3VE1A

The 2.9 angstrom crystal structure of transferrin binding protein b (tbpb) from serogroup b m982 neisseria meningitidis in complex with human transferrin
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
652
structure length
537
Chain Sequence
QGGYGFAMRLKRRNWYPGAEESEVKLNESDWEATGLPTKPKELPKRQKSVIEKVETDGDSDIYSSPYLTPSNHVNQPKNQATGHENFQYVYSGWFYKHAASEKDFSNKKIKSGDDGYIFYHGEKPSRQLPASGKVIYKGVWHFVTDTKKGQDFREIIQPSKKQGDRYSGFSGDGSEEYSNKNESTLKDDHEGYGFTSNLEVDFGNKKLTGKLIRNNASLNNNTNNDKHTTQYYSLDAQITGNRFNGTATATDKKENETKLHPFVSDSSSLSGGFFGPQGEELGFRFLSDDQKVAVVGSAKTKDKLSKLTTVLDAVELTLNDKKIKNLDNFSNAAQLVVDGIMIPLLPKDEFTRKFEHTPETKTYEVEVCCSNLNYLKYGMLTRKNQVEQSMFLQGERTDEKEIPTDQNVVYRGSWYGHIANGTSWSGNASDKEGGNRAEFTVNFADKKITGKLTAENRQAQTFTIEGMIQGNGFEGTAKTAESGFDLDRTPKAYITDAKVKGGFYGPKAEELGGWFAYPGDKASSATVVFGAKRQQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transferrin-binding protein 2
publication title The structural basis of transferrin sequestration by transferrin-binding protein B.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transport protein
total genus 136
structure length 537
sequence length 652
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
A PF17483 TbpB_C C-lobe handle domain of Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.240 Mainly Beta Beta Barrel Lipocalin Lipocalin 3ve1A03
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 3ve1A01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 3ve1A04
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 3ve1A02
4U9CA 4QQ1A 4AYMC 4O49A 4O4UA 4O4XA 4O3YA 4O3ZA 3V8UA 2KDYA 3PQSA 5EE2A 5T5FA 4AYID 4AYEC 4O3XB 1YS5A 4AYNA 3HOEA 4Z3TA 2W80C 3VE1A 3VE2A 4AYDC 3HOLA 2Y7SA 4O3WA 2LFUA 3KVDD 2W81C 3UAQA 2KC0A 2YPVA 3PQUA
chains in the Genus database with same CATH superfamily
2IZAA 4MVKA 4FZNA 5HZ9A 2Y3FA 1R0UA 2R4OA 2QCBA 1IIUA 4RLBA 3F9DA 4I95A 3C76X 4MEEA 1DFVA 2WSJA 2EU7X 2HZRA 4WFUA 3TZSA 1SLGB 4GRJA 1SRHA 1E06A 3NQKA 4N59A 2L67A 2WQ9A 2K4TA 4AYMC 1ZHZA 1MM9A 4Z2OA 3WZOA 2XSTA 2OMFA 4QAEA 3APUA 3ZWEA 4F4BA 5C0NA 5L8IA 3HWGA 2IZLB 2GTLO 1OPAA 3VG3A 1SWPA 2N2LA 1SWEA 4Y5DA 3HWEA 3BS0A 1G74A 2QTKA 1N43A 3RKGA 3FMZA 2F1TA 4A1YA 3K19A 2OVEA 5F6ZA 2WVPA 3T1DA 2FGQX 5BVSA 1AVEA 1VWBB 5D45A 1ZHXA 2LBVA 2GC9A 2MO5A 3RDSA 4G75A 1SXYA 3MVFA 3A0BO 1OSPO 1LPJA 1GX9A 1O1UA 2J4UP 4ZHGA 1PM1X 1AVDA 4IMNA 4BX6A 3VZTX 3POUA 2L5PA 3I0AA 3LHNA 3S5XA 4ZHFA 4PR7A 3BDRA 4HWMA 2R8AA 3VZWX 5LJGA 1X8QA 1VWRB 1HXUA 5F58A 1T68X 5K06A 2O62A 4I9RA 1GFNA 4LSHA 3ELXA 3UEUA 5G3AA 4AW8A 3WI5A 2P8GA 3P02A 2WPUA 3FA9A 4MVLA 4R0BA 3SZJA 2OZQA 1UREA 3C77X 1P4TA 1SWBA 1I05A 4BBOA 1THQA 4FESA 1BSYA 3C5OA 1A18A 5LJEA 3PPTA 4U9CA 3AUMO 1Y52X 3PGRA 1H91A 1IFBA 1Y9LA 4LSFA 3DWOX 3APWA 3VPJE 8PRNA 5IYUA 5AJCA 1SXXA 4EEJA 2IWVA 2C4IA 4FGIB 1I9HA 1S44A 3E3CA 3PEDA 4N75A 3QKGA 4ZHDA 4PJ0O 2FS6A 1OBQA 2Y0LA 2X55A 1AQBA 1LCVA 4G76A 3ZW0A 4K19A 1SY3A 4ORWA 2KW1A 3B2LA 4UU3A 1IKJA 1X89A 3F6ZB 4LSEA 3P6HA 4YBPA 5L8OA 4NYQA 2RTMA 1YUPA 2GE4A 4E1SA 5KAIO 4NV8A 4GNWA 3PDFA 4ZHHA 5B29A 3T24A 4JHQA 1ICNA 4ORRA 4AFKA 5B66O 2ZSCA 1VWDB 2R74A 3NR3A 1GT1A 4YCHA 3BX8A 2M06A 4GJVA 3B2IA 3IA8A 3LV4A 4FBRA 2A2UA 2FT9A 2KZ7A 4AZPA 3TGAA 1G90A 2FLJA 1SLFB 2AMMX 1Y55X 2X46A 4XMFA 4WHIA 2RD7C 2Q39A 1Z24A 5F6BA 2HLVA 4A8ZA 3LTWA 4Z28A 1GT5A 4AUIA 4CDFA 1G85A 3EC5A 2GTLM 2KC0A 4BX5B 1YP7A 1AB0A 1VWJB 2PRNA 2OVAA 1GFOA 2G8CO 2Q4NA 2Q9SA 2BT9A 1VWQB 5AFUK 4Z3TA 3FELA 3FR2A 1FJ1E 4ZR2A 1O8VA 2R73A 4EKVA 4I9SA 4C5PA 1FE3A 5GV0A 4COTA 1NP4A 2IZJA 1OBPA 2Y0HA 1B56A 1E02A 4ORUA 1JYJA 2G78A 1GX8A 3PQSA 4FQEA 1ZNDA 2G5LA 3BU1A 4ID2A 1LIBA 3LK41 4TLJA 5DL6A 3PF1A 4XMEA 2XMXA 1MX7A 2JU8A 1I4UA 3N91A 5ADXK 4OS8A 5HWZA 3FLLA 4GGRA 3A0HO 4Z6JA 5E79O 4HPDA 2KXPB 5HZ8A 1JV4A 2JMBA 1KT5A 2Y2XA 5F7GA 1EIOA 4BX7A 1LFOA 3NQ3A 1QFTA 3FYXA 1D2UA 3CWKA 1VWOB 1N4JA 1SWSA 3U9PC 3BRYA 3NX1A 4ARHA 6PRNA 4PUXA 1PBOA 2A5BA 3UEWA 1NP1A 3EYCA 4TKBA 1TVQA 2JU7A 2WJQA 4ORXA 3AA0B 2IZCB 3HOEA 1ERBA 2AT3X 4LZUA 2W2AA 1B8EA 1DZPA 2UYWA 1K3BA 3VG2A 1LF7A 3EMMA 5H9LA 2DM5A 2FWVA 4GHBA 4CK4A 1I78A 2MM3A 4Y0PA 2X8SA 4D6AA 1XKIA 3RE6A 1ADLA 1WUBA 4OELA 5FENA 2RCTA 5HTDA 2A0AA 2RTEB 1ERXA 4YH0A 4GUZA 2RTLA 4DQ4A 4C4VA 2XTRA 1SWCA 2FKGA 3WYPA 4AZLA 4BX5A 2A5CA 2A8GA 2F01A 3ZUOA 2LKKA 5B3MO 1A57A 1BRQA 3UPGA 2K23A 1BWYA 1NQMA 1RLBE 3SZIA 2AT5X 3SYSA 2K0LA 1EQDA 3SLJA 2XG6A 1MVGA 1LIEA 4EQAC 3HW9A 4NW4A 2JU3A 1FELA 3D95A 4O4XA 2OL6O 1SLDB 1SWAA 3SLOA 3FENA 2R4LA 4BX6B 1SWDA 2MNHA 2I5ZO 4OMWA 1Q9FA 1ALBA 3DSZA 1S2PA 2N93A 1YWDA 5H9AA 3RDMA 5D4AA 4YGHA 1HXTA 5HA0A 4Z27A 5FAZA 3T2XA 