  2Q9Q B;  5J0Z A;  2V5D A;  4UV9 B;  3GMI A;  2NW8 A;  4DV1 T;  5CGM A;  5L3C B;  4X1I E;  4JI3 T;  2W62 A;  1JNZ A;  4O4J E;  1B7T A;  2I6H A;  4U7Y A;  4G2A A;  3LDQ B;  4LML A;  1YW0 A;  1Q9F A;  4KUM B;  2XSA A;  3N9M A;  4N75 A;  4YHH T;  2LHR A;  2BBH A;  3HA4 A;  3HR0 A;  3UU3 A;  4QXH B;  3N2G E;  4C69 X;  1X79 A;  4IE7 A;  4HEA A;  4EB6 E;  3LBX B;  3UTK A;  4LF9 T;  4NUV A;  1X9B A;  3QK6 A;  5AQO B;  3K19 A;  4CN1 A;  2K5B B;  1XMO T;  1OXZ A;  2WZI A;  4E1T A;  1SE7 A;  4TWD A;  3N9Q A;  5L47 A;  5AFU K;  3J9X 1;  2NW7 A;  1ZHY A;  4FUV A;  4QX8 B;  5AQN B;  4X5T A;  5DL6 A;  2Y6X A;  4YTP A;  4DR4 T;  3KV5 A;  1D1A A;  2CRB A;  2V5C A;  2EHO A;  2N9D A;  2CPT A;  4XNK A;  1NAF A;  2CLY C;  3DP7 A;  3PE0 A;  1VCS A;  4FSP A;  2DNX A;  3L09 A;  3RHW A;  5F3J A;  5L3E B;  3PUG A;  4HFE A;  1MMA A;  3AA1 B;  1KNR A;  3PUQ A;  3WI3 A;  4AYE C;  2ACZ A;  4DVD A;  4AKG A;  3FBZ A;  3CQX C;  3SY9 A;  4FES A;  3UUN A;  3A0B O;  4FMS A;  2DCF A;  1Y64 B;  2LM2 A;  3ESL A;  5FL0 A;  2N2M A;  2IHR 1;  2IWW A;  2KXP A;  5FL1 A;  1T1L A;  1XDO A;  2YDQ A;  4H9R C;  1N36 T;  5AQS B;  4XBF B;  5LHG B;  3H3M A;  2J4U P;  3KZI O;  3WU2 O;  3TLW A;  3TKL B;  5JR9 C;  5L4E A;  4I43 B;  1MMN A;  1XMQ T;  4HN9 A;  1KNP A;  3ZPO A;  3IHR A;  3A0H O;  1J1J A;  2LFU A;  3R84 B;  4H9Q C;  5KDM C;  3OTO T;  1BH3 A;  3QB5 K;  3RRC A;  1BR0 A;  2XQY A;  2VKJ A;  2Q9Q D;  3F57 A;  4U3C A;  5HCJ A;  2PRN A;  4ZI2 C;  4EYY R;  1S94 A;  4WW0 A;  3SZD A;  2PG8 A;  4O2B E;  5AQV B;  3F2E A;  3C5O A;  3BQL A;  2IDO B;  1WRD A;  2OA5 A;  3ZMS B;  5FY1 A;  3P4S A;  1MM4 A;  5JDF A;  5M4Y A;  3KVA A;  5KAF O;  1QLB A;  5HEG A;  2BG9 E;  5HYA A;  5HCM A;  3ZYL A;  2VVN A;  3D0T A;  2MYS A;  5F8P A;  2JJ9 A;  3PUZ F;  4ZS2 A;  5ETW A;  1T98 A;  4HFH A;  4WBN E;  1THQ A;  4JBW F;  5G38 A;  2MTQ A;  5IYZ E;  4AKM A;  1NEK A;  3Q5D A;  3KVB A;  1T8B A;  4AKI A;  1WCR A;  4TZ4 C;  3KDS E;  2XPK A;  5E0O A;  3P4Q A;  3Q9D A;  2WY2 A;  3IF8 B;  3UQ4 A;  3L3P A;  5L4H A;  3UU8 A;  4HKA A;  4LFA T;  5JDP