3VE1A

The 2.9 angstrom crystal structure of transferrin binding protein b (tbpb) from serogroup b m982 neisseria meningitidis in complex with human transferrin
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
652
structure length
537
Chain Sequence
b'QGGYGFAMRLKRRNWYPGAEESEVKLNESDWEATGLPTKPKELPKRQKSVIEKVETDGDSDIYSSPYLTPSNHVNQPKNQATGHENFQYVYSGWFYKHAASEKDFSNKKIKSGDDGYIFYHGEKPSRQLPASGKVIYKGVWHFVTDTKKGQDFREIIQPSKKQGDRYSGFSGDGSEEYSNKNESTLKDDHEGYGFTSNLEVDFGNKKLTGKLIRNNASLNNNTNNDKHTTQYYSLDAQITGNRFNGTATATDKKENETKLHPFVSDSSSLSGGFFGPQGEELGFRFLSDDQKVAVVGSAKTKDKLSKLTTVLDAVELTLNDKKIKNLDNFSNAAQLVVDGIMIPLLPKDEFTRKFEHTPETKTYEVEVCCSNLNYLKYGMLTRKNQVEQSMFLQGERTDEKEIPTDQNVVYRGSWYGHIANGTSWSGNASDKEGGNRAEFTVNFADKKITGKLTAENRQAQTFTIEGMIQGNGFEGTAKTAESGFDLDRTPKAYITDAKVKGGFYGPKAEELGGWFAYPGDKASSATVVFGAKRQQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transferrin-binding protein 2
molecule tags Transport protein
source organism Neisseria meningitidis serogroup b
publication title The structural basis of transferrin sequestration by transferrin-binding protein B.
pubmed doi rcsb
total genus 136
structure length 537
sequence length 652
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
A PF17483 TbpB_C C-lobe handle domain of Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.240 Mainly Beta Beta Barrel Lipocalin Lipocalin 3ve1A03
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 3ve1A01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 3ve1A04
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 3ve1A02
3HOLA 2KDYA 3UAQA 4O3XB 4AYDC 3KVDD 3HOEA 4Z3TA 4U9CA 2W81C 3VE2A 4AYEC 4O4UA 4AYNA 4O3WA 2KC0A 5EE2A 1YS5A 2Y7SA 5T5FA 4O4XA 4AYID 4O3YA 2LFUA 2YPVA 2W80C 4QQ1A 4AYMC 3VE1A 4O49A 4O3ZA 3PQUA 3PQSA 3V8UA
chains in the Genus database with same CATH superfamily
4IBAA 2FWVA 4GDZA 5HWZA 5H9NA 3VHHA 3O22A 3HWDA 1T8VA 3FYXA 2Y32A 3EMMA 3NQ3A 2WJRA 2JQYA 4LSFA 3VG7A 2X27X 2JW1A 4IMNA 3PPTA 2F1TA 5B27A 1PMPA 1GX3A 1XKIA 3PP6A 3RSWA 1D3SA 1VWIB 3JTYA 3FIDA 4ZH9A 4RUUA 4GNWA 4GKCA 3TGBA 3P02A 3B2KA 4GCPA 3T0SA 5B10O 4WFUA 3LK42 4Z27A 7PRNA 4AZRA 1B4MA 3P24A 4JCHA 2AT8X 2NP1A 1HXTA 1VWJB 2RTAA 4LKTA 3HWFA 2WSJA 1UYOX 3VG4A 4WHIA 2Q9SA 4IB7A 4GU8A 2XSTA 3SY7A 2ODJA 1LCZA 5EDBA 1IKEA 1JYDA 2RD7C 2MWHA 2X9KA 1EIOA 3RZYA 3VZTX 2C4IA 4D65A 5PRNA 4KT5A 2RCTA 3SYBA 4LKPA 3IFBA 5FQ8E 3U0DA 2WR6A 2FT9A 1QJ8A 3O19A 4MVIA 3C77X 4EKVA 3TZSA 4O49A 2Q2PA 2A5BA 4ZHHA 1RSUB 1EI5A 3FA6A 2ALLX 4CDFA 5B5GA 3TGCA 2FGSA 4Y59A 5LJKA 5HCCC 3HOEA 5AJBA 4GF4A 2Y3EA 4FZLA 2R4OA 5DL8A 3WYPA 1QABE 2BS6A 3WBGA 5BYPA 4MVKA 1SWDA 4PSQA 4IAXA 2F01A 4TJZA 4FT6A 4QGWA 4CV7A 2LKKA 1A57A 1VWHB 3ELZA 2GTLM 3RE5A 2L9CA 4O4SA 3T24A 4QGVA 1GT3A 5HA0A 2LB6A 2N2LA 4OS3A 4TQ2A 2KW1A 5D8JA 5B5FA 1VWPB 1KFFA 2MJIA 2CBSA 3D95A 1P6PA 5HAEA 1SY3A 2OVSA 4YBUA 3PGSA 1LDQA 3WOVA 3EBKA 1JBHA 2IZLB 1VWMB 3B2LA 3SZVA 5HCDC 1ZNHA 1PBYA 4N58A 1DV9A 4QYPA 1SRJA 4C4VB 3FA9A 3GP6A 2WEXA 4BBOA 1DC9A 1HMSA 1KT5A 1VWCB 1HXLA 1YWBA 1NBXA 5LJGA 3DSZA 1S44A 3T2WA 3ZW0A 2F73A 3I0AA 4CDEA 3EM0A 3E3CA 5HZQA 3HOLA 2HZQA 2R73A 4BVMA 1B8EA 5C0NA 4BUMX 2L67A 3AAEA 3O2YA 2VFBA 1LPJA 5KIDA 5H8TA 1LFOA 1ERBA 2NNQA 3WVMA 5KHPA 4INNA 4MVEA 5IO5A 3PQUA 4OELA 2OL7A 2WQAE 1DF8A 4CPIA 4NP1A 1FE3A 5HZ6A 4BCSA 1MEPA 2AXTO 2C1QA 1SWPA 1SY0A 4JO6A 4UU3A 5F6BA 4G75A 4WFVA 5DL6A 3UEVA 3CWKA 2OF8A 1VWEB 1DF3A 1VWFB 1SREA 1MM9A 2QM9A 4I3CA 4TKHA 1QY0A 1KT4A 4OKAA 5HZ5A 1YP6A 1HQQA 5K68A 3OJYC 2DM5A 1I05A 2GTLN 4C4VA 1SRFA 1PTSA 1WBIA 2HNXA 4IB8A 3POUA 4QQ1A 1U17A 3SYSA 1OEJA 4TNNA 2Y0LA 2QTKA 2DJGA 3U03A 1G5WA 4L3RA 1GFNA 3UPGA 1AELA 4K3CA 1GM6A 3TGAA 2RTFB 1O1VA 3N91A 3ELXA 1HXZA 2O62A 3PGRA 1JQPA 2JU8A 3TZGA 4Z2VA 1MM4A 1KT3A 5DL5A 5TISO 4N7CA 2AKQA 1K24A 3CQNA 4AZOA 1STSB 3ZZVA 1ZNGA 1GGLA 3EC5A 2RTEB 4U3QA 3PDFA 3UU2A 2AT6X 4D6AA 3KFFA 6PRNA 3WJGA 3P6CA 3JCUO 3SLTA 2ACOA 4M6SA 3LV4A 3S26A 3WU2O 3AKNA 2OF9A 1KQWA 2KD2A 1BRQA 4N7DA 4PUXA 1MUPA 2F09A 2GTFX 3VG6A 2G8CO 4ODDA 3WI5A 4NNSA 5T5FA 5EPQA 2N93A 2IFBA 4FBOA 3P6FA 4AKMA 3KZIO 5F2BA 5KICA 2ZSCA 5JDPA 2E4JA 3QKGA 1VWOB 5B66O 2PI3O 1EPAA 2O4VA 2RTBB 1GT1A 1TW4A 5H2FO 4KR4A 1ZNLA 5HTDA 1KL3A 1TOUA 5AFUK 5KAFO 4A8ZA 3FDCA 2GH7A 4UB8O 5LJBA 1DFVA 5F7GA 1HXXA 4CTDA 4K3BA 3AA0B 2FHLA 5L8NA 3WI4A 4QAEA 5FVNA 3SZHA 3AA6B 1VWDB 1PRNA 2CBRA 2A2GA 1SRHA 3F6ZB 2RTKA 2BT9A 5EE2A 1VYGA 4JFBA 3P6GA 1DZPA 2I5ZO 4UU2A 2RTQB 3RBYA 3BS0A 1DZKA 2J4UP 4I60A 1PHOA 1T0VA 1BM5A 2OFRX 3FR5A 2IZIA 1WUBA 2XMXA 3BRYA 2JMMA 1ML7A 2KT4B 4O3XB 3VY9X 3JSQA 4PR7A 3BS2A 3B2HA 2A3FX 4AYNA 4QYNA 4CSBA 5HBSA 2LA7A 4UB6O 1IIUA 1I78A 4FZNA 1Z24A 4ML7B 3V8UA 3RDOA 3C78X 1P4TA 4XMCA 4Y0PA 2RN4A 3BX8A 3A0BO 1LDOA 3VG2A 2G79A 3FMZA 5IYUA 4YCHA 4BOEA 1VYOA 5H9KA 2XTRA 3VE1A 5B2AO 4O4OA 2CZUA 1KGLA 4Z2OA 3FIQA 3EMNX 4ZCBA 4GGZA 3STNA 5LJHA 4ORWA 3IA8A 2AT5X 1LUQA 4NV7A 2FHNX 2RTOB 2JMBA 1KZXA 1SXWA 4IABA 5IXGA 1YWAA 1GFOA 3UEXA 3PQSA 1SWUA 3WZNA 4DQ4A 3RWXA 1OEKA 1BXWA 8PRNA 1NGLA 3ZUOA 4U46A 1E5PA 1HQPA 2M06A 4XMEA 4ES7A 4KH8A 4EXZA 2KC0A 2PY1A 2WUTA 3NX1A 3SZDA 1SRGA 2R8AA 1BEBA 1FEMA 4IAWA 2DJFA 1W4TA 3LK3B 4C00A 1N43A 4ORYA 2R74A 3ZWEA 2CM9A 3BSZE 3CKFA 1KQXA 4OEMA 1SWNA 3HTYA 5AFUL 1EIIA 2QOSC 3BU9A 4E1SA 4MISA 3DWNA 2KXPB 2BC3A 3S5XA 