2RTPB 4KR8A 4AYID 1XCAA 3BLGA 3VE1A 1RXKA 2AKQA 5F2BA 2X8FA 3WZPA 1MOYA 1QG5A 2RTGB 3U03A 3FA8A 5LJDA 1AELA 1GT4A 2KXPA 1T8VA 4MVEA 4GDZA 1NBXA 2RTDB 3CKFA 4U8UM 2OL7A 3RE5A 4ALOA 2IWWA 3RBHA 1GX3A 2Y0KA 3H3IA 1DF3A 3BX7A 1RSTB 4HPCA 4JCHA 4YFPA 5JD2A 1EUOA 1PMPA 1CBIA 2QM9A 4AYEC 4IRWA 3AA0A 3POQA 3PK2A 4GCPA 2LFUA 1SWUA 3EW2A 2PORA 4HFOA 1OPBA 1ZNGA 4I60A 2YPVA 3O0EA 4LKPA 3BSZE 4GJSA 1YIVA 4QRLA 4YFRA 3STMX 3PGUA 2JMMA 2QO5A 1EPBA 4M7MA 5HZQA 4KC8A 1VWFB 1K24A 1E5PA 3ZW0B 1W5RA 2FKJA 1IFCA 4OS0A 3T20A 3FEKA 1OPFA 2LA7A 4KH8A 4N7DA 1Y53X 3RDUA 2BHVA 3C78X 1GFQA 5EE2A 1QJPA 2X32A 2RTBB 3QRCA 4GCQA 3GAQA 5H8TA 2ZFGA 4Z2PA 1FTPA 4FSOA 4O9SA 1N7YA 3APXA 1HMTA 5FQ6E 4FRTA 2IZDB 1S5LO 4CDEA 4YKMA 4Y0SA 1TOWA 4UB8O 4QGWA 2X34A 1DF8A 2KZ7B 3FIQA 1EXSA 2ODJA 2MF6A 1QY1A 3B2KA 4QNIA 5DG4A 1SXWA 3RBYA 3VY8X 3LK3B 3JS1A 1SWFA 2MHLA 4B61A 1VWMB 4QYPA 4IB8A 2R4NA 4AZRA 2QO4A 3RWXA 3HK1A 4Y0RA 1DZMA 1KOIA 2FTBA 4CPFA 4M6SA 5IRUA 4XMDA 2LFOA 1MX8A 1PRNA 2RTKA 4CDCA 1KZXA 3NSGA 1LIFA 5HAEA 1BRPA 4YKOA 2HYSA 3EM0A 3B2JA 1KL4A 1SY2A 4PJ2A 1KT4A 2Z4IA 3VG6A 3KFGA 4Y0QA 1ZHYA 3G7GA 5CYBA 1IKEA 1N9MA 2C1SA 3SZHA 1UZ2X 4AZNA 3OJYC 2CBRA 5LJCA 2OFBA 3DTQA 4Z2VA 3CMPA 3FYFA 3FA7A 5EZ2A 3CKGA 3PP6A 5LJKA 4I3BA 1B4MA 4BGFA 2YNKA 3S26A 2WJRA 1SWLA 3PH5A 3DA3A 4KRAA 4B55A 1GGLA 2X9KA 4IBAA 4NP1A 1BSQA 4NLIA 4K3CA 2F09A 5JR8A 1FENA 4ZFXA 1RXHA 1Y0GA 3PECA 3POXA 2OFMX 4BX7B 4FBOA 1DC9A 1KL3A 2CZTA 2KTSA 2N2MA 1X8PA 2ALLX 3WJEA 1BSOA 4MVIA 1BH3A 1JZUA 1U18A 1VWEB 2PY1A 3SYBA 3B2HA 2PI3O 2OL8O 2IZGB 4O3YA 3FR4A 1NGLA 3KFFA 5AJBA 1DV9A 4KR4A 4YGGA 3RDQA 3D96A 1HQPA 3KVDD 1HY2A 5DPQA 4DQ3A 3PQUA 1Y9TA 2RTJA 1RXJA 3AA7B 1T1LA 3WVMA 1SRJA 1VWPB 5PRNA 2AT0X 3AKNA 3RDXA 2RN4A 4JNJA 3APVA 3NP1A 3JSQA 1CRBA 3WBGA 4GK9A 4I6SA 4C4VB 3HTYA 3LK3A 4YFQA 2X56A 1RAVA 3GP6A 5EEEA 3ZW2A 5KHPA 2BSZA 3WJDA 4ON1A 5T5FA 4U8UO 2KDYA 2BLGA 3MBTA 4OMXA 4AYHA 5KICA 1OSMA 1O1VA 3I17A 3EMNX 2LHFA 1FDQA 1LDOA 3VG5A 1VYFA 4AZMA 5D47A 2ZAIA 4KT5A 5H9KA 4FRXA 3KZIO 1KGLA 3CR6A 1MDCA 3P6GA 2L68A 4E1TA 3U0DA 1KL5A 1VWCB 3HWBA 4AYNA 2AF5A 5JDPA 1ZNHA 2G79A 3WJBA 3LK2B 1IJ8A 4GETA 1VYOA 4YVBA 4FMSA 3FIDA 1X71A 5H2FO 2LB6A 3KFHA 3DWNA 4FQBB 5IRAA 3VU1A 4WBKA 2YG2A 2AT8X 1DZJA 3D97A 1A2DA 3RY1A 3AA1B 2QOMA 3FW5A 2F1VA 4AZQA 5B2AO 3WJFA 1CBRA 1U17A 3KVNA 4IB6A 4D5UA 1VWNB 2A13A 1NQNA 2POAA 1VWKB 5B10O 1GT3A 4ZGFA 3STKA 1L6MA 2RTHB 4KIIA 2OY5O 2QMIA 2XE2A 3FR5A 1ZNKA 4U46A 1X8NA 1BBPA 4RUNA 2XE3A 2IZKA 4INNA 3P6CA 4GD9A 4TQ2A 5L3YA 3ELZA 4MIRA 1Q9GA 2FHLA 2CM9A 1VWLB 5EPQA 5IO7A 3MM0A 1JMXA 4LQZA 5EDCA 3T6FA 1LELA 2ACOA 3AA7A 4DCBA 2RTAA 4XNKA 1PHOA 4TKHA 4RUUA 3P6FA 2XE5A 3AEHA 1T0VA 1SRFA 2QOSC 4TKJA 2IZBA 4QZTA 3IFBA 1HMSA 4D6BA 3P6DA 4GF4A 3PRNA 4HPBA 3ZZVA 3BRZA 1X8OA 2O4VA 4YBUA 4IAWA 2CAMA 4CPIA 2NNQA 3ZW1B 2MJIA 2JW1A 4N74A 5FFHA 4A60A 1TXLA 2R89A 4QZUA 3AA6B 2OFRX 1H6S1 2UZ2A 4FT6A 1G5WA 1QQSA 4YMYA 1E2TA 2BC3A 4LSIA 4GZVA 3UU2A 4LZVA 3JCUO 3X00A 1QY0A 4GGTA 1VWIB 4D65A 4O3XB 1STSB 1GM6A 3CQNA 1LIDA 3LK2A 3EBKA 4ORYA 2W81C 4NLJA 1JJXA 2OF8A 4IABA 1LNMA 3NJTA 3SOTA 2GTLN 4ORSA 1PTSA 1ML7A 4N58A 3SY9A 2RTIB 1SWRA 2AH7X 3V8UA 4I3CA 4AZOA 1CJ5A 3QRAA 4A1HA 4K3BA 1SREA 2FGRA 4TJZA 1HMRA 3AA1A 3NX2A 4BOEA 5KAFO 4DNEA 5HZ6A 5D48A 3ZI8A 1VWGB 4O4OA 4BJ8A 1QJ9A 1NDJA 5IO5A 2ANSA 2E4JA 1LKEA 4IB7A 1N9YA 1SWNA 4CSBA 2Y32A 1SWOA 4QGVA 2GJ5A 1JQPA 2R88A 1GXAA 1HXZA 4OEMA 1SWTA 1YWBA 5DL8A 1VYGA 4QYNA 2DJGA 4CPHB 2FR2A 5HCCC 5K67A 1OEJA 2ZLDA 1ZHWA 3P24A 2I5VO 2W2BA 4CPEA 5B5FA 3WJCA 1EIIA 2OVSA 5LKFA 1UYOX 3WZQA 4AKRB 1EW3A 4YDAA 4FSPA 4RLCA 5H9NA 4D64A 1MM5A 2MHDA 3EBWA 5G39A 2RA6A 1I06A 1BLRA 2FR3A 3WYQA 3ZW1A 2ACPX 5K68A 3SZDA 3RY2A 3FA6A 3AA6A 4C00A 1SY0A 2X27X 5CSEA 2NNEA 1A3YA 1SWKA 1CBQA 2Y3EA 3P6EA 4NNSA 3OE3A 2KTDA 4LKTA 4YGZA 2R56A 3A2SX 4ZCBA 5BVTA 1G7NA 4NYRA 7PRNA 3BY0A 3WI4A 1GFPA 1BXWA 1YP6A 4FUVA 4QQ1A 2AVIA 4O49A 1VWAB 1KT3A 4XMGA 2QO6A 2X4MA 1IW2A 4HPAA 1TW4A 5FQ8E 2A2GA 5CE4A 1ZNLA 4FZLA 5GTHO 1OBUA 4O3WA 1I04A 3AAEB 5B27A 3D4RA 3G7XA 1QJ8A 5AEOA 5TISO 1QY2A 2OY7A 2AXTO 5BYPA 2KT4B 1BEBA 2M4LA 1LDQA 5BVQA 2RQ0A 4MISA 1JBHA 3D9WA 2K62A 2WWPA 2WQAE 3EW1A 3UEVA 1MK5A 4KC7A 1ZNEA 3NADA 1SRGA 1PEEA 1GKAB 2RTNB 5LJBA 1ZHTA 4GNYA 1IZNA 5HCDC 1P6PA 3WXQA 4CPHA 3PH6A 4RJWA 2JQYA 2G7BA 4GKCA 3HWFA 4O3ZA 3NPOA 4U8UN 5AQ6A 2MWHA 1NC9A 5B5GA 3VHIA 1X8UA 4BUMX 4UU2A 3AAAB 2HMBA 4AKRA 4IAXA 1EALA 4TNNA 2OY8A 5DL5A 4ZH6A 4GGZA 3K3LA 3RZYA 2Q2MA 1MM4A 3STNA 2OYBO 3F8AA 1BT9A 1SXUA 3T6LA 2BS5A 3AKMA 1ZRYA 3BU9A 4AYDC 3HOLA 1PBYA 1GFMA 3OD9A 4CDDA 3T0SA 1ORMA 4GU8A 2M07A 1LUQA 3QQ2A 4QGXA 2A3FX 