A;  4O4U A;  3P4W A;  3N9N A;  3EDU A;  3UUB A;  5G39 A;  3ZC1 A;  3AA7 A;  3LK3 A;  4AQG A;  3KVD D;  2M6B A;  3AA6 B;  4ERR A;  3BQI A;  1W0B A;  4GYS A;  3A5X A;  5CJ5 A;  2LSI A;  2UXC T;  4A97 A;  3DA4 A;  4ISS A;  5DL7 A;  2HN2 A;  3EUH A;  1CHU A;  5G26 A;  1SA0 E;  2YDR A;  1QJP A;  2WZH A;  2WU2 A;  5HEO A;  5IUX A;  2W67 A;  1WFD A;  4CN4 A;  2NTX A;  3ZCI A;  4P1N A;  3WAJ A;  3SYB A;  2LEH A;  4K0U A;  1XDP A;  1HNW T;  3CWZ B;  3CVR A;  4IE4 A;  3ANW A;  2WQY A;  3CX8 B;  5TAO A;  2MPK A;  3NWI A;  3ZC0 A;  5FNV E;  4YSY A;  5LJN A;  2D9D A;  1G90 A;  4LF7 T;  2FJB A;  5EE2 A;  4TV9 E;  3S4U A;  1UX5 A;  4UEL A;  4AIU A;  1T72 A;  5LB7 B;  3AAE A;  3TZG A;  2ACX A;  2QYW A;  4DMW A;  2R89 A;  3N9P A;  2A3D A;  4NPP A;  2YN6 A;  1QJ8 A;  2MNH A;  1T7S A;  4AQY T;  2ES0 A;  2XTL A;  2EHO C;  3FZM B;  4PK6 A;  3MK7 C;  1N32 T;  3B5M A;  1IZN B;  3ONL C;  3KV4 A;  2ZFG A;  4CQI A;  1Y01 A;  4P0B A;  2E9X B;  4WYV A;  2J47 A;  4ZS3 A;  2WWU A;  2KMF A;  3QUJ A;  3PUY F;  1Q9G A;  5ABF B;  2C5I T;  3I1A A;  1W09 A;  2YEV C;  2N1G A;  4B3M T;  3SY7 A;  2BVM A;  3FB2 A;  3MAC A;  3QC9 A;  2X9H A;  4IT4 A;  4UIG A;  2YK0 A;  3PUR A;  4IL6 O;  2DWG A;  4OK0 A;  3AED A;  4LSF A;  4UF0 A;  1ZV4 X;  3Q2M A;  4EZ4 A;  4ILC A;  4A5X A;  4KRA A;  4O3Y A;  3PQS A;  1KK7 A;  4FT6 A;  3RKG A;  8PRN A;  2X68 A;  3CQG B;  3PGS A;  1D0X A;  2D0U A;  3PUA A;  2I0M A;  1WR0 A;  2Z6E A;  4X1K E;  1XNR T;  5CA0 E;  3PUX F;  1HXX A;  4ADZ A;  2IIU A;  2JQK A;  3POU A;  3HI2 A;  3GA8 A;  3VE1 A;  3GP6 A;  3FXE B;  2ODJ A;  1V9D A;  4K0K T;  2D2S A;  2R88 A;  2W0G A;  1HTJ F;  4CZZ B;  1D0Z A;  2BS3 A;  5FXX A;  3HL6 A;  3AVR A;  2X51 A;  2CBJ A;  3ZT5 A;  5LP6 E;  2V7L A;  1EZ3 A;  2ZMA A;  5LYJ E;  5EK2 A;  3A2S X;  4AFK A;  3N2O A;  1OED B;  3I9W A;  3DZM A;  2KND A;  1Z8U A;  2YIN A;  5FXV A;  4JYA T;  1FJG T;  2YDS A;  5KX5 E;  2DLR A;  3F31 A;  3POQ A;  2CM0 A;  3AAA B;  3PF1 A;  4UR9 A;  4A98 A;  2DL1 A;  5G3A A;  1BR4 A;  2KIN B;  1HG5 A;  4P0A A;  3FHN A;  4AIS A;  2V7J A;  