2Z4IA 1HN2A 2A2UA 3POQA 1BT9A 4QRLA 3FW4A 1FJ1E 1BSQA 1ICMA 4AYID 2FLJA 4AYMC 4YGZA 1QWDA 1GT4A 5BVSA 4ZFXA 2XE3A 1KOIA 2BHVA 3LHNA 3APVA 3K19A 1E02A 3D97A 4ZJ0A 2K4TA 4DQ3A 4O3YA 2W80C 3QRCA 1G85A 2RTLA 4I3DA 4D64A 1SWTA 2IZGB 4ALOA 1EUOA 4NLIA 3POXA 1CBSA 1X8QA 1I4UA 3BRZA 1BLRA 5HZ8A 2IWVA 4JHQA 3OE3A 3X00A 4YDAA 1TXLA 1SWOA 1SWBA 2WPUA 2IZBA 3KVNA 1O8VA 2X8SA 1ACDA 1SWAA 1SLFB 2G5LA 4KRAA 2QO6A 2BSZA 1BBPA 5DG4A 1STPA 1FDQA 1N7YA 4GGRA 2ZFGA 2HYSA 4LSEA 4YMYA 1VWRB 5G3AA 5CSEA 5D4AA 4WBKA 3K3LA 3S5VA 2X34A 2M4LA 4ORUA 1MDCA 4YKMA 2IZAA 2RTGB 1EXSA 2KZ7B 1EQDA 1HBQA 1GT5A 4HPBA 3QRAA 5EEEA 2FRSA 1THQA 1R0UA 5G38A 2BS5A 1S5LO 4QGXA 4Z28A 4YKOA 2Y7SA 1UYNX 2UYWA 3WJDA 4AYHA 4FZMA 4Z2PA 1LIEA 3MVFA 4FESA 1KL5A 5IRAA 1JYJA 4EEJA 3LK2A 2PRNA 1ICNA 2AT0X 1T16A 5G39A 2MM3A 2MHDA 3EBWA 1GX9A 1SA8A 3ZI8A 4LSIA 3STMX 1QFVA 2L68A 3HWGA 5GV0A 3RY1A 4LZVA 4HPCA 2JGSA 3A2SX 4AKRA 4BGFA 4AZPA 3B2JA 1X8PA 4ID2A 4EFGA 1TOWA 2KTDA 4COTA 1LF7A 3NJTA 3HPEA 1YS5A 4GH7A 3Q6LA 5DPQA 4BX7A 5DL7A 1QG5A 1X8NA 2QO5A 1MM5A 2YNKA 1HMTA 4TLJA 3CMPA 2JN3A 3HK1A 3ZUIA 3U9PC 5AJCA 5LKEA 4RLBA 2QOMA 5E79O 3VGWA 1LCWA 2HLVA 2AVIA 3ZW1A 4RL9A 2KDYA 4GCSA 3APWA 1Y53X 4AZNA 3SLOA 4HPAA 1BRPA 4FRXA 4RLCA 3FR2A 2QCBA 1LIBA 4RUNA 4XNKA 2LFOA 1NC9A 4GHBA 2AF5A 4FGIB 4I9SA 1SLGB 4GJSA 3MG5A 1RXJA 5K67A 3LK2B 4I95A 1AQBA 4NYQA 5BVQA 2ANSA 3APXA 4NW4A 1SWRA 5B3MO 4U9CA 1I04A 3F8AA 5K06A 1VWGB 2YMSA 4A1HA 4ZHFA 3CBCA 3AA1A 1U0XA 1IJ8A 2FS7A 2X55A 2FR2A 2K62A 1CBIA 4OMXA 4AZMA 2WJQA 1HY2A 4JNJA 1JIWI 4GZVA 1B56A 4CPEA 2OMFA 1SWQA 4CDCA 4AYEC 2RTNB 2W2FA 3FEKA 3T20A 1VWLB 1GKAA 3JQOA 2OVAA 5F58A 1S2PA 4YDBA 3RDUA 4A60A 4BJ8A 4AZQA 3KVDD 1Q9FA 3NP1A 5ADXK 4JGLA 3MM0A 1Y55X 4FBVA 2N2MA 1KL4A 1B0OA 4YGGA 4Y5DA 2EU7X 1E00A 2R4LA 3ZW1B 3S60A 1GX8A 3WJEA 4NYRA 3PH6A 2A5CA 1BJ7A 2OY7A 1SWGA 2X8TA 1IFBA 1Q9GA 1DZJA 4XNLA 4IB9A 2A0AA 5FAZA 2ZLDA 2NNEA 1BSYA 2BLGA 1G7NA 1T68X 1KXOA 4U8UM 5IRUA 1FTPA 2R89A 2FTBA 2IZEB 2OVEA 3RDSA 2RCQA 2W81C 5L8OA 2A8GA 1S7DA 5B11O 1I9HA 2XE5A 4CPHB 1E2TA 3HWEA 4TKBA 4GNYA 1A18A 1PM1X 4QZUA 3I17A 3AKMA 2QMIA 4BQUA 4N74A 5G26A 1FELA 3KQ0A 1SY2A 3DTQA 1G90A 3PRNA 2R56A 4L1NA 4ARHA 1JV4A 2W2BA 3A0HO 1LCVA 3AA7A 4EQAC 3AA6A 1E54A 4O9SA 2WEWA 4I9RA 2X56A 1GFMA 2IWWA 4KC8A 2HMBA 2FS6A 2GTLO 3G7GA 2X4MA 2MNHA 2FKGA 3FEPA 1ZHYA 5KAIO 2RTRB 4O3WA 1KT7A 2Q4NA 1Y0GA 1OBQA 3AUMO 2ZAIA 3BLGA 4AYDC 2W2AA 2I5VO 5L8IA 3NADA 3P6EA 5FFHA 1RAVA 5GTHO 2AH7X 3GE2A 4ZGUA 4FQEA 2OYBO 3NQ9A 4BX7B 1SWHA 5CHKA 1VWBB 1E06A 1IZNA 4FSOA 4FSPA 1ZHTA 1ADLA 2G78A 5EDCA 2R4PA 4QZTA 3RDMA 3WZPA 2ERVA 4N75A 1OPFA 1SWKA 1ZNKA 3LK41 1N4JA 4EDEA 1SXYA 3GAQA 1LNMA 1SWEA 2OY5O 4BX6B 3HWBA 2RTIB 1RXHA 1UREA 3FR4A 4YBPA 1SLEB 1ZHWA 3APUA 1Y9LA 3HW9A 2OL8O 2LBAA 3FELA 3KFHA 5F1EA 1FENA 1MPFA 3VZWX 1SWJA 3WJBA 3T2XA 2F1VA 4CPFA 4ON1A 1SXXA 3KFIA 3DA4A 3AA7B 4KR8A 3SOTA 1BSOA 3NX2A 3P6HA 5LJDA 1SWCA 2AT3X 2CM4A 3FA7A 1DZMA 5FENA 3G7XA 2YG2A 1I06A 4ZGFA 1W5RA 2IZKA 3ZW0B 3NQKA 4E1TA 3PF1A 1GXAA 4B55A 3VHMA 1G74A 3T6FA 1H6S1 2XE1A 1IZNB 2KTSA 1OPAA 3LK3A 5HTEA 4AUIA 1A2DA 3OD9A 2LHFA 5IO7A 1SRIA 3RY2A 2RTJA 4YCEA 3FW5A 4Y0RA 1LELA 1JJJA 3DWOX 2Z4HA 4I6SA 3PH5A 2XE2A 1JZUA 2K23A 4MVLA 1OBUA 4MEEA 1H91A 3RE6A 2XTQA 1IW2A 1EPBA 5IO6A 4AW8A 3FYFA 1IKJA 4Z3TA 4GE1A 2KXPA 3D9WA 3OBLA 5CYBA 4HWMA 3BDRA 3L4RA 1QFTA 4I3BA 1W6FA 4O3ZA 2X45A 4C5PA 4MIRA 2WQ9A 3P6DA 4U8UN 4NNTA 1VWNB 1QY2A 3SY9A 1CBRA 2IZHB 3BX7A 3T1DA 1MK5A 5EEDA 2LBVA 4R0BA 4FRTA 1VWAB 1ORMA 2HKDA 2Q2MA 1MVGA 3PECA 5BVTA 2UZ2A 3UEUA 2CAMA 3PEDA 2ACPX 4FOZA 1QJPA 1MOYA 1U18A 1Y9TA 3RDQA 3BRNA 4N59A 3WXQA 4A1YA 4CK4A 4HFOA 3NPOA 2GE4A 1LIDA 2VDFA 3EW2A 2OZQA 4GDAA 1N0SA 2AMMX 3VU1A 4YFPA 3NBXX 2FGRA 1LICA 3EW1A 4DCBA 3AA1B 4GK9A 4OS0A 1OSMA 2GJ5A 4U8UO 3WJFA 4K19A 1HBPA 1O1UA 1ZHXA 1RLBE 2R4NA 3PGUA 3FENA 1CJ5A 3CQRA 3D96A 1SWFA 1TVQA 1EW3A 3C76X 3NSGA 1MX8A 2ZAGA 2NNDA 3AEHA 3SZIA 4XMGA 3D4RA 4IRWA 5D48A 3UAQA 3F9DA 4GCQA 1LIFA 1YUPA 1PEEA 5LJCA 5HZ9A 3FA8A 5AEOA 3SZJA 3ZQ3A 1JJUA 2R88A 1VWKB 1RBPA 3KFGA 4Y0SA 1LKEA 1X8OA 2IZCB 4ZHCA 3H3IA 1SWSA 2K0LA 5B5EO 3SAOA 5JR8A 1JMZA 2YPVA 1X89A 5CE4A 3VG3A 4FUVA 1K3BA 4OMWA 4LZUA 1RXKA 4GETA 2X8FA 1VYFA 4TKJA 3BU1A 1NQNA 3STKA 4D6BA 1YWCA 1N9YA 1Y52X 3O0EA 2POAA 2IZDB 1NP1A 3DA3A 1SMPI 2A13A 2WWPA 4YFRA 4NLJA 4QNIA 3MBTA 1A3YA 1XCAA 5L3YA 3JS1A 3PK2A 4CDDA 4ZR2A 3RKGA 2M07A 4ORXA 3VG5A 1STRB 3LTWA 5GTIO 2OFAA 2CZTA 3T6LA 1N9MA 2RTPB 1VPRA 1CBQA 2AL0X 4BX5B 5EZ2A 4LSHA 4IB6A 1ZNEA 4KC7A 1NDJA 1MX7A 4HPDA 4KIIA 4DNEA 2XKLA 3SLJA 3VY8X 4GD9A 5D5DA 4FMSA 2QO4A 1BWYA 3Q34A 4G76A 1OSPO 3AAAB 1JMXA 4XMFA 5LJEA 4KCAA 2RA6A 3WYQA 2L5PA 4ZH6A 1GFPA 2Q39A 5FQ6E 1D2UA 1GKAB 1HXUA 2KZ7A 1AB0A 1YP7A 4PJ0O 4O4XA 2LFUA 3CBSA 1OBPA 4PJ2A 4D5UA 3NR3A 4XMHA 4IL6O 4FBRA 2IZFB 1UZ2X 4AZLA 2X32A 2JU7A 4Z6JA 2G7BA 3AAEB 1PBOA 2RTCB 5AQ6A 2OVDA 4RJWA 1NQMA 4YGHA 4O4UA 1VWQB 2FKJA 1SLDB 1RSTB 3B2IA 4NV8A 4BX6A 3PORA 3EYCA 3VHIA 1QY1A 4IMOA 4ZHDA 3RBHA 3KZAA 2WVPA 4LQZA 3CKGA 2F1CX 3VE2A 2MO5A 4ORSA 1EALA 2MF6A 3QQ2A 1SWLA 3AA0A 1QQSA 4F4BA 3WZQA 1SY1A 2Y0HA 3MX7A 2XG6A 2OY8A 2X46A 1AVEA 5B29A 1L6MA 4BX5A 5H9AA 3C5OA 2JU3A 5FQ7E 2HZRA 2VFCA 1ERXA 1OEEA 4GUZA 3RDXA 4AFKA 4AKRB 4CPHA 4C69X 4B61A 1NP4A 2RTDB 4Y0QA 2FGQX 1BH3A 4GGTA 3AAAA 1YWDA 2JOZA 3UEWA 1AVDA 4FQBB 2PORA 2MHLA 1OPBA 4GJVA 4ALBA 2OY1O 2FR3A 2P8GA 1GFQA 3FLLA 1AVGI 5HA1A 2ASNX 1QJ9A 1IFCA 2Y3FA 5JD2A 2RQ0A 5D45A 3ZW2A 3CR6A 1HMRA 2OFMX 4YFQA 4YH0A 3VZUX 1ZRYA 2RTMA 1T1LA 5ADXL 1ZNDA 2GC9A 4ORRA 4XMDA 1KT6A 3WJCA 1KZWA 5LKFA 3BY0A 2IZJA 1CRBA 2OL6O 1JJXA 3DZMA 2OFBA 3TF6A 4OS8A 5D47A 5H9LA 3WZOA 1ALBA 1ZHZA 3VPJE 4ZHGA 2J1NA 5F6ZA 2C1SA 4M7MA 4RJXA 2RTHB 1SXUA 1X71A 5HCEC 2Y0KA 2Y2XA 1X8UA 4YVBA 4GRJA 1YIVA 5IRWA