5B5EO 2JN3A 1SLEB 2C1QA 2OY1O 2XTQA 5EEDA 2OVDA 1KXOA 1MEPA 4CV7A 4KCAA 4BCSA 1ICMA 1QFVA 2HZQA 1MPFA 3HPEA 3DZMA 1SWQA 3WJGA 1HBPA 4ALBA 2J1NA 3O22A 1JJJA 3Q6LA 3CQRA 2W80C 1MUPA 3VHHA 3ZQ3A 3TZGA 3WZNA 2RTCB 3AAEA 2XE1A 2YMSA 1KFFA 4ML7B 5FQ7E 3SY7A 1S7DA 1SWJA 4EXZA 3LK42 4BVMA 1E00A 2F73A 1CBSA 1BJ7A 1LICA 2X45A 2FRSA 1SMPI 1HXXA 5IRWA 1GKAA 5KIDA 2HKDA 4U3QA 3HWDA 2VFCA 5G26A 1STPA 1RSUB 2CZUA 3MX7A 5G38A 3MG5A 2IZIA 3DA4A 3VZUX 1OEEA 4ODDA 1N0SA 4EDEA 3RDOA 4GH7A 3CBSA 5HTEA 2FGSA 1JJUA 1TOUA 2L9CA 3TF6A 5FVNA 2HNXA 2WEWA 3VE2A 2Z4HA 1VPRA 1HQQA 1RBPA 1YWCA 3NBXX 4L3RA 5HCEC 3AAAA 2CM4A 1UYNX 1JMZA 4JO6A 3RSWA 2NP1A 5IXGA 1BM5A 3FEPA 3KQ0A 1YS5A 3S60A 2W2FA 4FBVA 4JGLA 2AT6X 1U0XA 4ZJ0A 2VFBA 1SWHA 4XMHA 3VG4A 4CTDA 2RTFB 4Y59A 1SY1A 2JGSA 4GDAA 3O2YA 3FW4A 4FZMA 3PGSA 3T2WA 4JFBA 1ACDA 4UB6O 4C69X 1VWHB 3S5VA 1OEKA 5IO6A 1LCWA 1YWAA 3VGWA 5DL7A 1W4TA 1KT6A 4XNLA 3PORA 4O4UA 2WR6A 2IZFB 2RTRB 1JYDA 2FS7A 3CBCA 2OF9A 4N7CA 3FDCA 2JOZA 1KZWA 2ERVA 5L8NA 4IL6O 1STRB 2R4PA 5AFUL 4BQUA 1WBIA 3BRNA 4FOZA 2VDFA 2WEXA 2IZEB 5LJHA 4IMOA 3JQOA 4YDBA 5LKEA 2Y7SA 3SLTA 1SWGA 2KD2A 1EI5A 2FHNX 1HBQA 5HZ5A 4ZH9A 1QABE 4XMCA 1DZKA 4GCSA 2RCQA 2GH7A 4IB9A 1W6FA 3SAOA 3SZVA 5F1EA 1FEMA 1QWDA 4YCEA 3KZAA 3VHMA 4O4SA 1EPAA 3TGCA 1KQXA 5HA1A 3NQ9A 4RJXA 4I3DA 3GE2A 4NV7A 2NNDA 3WU2O 3TGBA 5ADXL 1AVGI 1HN2A 4OS3A 3KFIA 4L1NA 2DJFA 4WFVA 1B0OA 1HXLA 2AL0X 4OKAA 2ASNX 3VY9X 5D5DA 1SA8A 4ZHCA 1LCZA 2CBSA 5D8JA 3UEXA 5CHKA 2F1CX 2Q2PA 1SRIA 2ZAGA 2RTQB 5B11O 5EDBA 2X8TA 2IZHB 1E54A 4ES7A 4ZGUA 2OFAA 3L4RA 3UAQA 1KT7A 2GTFX 1KQWA 5HBSA 1D3SA 4GE1A 3Q34A 4EFGA 3WOVA 1JIWI 2LBAA 3ZUIA 3OBLA 4PSQA 2IFBA 4AKMA 4NNTA 3JTYA 2BS6A 4RL9A 5GTIO 3BS2A 1IZNB 3O19A 2XKLA 3VG7A 2RTOB 1T16A 2WUTA
chains in the Genus database with same CATH topology
1ZNEA 2MM3A 3NADA 4Y0PA 5KHPA 2X8SA 4D6AA 4MVKA 1XKIA 4FZNA 5HZ9A 1ADLA 3WJDA 4ON1A 5T5FA 4U8UO 1PEEA 2KDYA 1R0UA 1GKAB 2BLGA 5FENA 2RCTA 5LJBA 1IIUA 5HTDA 4RLBA 3F9DA 2A0AA 3MBTA 4I95A 3C76X 1ERXA 1ZHTA 4OMXA 4YH0A 4AYHA 1DFVA 2WSJA 2EU7X 4DQ4A 5KICA 4GNYA 1OSMA 1IZNA 2HZRA 5HCDC 1O1VA 1P6PA 4WFUA 3TZSA 3I17A 3EMNX 2LHFA 1FDQA 3WXQA 3VG5A 2XTRA 4GRJA 3PH6A 1VYFA 4AZMA 1E06A 3NQKA 5D47A 2ZAIA 4N59A 4RJWA 4KT5A 5H9KA 2L67A 2WQ9A 2K4TA 2G7BA 4GKCA 4FRXA 4AYMC 1ZHZA 3ZUOA 3CR6A 1MDCA 2LKKA 3P6GA 1A57A 3HWFA 2L68A 1KGLA 4E1TA 4O3ZA 3U0DA 3NPOA 4AZLA 4U8UN 1BRQA 3HWBA 5AQ6A 4AYNA 5JDPA 2MWHA 1ZNHA 3UPGA 2G79A 2XSTA 2OMFA 4QAEA 3WJBA 3LK2B 2K23A 3APUA 1BWYA 3ZWEA 4F4BA 4GETA 5C0NA 5L8IA 1X8UA 4FMSA 1X71A 4BUMX 4UU2A 3HWGA 3AAAB 1RLBE 2HMBA 2AT5X 4AKRA 2GTLO 3SYSA 4IAXA 2K0LA 1EQDA 1OPAA 2LB6A 3KFHA 2XG6A 1EALA 4TNNA 3VG3A 1MVGA 4FQBB 2N2LA 5DL5A 4ZH6A 3HWEA 3VU1A 1LIEA 1G74A 3K3LA 4WBKA 3RZYA 2YG2A 4EQAC 4NW4A 2JU3A 2Q2MA 3HW9A 1MM4A 1FELA 2AT8X 3STNA 2QTKA 3D95A 3F8AA 4O4XA 1BT9A 3RKGA 1SXUA 2BS5A 3AKMA 3FMZA 1DZJA 3D97A 2F1TA 4A1YA 1ZRYA 3FENA 3BU9A 4AYDC 3HOLA 1A2DA 3AA1B 3FW5A 1GFMA 2F1VA 4AZQA 3OD9A 3T0SA 1ORMA 2MNHA 4OMWA 3WJFA 1Q9FA 1ALBA 3K19A 2OVEA 3DSZA 1S2PA 1CBRA 2N93A 4GU8A 1YWDA 5F6ZA 2M07A 3T1DA 2FGQX 1U17A 5H9AA 5BVSA 4IB6A 5D4AA 4QGXA 4D5UA 4YGHA 2A3FX 1HXTA 5HA0A 2A13A 2JN3A 5FAZA 5D45A 1ZHXA 2LBVA 2POAA 2GC9A 2MO5A 4KR8A 4G75A 2XTQA 5EEDA 1SXYA 1GT3A 1XCAA 3BLGA 3MVFA 4ZGFA 4AYID 2OVDA 1LPJA 3VE1A 3STKA 1GX9A 1KXOA 1O1UA 1L6MA 4CV7A 2AKQA 2J4UP 4ZHGA 1PM1X 2X8FA 4KCAA 4IMNA 1ICMA 1QFVA 1QG5A 2HZQA 3U03A 1MPFA 3FA8A 4KIIA 3VZTX 3POUA 5LJDA 1AELA 2QMIA 2L5PA 3I0AA 3LHNA 3S5XA 2XE2A 4ZHFA 1GT4A 2KXPA 3BDRA 3FR5A 1ZNKA 4HWMA 3WJGA 3VZWX 1T8VA 4MVEA 5LJGA 1HBPA 4GDZA 4ALBA 1X8NA 1X8QA 2J1NA 1BBPA 3O22A 4U8UM 4ALOA 1HXUA 1JJJA 4RUNA 3Q6LA 5F58A 3RBHA 1T68X 3CQRA 2W80C 5K06A 2XE3A 1MUPA 2Y0KA 2O62A 3H3IA 4INNA 3P6CA 3ZQ3A 3TZGA 1DF3A 4I9RA 3BX7A 4TQ2A 1GFNA 3ELZA 4MIRA 4HPCA 4LSHA 3ELXA 3UEUA 1Q9GA 3AAEA 2CM9A 4AW8A 4YFPA 5EPQA 5IO7A 4JCHA 3WI5A 2P8GA 4LQZA 3P02A 5EDCA 2XE1A 1EUOA 5PRNA 3FA9A 1PMPA 1CBIA 2ACOA 3AA7A 2YMSA 2QM9A 4MVLA 4R0BA 4ML7B 4AYEC 5FQ7E 3SY7A 1S7DA 4XNKA 1PHOA 4TKHA 2OZQA 4EXZA 1UREA 3AA0A 4RUUA 3P6FA 3LK42 3C77X 1P4TA 3POQA 2XE5A 4BVMA 1T0VA 2QOSC 4TKJA 4GCPA 1I05A 1E00A 1THQA 4FESA 2LFUA 1BSYA 4QZTA 3IFBA 1HMSA 4D6BA 1A18A 4HFOA 1OPBA 2PORA 1ZNGA 3C5OA 2F73A 2YPVA 3O0EA 3P6DA 4LKPA 5LJEA 4GF4A 1CBSA 3BSZE 3PPTA 3PRNA 1BJ7A 4U9CA 1YIVA 4HPBA 4QRLA 3ZZVA 1LICA 1X8OA 2O4VA 4YFRA 3STMX 2X45A 2QO5A 4IAWA 1EPBA 4M7MA 2FRSA 4YBUA 5HZQA 2JMMA 2NNQA 1H91A 1SMPI 2MJIA 4KC8A 3ZW1B 1HXXA 2JW1A 1IFBA 1Y9LA 5FFHA 4A60A 1TXLA 1E5PA 3ZW0B 4QZUA 3AA6B 4LSFA 1GKAA 2OFRX 3APWA 3VPJE 1IFCA 4OS0A 