1UGO A;  4HWH A;  2NTY A;  3SWH A;  3ETV A;  4DR3 T;  4N78 D;  5LG3 A;  4HWF A;  3CX7 B;  4N59 A;  2VB6 A;  3UT5 E;  4DR6 T;  5FKY A;  4DV5 T;  1ZKE A;  3GWH A;  2KWH A;  1L0V A;  5C3J A;  5L3G B;  2V7I A;  4I4T E;  3WI4 A;  2E9X D;  5J2U E;  2GK9 A;  4YLH A;  4DR5 T;  3CPZ A;  3ZMZ B;  4ILB A;  1GFO A;  3C4Z A;  4OX9 T;  4JV5 T;  3E0Z A;  2CBI A;  1BR1 A;  4YSX A;  2WJR A;  4ZZC A;  4C00 A;  2ODU A;  2V6Y B;  2LKG A;  3C4W A;  3O1I A;  4I50 E;  2NOX A;  2X66 A;  4M1P A;  3A8Y C;  2QVA A;  4IE6 A;  3EAB A;  1UUR A;  1WR6 A;  3ZSS A;  5BR8 T;  3VU7 H;  4B61 A;  4UVC B;  2LT3 A;  3TLV A;  4U31 A;  2K24 A;  3QOF A;  5AQL B;  3PV0 F;  4IIJ E;  3V5U A;  2Y0L A;  1G73 A;  3RPU A;  4DV7 T;  1HR0 T;  1E54 A;  2POR A;  2VWA A;  3LK2 A;  3C64 A;  3FZK B;  3IA3 A;  4JEH B;  1WYB A;  4QKN A;  5CFB A;  1UK5 A;  3ZJ1 A;  2FUP A;  3AEE A;  1HNX T;  2BDE A;  4YXD A;  2M06 A;  3POR A;  3PDY A;  3CK6 A;  3PU3 A;  2FGR A;  2X27 X;  3LSV A;  5AQJ B;  1J5E T;  3RIA A;  1MND A;  3HKC E;  4D64 A;  4GKK T;  4EEB A;  2D0T A;  4A56 A;  3AB3 B;  4DUY T;  1HFA A;  2VKH A;  3LJC A;  3NZQ A;  5LHH B;  2H7V C;  2L8K A;  4JLE A;  1SUM B;  2XTQ A;  5HEJ A;  3OPC A;  4IDP A;  4PFO A;  2C5K T;  4K3C A;  4B3T T;  4CN6 A;  5CA1 E;  4DBQ A;  2BZB A;  2CXD A;  2V1D B;  4TN7 B;  4UB8 O;  1MNE A;  4ZI3 C;  2X67 A;  1MIY A;  4ILU A;  2WP9 A;  4AZL A;  4O4X A;  4H63 V;  3K1S A;  2XAJ B;  4LFC T;  4MHC A;  5GON E;  4JUY A;  2F1C X;  4LMJ A;  2JRK A;  1M62 A;  3BRZ A;  2WDQ A;  2HHH T;  3JCF A;  4LMK A;  1P4T A;  4UB6 O;  2R4O A;  2V8S V;  2W2U A;  1OED E;  4GOU A;  1KNZ A;  3EMN X;  4FZL A;  4RLC A;  3RC3 A;  4EZH A;  1PRN A;  4U2Z A;  5FYM A;  2QGS A;  4HFD A;  1JNR A;  2MAW A;  3N9L A;  1BR2 A;  4HFV A;  1BXW A;  2F1V A;  5HWY A;  4O4H E;  1O3X A;  3ABV A;  2KSR A;  1YD8 G;  1GFQ A;  3KV9 A;  3PU8 A;  4LSE A;  4AYM C;  3K3Q C;  4F4B A;  3O0E A;  5PRN A;  3J7Y q;  2WSS V;  3ZEF B;  3MA9 A;  5GTH O;  3RGL A;  5LGT B;  2X9W A;  4O3W A;  2N2N A;  3E22 E;  5AQF B;  1ZHX A;  1PHO A;  5LGU B;  3NKZ A;  5HXH A;  2H3R A;  