chains in the Genus database with same CATH topology
2LBVA 4IBAA 4R0BA 3ZW1A 4FRTA 4RL9A 1ORMA 2KDYA 2FWVA 4GCSA 3APWA 4AZNA 4GDZA 5HWZA 5H9NA 5LJBA 1DFVA 4HPAA 2Q2MA 1BRPA 1MVGA 5F7GA 1HXXA 4FRXA 4RLCA 3PECA 3FR2A 5BVTA 3O22A 1LIBA 4RUNA 3HWDA 1T8VA 3FYXA 4XNKA 2LFOA 3UEUA 3EMMA 3PEDA 5L8NA 3AA0B 2ACPX 4GHBA 3NQ3A 4FOZA 4LSFA 1QJPA 3WI4A 1U18A 4FGIB 3VG7A 4I9SA 1Y9TA 4QAEA 5FVNA 3BRNA 3AA6B 4N59A 2X27X 2JW1A 3WXQA 4IMNA 4A1YA 4CK4A 3PPTA 4HFOA 1PRNA 2F1TA 2CBRA 3NPOA 2GE4A 3LK2B 4I95A 1AQBA 2A2GA 4NYQA 2ANSA 5B27A 5BVQA 1LIDA 3APXA 4NW4A 1PMPA 4U9CA 2OZQA 1N0SA 1XKIA 1I04A 2AMMX 3VU1A 3F6ZB 3PP6A 3RSWA 1D3SA 4YFPA 3JTYA 4ZH9A 2BT9A 4GNWA 4GKCA 3F8AA 3NBXX 4RUUA 1VYGA 5K06A 3TGBA 5EE2A 2FGRA 3P02A 3B2KA 4GCPA 4JFBA 2YMSA 3P6GA 1LICA 1DZPA 4A1HA 3T0SA 4ZHFA 4WFUA 3AA1B 3CBCA 4GK9A 4OS0A 1U0XA 1OSMA 3AA1A 2GJ5A 4U8UO 2FS7A 4UU2A 3LK42 3WJFA 4K19A 7PRNA 4AZRA 3RBYA 2FR2A 2K62A 1CBIA 3P24A 1DZKA 1HBPA 1O1UA 4OMXA 2AT8X 2NP1A 4AZMA 1HXTA 4JCHA 1ZHXA 2J4UP 1RLBE 4LKTA 1JIWI 4GZVA 1B56A 1PHOA 2OMFA 3HWFA 1T0VA 3FENA 1BM5A 2WSJA 4AYEC 3VG4A 1CJ5A 4WHIA 2OFRX 2Q9SA 2W2FA 3FEKA 3T20A 4IB7A 4GU8A 3FR5A 1GKAA 2XSTA 3JQOA 3SY7A 2OVAA 5F58A 2ODJA 1S2PA 3CQRA 3D96A 1TVQA 1EW3A 5EDBA 3C76X 1IKEA 1JYDA 2RD7C 4YDBA 3NSGA 2MWHA 2XMXA 1MX8A 4A60A 2ZAGA 1EIOA 2NNDA 3RZYA 2JMMA 3VZTX 1ML7A 4XMGA 3D4RA 2KT4B 4D65A 5D48A 3UAQA 4O3XB 3F9DA 4AZQA 4GCQA 3VY9X 5PRNA 4KT5A 3KVDD 3JSQA 1Q9FA 2RCTA 3NP1A 1LIFA 3BS2A 3SYBA 5ADXK 1YUPA 1PEEA 4JGLA 5LJCA 3B2HA 4LKPA 5HZ9A 3IFBA 3FA8A 4FBVA 5FQ8E 2A3FX 2WR6A 3U0DA 2N2MA 4AYNA 5AEOA 2FT9A 4QYNA 3ZQ3A 1QJ8A 1B0OA 4YGGA 3O19A 4CSBA 4MVIA 5HBSA 2LA7A 2EU7X 1IIUA 3C77X 1E00A 4FZNA 1Z24A 3TZSA 4ML7B 4O49A 2Q2PA 4ZHHA 1RBPA 1EI5A 3V8UA 3C78X 3S60A 3FA6A 3ZW1B 1P4TA 3KFGA 1GX8A 2ALLX 4XMCA 3TGCA 4Y0SA 1LKEA 1X8OA 4Y0PA 3WJEA 4NYRA 3PH6A 5LJKA 1BJ7A 2RN4A 3BX8A 5HCCC 3HOEA 4ZHCA 2X8TA 3VG2A 5AJBA 1IFBA 1Q9GA 2G79A 3FMZA 3H3IA 1DZJA 4GF4A 4XNLA 4IB9A 5IYUA 2K0LA 2A0AA 4YCHA 3SAOA 4BOEA 5JR8A 4FZLA 5FAZA 5DL8A 2YPVA 5H9KA 2XTRA 1X89A 1QABE 2BS6A 3WBGA 3VE1A 5BYPA 5CE4A 2ZLDA 4O4OA 3VG3A 2NNEA 4FUVA 2CZUA 1BSYA 4OMWA 2BLGA 4LZUA 1KGLA 4MVKA 1G7NA 1T68X 3FIQA 1KXOA 4GETA 3EMNX 2X8FA 1VYFA 4PSQA 4TKJA 4ZCBA 4U8UM 3BU1A 4IAXA 3STNA 5LJHA 1FTPA 4TJZA 3STKA 4D6BA 2FTBA 4ORWA 2OVEA 4FT6A 2RCQA 2W81C 3IA8A 4QGWA 4CV7A 5L8OA 1YWCA 1S7DA 3O0EA 2AT5X 2LKKA 1A57A 2POAA 2XE5A 1NP1A 3DA3A 1SMPI 3ELZA 2GTLM 2JMBA 1KZXA 2L9CA 1SXWA 4IABA 3HWEA 2A13A 1YWAA 2WWPA 4O4SA 4QGVA 4TKBA 1GT3A 4YFRA 1GFOA 4NLJA 3T24A 4GNYA 5HA0A 3UEXA 3PQSA 2LB6A 4DQ4A 2N2LA 4QNIA 1A18A 1PM1X 4OS3A 4QZUA 3I17A 3RWXA 4TQ2A 3AKMA 2KW1A 1OEKA 2QMIA 5D8JA 4BQUA 1BXWA 8PRNA 1NGLA 3ZUOA 5G26A 1FELA 3MBTA 3KQ0A 1A3YA 1SY2A 3DTQA 1XCAA 3JS1A 1E5PA 2MJIA 1HQPA 1B4MA 2M06A 4XMEA 1G90A 4ES7A 2CBSA 3D95A 1P6PA 5HAEA 2R56A 4ZR2A 3RKGA 4L1NA 2M07A 3PRNA 1SY3A 4ORXA 2OVSA 4KH8A 4EXZA 2KC0A 4YBUA 2PY1A 3VG5A 3WOVA 4ARHA 1JV4A 2WUTA 2W2BA 3NX1A 3SZDA 3AA7A 4EQAC 3AA6A 1BEBA 1FEMA 3EBKA 4IAWA 1JBHA 1E54A 2CZTA 4O9SA 2WEWA 3B2LA 3LK3B 1VPRA 1CBQA 2AL0X 4ORYA 2R74A 1ZNHA 4I9RA 5EZ2A 3ZWEA 5HCDC 3SZVA 2CM9A 4N58A 3BSZE 1GFMA 4LSHA 1DV9A 4QYPA 1KQXA 4KC8A 2HMBA 2FS6A 2GTLO 3G7GA 2MNHA 3FEPA 3HTYA 1ZHYA 4IB6A 5AFUL 1ZNEA 4KC7A 4O3WA 1MX7A 4HPDA 1EIIA 2QOSC 1KT7A 3BU9A 4KIIA 2Q4NA 2XKLA 4E1SA 3VY8X 1OBQA 3FA9A 3GP6A 5D5DA 2WEXA 4MISA 2ZAIA 2KXPB 4FMSA 3BLGA 1DC9A 4AYDC 1HMSA 2W2AA 5L8IA 1KT5A 2QO4A 3NADA 3S5XA 1BWYA 4G76A 2Z4IA 3P6EA 1HN2A 2A2UA 5FFHA 3AAAB 3POQA 4XMFA 1YWBA 4KCAA 5LJEA 2RA6A 1BT9A 2L5PA 4QRLA 4ZH6A 1GFPA 5LJGA 2AH7X 3FW4A 2Q39A 3DSZA 1S44A 3GE2A 4ZGUA 5FQ6E 1BSQA 1D2UA 3ZW0A 1GKAB 1HXUA 2KZ7A 2F73A 3I0AA 1AB0A 3NQ9A 1YP7A 1ICMA 4O4XA 4AYID 2LFUA 2FLJA 1OBPA 3CBSA 3EM0A 4AYMC 4PJ2A 1E06A 3E3CA 1IZNA 4D5UA 3NR3A 4YGZA 4XMHA 4FSOA 1QWDA 4FSPA 1GT4A 5HZQA 4FBRA 3HOLA 1ZHTA 1ADLA 2G78A 2HZQA 1UZ2X 5EDCA 5BVSA 4AZLA 2R73A 4BVMA 1B8EA 4ZFXA 2JU7A 5C0NA 4QZTA 2XE3A 1KOIA 4BUMX 2L67A 3AAEA 2BHVA 2G7BA 3LHNA 3O2YA 3AAEB 1PBOA 2ERVA 3APVA 3K19A 1E02A 5AQ6A 1LPJA 2OVDA 4RJWA 1OPFA 3D97A 4YGHA 5KIDA 5H8TA 1ZNKA 4O4UA 1LFOA 4ZJ0A 2K4TA 3LK41 1ERBA 2NNQA 4EDEA 1SXYA 3WVMA 4DQ3A 5KHPA 3GAQA 4O3YA 3B2IA 4INNA 4MVEA 2W80C 1LNMA 5IO5A 3PORA 3HWBA 3PQUA 1UREA 3EYCA 3QRCA 3FR4A 4YBPA 1QY1A 1G85A 2WQAE 4IMOA 4I3DA 4ZHDA 3RBHA 4D64A 3KZAA 1ZHWA 4LQZA 4ALOA 4NP1A 1EUOA 1FE3A 5HZ6A 3APUA 1Y9LA 3HW9A 3VE2A 4NLIA 3FELA 2LBAA 3KFHA 5F1EA 1CBSA 1X8QA 2MO5A 4ORSA 1EALA 3POXA 1FENA 1MPFA 3VZWX 1I4UA 1BLRA 5HZ8A 3WJBA 3AA0A 2F1VA 4ON1A 1SY0A 4UU3A 3OE3A 1QQSA 1SXXA 3KFIA 3DA4A 5F6BA 3AA7B 4F4BA 4G75A 1SY1A 4WFVA 5DL6A 3UEVA 3CWKA 4YDAA 3MX7A 1TXLA 1DF3A 2Y0HA 2XG6A 2X46A 5B29A 4KR8A 1L6MA 5H9AA 1O8VA 3SOTA 2X8SA 3C5OA 1BSOA 2QM9A 1ACDA 4I3CA 4TKHA 1QY0A 1KT4A 2JU3A 5FQ7E 2HZRA 5HZ5A 