5KIDA 8PRNA 4U3QA 1H6S1 3HWDA 5IYUA 5AJCA 4FT6A 3T20A 1G5WA 1SXXA 4EEJA 3FEKA 5G26A 1QQSA 1OPFA 2LA7A 2CZUA 3MX7A 4KH8A 4YMYA 4FGIB 4LSIA 4GZVA 3DA4A 1OEEA 3VZUX 4N7DA 3UU2A 4ODDA 1N0SA 4LZVA 1S44A 3E3CA 3PEDA 4GH7A 4EDEA 3CBSA 3QKGA 2BHVA 3C78X 5HTEA 4ZHDA 1QY0A 1TOUA 2FS6A 1GFQA 5EE2A 1QJPA 4D65A 1OBQA 2L9CA 4O3XB 2Y0LA 1GM6A 1AQBA 3TF6A 5FVNA 3CQNA 2HNXA 2WEWA 3VE2A 4G76A 3QRCA 2Z4HA 1VPRA 3ZW0A 4GCQA 1RBPA 3GAQA 5H8TA 2ZFGA 1LIDA 4K19A 1SY3A 4ORWA 2KW1A 3LK2A 3B2LA 3EBKA 1YWCA 4UU3A 1IKJA 4ORYA 3NBXX 4L3RA 5HCEC 2W81C 1X89A 4NLJA 1JJXA 1FTPA 3F6ZB 4LSEA 4IABA 4FSOA 1LNMA 3P6HA 4YBPA 4O9SA 3SOTA 2GTLN 5L8OA 2CM4A 4ORSA 3AAAA 1ML7A 3APXA 1HMTA 4N58A 3SY9A 3RSWA 4NYQA 5FQ6E 2NP1A 1YUPA 1BM5A 2AH7X 4FRTA 3V8UA 4I3CA 3FEPA 3KQ0A 4AZOA 1YS5A 1CJ5A 3S60A 2W2FA 2GE4A 4E1SA 3QRAA 4FBVA 4GNWA 4A1HA 4YKMA 4JGLA 4Y0SA 2FGRA 4TJZA 1HMRA 2AT6X 3AA1A 1TOWA 4ZHHA 1U0XA 4ZJ0A 5B29A 3NX2A 4BOEA 4XMHA 4QGWA 3VG4A 2KZ7B 5HZ6A 3FIQA 3T24A 1EXSA 5D48A 3ZI8A 2ODJA 1QY1A 3B2KA 4O4OA 1ICNA 1QJ9A 4ORRA 1SY1A 4AFKA 3O2YA 3FW4A 2R74A 5IO5A 4FZMA 2ANSA 4QNIA 3NR3A 4JFBA 1ACDA 2E4JA 1GT1A 5DG4A 4YCHA 3BX8A 1LKEA 1SXWA 4IB7A 3RBYA 3VY8X 3LK3B 3JS1A 2M06A 4C69X 2MHLA 3S5VA 4B61A 4CSBA 1OEKA 3B2IA 3IA8A 3LV4A 4FBRA 2A2UA 5IO6A 4QYPA 1YWAA 2FT9A 5DL7A 4IB8A 4QGVA 4AZPA 2GJ5A 2QO4A 3RWXA 3TGAA 4AZRA 2KZ7A 1G90A 2FLJA 3HK1A 1KT6A 1GXAA 4XNLA 3PORA 2AMMX 4Y0RA 2X46A 1DZMA 4XMFA 4O4UA 4WHIA 1KOIA 2FTBA 2RD7C 4M6SA 2Q39A 2WR6A 4XMDA 1JYDA 2LFOA 1Z24A 5F6BA 1YWBA 2FS7A 5DL8A 1MX8A 1VYGA 3CBCA 2HLVA 4QYNA 4A8ZA 1PRNA 4N7CA 1KZXA 3NSGA 1LIFA 5HAEA 1GT5A 2JOZA 1BRPA 2FR2A 4AUIA 4YKOA 5HCCC 1G85A 2HYSA 2GTLM 3EM0A 1KZWA 2KC0A 2ERVA 3B2JA 5L8NA 1YP7A 1OEJA 1AB0A 2ZLDA 5AFUL 1SY2A 4BQUA 4PJ2A 2PRNA 2OVAA 1KT4A 3BRNA 1GFOA 1ZHWA 4FOZA 2Q4NA 2Q9SA 3P24A 2Z4IA 2W2BA 2BT9A 3VG6A 3KFGA 3WJCA 1EIIA 5AFUK 2OVSA 5LKFA 2WEXA 4Y0QA 4Z3TA 3FELA 1ZHYA 3FR2A 5LJHA 4ZR2A 4IMOA 5CYBA 3G7GA 1O8VA 2R73A 1IKEA 3JQOA 4YDBA 4I9SA 5LKEA 1FE3A 1UZ2X 4AZNA 4AKRB 1EW3A 2Y7SA 5GV0A 4YDAA 4COTA 4FSPA 4RLCA 3OJYC 1NP4A 2CBRA 5LJCA 3DTQA 5H9NA 4D64A 1OBPA 1MM5A 2MHDA 2KD2A 1EI5A 3CMPA 3FYFA 1HBQA 3FA7A 5EZ2A 3EBWA 5HZ5A 1B56A 3PP6A 5LJKA 2Y0HA 1E02A 4I3BA 4ZH9A 1B4MA 1QABE 2RA6A 1DZKA 4ORUA 4XMCA 3S26A 1JYJA 2YNKA 1I06A 1BLRA 2FR3A 2G78A 4GCSA 1GX8A 3PH5A 3PQSA 2RCQA 3DA3A 4KRAA 4IB9A 3ZW1A 2ACPX 1ZNDA 3SAOA 3SZVA 3BU1A 1FEMA 1GGLA 1QWDA 4ID2A 5F1EA 3SZDA 4YCEA 4IBAA 3FA6A 4NP1A 3AA6A 1LIBA 3KZAA 3LK41 4TLJA 1BSQA 4NLIA 1SY0A 5DL6A 4O4SA 1EPAA 2F09A 3TGCA 1KQXA 5JR8A 5HA1A 3NQ9A 4RJXA 1FENA 4I3DA 4ZFXA 2X27X 3GE2A 2NNEA 3PECA 1A3YA 3POXA 2NNDA 2OFMX 3TGBA 5ADXL 4XMEA 1CBQA 2XMXA 1MX7A 3P6EA 2JU8A 4NNSA 3OE3A 1I4UA 2KTDA 4FBOA 1DC9A 3N91A 5ADXK 2CZTA 4LKTA 2KTSA 1AVGI 1HN2A 4OS3A 2R56A 3KFIA 4YGZA 2N2MA 3A2SX 1X8PA 4L1NA 2ALLX 4OS8A 4ZCBA 3WJEA 5BVTA 1G7NA 4WFVA 4NYRA 7PRNA 1B0OA 2AL0X 5HWZA 3FLLA 1BSOA 4MVIA 4HPDA 3BY0A 2KXPB 2ASNX 5HZ8A 1BH3A 3WI4A 1JV4A 2JMBA 1GFPA 1BXWA 5D5DA 1JZUA 1YP6A 1U18A 3VY9X 1SA8A 1KT5A 2PY1A 3SYBA 3B2HA 2Y2XA 4ZHCA 4FUVA 4QQ1A 5F7GA 2CBSA 4O49A 5D8JA 1EIOA 4O3YA 1LFOA 1KT3A 2Q2PA 2ZAGA 4XMGA 3NQ3A 3UEXA 3FR4A 1NGLA 2QO6A 1IW2A 1QFTA 1D2UA 3KFFA 3FYXA 4HPAA 3CWKA 1TW4A 5AJBA 5FQ8E 1DV9A 2A2GA 4YGGA 1ZNLA 5CE4A 4FZLA 5EDBA 4KR4A 3D96A 1OBUA 3U9PC 1HQPA 2X8TA 1E54A 4ES7A 4O3WA 1I04A 4ZGUA 3AAEB 3L4RA 5B27A 3NX1A 3KVDD 3UAQA 1KT7A 2GTFX 3D4RA 3G7XA 4ARHA 1KQWA 5DPQA 6PRNA 1QJ8A 4PUXA 1PBOA 3UEWA 3PQUA 4DQ3A 1NP1A 3EYCA 1Y9TA 5HBSA 1D3SA 4GE1A 4TKBA 5AEOA 4EFGA 3AA7B 3WOVA 1JIWI 1QY2A 2LBAA 3ZUIA 5BYPA 1TVQA 2JU7A 3WVMA 2KT4B 1BEBA 2AT0X 2M4LA 3AKNA 3OBLA 4PSQA 5BVQA 4ORXA 2IFBA 3AA0B 4AKMA 2RQ0A 4NNTA 3HOEA 3JTYA 1ERBA 2RN4A 2AT3X 3APVA 4MISA 2K62A 3NP1A 2BS6A 3JSQA 4LZUA 1JBHA 4RL9A 1CRBA 2W2AA 2WWPA 3BS2A 3WBGA 4GK9A 4I6SA 1B8EA 1DZPA 1IZNB 3VG2A 1LF7A 3HTYA 3EMMA 3O19A 2XKLA 3VG7A 4YFQA 5H9LA 3LK3A 2WQAE 3UEVA 3GP6A 2DM5A 4KC7A 5EEEA 2FWVA 3ZW2A 4GHBA 4CK4A 2WUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U9C A;  4QQ1 A;  4AYM C;  4O49 A;  4O4U A;  4O4X A;  4O3Y A;  4O3Z A;  3V8U A;  2KDY A;  3PQS A;  5EE2 A;  5T5F A;  4AYI D;  4AYE C;  4O3X B;  1YS5 A;  4AYN A;  3HOE A;  4Z3T A;  2W80 C;  3VE1 A;  3VE2 A;  4AYD C;  3HOL A;  2Y7S A;  4O3W A;  2LFU A;  3KVD D;  2W81 C;  3UAQ A;  2KC0 A;  2YPV A;  3PQU A; 
#chains in the Genus database with same CATH topology