2BBJ A;  4RJW A;  4Q25 A;  3JC6 C;  3ONJ A;  1WLX A;  4EXT A;  2CMR A;  2P9B A;  2H88 A;  3K3N A;  2VL8 A;  3RIU A;  2LE8 A;  3AA0 B;  3T1Y T;  4JFB A;  2WWV A;  4UXN B;  3AXJ A;  2OMF A;  4L5G A;  1QSD A;  4X1Y E;  2NR4 A;  2KZ7 B;  3POX A;  2WU5 A;  2JQH A;  4QX7 B;  2WCA A;  3M3Z B;  3GN5 A;  2VAS A;  2CLY B;  1UCU A;  4HWI B;  3NSG A;  3OYZ A;  1VRB A;  2J62 A;  4JEU B;  2IW5 B;  4QHO A;  3TLT A;  3BS0 A;  3ETU A;  3HKD E;  1GFN A;  4ZEY A;  1QJ9 A;  3P7I A;  1Z0P A;  3B57 A;  3PRN A;  4LF8 T;  4PK5 A;  3FZH B;  4GHB A;  3EAM A;  2W63 A;  4CXW A;  4Z3T A;  1ZHZ A;  3MJX A;  4MLK A;  2ERV A;  2BG9 A;  3AEA A;  2CCQ A;  3PJA J;  3R6N A;  2XQ5 A;  2LRL A;  2MBG A;  1D0Y A;  2JMM A;  2Q9Q A;  3SZV A;  5JR9 B;  4BAY B;  3VRB A; 
#chains in the Genus database with same CATH homology
 1KK7 A;  2K9A A;  3GN5 B;  5HAX A;  1HXU A;  4FT6 A;  5BMV E;  8PRN A;  1YKH B;  5FVN A;  2F1T A;  2X68 A;  3CQG B;  4P09 A;  3B13 A;  1D0X A;  3Q5W A;  2ZM8 A;  3MZK B;  4J2C A;  5JQG E;  2D0U A;  4XAX B;  3PUA A;  2YPV A;  4O4L E;  5FY7 A;  3SRZ A;  2WM9 A;  3AAA A;  5EZY E;  4N58 A;  4L0R A;  2Z6E A;  2YNK A;  5DJQ C;  4X1K E;  1U4Q A;  3C98 B;  1CUN A;  3OBV E;  4CXY A;  5CA0 E;  1HXX A;  4ADZ A;  2PJQ A;  4GIW A;  4AYN A;  2NP9 A;  2UXN B;  3POU A;  3VY8 X;  3HI2 A;  5LHI B;  3GA8 A;  3RBH A;  3NRX A;  1GFM A;  1OWA A;  3LBX A;  4PNI A;  3FXE B;  3NRY A;  3GP6 A;  2Y0K A;  2XAF B;  3VE1 A;  2ODJ A;  3I0Q A;  1G8X A;  1HX8 A;  1V9D A;  5H6R B;  3IBP A;  1HCI A;  2D2S A;  2Y7S A;  3LFM A;  2W0G A;  2L3L A;  1HTJ F;  3RYH E;  4AYD C;  3KFW X;  4CZZ B;  1D0Z A;  4G75 A;  3WI5 A;  4UVA B;  5C8Y E;  3HW9 A;  4FZN A;  4IE0 A;  5FXX A;  3C4X A;  3C51 A;  3HL6 A;  4Z8X A;  5JRC A;  3C50 A;  5ADX K;  2MOZ A;  1GFP A;  3AVR A;  2X51 A;  4PJN A;  5HXC A;  3ZLI A;  3K3O A;  4WNK A;  5LP6 E;  2I59 A;  2V7L A;  1EZ3 A;  2M67 A;  2CWY A;  2ZMA A;  2NWB A;  2VK9 A;  4I55 E;  4EIW A;  4RL9 A;  5LYJ E;  4UF0 B;  4UVB B;  3FYX A;  4PFP A;  5LBM A;  3HOL A;  4IGU A;  5EK2 A;  4O3X B;  2WAU A;  2Q9Q B;  2RP4 