4KRAA 2QO6A 1YP6A 1ERXA 3OJYC 1OEEA 3NX2A 3P6HA 2DM5A 5LJDA 1I05A 1BBPA 2AT3X 2CM4A 2GTLN 5DG4A 3FA7A 4AFKA 4AKRB 1DZMA 2HNXA 1FDQA 4C69X 4IB8A 5FENA 3G7XA 2ZFGA 2YG2A 2HYSA 4LSEA 4B61A 4YMYA 3POUA 4QQ1A 1U17A 3SYSA 5D4AA 1OEJA 1NP4A 4WBKA 3K3LA 4TNNA 3S5VA 2Y0LA 1I06A 2QTKA 2M4LA 4Y0QA 4ORUA 3U03A 4ZGFA 1G5WA 1MDCA 4YKMA 4L3RA 2FGQX 3ZW0B 1GFNA 3UPGA 1EXSA 3NQKA 1BH3A 2KZ7B 4E1TA 3AAAA 1EQDA 1AELA 1YWDA 1HBQA 1GT5A 1GM6A 4HPBA 2JOZA 3TGAA 3UEWA 1O1VA 1GXAA 3QRAA 5EEEA 2FRSA 1THQA 1R0UA 3N91A 2BS5A 4FQBB 3ELXA 1G74A 2PORA 4QGXA 2MHLA 1H6S1 2O62A 1OPBA 4YKOA 4ALBA 2Y7SA 2JU8A 2XE1A 2FR3A 3WJDA 2P8GA 3TZGA 1GFQA 2KTSA 4AYHA 1IZNB 1MM4A 4FZMA 3FLLA 1OPAA 1KT3A 1LIEA 5DL5A 1AVGI 3MVFA 5HA1A 5HTEA 3LK3A 4FESA 4N7CA 1JYJA 4EEJA 4AUIA 1A2DA 2AKQA 3CQNA 4AZOA 2ASNX 1QJ9A 3ZZVA 1IFCA 1ZNGA 3OD9A 1GGLA 3LK2A 2PRNA 2LHFA 5IO7A 1ICNA 2RQ0A 2AT0X 4U3QA 2MM3A 4YCEA 2MHDA 3FW5A 4Y0RA 5D45A 1JJJA 3EBWA 3UU2A 1GX9A 2AT6X 2Z4HA 3CR6A 3KFFA 4I6SA 1HMRA 3ZW2A 4D6AA 6PRNA 1SA8A 3WJGA 3ZI8A 3P6CA 3PH5A 4LSIA 2XE2A 2OFMX 4YFQA 4YH0A 3STMX 1QFVA 1ZRYA 3VZUX 2L68A 2ACOA 3HWGA 1JZUA 2K23A 5GV0A 4M6SA 4MVLA 5ADXL 1OBUA 4LZVA 1H91A 3LV4A 1ZNDA 4HPCA 2GC9A 3S26A 3A2SX 4AKRA 4ORRA 4XMDA 1KT6A 3AKNA 3B2JA 4AZPA 1KQWA 1X8PA 3WJCA 2KD2A 1BRQA 1IW2A 1EPBA 5IO6A 1KZWA 2XTQA 4N7DA 4AW8A 5LKFA 4PUXA 3FYFA 1MUPA 1IKJA 3BY0A 2F09A 4GE1A 4ID2A 4EFGA 1TOWA 4Z3TA 2KXPA 1CRBA 2GTFX 1JJXA 3VG6A 2KTDA 4COTA 1LF7A 3OBLA 3WI5A 4ODDA 5CYBA 4NNSA 4HWMA 3TF6A 4OS8A 5D47A 1YS5A 4GH7A 5H9LA 3BDRA 3L4RA 3Q6LA 5DPQA 1QFTA 2N93A 4I3BA 5EPQA 2IFBA 5DL7A 4FBOA 1QG5A 3P6FA 1X8NA 4AKMA 2QO5A 4O3ZA 1MM5A 1ALBA 2YNKA 2X45A 5KICA 1HMTA 4TLJA 3CMPA 5JDPA 1ZHZA 4MIRA 2WQ9A 2JN3A 3P6DA 2E4JA 3VPJE 3QKGA 4U8UN 4ZHGA 2J1NA 4NNTA 5F6ZA 3HK1A 4M7MA 4RJXA 1QY2A 1EPAA 3ZUIA 3SY9A 1CBRA 1SXUA 3U9PC 1X71A 5AJCA 5LKEA 2O4VA 3BX7A 3T1DA 5HCEC 1GT1A 2Y0KA 4RLBA 1TW4A 4KR4A 2Y2XA 1X8UA 1ZNLA 5HTDA 5EEDA 1TOUA 4GRJA 1YIVA 5T5FA 5AFUK 2HLVA 4A8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOL A;  2KDY A;  3UAQ A;  4O3X B;  4AYD C;  3KVD D;  3HOE A;  4Z3T A;  4U9C A;  2W81 C;  3VE2 A;  4AYE C;  4O4U A;  4AYN A;  4O3W A;  2KC0 A;  5EE2 A;  1YS5 A;  2Y7S A;  5T5F A;  4O4X A;  4AYI D;  4O3Y A;  2LFU A;  2YPV A;  2W80 C;  4QQ1 A;  4AYM C;  3VE1 A;  4O49 A;  4O3Z A;  3PQU A;  3PQS A;  3V8U A; 
#chains in the Genus database with same CATH topology
 4IBA A;  2FWV A;  4GDZ A;  5HWZ A;  5H9N A;  3VHH A;  3O22 A;  3HWD A;  1T8V A;  3FYX A;  2Y32 A;  3EMM A;  3NQ3 A;  2WJR A;  2JQY A;  4LSF A;  3VG7 A;  2X27 X;  2JW1 A;  4IMN A;  3PPT A;  2F1T A;  5B27 A;  1PMP A;  1GX3 A;  1XKI A;  3PP6 A;  3RSW A;  1D3S A;  1VWI B;  3JTY A;  3FID A;  4ZH9 A;  4RUU A;  4GNW A;  4GKC A;  3TGB A;  3P02 A;  3B2K A;  4GCP A;  3T0S A;  5B10 O;  4WFU A;  3LK4 2;  4Z27 A;  7PRN A;  4AZR A;  1B4M A;  3P24 A;  4JCH A;  2AT8 X;  2NP1 A;  1HXT A;  1VWJ B;  2RTA A;  4LKT A;  3HWF A;  2WSJ A;  1UYO X;  3VG4 A;  4WHI A;  2Q9S A;  4IB7 A;  4GU8 A;  2XST A;  3SY7 A;  2ODJ A;  1LCZ A;  5EDB A;  1IKE A;  1JYD A;  2RD7 C;  2MWH A;  2X9K A;  1EIO A;  3RZY A;  3VZT X;  2C4I A;  4D65 A;  5PRN A;  4KT5 A;  2RCT A;  3SYB A;  4LKP A;  3IFB A;  5FQ8 E;  3U0D A;  2WR6 A;  2FT9 A;  1QJ8 A;  3O19 A;  4MVI A;  3C77 X;  4EKV A;  3TZS A;  4O49 A;  2Q2P A;  2A5B A;  4ZHH A;  1RSU B;  1EI5 A;  3FA6 A;  2ALL X;  4CDF A;  5B5G A;  3TGC A;  2FGS A;  4Y59 A;  5LJK A;  5HCC C;  3HOE A;  5AJB A;  4GF4 A;  2Y3E A;  4FZL A;  2R4O A;  5DL8 A;  3WYP A;  1QAB E;  2BS6 A;  3WBG A;  5BYP A;  4MVK A;  1SWD A;  4PSQ A;  4IAX A;  2F01 A;  4TJZ A;  4FT6 A;  4QGW A;  4CV7 A;  2LKK A;  1A57 A;  1VWH B;  3ELZ A;  2GTL M;  3RE5 A;  2L9C A;  4O4S A;  3T24 A;  4QGV A;  1GT3 A;  5HA0 A;  2LB6 A;  2N2L A;  4OS3 A;  4TQ2 A;  2KW1 A;  5D8J A;  5B5F A;  1VWP B;  1KFF A;  2MJI A;  2CBS A;  3D95 A;  1P6P A;  5HAE A;  1SY3 A;  2OVS A;  4YBU A;  3PGS A;  1LDQ A;  3WOV A;  3EBK A;  1JBH A;  2IZL B;  1VWM B;  3B2L A;  3SZV A;  5HCD C;  1ZNH A;  1PBY A;  4N58 A;  1DV9 A;  4QYP A;  1SRJ A;  4C4V B;  3FA9 A;  3GP6 A;  2WEX A;  4BBO A;  1DC9 A;  1HMS A;  1KT5 A;  1VWC B;  1HXL A;  1YWB A;  1NBX A;  5LJG A;  3DSZ A;  1S44 A;  3T2W A;  3ZW0 A;  2F73 A;  3I0A A;  4CDE A;  3EM0 A;  3E3C A;  5HZQ A;  3HOL A;  2HZQ A;  2R73 A;  4BVM A;  1B8E A;  5C0N A;  4BUM X;  2L67 A;  3AAE A;  3O2Y A;  2VFB A;  1LPJ A;  5KID A;  5H8T A;  1LFO A;  1ERB A;  2NNQ A;  3WVM A;  5KHP A;  4INN A;  4MVE A;  5IO5 A;  3PQU A;  4OEL A;  2OL7 A;  2WQA E;  1DF8 A;  4CPI A;  4NP1 A;  1FE3 A;  5HZ6 A;  4BCS A;  1MEP A;  2AXT O;  2C1Q A;  1SWP A;  1SY0 A;  4JO6 A;  4UU3 A;  5F6B A;  4G75 A;  4WFV A;  5DL6 A;  3UEV A;  3CWK A;  2OF8 A;  1VWE B;  1DF3 A;  1VWF B;  1SRE A;  1MM9 A;  2QM9 A;  4I3C A;  4TKH A;  1QY0 A;  1KT4 A;  4OKA A;  5HZ5 A;  1YP6 A;  1HQQ A;  5K68 A;  3OJY C;  2DM5 A;  1I05 A;  2GTL N;  4C4V A;  1SRF A;  1PTS A;  1WBI A;  2HNX A;  4IB8 A;  3POU A;  4QQ1 A;  1U17 A;  3SYS A;  1OEJ A;  4TNN A;  2Y0L A;  2QTK A;  2DJG A;  3U03 A;  1G5W A;  4L3R A;  1GFN A;  3UPG A;  1AEL A;  4K3C A;  1GM6 A;  3TGA A;  2RTF B;  1O1V A;  3N91 A;  3ELX A;  1HXZ A;  2O62 A;  3PGR A;  1JQP A;  2JU8 A;  3TZG A;  4Z2V A;  1MM4 A;  1KT3 A;  5DL5 A;  5TIS O;  