 2IZA A;  4MVK A;  4FZN A;  5HZ9 A;  2Y3F A;  1R0U A;  2R4O A;  2QCB A;  1IIU A;  4RLB A;  3F9D A;  4I95 A;  3C76 X;  4MEE A;  1DFV A;  2WSJ A;  2EU7 X;  2HZR A;  4WFU A;  3TZS A;  1SLG B;  4GRJ A;  1SRH A;  1E06 A;  3NQK A;  4N59 A;  2L67 A;  2WQ9 A;  2K4T A;  4AYM C;  1ZHZ A;  1MM9 A;  4Z2O A;  3WZO A;  2XST A;  2OMF A;  4QAE A;  3APU A;  3ZWE A;  4F4B A;  5C0N A;  5L8I A;  3HWG A;  2IZL B;  2GTL O;  1OPA A;  3VG3 A;  1SWP A;  2N2L A;  1SWE A;  4Y5D A;  3HWE A;  3BS0 A;  1G74 A;  2QTK A;  1N43 A;  3RKG A;  3FMZ A;  2F1T A;  4A1Y A;  3K19 A;  2OVE A;  5F6Z A;  2WVP A;  3T1D A;  2FGQ X;  5BVS A;  1AVE A;  1VWB B;  5D45 A;  1ZHX A;  2LBV A;  2GC9 A;  2MO5 A;  3RDS A;  4G75 A;  1SXY A;  3MVF A;  3A0B O;  1OSP O;  1LPJ A;  1GX9 A;  1O1U A;  2J4U P;  4ZHG A;  1PM1 X;  1AVD A;  4IMN A;  4BX6 A;  3VZT X;  3POU A;  2L5P A;  3I0A A;  3LHN A;  3S5X A;  4ZHF A;  4PR7 A;  3BDR A;  4HWM A;  2R8A A;  3VZW X;  5LJG A;  1X8Q A;  1VWR B;  1HXU A;  5F58 A;  1T68 X;  5K06 A;  2O62 A;  4I9R A;  1GFN A;  4LSH A;  3ELX A;  3UEU A;  5G3A A;  4AW8 A;  3WI5 A;  2P8G A;  3P02 A;  2WPU A;  3FA9 A;  4MVL A;  4R0B A;  3SZJ A;  2OZQ A;  1URE A;  3C77 X;  1P4T A;  1SWB A;  1I05 A;  4BBO A;  1THQ A;  4FES A;  1BSY A;  3C5O A;  1A18 A;  5LJE A;  3PPT A;  4U9C A;  3AUM O;  1Y52 X;  3PGR A;  1H91 A;  1IFB A;  1Y9L A;  4LSF A;  3DWO X;  3APW A;  3VPJ E;  8PRN A;  5IYU A;  5AJC A;  1SXX A;  4EEJ A;  2IWV A;  2C4I A;  4FGI B;  1I9H A;  1S44 A;  3E3C A;  3PED A;  4N75 A;  3QKG A;  4ZHD A;  4PJ0 O;  2FS6 A;  1OBQ A;  2Y0L A;  2X55 A;  1AQB A;  1LCV A;  4G76 A;  3ZW0 A;  4K19 A;  1SY3 A;  4ORW A;  2KW1 A;  3B2L A;  4UU3 A;  1IKJ A;  1X89 A;  3F6Z B;  4LSE A;  3P6H A;  4YBP A;  5L8O A;  4NYQ A;  2RTM A;  1YUP A;  2GE4 A;  4E1S A;  5KAI O;  4NV8 A;  4GNW A;  3PDF A;  4ZHH A;  5B29 A;  3T24 A;  4JHQ A;  1ICN A;  4ORR A;  4AFK A;  5B66 O;  2ZSC A;  1VWD B;  2R74 A;  3NR3 A;  1GT1 A;  4YCH A;  3BX8 A;  2M06 A;  4GJV A;  3B2I A;  3IA8 A;  3LV4 A;  4FBR A;  2A2U A;  2FT9 A;  2KZ7 A;  4AZP A;  3TGA A;  1G90 A;  2FLJ A;  1SLF B;  2AMM X;  1Y55 X;  2X46 A;  4XMF A;  4WHI A;  2RD7 C;  2Q39 A;  1Z24 A;  5F6B A;  2HLV A;  4A8Z A;  3LTW A;  4Z28 A;  1GT5 A;  4AUI A;  4CDF A;  1G85 A;  3EC5 A;  2GTL M;  2KC0 A;  4BX5 B;  1YP7 A;  1AB0 A;  1VWJ B;  2PRN A;  2OVA A;  1GFO A;  2G8C O;  2Q4N A;  2Q9S A;  2BT9 A;  1VWQ B;  5AFU K;  4Z3T A;  3FEL A;  3FR2 A;  1FJ1 E;  4ZR2 A;  1O8V A;  2R73 A;  4EKV A;  4I9S A;  4C5P A;  1FE3 A;  5GV0 A;  4COT A;  1NP4 A;  2IZJ A;  1OBP A;  2Y0H A;  1B56 A;  1E02 A;  4ORU A;  1JYJ A;  2G78 A;  1GX8 A;  3PQS A;  4FQE A;  1ZND A;  2G5L A;  3BU1 A;  4ID2 A;  1LIB A;  3LK4 1;  4TLJ A;  5DL6 A;  3PF1 A;  4XME A;  2XMX A;  1MX7 A;  2JU8 A;  1I4U A;  3N91 A;  5ADX K;  4OS8 A;  5HWZ A;  3FLL A;  4GGR A;  3A0H O;  4Z6J A;  5E79 O;  4HPD A;  2KXP B;  5HZ8 A;  1JV4 A;  2JMB A;  1KT5 A;  2Y2X A;  5F7G A;  1EIO A;  4BX7 A;  1LFO A;  3NQ3 A;  1QFT A;  3FYX A;  1D2U A;  3CWK A;  1VWO B;  1N4J A;  1SWS A;  3U9P C;  3BRY A;  3NX1 A;  4ARH A;  6PRN A;  4PUX A;  1PBO A;  2A5B A;  3UEW A;  1NP1 A;  3EYC A;  4TKB A;  1TVQ A;  2JU7 A;  2WJQ A;  4ORX A;  3AA0 B;  2IZC B;  3HOE A;  1ERB A;  2AT3 X;  4LZU A;  2W2A A;  1B8E A;  1DZP A;  2UYW A;  1K3B A;  3VG2 A;  1LF7 A;  3EMM A;  5H9L A;  2DM5 A;  2FWV A;  4GHB A;  4CK4 A;  1I78 A;  2MM3 A;  4Y0P A;  2X8S A;  4D6A A;  1XKI A;  3RE6 A;  1ADL A;  1WUB A;  4OEL A;  5FEN A;  2RCT A;  5HTD A;  2A0A A;  2RTE B;  1ERX A;  4YH0 A;  4GUZ A;  2RTL A;  4DQ4 A;  4C4V A;  2XTR A;  1SWC A;  2FKG A;  3WYP A;  4AZL A;  4BX5 A;  2A5C A;  2A8G A;  2F01 A;  3ZUO A;  2LKK A;  5B3M O;  1A57 A;  1BRQ A;  3UPG A;  2K23 A;  1BWY A;  1NQM A;  1RLB E;  3SZI A;  2AT5 X;  3SYS A;  2K0L A;  1EQD A;  3SLJ A;  2XG6 A;  1MVG A;  1LIE A;  4EQA C;  3HW9 A;  4NW4 A;  2JU3 A;  1FEL A;  3D95 A;  4O4X A;  2OL6 O;  1SLD B;  1SWA A;  3SLO A;  3FEN A;  2R4L A;  4BX6 B;  1SWD A;  2MNH A;  2I5Z O;  4OMW A;  1Q9F A;  1ALB A;  3DSZ A;  1S2P A;  2N93 A;  1YWD A;  5H9A A;  3RDM A;  5D4A A;  4YGH A;  1HXT A;  5HA0 A;  4Z27 A;  5FAZ A;  3T2X A;  2RTP B;  4KR8 A;  4AYI D;  1XCA A;  3BLG A;  3VE1 A;  1RXK A;  2AKQ A;  5F2B A;  2X8F A;  3WZP A;  1MOY A;  1QG5 A;  2RTG B;  3U03 A;  3FA8 A;  5LJD A;  1AEL A;  1GT4 A;  2KXP A;  1T8V A;  4MVE A;  4GDZ A;  1NBX A;  2RTD B;  3CKF A;  4U8U M;  2OL7 A;  3RE5 A;  4ALO A;  2IWW A;  3RBH A;  1GX3 A;  2Y0K A;  3H3I A;  1DF3 A;  3BX7 A;  1RST B;  4HPC A;  4JCH A;  4YFP A;  5JD2 A;  1EUO A;  1PMP A;  1CBI A;  2QM9 A;  4AYE C;  4IRW A;  3AA0 A;  3POQ A;  3PK2 A;  4GCP A;  2LFU A;  1SWU A;  3EW2 A;  2POR A;  4HFO A;  1OPB A;  1ZNG A;  4I60 A;  2YPV A;  3O0E A;  4LKP A;  3BSZ E;  4GJS A;  1YIV A;  4QRL A;  4YFR A;  3STM X;  3PGU A;  