A;  5IHY A;  4UV9 B;  5HXE A;  3GMI A;  3A2S X;  4AFK A;  2ODV A;  3KBU A;  4AKR B;  4OFZ A;  2NW8 A;  2ZM0 A;  2VKO A;  4O4I E;  3RKO A;  5L3C B;  4X1I E;  3N2O A;  4MBQ A;  2W62 A;  3SYS A;  4FRT A;  4TX5 A;  4O4J E;  1B7T A;  3I9W A;  4OYJ A;  2BVL A;  2KND A;  4G2A A;  2YIN A;  3AAI A;  5FXV A;  2XE3 A;  2Y2X A;  1YW0 A;  1Q9F A;  3I9Y A;  4KUM B;  5KX5 E;  2DLR A;  3F31 A;  4AQF C;  3UUX B;  3N9M A;  3POQ A;  5FY0 A;  2CM0 A;  3AAA B;  2LHR A;  4ZHQ E;  4CI1 B;  3HA4 A;  3HR0 A;  2XAS B;  4CXX A;  5FMN A;  1ZEE A;  4QXH B;  3VY9 X;  2IC9 A;  4N59 A;  1BR4 A;  2KIN B;  3N2G E;  1HG5 A;  4AKH A;  4P0A A;  4C69 X;  3FHN A;  1X79 A;  4IE7 A;  4HEA A;  4EB6 E;  2V7J A;  3LBX B;  4V1A v;  3UTK A;  4FOZ A;  4KR8 A;  4NUV A;  2NTY A;  2HH7 A;  3RC8 A;  2LHF A;  3AA1 A;  5JDL A;  3SWH A;  3QK6 A;  2QTK A;  3K19 A;  5D5D A;  3ETV A;  4N78 D;  2K5B B;  2W00 A;  4FJO A;  3CX7 B;  3OJA A;  2C0S A;  2CXF A;  1OXZ A;  4X20 E;  2VB6 A;  2Y8D A;  3RYC E;  3UT5 E;  3WAK A;  4IDZ A;  1WYC A;  4E1T A;  2FGQ X;  4FZM A;  4O8S A;  4ZI7 E;  3N9Q A;  2LJL A;  3G7G A;  5AFU K;  2H7O A;  4G63 A;  5JRC B;  5IYU A;  3J9X 1;  3E08 A;  4WBO A;  2NW7 A;  1ZKE A;  3GWH A;  2HPJ A;  1ZHY A;  4FUV A;  2KWH A;  4QX8 B;  2LHN A;  5JDQ A;  5DL6 A;  3BK9 A;  2Y6X A;  4FI5 A;  4PK4 A;  5LA6 E;  5L3G B;  2WMO A;  1E1H B;  3KV5 A;  3PQU A;  3RH3 A;  1D1A A;  2V7I A;  4I4T E;  4YFS A;  3WI4 A;  1MIW A;  2E9X D;  5J2U E;  5LBQ B;  3O4X E;  2EHO A;  3O1H A;  2N9D A;  2LSJ A;  2GK9 A;  4YLH A;  3N9O A;  3CPZ A;  3I0O A;  4PJJ A;  3ZMZ B;  1GFO A;  3C4Z A;  3E0Z A;  1FMW A;  1BR1 A;  2YU1 A;  2W80 C;  1MIV A;  5LOV E;  5GV0 A;  5EK4 A;  4DO0 A;  3ZJ2 A;  4XNK A;  3T24 A;  2W61 A;  3DA3 A;  1HF8 A;  4OHF A;  3VKH A;  1NAF A;  2ODU A;  4AXP A;  3C4W A;  3O1I A;  4I50 E;  2CLY C;  2W81 C;  2NOX A;  2X66 A;  1FIO A;  4M1P A;  3UFE A;  4KMC A;  3DP7 A;  2JMH A;  2J1N A;  3PE0 A;  4FSP A;  2J1D G;  3HKB E;  2DNX A;  3L09 A;  5LGN B;  4IE6 A;  1QUU A;  2B1E A;  5F3J A;  5L3E B;  1WR6 A;  3PUG A;  3OYX A;  1MMA A;  3VU7 