4N7C A;  2AKQ A;  1K24 A;  3CQN A;  4AZO A;  1STS B;  3ZZV A;  1ZNG A;  1GGL A;  3EC5 A;  2RTE B;  4U3Q A;  3PDF A;  3UU2 A;  2AT6 X;  4D6A A;  3KFF A;  6PRN A;  3WJG A;  3P6C A;  3JCU O;  3SLT A;  2ACO A;  4M6S A;  3LV4 A;  3S26 A;  3WU2 O;  3AKN A;  2OF9 A;  1KQW A;  2KD2 A;  1BRQ A;  4N7D A;  4PUX A;  1MUP A;  2F09 A;  2GTF X;  3VG6 A;  2G8C O;  4ODD A;  3WI5 A;  4NNS A;  5T5F A;  5EPQ A;  2N93 A;  2IFB A;  4FBO A;  3P6F A;  4AKM A;  3KZI O;  5F2B A;  5KIC A;  2ZSC A;  5JDP A;  2E4J A;  3QKG A;  1VWO B;  5B66 O;  2PI3 O;  1EPA A;  2O4V A;  2RTB B;  1GT1 A;  1TW4 A;  5H2F O;  4KR4 A;  1ZNL A;  5HTD A;  1KL3 A;  1TOU A;  5AFU K;  5KAF O;  4A8Z A;  3FDC A;  2GH7 A;  4UB8 O;  5LJB A;  1DFV A;  5F7G A;  1HXX A;  4CTD A;  4K3B A;  3AA0 B;  2FHL A;  5L8N A;  3WI4 A;  4QAE A;  5FVN A;  3SZH A;  3AA6 B;  1VWD B;  1PRN A;  2CBR A;  2A2G A;  1SRH A;  3F6Z B;  2RTK A;  2BT9 A;  5EE2 A;  1VYG A;  4JFB A;  3P6G A;  1DZP A;  2I5Z O;  4UU2 A;  2RTQ B;  3RBY A;  3BS0 A;  1DZK A;  2J4U P;  4I60 A;  1PHO A;  1T0V A;  1BM5 A;  2OFR X;  3FR5 A;  2IZI A;  1WUB A;  2XMX A;  3BRY A;  2JMM A;  1ML7 A;  2KT4 B;  4O3X B;  3VY9 X;  3JSQ A;  4PR7 A;  3BS2 A;  3B2H A;  2A3F X;  4AYN A;  4QYN A;  4CSB A;  5HBS A;  2LA7 A;  4UB6 O;  1IIU A;  1I78 A;  4FZN A;  1Z24 A;  4ML7 B;  3V8U A;  3RDO A;  3C78 X;  1P4T A;  4XMC A;  4Y0P A;  2RN4 A;  3BX8 A;  3A0B O;  1LDO A;  3VG2 A;  2G79 A;  3FMZ A;  5IYU A;  4YCH A;  4BOE A;  1VYO A;  5H9K A;  2XTR A;  3VE1 A;  5B2A O;  4O4O A;  2CZU A;  1KGL A;  4Z2O A;  3FIQ A;  3EMN X;  4ZCB A;  4GGZ A;  3STN A;  5LJH A;  4ORW A;  3IA8 A;  2AT5 X;  1LUQ A;  4NV7 A;  2FHN X;  2RTO B;  2JMB A;  1KZX A;  1SXW A;  4IAB A;  5IXG A;  1YWA A;  1GFO A;  3UEX A;  3PQS A;  1SWU A;  3WZN A;  4DQ4 A;  3RWX A;  1OEK A;  1BXW A;  8PRN A;  1NGL A;  3ZUO A;  4U46 A;  1E5P A;  1HQP A;  2M06 A;  4XME A;  4ES7 A;  4KH8 A;  4EXZ A;  2KC0 A;  2PY1 A;  2WUT A;  3NX1 A;  3SZD A;  1SRG A;  2R8A A;  1BEB A;  1FEM A;  4IAW A;  2DJF A;  1W4T A;  3LK3 B;  4C00 A;  1N43 A;  4ORY A;  2R74 A;  3ZWE A;  2CM9 A;  3BSZ E;  3CKF A;  1KQX A;  4OEM A;  1SWN A;  3HTY A;  5AFU L;  1EII A;  2QOS C;  3BU9 A;  4E1S A;  4MIS A;  3DWN A;  2KXP B;  2BC3 A;  3S5X A;  2Z4I A;  1HN2 A;  2A2U A;  3POQ A;  1BT9 A;  4QRL A;  3FW4 A;  1FJ1 E;  1BSQ A;  1ICM A;  4AYI D;  2FLJ A;  4AYM C;  4YGZ A;  1QWD A;  1GT4 A;  5BVS A;  4ZFX A;  2XE3 A;  1KOI A;  2BHV A;  3LHN A;  3APV A;  3K19 A;  1E02 A;  3D97 A;  4ZJ0 A;  2K4T A;  4DQ3 A;  4O3Y A;  2W80 C;  3QRC A;  1G85 A;  2RTL A;  4I3D A;  4D64 A;  1SWT A;  2IZG B;  4ALO A;  1EUO A;  4NLI A;  3POX A;  1CBS A;  1X8Q A;  1I4U A;  3BRZ A;  1BLR A;  5HZ8 A;  2IWV A;  4JHQ A;  3OE3 A;  3X00 A;  4YDA A;  1TXL A;  1SWO A;  1SWB A;  2WPU A;  2IZB A;  3KVN A;  1O8V A;  2X8S A;  1ACD A;  1SWA A;  1SLF B;  2G5L A;  4KRA A;  2QO6 A;  2BSZ A;  1BBP A;  5DG4 A;  1STP A;  1FDQ A;  1N7Y A;  4GGR A;  2ZFG A;  2HYS A;  4LSE A;  4YMY A;  1VWR B;  5G3A A;  5CSE A;  5D4A A;  4WBK A;  3K3L A;  3S5V A;  2X34 A;  2M4L A;  4ORU A;  1MDC A;  4YKM A;  2IZA A;  2RTG B;  1EXS A;  2KZ7 B;  1EQD A;  1HBQ A;  1GT5 A;  4HPB A;  3QRA A;  5EEE A;  2FRS A;  1THQ A;  1R0U A;  5G38 A;  2BS5 A;  1S5L O;  4QGX A;  4Z28 A;  4YKO A;  2Y7S A;  1UYN X;  2UYW A;  3WJD A;  4AYH A;  4FZM A;  4Z2P A;  1LIE A;  3MVF A;  4FES A;  1KL5 A;  5IRA A;  1JYJ A;  4EEJ A;  3LK2 A;  2PRN A;  1ICN A;  2AT0 X;  1T16 A;  5G39 A;  2MM3 A;  2MHD A;  3EBW A;  1GX9 A;  1SA8 A;  3ZI8 A;  4LSI A;  3STM X;  1QFV A;  2L68 A;  3HWG A;  5GV0 A;  3RY1 A;  4LZV A;  4HPC A;  2JGS A;  3A2S X;  4AKR A;  4BGF A;  4AZP A;  3B2J A;  1X8P A;  4ID2 A;  4EFG A;  1TOW A;  2KTD A;  4COT A;  1LF7 A;  3NJT A;  3HPE A;  1YS5 A;  4GH7 A;  3Q6L A;  5DPQ A;  4BX7 A;  5DL7 A;  1QG5 A;  1X8N A;  2QO5 A;  1MM5 A;  2YNK A;  1HMT A;  4TLJ A;  3CMP A;  2JN3 A;  3HK1 A;  3ZUI A;  3U9P C;  5AJC A;  5LKE A;  4RLB A;  2QOM A;  5E79 O;  3VGW A;  1LCW A;  2HLV A;  2AVI A;  3ZW1 A;  4RL9 A;  2KDY A;  4GCS A;  3APW A;  1Y53 X;  4AZN A;  3SLO A;  4HPA A;  1BRP A;  4FRX A;  4RLC A;  3FR2 A;  2QCB A;  1LIB A;  4RUN A;  4XNK A;  2LFO A;  1NC9 A;  4GHB A;  2AF5 A;  4FGI B;  4I9S A;  1SLG B;  4GJS A;  3MG5 A;  1RXJ A;  5K67 A;  3LK2 B;  4I95 A;  1AQB A;  4NYQ A;  5BVQ A;  2ANS A;  3APX A;  4NW4 A;  1SWR A;  5B3M O;  4U9C A;  1I04 A;  3F8A A;  5K06 A;  1VWG B;  2YMS A;  4A1H A;  4ZHF A;  3CBC A;  3AA1 A;  1U0X A;  1IJ8 A;  2FS7 A;  2X55 A;  2FR2 A;  2K62 A;  1CBI A;  4OMX A;  4AZM A;  2WJQ A;  1HY2 A;  4JNJ A;  1JIW I;  4GZV A;  1B56 A;  4CPE A;  2OMF A;  1SWQ A;  4CDC A;  4AYE C;  2RTN B;  2W2F A;  3FEK A;  3T20 A;  1VWL B;  1GKA A;  3JQO A;  2OVA A;  5F58 A;  1S2P A;  4YDB A;  3RDU A;  4A60 A;  4BJ8 A;  4AZQ A;  3KVD D;  1Q9F A;  3NP1 A;  5ADX K;  4JGL A;  3MM0 A;  1Y55 X;  4FBV A;  2N2M A;  1KL4 A;  1B0O A;  4YGG A;  4Y5D A;  2EU7 X;  1E00 A;  2R4L A;  3ZW1 B;  3S60 A;  1GX8 A;  3WJE A;  4NYR A;  3PH6 A;  2A5C A;  1BJ7 A;  2OY7 A;  1SWG A;  2X8T A;  1IFB A;  1Q9G A;  1DZJ A;  4XNL A;  4IB9 A;  2A0A A;  5FAZ A;  2ZLD A;  2NNE A;  1BSY A;  2BLG A;  1G7N A;  1T68 X;  1KXO A;  4U8U M;  5IRU A;  1FTP A;  2R89 A;  2FTB A;  2IZE B;  2OVE A;  3RDS A;  2RCQ A;  2W81 C;  