2JMM A;  2QO5 A;  1EPB A;  4M7M A;  5HZQ A;  4KC8 A;  1VWF B;  1K24 A;  1E5P A;  3ZW0 B;  1W5R A;  2FKJ A;  1IFC A;  4OS0 A;  3T20 A;  3FEK A;  1OPF A;  2LA7 A;  4KH8 A;  4N7D A;  1Y53 X;  3RDU A;  2BHV A;  3C78 X;  1GFQ A;  5EE2 A;  1QJP A;  2X32 A;  2RTB B;  3QRC A;  4GCQ A;  3GAQ A;  5H8T A;  2ZFG A;  4Z2P A;  1FTP A;  4FSO A;  4O9S A;  1N7Y A;  3APX A;  1HMT A;  5FQ6 E;  4FRT A;  2IZD B;  1S5L O;  4CDE A;  4YKM A;  4Y0S A;  1TOW A;  4UB8 O;  4QGW A;  2X34 A;  1DF8 A;  2KZ7 B;  3FIQ A;  1EXS A;  2ODJ A;  2MF6 A;  1QY1 A;  3B2K A;  4QNI A;  5DG4 A;  1SXW A;  3RBY A;  3VY8 X;  3LK3 B;  3JS1 A;  1SWF A;  2MHL A;  4B61 A;  1VWM B;  4QYP A;  4IB8 A;  2R4N A;  4AZR A;  2QO4 A;  3RWX A;  3HK1 A;  4Y0R A;  1DZM A;  1KOI A;  2FTB A;  4CPF A;  4M6S A;  5IRU A;  4XMD A;  2LFO A;  1MX8 A;  1PRN A;  2RTK A;  4CDC A;  1KZX A;  3NSG A;  1LIF A;  5HAE A;  1BRP A;  4YKO A;  2HYS A;  3EM0 A;  3B2J A;  1KL4 A;  1SY2 A;  4PJ2 A;  1KT4 A;  2Z4I A;  3VG6 A;  3KFG A;  4Y0Q A;  1ZHY A;  3G7G A;  5CYB A;  1IKE A;  1N9M A;  2C1S A;  3SZH A;  1UZ2 X;  4AZN A;  3OJY C;  2CBR A;  5LJC A;  2OFB A;  3DTQ A;  4Z2V A;  3CMP A;  3FYF A;  3FA7 A;  5EZ2 A;  3CKG A;  3PP6 A;  5LJK A;  4I3B A;  1B4M A;  4BGF A;  2YNK A;  3S26 A;  2WJR A;  1SWL A;  3PH5 A;  3DA3 A;  4KRA A;  4B55 A;  1GGL A;  2X9K A;  4IBA A;  4NP1 A;  1BSQ A;  4NLI A;  4K3C A;  2F09 A;  5JR8 A;  1FEN A;  4ZFX A;  1RXH A;  1Y0G A;  3PEC A;  3POX A;  2OFM X;  4BX7 B;  4FBO A;  1DC9 A;  1KL3 A;  2CZT A;  2KTS A;  2N2M A;  1X8P A;  2ALL X;  3WJE A;  1BSO A;  4MVI A;  1BH3 A;  1JZU A;  1U18 A;  1VWE B;  2PY1 A;  3SYB A;  3B2H A;  2PI3 O;  2OL8 O;  2IZG B;  4O3Y A;  3FR4 A;  1NGL A;  3KFF A;  5AJB A;  1DV9 A;  4KR4 A;  4YGG A;  3RDQ A;  3D96 A;  1HQP A;  3KVD D;  1HY2 A;  5DPQ A;  4DQ3 A;  3PQU A;  1Y9T A;  2RTJ A;  1RXJ A;  3AA7 B;  1T1L A;  3WVM A;  1SRJ A;  1VWP B;  5PRN A;  2AT0 X;  3AKN A;  3RDX A;  2RN4 A;  4JNJ A;  3APV A;  3NP1 A;  3JSQ A;  1CRB A;  3WBG A;  4GK9 A;  4I6S A;  4C4V B;  3HTY A;  3LK3 A;  4YFQ A;  2X56 A;  1RAV A;  3GP6 A;  5EEE A;  3ZW2 A;  5KHP A;  2BSZ A;  3WJD A;  4ON1 A;  5T5F A;  4U8U O;  2KDY A;  2BLG A;  3MBT A;  4OMX A;  4AYH A;  5KIC A;  1OSM A;  1O1V A;  3I17 A;  3EMN X;  2LHF A;  1FDQ A;  1LDO A;  3VG5 A;  1VYF A;  4AZM A;  5D47 A;  2ZAI A;  4KT5 A;  5H9K A;  4FRX A;  3KZI O;  1KGL A;  3CR6 A;  1MDC A;  3P6G A;  2L68 A;  4E1T A;  3U0D A;  1KL5 A;  1VWC B;  3HWB A;  4AYN A;  2AF5 A;  5JDP A;  1ZNH A;  2G79 A;  3WJB A;  3LK2 B;  1IJ8 A;  4GET A;  1VYO A;  4YVB A;  4FMS A;  3FID A;  1X71 A;  5H2F O;  2LB6 A;  3KFH A;  3DWN A;  4FQB B;  5IRA A;  3VU1 A;  4WBK A;  2YG2 A;  2AT8 X;  1DZJ A;  3D97 A;  1A2D A;  3RY1 A;  3AA1 B;  2QOM A;  3FW5 A;  2F1V A;  4AZQ A;  5B2A O;  3WJF A;  1CBR A;  1U17 A;  3KVN A;  4IB6 A;  4D5U A;  1VWN B;  2A13 A;  1NQN A;  2POA A;  1VWK B;  5B10 O;  1GT3 A;  4ZGF A;  3STK A;  1L6M A;  2RTH B;  4KII A;  2OY5 O;  2QMI A;  2XE2 A;  3FR5 A;  1ZNK A;  4U46 A;  1X8N A;  1BBP A;  4RUN A;  2XE3 A;  2IZK A;  4INN A;  3P6C A;  4GD9 A;  4TQ2 A;  5L3Y A;  3ELZ A;  4MIR A;  1Q9G A;  2FHL A;  2CM9 A;  1VWL B;  5EPQ A;  5IO7 A;  3MM0 A;  1JMX A;  4LQZ A;  5EDC A;  3T6F A;  1LEL A;  2ACO A;  3AA7 A;  4DCB A;  2RTA A;  4XNK A;  1PHO A;  4TKH A;  4RUU A;  3P6F A;  2XE5 A;  3AEH A;  1T0V A;  1SRF A;  2QOS C;  4TKJ A;  2IZB A;  4QZT A;  3IFB A;  1HMS A;  4D6B A;  3P6D A;  4GF4 A;  3PRN A;  4HPB A;  3ZZV A;  3BRZ A;  1X8O A;  2O4V A;  4YBU A;  4IAW A;  2CAM A;  4CPI A;  2NNQ A;  3ZW1 B;  2MJI A;  2JW1 A;  4N74 A;  5FFH A;  4A60 A;  1TXL A;  2R89 A;  4QZU A;  3AA6 B;  2OFR X;  1H6S 1;  2UZ2 A;  4FT6 A;  1G5W A;  1QQS A;  4YMY A;  1E2T A;  2BC3 A;  4LSI A;  4GZV A;  3UU2 A;  4LZV A;  3JCU O;  3X00 A;  1QY0 A;  4GGT A;  1VWI B;  4D65 A;  4O3X B;  1STS B;  1GM6 A;  3CQN A;  1LID A;  3LK2 A;  3EBK A;  4ORY A;  2W81 C;  4NLJ A;  1JJX A;  2OF8 A;  4IAB A;  1LNM A;  3NJT A;  3SOT A;  2GTL N;  4ORS A;  1PTS A;  1ML7 A;  4N58 A;  3SY9 A;  2RTI B;  1SWR A;  2AH7 X;  3V8U A;  4I3C A;  4AZO A;  1CJ5 A;  3QRA A;  4A1H A;  4K3B A;  1SRE A;  2FGR A;  4TJZ A;  1HMR A;  3AA1 A;  3NX2 A;  4BOE A;  5KAF O;  4DNE A;  5HZ6 A;  5D48 A;  3ZI8 A;  1VWG B;  4O4O A;  4BJ8 A;  1QJ9 A;  1NDJ A;  5IO5 A;  2ANS A;  2E4J A;  1LKE A;  4IB7 A;  1N9Y A;  1SWN A;  4CSB A;  2Y32 A;  1SWO A;  4QGV A;  2GJ5 A;  1JQP A;  2R88 A;  1GXA A;  1HXZ A;  4OEM A;  1SWT A;  1YWB A;  5DL8 A;  1VYG A;  4QYN A;  2DJG A;  4CPH B;  2FR2 A;  5HCC C;  5K67 A;  1OEJ A;  2ZLD A;  1ZHW A;  3P24 A;  2I5V O;  2W2B A;  