H;  4EAH A;  4B61 A;  3UPG A;  3AA1 B;  4AI6 A;  3M65 A;  3VZU X;  4UVC B;  3JTY A;  2LT3 A;  3H3A A;  3SOL A;  5HXS A;  3PUQ A;  1US7 B;  2E9X C;  2KWI B;  3WI3 A;  4AYE C;  2K24 A;  3JC6 D;  4DVD A;  4AKG A;  3FBZ A;  3CQX C;  5LCY A;  4IIJ E;  3SY9 A;  4FES A;  3CQC B;  2DI4 A;  1D1B A;  3UUN A;  3V5U A;  2Y0L A;  1HXT A;  2HPL A;  1G73 A;  4FMS A;  4U74 A;  2K48 A;  2DCF A;  4QXC B;  1Y64 B;  3RPU A;  3ESL A;  2VKD A;  2POR A;  1E54 A;  3LK2 A;  2VWA A;  4GCS A;  5HWX A;  3C64 A;  1LKX A;  3LK4 2;  2N2M A;  2KXP A;  4JEH B;  1WYB A;  4QKN A;  1YS5 A;  4IHJ E;  5JDG A;  3ZJ1 A;  2K4T A;  4ZI2 D;  2C5J A;  3VKG A;  2UXX B;  2BDE A;  4BJN A;  4H9R C;  3NZP A;  4QWN B;  2M06 A;  3POR A;  1MMG A;  4B6X A;  2EHO B;  4MFR A;  2IC6 A;  2MHL A;  3PDY A;  4XBF B;  3PU3 A;  5LHG B;  2FGR A;  4EOZ B;  3RYF E;  2X27 X;  1MMD A;  2QA7 A;  2J4U P;  5ADX L;  5DL8 A;  5H6Q B;  3QRC A;  2SPC A;  2XTR A;  5JR9 C;  3TKL B;  4RJX A;  1MND A;  3HKC E;  4ZI3 D;  4D64 A;  2M07 A;  2D0T A;  2YU2 A;  4I43 B;  1MMN A;  3UUM A;  4HN9 A;  3DTO A;  4A56 A;  3AB3 B;  2DWK A;  1HFA A;  2VKH A;  4NUU A;  3LJC A;  3NZQ A;  5LHH B;  2A72 A;  2V7K A;  3IHR A;  2KT9 A;  3ZPO A;  4BUM X;  1YKE B;  2LFU A;  3R84 B;  2CWO A;  3K8P C;  4H9Q C;  5KDM C;  4GF4 A;  2H7V C;  5DL5 A;  4LSH A;  2L8K A;  1BH3 A;  4JLE A;  2XTQ A;  2XUE A;  3CX6 B;  3PUS A;  3RRC A;  1BR0 A;  2JQQ A;  2XQY A;  2VKJ A;  4PFO A;  4ASK A;  2KC0 A;  2Q9Q D;  2C5K T;  3F57 A;  3NBX X;  2PRN A;  4ZI2 C;  4D65 A;  3ZN1 B;  4EYY R;  1S94 A;  4CI3 B;  4WW0 A;  2BZB A;  2CXD A;  4DBQ A;  5CA1 E;  3SZD A;  2V1D B;  4QQ1 A;  2PG8 A;  4O2B E;  3F2E A;  4TN7 B;  3HKE E;  3C5O A;  3BQL A;  3ZMS B;  1WRD A;  2OA5 A;  5JRE A;  3AA6 A;  3VE2 A;  5FY1 A;  2PBI A;  3LK2 B;  1MM4 A;  2ZLY A;  4UEM A;  5JDF A;  2NW9 A;  1MNE A;  3U78 A;  2KXP B;  4ZI3 C;  2X67 A;  1MIY A;  3ZYM A;  5L3F B;  4ILU A;  5M4Y A;  4AZL A;  4O4X A;  4BJM A;  3KVA A;  4H63 V;  2XE2 A;  1S35 A;  4L9I A;  3HOE A;  2XAJ B;  1IJ6 A;  4DMV A;  4MHC A;  5HYA A;  4PW8 A;  5GON E;  