5L8O A;  2A8G A;  1S7D A;  5B11 O;  1I9H A;  2XE5 A;  4CPH B;  1E2T A;  3HWE A;  4TKB A;  4GNY A;  1A18 A;  1PM1 X;  4QZU A;  3I17 A;  3AKM A;  2QMI A;  4BQU A;  4N74 A;  5G26 A;  1FEL A;  3KQ0 A;  1SY2 A;  3DTQ A;  1G90 A;  3PRN A;  2R56 A;  4L1N A;  4ARH A;  1JV4 A;  2W2B A;  3A0H O;  1LCV A;  3AA7 A;  4EQA C;  3AA6 A;  1E54 A;  4O9S A;  2WEW A;  4I9R A;  2X56 A;  1GFM A;  2IWW A;  4KC8 A;  2HMB A;  2FS6 A;  2GTL O;  3G7G A;  2X4M A;  2MNH A;  2FKG A;  3FEP A;  1ZHY A;  5KAI O;  2RTR B;  4O3W A;  1KT7 A;  2Q4N A;  1Y0G A;  1OBQ A;  3AUM O;  2ZAI A;  3BLG A;  4AYD C;  2W2A A;  2I5V O;  5L8I A;  3NAD A;  3P6E A;  5FFH A;  1RAV A;  5GTH O;  2AH7 X;  3GE2 A;  4ZGU A;  4FQE A;  2OYB O;  3NQ9 A;  4BX7 B;  1SWH A;  5CHK A;  1VWB B;  1E06 A;  1IZN A;  4FSO A;  4FSP A;  1ZHT A;  1ADL A;  2G78 A;  5EDC A;  2R4P A;  4QZT A;  3RDM A;  3WZP A;  2ERV A;  4N75 A;  1OPF A;  1SWK A;  1ZNK A;  3LK4 1;  1N4J A;  4EDE A;  1SXY A;  3GAQ A;  1LNM A;  1SWE A;  2OY5 O;  4BX6 B;  3HWB A;  2RTI B;  1RXH A;  1URE A;  3FR4 A;  4YBP A;  1SLE B;  1ZHW A;  3APU A;  1Y9L A;  3HW9 A;  2OL8 O;  2LBA A;  3FEL A;  3KFH A;  5F1E A;  1FEN A;  1MPF A;  3VZW X;  1SWJ A;  3WJB A;  3T2X A;  2F1V A;  4CPF A;  4ON1 A;  1SXX A;  3KFI A;  3DA4 A;  3AA7 B;  4KR8 A;  3SOT A;  1BSO A;  3NX2 A;  3P6H A;  5LJD A;  1SWC A;  2AT3 X;  2CM4 A;  3FA7 A;  1DZM A;  5FEN A;  3G7X A;  2YG2 A;  1I06 A;  4ZGF A;  1W5R A;  2IZK A;  3ZW0 B;  3NQK A;  4E1T A;  3PF1 A;  1GXA A;  4B55 A;  3VHM A;  1G74 A;  3T6F A;  1H6S 1;  2XE1 A;  1IZN B;  2KTS A;  1OPA A;  3LK3 A;  5HTE A;  4AUI A;  1A2D A;  3OD9 A;  2LHF A;  5IO7 A;  1SRI A;  3RY2 A;  2RTJ A;  4YCE A;  3FW5 A;  4Y0R A;  1LEL A;  1JJJ A;  3DWO X;  2Z4H A;  4I6S A;  3PH5 A;  2XE2 A;  1JZU A;  2K23 A;  4MVL A;  1OBU A;  4MEE A;  1H91 A;  3RE6 A;  2XTQ A;  1IW2 A;  1EPB A;  5IO6 A;  4AW8 A;  3FYF A;  1IKJ A;  4Z3T A;  4GE1 A;  2KXP A;  3D9W A;  3OBL A;  5CYB A;  4HWM A;  3BDR A;  3L4R A;  1QFT A;  4I3B A;  1W6F A;  4O3Z A;  2X45 A;  4C5P A;  4MIR A;  2WQ9 A;  3P6D A;  4U8U N;  4NNT A;  1VWN B;  1QY2 A;  3SY9 A;  1CBR A;  2IZH B;  3BX7 A;  3T1D A;  1MK5 A;  5EED A;  2LBV A;  4R0B A;  4FRT A;  1VWA B;  1ORM A;  2HKD A;  2Q2M A;  1MVG A;  3PEC A;  5BVT A;  2UZ2 A;  3UEU A;  2CAM A;  3PED A;  2ACP X;  4FOZ A;  1QJP A;  1MOY A;  1U18 A;  1Y9T A;  3RDQ A;  3BRN A;  4N59 A;  3WXQ A;  4A1Y A;  4CK4 A;  4HFO A;  3NPO A;  2GE4 A;  1LID A;  2VDF A;  3EW2 A;  2OZQ A;  4GDA A;  1N0S A;  2AMM X;  3VU1 A;  4YFP A;  3NBX X;  2FGR A;  1LIC A;  3EW1 A;  4DCB A;  3AA1 B;  4GK9 A;  4OS0 A;  1OSM A;  2GJ5 A;  4U8U O;  3WJF A;  4K19 A;  1HBP A;  1O1U A;  1ZHX A;  1RLB E;  2R4N A;  3PGU A;  3FEN A;  1CJ5 A;  3CQR A;  3D96 A;  1SWF A;  1TVQ A;  1EW3 A;  3C76 X;  3NSG A;  1MX8 A;  2ZAG A;  2NND A;  3AEH A;  3SZI A;  4XMG A;  3D4R A;  4IRW A;  5D48 A;  3UAQ A;  3F9D A;  4GCQ A;  1LIF A;  1YUP A;  1PEE A;  5LJC A;  5HZ9 A;  3FA8 A;  5AEO A;  3SZJ A;  3ZQ3 A;  1JJU A;  2R88 A;  1VWK B;  1RBP A;  3KFG A;  4Y0S A;  1LKE A;  1X8O A;  2IZC B;  4ZHC A;  3H3I A;  1SWS A;  2K0L A;  5B5E O;  3SAO A;  5JR8 A;  1JMZ A;  2YPV A;  1X89 A;  5CE4 A;  3VG3 A;  4FUV A;  1K3B A;  4OMW A;  4LZU A;  1RXK A;  4GET A;  2X8F A;  1VYF A;  4TKJ A;  3BU1 A;  1NQN A;  3STK A;  4D6B A;  1YWC A;  1N9Y A;  1Y52 X;  3O0E A;  2POA A;  2IZD B;  1NP1 A;  3DA3 A;  1SMP I;  2A13 A;  2WWP A;  4YFR A;  4NLJ A;  4QNI A;  3MBT A;  1A3Y A;  1XCA A;  5L3Y A;  3JS1 A;  3PK2 A;  4CDD A;  4ZR2 A;  3RKG A;  2M07 A;  4ORX A;  3VG5 A;  1STR B;  3LTW A;  5GTI O;  2OFA A;  2CZT A;  3T6L A;  1N9M A;  2RTP B;  1VPR A;  1CBQ A;  2AL0 X;  4BX5 B;  5EZ2 A;  4LSH A;  4IB6 A;  1ZNE A;  4KC7 A;  1NDJ A;  1MX7 A;  4HPD A;  4KII A;  4DNE A;  2XKL A;  3SLJ A;  3VY8 X;  4GD9 A;  5D5D A;  4FMS A;  2QO4 A;  1BWY A;  3Q34 A;  4G76 A;  1OSP O;  3AAA B;  1JMX A;  4XMF A;  5LJE A;  4KCA A;  2RA6 A;  3WYQ A;  2L5P A;  4ZH6 A;  1GFP A;  2Q39 A;  5FQ6 E;  1D2U A;  1GKA B;  1HXU A;  2KZ7 A;  1AB0 A;  1YP7 A;  4PJ0 O;  4O4X A;  2LFU A;  3CBS A;  1OBP A;  4PJ2 A;  4D5U A;  3NR3 A;  4XMH A;  4IL6 O;  4FBR A;  2IZF B;  1UZ2 X;  4AZL A;  2X32 A;  2JU7 A;  4Z6J A;  2G7B A;  3AAE B;  1PBO A;  2RTC B;  5AQ6 A;  2OVD A;  4RJW A;  1NQM A;  4YGH A;  4O4U A;  1VWQ B;  2FKJ A;  1SLD B;  1RST B;  3B2I A;  4NV8 A;  4BX6 A;  3POR A;  3EYC A;  3VHI A;  1QY1 A;  4IMO A;  4ZHD A;  3RBH A;  3KZA A;  2WVP A;  4LQZ A;  3CKG A;  2F1C X;  3VE2 A;  2MO5 A;  4ORS A;  1EAL A;  2MF6 A;  3QQ2 A;  1SWL A;  3AA0 A;  1QQS A;  4F4B A;  3WZQ A;  1SY1 A;  2Y0H A;  3MX7 A;  2XG6 A;  2OY8 A;  2X46 A;  1AVE A;  5B29 A;  1L6M A;  4BX5 A;  5H9A A;  3C5O A;  2JU3 A;  5FQ7 E;  2HZR A;  2VFC A;  1ERX A;  1OEE A;  4GUZ A;  3RDX A;  4AFK A;  4AKR B;  4CPH A;  4C69 X;  4B61 A;  1NP4 A;  2RTD B;  4Y0Q A;  2FGQ X;  1BH3 A;  4GGT A;  3AAA A;  1YWD A;  2JOZ A;  3UEW A;  1AVD A;  4FQB B;  2POR A;  2MHL A;  1OPB A;  4GJV A;  4ALB A;  2OY1 O;  2FR3 A;  2P8G A;  1GFQ A;  3FLL A;  1AVG I;  5HA1 A;  2ASN X;  1QJ9 A;  1IFC A;  2Y3F A;  5JD2 A;  2RQ0 A;  5D45 A;  3ZW2 A;  3CR6 A;  1HMR A;  2OFM X;  4YFQ A;  4YH0 A;  3VZU X;  1ZRY A;  2RTM A;  1T1L A;  5ADX L;  1ZND A;  2GC9 A;  4ORR A;  4XMD A;  1KT6 A;  3WJC A;  1KZW A;  5LKF A;  3BY0 A;  2IZJ A;  1CRB A;  2OL6 O;  1JJX A;  3DZM A;  2OFB A;  3TF6 A;  4OS8 A;  5D47 A;  5H9L A;  3WZO A;  1ALB A;  1ZHZ A;  3VPJ E;  4ZHG A;  2J1N A;  5F6Z A;  2C1S A;  4M7M A;  4RJX A;  2RTH B;  1SXU A;  1X71 A;  5HCE C;  2Y0K A;  2Y2X A;  1X8U A;  4YVB A;  4GRJ A;  1YIV A;  5IRW A; 