4CPE A;  5B5F A;  3WJC A;  1EII A;  2OVS A;  5LKF A;  1UYO X;  3WZQ A;  4AKR B;  1EW3 A;  4YDA A;  4FSP A;  4RLC A;  5H9N A;  4D64 A;  1MM5 A;  2MHD A;  3EBW A;  5G39 A;  2RA6 A;  1I06 A;  1BLR A;  2FR3 A;  3WYQ A;  3ZW1 A;  2ACP X;  5K68 A;  3SZD A;  3RY2 A;  3FA6 A;  3AA6 A;  4C00 A;  1SY0 A;  2X27 X;  5CSE A;  2NNE A;  1A3Y A;  1SWK A;  1CBQ A;  2Y3E A;  3P6E A;  4NNS A;  3OE3 A;  2KTD A;  4LKT A;  4YGZ A;  2R56 A;  3A2S X;  4ZCB A;  5BVT A;  1G7N A;  4NYR A;  7PRN A;  3BY0 A;  3WI4 A;  1GFP A;  1BXW A;  1YP6 A;  4FUV A;  4QQ1 A;  2AVI A;  4O49 A;  1VWA B;  1KT3 A;  4XMG A;  2QO6 A;  2X4M A;  1IW2 A;  4HPA A;  1TW4 A;  5FQ8 E;  2A2G A;  5CE4 A;  1ZNL A;  4FZL A;  5GTH O;  1OBU A;  4O3W A;  1I04 A;  3AAE B;  5B27 A;  3D4R A;  3G7X A;  1QJ8 A;  5AEO A;  5TIS O;  1QY2 A;  2OY7 A;  2AXT O;  5BYP A;  2KT4 B;  1BEB A;  2M4L A;  1LDQ A;  5BVQ A;  2RQ0 A;  4MIS A;  1JBH A;  3D9W A;  2K62 A;  2WWP A;  2WQA E;  3EW1 A;  3UEV A;  1MK5 A;  4KC7 A;  1ZNE A;  3NAD A;  1SRG A;  1PEE A;  1GKA B;  2RTN B;  5LJB A;  1ZHT A;  4GNY A;  1IZN A;  5HCD C;  1P6P A;  3WXQ A;  4CPH A;  3PH6 A;  4RJW A;  2JQY A;  2G7B A;  4GKC A;  3HWF A;  4O3Z A;  3NPO A;  4U8U N;  5AQ6 A;  2MWH A;  1NC9 A;  5B5G A;  3VHI A;  1X8U A;  4BUM X;  4UU2 A;  3AAA B;  2HMB A;  4AKR A;  4IAX A;  1EAL A;  4TNN A;  2OY8 A;  5DL5 A;  4ZH6 A;  4GGZ A;  3K3L A;  3RZY A;  2Q2M A;  1MM4 A;  3STN A;  2OYB O;  3F8A A;  1BT9 A;  1SXU A;  3T6L A;  2BS5 A;  3AKM A;  1ZRY A;  3BU9 A;  4AYD C;  3HOL A;  1PBY A;  1GFM A;  3OD9 A;  4CDD A;  3T0S A;  1ORM A;  4GU8 A;  2M07 A;  1LUQ A;  3QQ2 A;  4QGX A;  2A3F X;  5B5E O;  2JN3 A;  1SLE B;  2C1Q A;  2OY1 O;  2XTQ A;  5EED A;  2OVD A;  1KXO A;  1MEP A;  4CV7 A;  4KCA A;  4BCS A;  1ICM A;  1QFV A;  2HZQ A;  1MPF A;  3HPE A;  3DZM A;  1SWQ A;  3WJG A;  1HBP A;  4ALB A;  2J1N A;  3O22 A;  1JJJ A;  3Q6L A;  3CQR A;  2W80 C;  1MUP A;  3VHH A;  3ZQ3 A;  3TZG A;  3WZN A;  2RTC B;  3AAE A;  2XE1 A;  2YMS A;  1KFF A;  4ML7 B;  5FQ7 E;  3SY7 A;  1S7D A;  1SWJ A;  4EXZ A;  3LK4 2;  4BVM A;  1E00 A;  2F73 A;  1CBS A;  1BJ7 A;  1LIC A;  2X45 A;  2FRS A;  1SMP I;  1HXX A;  5IRW A;  1GKA A;  5KID A;  2HKD A;  4U3Q A;  3HWD A;  2VFC A;  5G26 A;  1STP A;  1RSU B;  2CZU A;  3MX7 A;  5G38 A;  3MG5 A;  2IZI A;  3DA4 A;  3VZU X;  1OEE A;  4ODD A;  1N0S A;  4EDE A;  3RDO A;  4GH7 A;  3CBS A;  5HTE A;  2FGS A;  1JJU A;  1TOU A;  2L9C A;  3TF6 A;  5FVN A;  2HNX A;  2WEW A;  3VE2 A;  2Z4H A;  1VPR A;  1HQQ A;  1RBP A;  1YWC A;  3NBX X;  4L3R A;  5HCE C;  3AAA A;  2CM4 A;  1UYN X;  1JMZ A;  4JO6 A;  3RSW A;  2NP1 A;  5IXG A;  1BM5 A;  3FEP A;  3KQ0 A;  1YS5 A;  3S60 A;  2W2F A;  4FBV A;  4JGL A;  2AT6 X;  1U0X A;  4ZJ0 A;  2VFB A;  1SWH A;  4XMH A;  3VG4 A;  4CTD A;  2RTF B;  4Y59 A;  1SY1 A;  2JGS A;  4GDA A;  3O2Y A;  3FW4 A;  4FZM A;  3PGS A;  3T2W A;  4JFB A;  1ACD A;  4UB6 O;  4C69 X;  1VWH B;  3S5V A;  1OEK A;  5IO6 A;  1LCW A;  1YWA A;  3VGW A;  5DL7 A;  1W4T A;  1KT6 A;  4XNL A;  3POR A;  4O4U A;  2WR6 A;  2IZF B;  2RTR B;  1JYD A;  2FS7 A;  3CBC A;  2OF9 A;  4N7C A;  3FDC A;  2JOZ A;  1KZW A;  2ERV A;  5L8N A;  4IL6 O;  1STR B;  2R4P A;  5AFU L;  4BQU A;  1WBI A;  3BRN A;  4FOZ A;  2VDF A;  2WEX A;  2IZE B;  5LJH A;  4IMO A;  3JQO A;  4YDB A;  5LKE A;  2Y7S A;  3SLT A;  1SWG A;  2KD2 A;  1EI5 A;  2FHN X;  1HBQ A;  5HZ5 A;  4ZH9 A;  1QAB E;  4XMC A;  1DZK A;  4GCS A;  2RCQ A;  2GH7 A;  4IB9 A;  1W6F A;  3SAO A;  3SZV A;  5F1E A;  1FEM A;  1QWD A;  4YCE A;  3KZA A;  3VHM A;  4O4S A;  1EPA A;  3TGC A;  1KQX A;  5HA1 A;  3NQ9 A;  4RJX A;  4I3D A;  3GE2 A;  4NV7 A;  2NND A;  3WU2 O;  3TGB A;  5ADX L;  1AVG I;  1HN2 A;  4OS3 A;  3KFI A;  4L1N A;  2DJF A;  4WFV A;  1B0O A;  1HXL A;  2AL0 X;  4OKA A;  2ASN X;  3VY9 X;  5D5D A;  1SA8 A;  4ZHC A;  1LCZ A;  2CBS A;  5D8J A;  3UEX A;  5CHK A;  2F1C X;  2Q2P A;  1SRI A;  2ZAG A;  2RTQ B;  5B11 O;  5EDB A;  2X8T A;  2IZH B;  1E54 A;  4ES7 A;  4ZGU A;  2OFA A;  3L4R A;  3UAQ A;  1KT7 A;  2GTF X;  1KQW A;  5HBS A;  1D3S A;  4GE1 A;  3Q34 A;  4EFG A;  3WOV A;  1JIW I;  2LBA A;  3ZUI A;  3OBL A;  4PSQ A;  2IFB A;  4AKM A;  4NNT A;  3JTY A;  2BS6 A;  4RL9 A;  5GTI O;  3BS2 A;  1IZN B;  3O19 A;  2XKL A;  3VG7 A;  2RTO B;  1T16 A;  2WUT A; 
#chains in the Genus database with same CATH homology