3ZYL A;  5AFU L;  4E7Z A;  3H37 A;  3D0T A;  2XAG B;  3FXD B;  2MYS A;  3N2K E;  4JUY A;  5F8P A;  2JJ9 A;  4AQF A;  1ORM A;  3ZYK A;  4ANJ A;  2Q9Q C;  4ZS2 A;  2JRK A;  5ETW A;  3SS1 A;  1T98 A;  3T20 A;  4BA9 A;  1LRZ A;  2CEA A;  2Y0H A;  4WBN E;  1THQ A;  2MTQ A;  4F6R C;  1P4T A;  5IYZ E;  4HTE A;  4FRX A;  4AKM A;  3CKD A;  4HGA A;  3KVB A;  4AKI A;  4GYR A;  5L3D B;  1KNZ A;  4GOU A;  4TZ4 C;  3EMN X;  3KDS E;  5LXT E;  4FZL A;  3CML A;  5E0O A;  4RLC A;  3VZW X;  3Q9D A;  3RC3 A;  3EDV A;  3RX6 A;  3IF8 B;  4EZH A;  1ZHT A;  1NWM X;  3L3P A;  1PRN A;  4HKA A;  5JDP A;  4FSO A;  3UAQ A;  4O4U A;  5FYM A;  4O3Z A;  3P8C D;  3N9N A;  5FP3 A;  2XAQ B;  2QGS A;  3EDU A;  3W15 B;  1HS7 A;  4YJ3 E;  1OSM A;  2XHE B;  3ZC1 A;  3AA7 A;  3V8U A;  3LK3 A;  3N9L A;  1BR2 A;  2V7M A;  4HFV A;  3RRW A;  4AQG A;  3KVD D;  3EVY A;  3AA6 B;  4ERR A;  1BXW A;  3ONX A;  3BQI A;  2F1V A;  5HWY A;  4GYS A;  1ZHC A;  3A5X A;  4O4H E;  2IAK A;  3AA0 A;  4GK5 E;  4U72 A;  4GCQ A;  1O3X A;  4DBR A;  2LSI A;  4GCP A;  4TV8 E;  2LSK A;  1H6S 1;  2XE5 A;  3DA4 A;  4ISS A;  5L2L A;  1YD8 G;  3VHL A;  5DL7 A;  1GFQ A;  2ZM2 A;  3KV9 A;  4D5U A;  3EUH A;  3PU8 A;  5EK3 A;  5G26 A;  1SA0 E;  4LSE A;  4CI2 B;  5LNK A;  1QJP A;  4AYM C;  3FBL A;  3K3Q C;  4F4B A;  4QXB B;  3O0E A;  1LVF A;  2O4V A;  2KZ7 A;  5PRN A;  3J7Y q;  2WSS V;  4LSI A;  3ZEF B;  1HG2 A;  3MA9 A;  2G0U A;  5LG4 A;  3KV6 A;  4E7S A;  2X9W A;  5LGT B;  4O3W A;  2N2N A;  2ZLD A;  3E22 E;  4H9S E;  4YHJ A;  4H9P C;  2NTX A;  3ZCI A;  3WAJ A;  1ZHX A;  1PHO A;  3VZT X;  2Y48 B;  3KBT A;  5LGU B;  3SYB A;  2LEH A;  4K0U A;  3PTR B;  1UX4 A;  5HXH A;  3CWZ B;  1IZN A;  2JMK A;  3CVR A;  4IE4 A;  3T8O A;  2H3R A;  3BQK A;  2LM9 A;  2LOS A;  3ANW A;  5CB4 E;  3CX8 B;  5TAO A;  3O9X A;  2XAH B;  3ZC0 A;  4RJW A;  5FNV E;  2XG6 A;  2E9X A;  3LK4 1;  3JC6 C;  5LJN A;  1BT9 A;  4AUI A;  4U9C A;  6PRN A;  1G90 A;  1FEW A;  5DQW A;  5JH7 E;  2KDY A;  4TUY E;  3ZCJ A;  1WLX A;  1ZHW A;  4XNL A;  2EHO D;  3ZMU B;  3ZMT B;  4EXT A;  2CMR A;  