#chains in the Genus database with same CATH homology
 2LBV A;  4IBA A;  4R0B A;  3ZW1 A;  4FRT A;  4RL9 A;  1ORM A;  2KDY A;  2FWV A;  4GCS A;  3APW A;  4AZN A;  4GDZ A;  5HWZ A;  5H9N A;  5LJB A;  1DFV A;  4HPA A;  2Q2M A;  1BRP A;  1MVG A;  5F7G A;  1HXX A;  4FRX A;  4RLC A;  3PEC A;  3FR2 A;  5BVT A;  3O22 A;  1LIB A;  4RUN A;  3HWD A;  1T8V A;  3FYX A;  4XNK A;  2LFO A;  3UEU A;  3EMM A;  3PED A;  5L8N A;  3AA0 B;  2ACP X;  4GHB A;  3NQ3 A;  4FOZ A;  4LSF A;  1QJP A;  3WI4 A;  1U18 A;  4FGI B;  3VG7 A;  4I9S A;  1Y9T A;  4QAE A;  5FVN A;  3BRN A;  3AA6 B;  4N59 A;  2X27 X;  2JW1 A;  3WXQ A;  4IMN A;  4A1Y A;  4CK4 A;  3PPT A;  4HFO A;  1PRN A;  2F1T A;  2CBR A;  3NPO A;  2GE4 A;  3LK2 B;  4I95 A;  1AQB A;  2A2G A;  4NYQ A;  2ANS A;  5B27 A;  5BVQ A;  1LID A;  3APX A;  4NW4 A;  1PMP A;  4U9C A;  2OZQ A;  1N0S A;  1XKI A;  1I04 A;  2AMM X;  3VU1 A;  3F6Z B;  3PP6 A;  3RSW A;  1D3S A;  4YFP A;  3JTY A;  4ZH9 A;  2BT9 A;  4GNW A;  4GKC A;  3F8A A;  3NBX X;  4RUU A;  1VYG A;  5K06 A;  3TGB A;  5EE2 A;  2FGR A;  3P02 A;  3B2K A;  4GCP A;  4JFB A;  2YMS A;  3P6G A;  1LIC A;  1DZP A;  4A1H A;  3T0S A;  4ZHF A;  4WFU A;  3AA1 B;  3CBC A;  4GK9 A;  4OS0 A;  1U0X A;  1OSM A;  3AA1 A;  2GJ5 A;  4U8U O;  2FS7 A;  4UU2 A;  3LK4 2;  3WJF A;  4K19 A;  7PRN A;  4AZR A;  3RBY A;  2FR2 A;  2K62 A;  1CBI A;  3P24 A;  1DZK A;  1HBP A;  1O1U A;  4OMX A;  2AT8 X;  2NP1 A;  4AZM A;  1HXT A;  4JCH A;  1ZHX A;  2J4U P;  1RLB E;  4LKT A;  1JIW I;  4GZV A;  1B56 A;  1PHO A;  2OMF A;  3HWF A;  1T0V A;  3FEN A;  1BM5 A;  2WSJ A;  4AYE C;  3VG4 A;  1CJ5 A;  4WHI A;  2OFR X;  2Q9S A;  2W2F A;  3FEK A;  3T20 A;  4IB7 A;  4GU8 A;  3FR5 A;  1GKA A;  2XST A;  3JQO A;  3SY7 A;  2OVA A;  5F58 A;  2ODJ A;  1S2P A;  3CQR A;  3D96 A;  1TVQ A;  1EW3 A;  5EDB A;  3C76 X;  1IKE A;  1JYD A;  2RD7 C;  4YDB A;  3NSG A;  2MWH A;  2XMX A;  1MX8 A;  4A60 A;  2ZAG A;  1EIO A;  2NND A;  3RZY A;  2JMM A;  3VZT X;  1ML7 A;  4XMG A;  3D4R A;  2KT4 B;  4D65 A;  5D48 A;  3UAQ A;  4O3X B;  3F9D A;  4AZQ A;  4GCQ A;  3VY9 X;  5PRN A;  4KT5 A;  3KVD D;  3JSQ A;  1Q9F A;  2RCT A;  3NP1 A;  1LIF A;  3BS2 A;  3SYB A;  5ADX K;  1YUP A;  1PEE A;  4JGL A;  5LJC A;  3B2H A;  4LKP A;  5HZ9 A;  3IFB A;  3FA8 A;  4FBV A;  5FQ8 E;  2A3F X;  2WR6 A;  3U0D A;  2N2M A;  4AYN A;  5AEO A;  2FT9 A;  4QYN A;  3ZQ3 A;  1QJ8 A;  1B0O A;  4YGG A;  3O19 A;  4CSB A;  4MVI A;  5HBS A;  2LA7 A;  2EU7 X;  1IIU A;  3C77 X;  1E00 A;  4FZN A;  1Z24 A;  3TZS A;  4ML7 B;  4O49 A;  2Q2P A;  4ZHH A;  1RBP A;  1EI5 A;  3V8U A;  3C78 X;  3S60 A;  3FA6 A;  3ZW1 B;  1P4T A;  3KFG A;  1GX8 A;  2ALL X;  4XMC A;  3TGC A;  4Y0S A;  1LKE A;  1X8O A;  4Y0P A;  3WJE A;  4NYR A;  3PH6 A;  5LJK A;  1BJ7 A;  2RN4 A;  3BX8 A;  5HCC C;  3HOE A;  4ZHC A;  2X8T A;  3VG2 A;  5AJB A;  1IFB A;  1Q9G A;  2G79 A;  3FMZ A;  3H3I A;  1DZJ A;  4GF4 A;  4XNL A;  4IB9 A;  5IYU A;  2K0L A;  2A0A A;  4YCH A;  3SAO A;  4BOE A;  5JR8 A;  4FZL A;  5FAZ A;  5DL8 A;  2YPV A;  5H9K A;  2XTR A;  1X89 A;  1QAB E;  2BS6 A;  3WBG A;  3VE1 A;  5BYP A;  5CE4 A;  2ZLD A;  4O4O A;  3VG3 A;  2NNE A;  4FUV A;  2CZU A;  1BSY A;  4OMW A;  2BLG A;  4LZU A;  1KGL A;  4MVK A;  1G7N A;  1T68 X;  3FIQ A;  1KXO A;  4GET A;  3EMN X;  2X8F A;  1VYF A;  4PSQ A;  4TKJ A;  4ZCB A;  4U8U M;  3BU1 A;  4IAX A;  3STN A;  5LJH A;  1FTP A;  4TJZ A;  3STK A;  4D6B A;  2FTB A;  4ORW A;  2OVE A;  4FT6 A;  2RCQ A;  2W81 C;  3IA8 A;  4QGW A;  4CV7 A;  5L8O A;  1YWC A;  1S7D A;  3O0E A;  2AT5 X;  2LKK A;  1A57 A;  2POA A;  2XE5 A;  1NP1 A;  3DA3 A;  1SMP I;  3ELZ A;  2GTL M;  2JMB A;  1KZX A;  2L9C A;  1SXW A;  4IAB A;  3HWE A;  2A13 A;  1YWA A;  2WWP A;  4O4S A;  4QGV A;  4TKB A;  1GT3 A;  4YFR A;  1GFO A;  4NLJ A;  3T24 A;  4GNY A;  5HA0 A;  3UEX A;  3PQS A;  2LB6 A;  4DQ4 A;  2N2L A;  4QNI A;  1A18 A;  1PM1 X;  4OS3 A;  4QZU A;  3I17 A;  3RWX A;  4TQ2 A;  3AKM A;  2KW1 A;  1OEK A;  2QMI A;  5D8J A;  4BQU A;  1BXW A;  8PRN A;  1NGL A;  3ZUO A;  5G26 A;  1FEL A;  3MBT A;  3KQ0 A;  1A3Y A;  1SY2 A;  3DTQ A;  1XCA A;  3JS1 A;  1E5P A;  2MJI A;  1HQP A;  1B4M A;  2M06 A;  4XME A;  1G90 A;  4ES7 A;  2CBS A;  3D95 A;  1P6P A;  5HAE A;  2R56 A;  4ZR2 A;  3RKG A;  4L1N A;  2M07 A;  3PRN A;  1SY3 A;  4ORX A;  2OVS A;  4KH8 A;  4EXZ A;  2KC0 A;  4YBU A;  2PY1 A;  3VG5 A;  3WOV A;  4ARH A;  1JV4 A;  2WUT A;  2W2B A;  3NX1 A;  3SZD A;  3AA7 A;  4EQA C;  3AA6 A;  1BEB A;  1FEM A;  3EBK A;  4IAW A;  1JBH A;  1E54 A;  2CZT A;  4O9S A;  2WEW A;  3B2L A;  3LK3 B;  1VPR A;  1CBQ A;  2AL0 X;  4ORY A;  2R74 A;  1ZNH A;  4I9R A;  5EZ2 A;  3ZWE A;  5HCD C;  3SZV A;  2CM9 A;  4N58 A;  3BSZ E;  1GFM A;  4LSH A;  1DV9 A;  4QYP A;  1KQX A;  4KC8 A;  2HMB A;  2FS6 A;  2GTL O;  3G7G A;  2MNH A;  3FEP A;  3HTY A;  1ZHY A;  4IB6 A;  5AFU L;  1ZNE A;  4KC7 A;  4O3W A;  1MX7 A;  4HPD A;  1EII A;  2QOS C;  1KT7 A;  3BU9 A;  4KII