2P9B A;  3AA7 B;  3K3N A;  4O2A E;  1MM5 A;  2V26 A;  3LK3 B;  4MAL A;  5EE2 A;  4DND A;  3MKD A;  5FXZ A;  2VL8 A;  3OKQ A;  4TV9 E;  2WBL A;  3S4U A;  1UX5 A;  2LE8 A;  4UEL A;  3AA0 B;  2X0L B;  1AJ3 A;  5JDN A;  5FXW A;  4HE8 A;  3Q5X A;  3V5S A;  3AAE A;  3TZG A;  4JFB A;  4UXN B;  2ACX A;  4DMW A;  2D5U A;  5L3B B;  2OMF A;  4PUX A;  3UU2 A;  3UUL A;  4EYU A;  3N9P A;  5JDM A;  4L5G A;  1QSD A;  2CA5 A;  4X1Y E;  3KIN B;  2XE1 A;  2KZ7 B;  3POX A;  2A3D A;  5JR9 A;  2XMX A;  4QX7 B;  5DQV A;  2JPF A;  1QJ8 A;  4PJM A;  2MNH A;  2K0L A;  3GN5 A;  2X9X A;  7PRN A;  2LSY A;  2ES0 A;  3HWB A;  2WMN A;  2VAS A;  2XTL A;  4E1S A;  2CLY B;  1UCU A;  3MXZ A;  4OYK A;  2EHO C;  2LSG A;  3RYI E;  3NSG A;  4GK0 E;  3OYZ A;  1VRB A;  4PK6 A;  5A1L A;  3N5L A;  4JEU B;  5J1G A;  4PJL A;  2IW5 B;  3MK7 C;  4H9N C;  4QHO A;  4C91 A;  1IZN B;  2CE7 A;  3AVS A;  3ETU A;  3ANW B;  2X9Y A;  3KV4 A;  2RA1 A;  2CXL A;  3HKD E;  1GFN A;  2ZFG A;  4CQI A;  5LJM A;  4AKL A;  3T0S A;  4RLB A;  5KMG P;  1QJ9 A;  3P7I A;  4P0B A;  2E9X B;  1Z0P A;  3B57 A;  3PRN A;  4ZS3 A;  2PFV A;  2WWU A;  4PK5 A;  2KMF A;  1IJ5 A;  3QUJ A;  4H63 H;  4IE5 A;  1Q9G A;  5JVD E;  1VOM A;  2LOP A;  4ZOL E;  2A2F X;  5T5F A;  2KLQ A;  2C5I T;  3I1A A;  4GHB A;  2DHR A;  2YEV C;  5HXR A;  2GE4 A;  1OPF A;  3ZMV B;  1IAP A;  2N1G A;  2W63 A;  4CXW A;  3O1J A;  3SY7 A;  2BVM A;  4JCH A;  4Z3T A;  3FB2 A;  1ZHZ A;  3MAC A;  4UV8 B;  4O49 A;  4AYI D;  2E8I A;  3MJX A;  4MLK A;  3DJB A;  3QC9 A;  4YJ2 E;  2ERV A;  3QRA A;  1FMV A;  3LG7 A;  1SHZ C;  3IEE A;  5J2T E;  2X9H A;  4UIG A;  3AAE B;  5DAB A;  2YK0 A;  3PUR A;  4C90 A;  1U5P A;  2CCQ A;  3R6N A;  4KR4 A;  4PAG A;  1D1C A;  2DWG A;  4IST A;  4OK0 A;  4KP3 C;  4LSF A;  4UF0 A;  2MBG A;  1ZV4 X;  1MPF A;  3Q2M A;  2L9Q A;  4H9O C;  3ZN0 B;  1D0Y A;  2JMM A;  4EZ4 A;  4G76 A;  2Q9Q A;  2N2L A;  3SZV A;  5JR9 B;  4KRA A;  4BAY B;  1H7C A;  5JDH A;  1LVK A;  4O3Y A;  4AKR A;  4XZC A;  3PQS A;  4KBM B;  3U3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...