A;  2Q4N A;  2XKL A;  4E1S A;  3VY8 X;  1OBQ A;  3FA9 A;  3GP6 A;  5D5D A;  2WEX A;  4MIS A;  2ZAI A;  2KXP B;  4FMS A;  3BLG A;  1DC9 A;  4AYD C;  1HMS A;  2W2A A;  5L8I A;  1KT5 A;  2QO4 A;  3NAD A;  3S5X A;  1BWY A;  4G76 A;  2Z4I A;  3P6E A;  1HN2 A;  2A2U A;  5FFH A;  3AAA B;  3POQ A;  4XMF A;  1YWB A;  4KCA A;  5LJE A;  2RA6 A;  1BT9 A;  2L5P A;  4QRL A;  4ZH6 A;  1GFP A;  5LJG A;  2AH7 X;  3FW4 A;  2Q39 A;  3DSZ A;  1S44 A;  3GE2 A;  4ZGU A;  5FQ6 E;  1BSQ A;  1D2U A;  3ZW0 A;  1GKA B;  1HXU A;  2KZ7 A;  2F73 A;  3I0A A;  1AB0 A;  3NQ9 A;  1YP7 A;  1ICM A;  4O4X A;  4AYI D;  2LFU A;  2FLJ A;  1OBP A;  3CBS A;  3EM0 A;  4AYM C;  4PJ2 A;  1E06 A;  3E3C A;  1IZN A;  4D5U A;  3NR3 A;  4YGZ A;  4XMH A;  4FSO A;  1QWD A;  4FSP A;  1GT4 A;  5HZQ A;  4FBR A;  3HOL A;  1ZHT A;  1ADL A;  2G78 A;  2HZQ A;  1UZ2 X;  5EDC A;  5BVS A;  4AZL A;  2R73 A;  4BVM A;  1B8E A;  4ZFX A;  2JU7 A;  5C0N A;  4QZT A;  2XE3 A;  1KOI A;  4BUM X;  2L67 A;  3AAE A;  2BHV A;  2G7B A;  3LHN A;  3O2Y A;  3AAE B;  1PBO A;  2ERV A;  3APV A;  3K19 A;  1E02 A;  5AQ6 A;  1LPJ A;  2OVD A;  4RJW A;  1OPF A;  3D97 A;  4YGH A;  5KID A;  5H8T A;  1ZNK A;  4O4U A;  1LFO A;  4ZJ0 A;  2K4T A;  3LK4 1;  1ERB A;  2NNQ A;  4EDE A;  1SXY A;  3WVM A;  4DQ3 A;  5KHP A;  3GAQ A;  4O3Y A;  3B2I A;  4INN A;  4MVE A;  2W80 C;  1LNM A;  5IO5 A;  3POR A;  3HWB A;  3PQU A;  1URE A;  3EYC A;  3QRC A;  3FR4 A;  4YBP A;  1QY1 A;  1G85 A;  2WQA E;  4IMO A;  4I3D A;  4ZHD A;  3RBH A;  4D64 A;  3KZA A;  1ZHW A;  4LQZ A;  4ALO A;  4NP1 A;  1EUO A;  1FE3 A;  5HZ6 A;  3APU A;  1Y9L A;  3HW9 A;  3VE2 A;  4NLI A;  3FEL A;  2LBA A;  3KFH A;  5F1E A;  1CBS A;  1X8Q A;  2MO5 A;  4ORS A;  1EAL A;  3POX A;  1FEN A;  1MPF A;  3VZW X;  1I4U A;  1BLR A;  5HZ8 A;  3WJB A;  3AA0 A;  2F1V A;  4ON1 A;  1SY0 A;  4UU3 A;  3OE3 A;  1QQS A;  1SXX A;  3KFI A;  3DA4 A;  5F6B A;  3AA7 B;  4F4B A;  4G75 A;  1SY1 A;  4WFV A;  5DL6 A;  3UEV A;  3CWK A;  4YDA A;  3MX7 A;  1TXL A;  1DF3 A;  2Y0H A;  2XG6 A;  2X46 A;  5B29 A;  4KR8 A;  1L6M A;  5H9A A;  1O8V A;  3SOT A;  2X8S A;  3C5O A;  1BSO A;  2QM9 A;  1ACD A;  4I3C A;  4TKH A;  1QY0 A;  1KT4 A;  2JU3 A;  5FQ7 E;  2HZR A;  5HZ5 A;  4KRA A;  2QO6 A;  1YP6 A;  1ERX A;  3OJY C;  1OEE A;  3NX2 A;  3P6H A;  2DM5 A;  5LJD A;  1I05 A;  1BBP A;  2AT3 X;  2CM4 A;  2GTL N;  5DG4 A;  3FA7 A;  4AFK A;  4AKR B;  1DZM A;  2HNX A;  1FDQ A;  4C69 X;  4IB8 A;  5FEN A;  3G7X A;  2ZFG A;  2YG2 A;  2HYS A;  4LSE A;  4B61 A;  4YMY A;  3POU A;  4QQ1 A;  1U17 A;  3SYS A;  5D4A A;  1OEJ A;  1NP4 A;  4WBK A;  3K3L A;  4TNN A;  3S5V A;  2Y0L A;  1I06 A;  2QTK A;  2M4L A;  4Y0Q A;  4ORU A;  3U03 A;  4ZGF A;  1G5W A;  1MDC A;  4YKM A;  4L3R A;  2FGQ X;  3ZW0 B;  1GFN A;  3UPG A;  1EXS A;  3NQK A;  1BH3 A;  2KZ7 B;  4E1T A;  3AAA A;  1EQD A;  1AEL A;  1YWD A;  1HBQ A;  1GT5 A;  1GM6 A;  4HPB A;  2JOZ A;  3TGA A;  3UEW A;  1O1V A;  1GXA A;  3QRA A;  5EEE A;  2FRS A;  1THQ A;  1R0U A;  3N91 A;  2BS5 A;  4FQB B;  3ELX A;  1G74 A;  2POR A;  4QGX A;  2MHL A;  1H6S 1;  2O62 A;  1OPB A;  4YKO A;  4ALB A;  2Y7S A;  2JU8 A;  2XE1 A;  2FR3 A;  3WJD A;  2P8G A;  3TZG A;  1GFQ A;  2KTS A;  4AYH A;  1IZN B;  1MM4 A;  4FZM A;  3FLL A;  1OPA A;  1KT3 A;  1LIE A;  5DL5 A;  1AVG I;  3MVF A;  5HA1 A;  5HTE A;  3LK3 A;  4FES A;  4N7C A;  1JYJ A;  4EEJ A;  4AUI A;  1A2D A;  2AKQ A;  3CQN A;  4AZO A;  2ASN X;  1QJ9 A;  3ZZV A;  1IFC A;  1ZNG A;  3OD9 A;  1GGL A;  3LK2 A;  2PRN A;  2LHF A;  5IO7 A;  1ICN A;  2RQ0 A;  2AT0 X;  4U3Q A;  2MM3 A;  4YCE A;  2MHD A;  3FW5 A;  4Y0R A;  5D45 A;  1JJJ A;  3EBW A;  3UU2 A;  1GX9 A;  2AT6 X;  2Z4H A;  3CR6 A;  3KFF A;  4I6S A;  1HMR A;  3ZW2 A;  4D6A A;  6PRN A;  1SA8 A;  3WJG A;  3ZI8 A;  3P6C A;  3PH5 A;  4LSI A;  2XE2 A;  2OFM X;  4YFQ A;  4YH0 A;  3STM X;  1QFV A;  1ZRY A;  3VZU X;  2L68 A;  2ACO A;  3HWG A;  1JZU A;  2K23 A;  5GV0 A;  4M6S A;  4MVL A;  5ADX L;  1OBU A;  4LZV A;  1H91 A;  3LV4 A;  1ZND A;  4HPC A;  2GC9 A;  3S26 A;  3A2S X;  4AKR A;  4ORR A;  4XMD A;  1KT6 A;  3AKN A;  3B2J A;  4AZP A;  1KQW A;  1X8P A;  3WJC A;  2KD2 A;  1BRQ A;  1IW2 A;  1EPB A;  5IO6 A;  1KZW A;  2XTQ A;  4N7D A;  4AW8 A;  5LKF A;  4PUX A;  3FYF A;  1MUP A;  1IKJ A;  3BY0 A;  2F09 A;  4GE1 A;  4ID2 A;  4EFG A;  1TOW A;  4Z3T A;  2KXP A;  1CRB A;  2GTF X;  1JJX A;  3VG6 A;  2KTD A;  4COT A;  1LF7 A;  3OBL A;  3WI5 A;  4ODD A;  5CYB A;  4NNS A;  4HWM A;  3TF6 A;  4OS8 A;  5D47 A;  1YS5 A;  4GH7 A;  5H9L A;  3BDR A;  3L4R A;  3Q6L A;  5DPQ A;  1QFT A;  2N93 A;  4I3B A;  5EPQ A;  2IFB A;  5DL7 A;  4FBO A;  1QG5 A;  3P6F A;  1X8N A;  4AKM A;  2QO5 A;  4O3Z A;  1MM5 A;  1ALB A;  2YNK A;  2X45 A;  5KIC A;  1HMT A;  4TLJ A;  3CMP A;  5JDP A;  1ZHZ A;  4MIR A;  2WQ9 A;  2JN3 A;  3P6D A;  2E4J A;  3VPJ E;  3QKG A;  4U8U N;  4ZHG A;  2J1N A;  4NNT A;  5F6Z A;  3HK1 A;  4M7M A;  4RJX A;  1QY2 A;  1EPA A;  3ZUI A;  3SY9 A;  1CBR A;  1SXU A;  3U9P C;  1X71 A;  5AJC A;  5LKE A;  2O4V A;  3BX7 A;  3T1D A;  5HCE C;  1GT1 A;  2Y0K A;  4RLB A;  1TW4 A;  4KR4 A;  2Y2X A;  1X8U A;  1ZNL A;  5HTD A;  5EED A;  1TOU A;  4GRJ A;  1YIV A;  5T5F A;  5AFU K;  2HLV A;  4A8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...