 1ZNE A;  2MM3 A;  3NAD A;  4Y0P A;  5KHP A;  2X8S A;  4D6A A;  4MVK A;  1XKI A;  4FZN A;  5HZ9 A;  1ADL A;  3WJD A;  4ON1 A;  5T5F A;  4U8U O;  1PEE A;  2KDY A;  1R0U A;  1GKA B;  2BLG A;  5FEN A;  2RCT A;  5LJB A;  1IIU A;  5HTD A;  4RLB A;  3F9D A;  2A0A A;  3MBT A;  4I95 A;  3C76 X;  1ERX A;  1ZHT A;  4OMX A;  4YH0 A;  4AYH A;  1DFV A;  2WSJ A;  2EU7 X;  4DQ4 A;  5KIC A;  4GNY A;  1OSM A;  1IZN A;  2HZR A;  5HCD C;  1O1V A;  1P6P A;  4WFU A;  3TZS A;  3I17 A;  3EMN X;  2LHF A;  1FDQ A;  3WXQ A;  3VG5 A;  2XTR A;  4GRJ A;  3PH6 A;  1VYF A;  4AZM A;  1E06 A;  3NQK A;  5D47 A;  2ZAI A;  4N59 A;  4RJW A;  4KT5 A;  5H9K A;  2L67 A;  2WQ9 A;  2K4T A;  2G7B A;  4GKC A;  4FRX A;  4AYM C;  1ZHZ A;  3ZUO A;  3CR6 A;  1MDC A;  2LKK A;  3P6G A;  1A57 A;  3HWF A;  2L68 A;  1KGL A;  4E1T A;  4O3Z A;  3U0D A;  3NPO A;  4AZL A;  4U8U N;  1BRQ A;  3HWB A;  5AQ6 A;  4AYN A;  5JDP A;  2MWH A;  1ZNH A;  3UPG A;  2G79 A;  2XST A;  2OMF A;  4QAE A;  3WJB A;  3LK2 B;  2K23 A;  3APU A;  1BWY A;  3ZWE A;  4F4B A;  4GET A;  5C0N A;  5L8I A;  1X8U A;  4FMS A;  1X71 A;  4BUM X;  4UU2 A;  3HWG A;  3AAA B;  1RLB E;  2HMB A;  2AT5 X;  4AKR A;  2GTL O;  3SYS A;  4IAX A;  2K0L A;  1EQD A;  1OPA A;  2LB6 A;  3KFH A;  2XG6 A;  1EAL A;  4TNN A;  3VG3 A;  1MVG A;  4FQB B;  2N2L A;  5DL5 A;  4ZH6 A;  3HWE A;  3VU1 A;  1LIE A;  1G74 A;  3K3L A;  4WBK A;  3RZY A;  2YG2 A;  4EQA C;  4NW4 A;  2JU3 A;  2Q2M A;  3HW9 A;  1MM4 A;  1FEL A;  2AT8 X;  3STN A;  2QTK A;  3D95 A;  3F8A A;  4O4X A;  1BT9 A;  3RKG A;  1SXU A;  2BS5 A;  3AKM A;  3FMZ A;  1DZJ A;  3D97 A;  2F1T A;  4A1Y A;  1ZRY A;  3FEN A;  3BU9 A;  4AYD C;  3HOL A;  1A2D A;  3AA1 B;  3FW5 A;  1GFM A;  2F1V A;  4AZQ A;  3OD9 A;  3T0S A;  1ORM A;  2MNH A;  4OMW A;  3WJF A;  1Q9F A;  1ALB A;  3K19 A;  2OVE A;  3DSZ A;  1S2P A;  1CBR A;  2N93 A;  4GU8 A;  1YWD A;  5F6Z A;  2M07 A;  3T1D A;  2FGQ X;  1U17 A;  5H9A A;  5BVS A;  4IB6 A;  5D4A A;  4QGX A;  4D5U A;  4YGH A;  2A3F X;  1HXT A;  5HA0 A;  2A13 A;  2JN3 A;  5FAZ A;  5D45 A;  1ZHX A;  2LBV A;  2POA A;  2GC9 A;  2MO5 A;  4KR8 A;  4G75 A;  2XTQ A;  5EED A;  1SXY A;  1GT3 A;  1XCA A;  3BLG A;  3MVF A;  4ZGF A;  4AYI D;  2OVD A;  1LPJ A;  3VE1 A;  3STK A;  1GX9 A;  1KXO A;  1O1U A;  1L6M A;  4CV7 A;  2AKQ A;  2J4U P;  4ZHG A;  1PM1 X;  2X8F A;  4KCA A;  4IMN A;  1ICM A;  1QFV A;  1QG5 A;  2HZQ A;  3U03 A;  1MPF A;  3FA8 A;  4KII A;  3VZT X;  3POU A;  5LJD A;  1AEL A;  2QMI A;  2L5P A;  3I0A A;  3LHN A;  3S5X A;  2XE2 A;  4ZHF A;  1GT4 A;  2KXP A;  3BDR A;  3FR5 A;  1ZNK A;  4HWM A;  3WJG A;  3VZW X;  1T8V A;  4MVE A;  5LJG A;  1HBP A;  4GDZ A;  4ALB A;  1X8N A;  1X8Q A;  2J1N A;  1BBP A;  3O22 A;  4U8U M;  4ALO A;  1HXU A;  1JJJ A;  4RUN A;  3Q6L A;  5F58 A;  3RBH A;  1T68 X;  3CQR A;  2W80 C;  5K06 A;  2XE3 A;  1MUP A;  2Y0K A;  2O62 A;  3H3I A;  4INN A;  3P6C A;  3ZQ3 A;  3TZG A;  1DF3 A;  4I9R A;  3BX7 A;  4TQ2 A;  1GFN A;  3ELZ A;  4MIR A;  4HPC A;  4LSH A;  3ELX A;  3UEU A;  1Q9G A;  3AAE A;  2CM9 A;  4AW8 A;  4YFP A;  5EPQ A;  5IO7 A;  4JCH A;  3WI5 A;  2P8G A;  4LQZ A;  3P02 A;  5EDC A;  2XE1 A;  1EUO A;  5PRN A;  3FA9 A;  1PMP A;  1CBI A;  2ACO A;  3AA7 A;  2YMS A;  2QM9 A;  4MVL A;  4R0B A;  4ML7 B;  4AYE C;  5FQ7 E;  3SY7 A;  1S7D A;  4XNK A;  1PHO A;  4TKH A;  2OZQ A;  4EXZ A;  1URE A;  3AA0 A;  4RUU A;  3P6F A;  3LK4 2;  3C77 X;  1P4T A;  3POQ A;  2XE5 A;  4BVM A;  1T0V A;  2QOS C;  4TKJ A;  4GCP A;  1I05 A;  1E00 A;  1THQ A;  4FES A;  2LFU A;  1BSY A;  4QZT A;  3IFB A;  1HMS A;  4D6B A;  1A18 A;  4HFO A;  1OPB A;  2POR A;  1ZNG A;  3C5O A;  2F73 A;  2YPV A;  3O0E A;  3P6D A;  4LKP A;  5LJE A;  4GF4 A;  1CBS A;  3BSZ E;  3PPT A;  3PRN A;  1BJ7 A;  4U9C A;  1YIV A;  4HPB A;  4QRL A;  3ZZV A;  1LIC A;  1X8O A;  2O4V A;  4YFR A;  3STM X;  2X45 A;  2QO5 A;  4IAW A;  1EPB A;  4M7M A;  2FRS A;  4YBU A;  5HZQ A;  2JMM A;  2NNQ A;  1H91 A;  1SMP I;  2MJI A;  4KC8 A;  3ZW1 B;  1HXX A;  2JW1 A;  1IFB A;  1Y9L A;  5FFH A;  4A60 A;  1TXL A;  1E5P A;  3ZW0 B;  4QZU A;  3AA6 B;  4LSF A;  1GKA A;  2OFR X;  3APW A;  3VPJ E;  1IFC A;  4OS0 A;  5KID A;  8PRN A;  4U3Q A;  1H6S 1;  3HWD A;  5IYU A;  5AJC A;  4FT6 A;  3T20 A;  1G5W A;  1SXX A;  4EEJ A;  3FEK A;  5G26 A;  1QQS A;  1OPF A;  2LA7 A;  2CZU A;  3MX7 A;  4KH8 A;  4YMY A;  4FGI B;  4LSI A;  4GZV A;  3DA4 A;  1OEE A;  3VZU X;  4N7D A;  3UU2 A;  4ODD A;  1N0S A;  4LZV A;  1S44 A;  3E3C A;  3PED A;  4GH7 A;  4EDE A;  3CBS A;  3QKG A;  2BHV A;  3C78 X;  5HTE A;  4ZHD A;  1QY0 A;  1TOU A;  2FS6 A;  1GFQ A;  5EE2 A;  1QJP A;  4D65 A;  1OBQ A;  2L9C A;  4O3X B;  2Y0L A;  1GM6 A;  1AQB A;  3TF6 A;  5FVN A;  3CQN A;  2HNX A;  2WEW A;  3VE2 A;  4G76 A;  3QRC A;  2Z4H A;  1VPR A;  3ZW0 A;  4GCQ A;  1RBP A;  3GAQ A;  5H8T A;  2ZFG A;  1LID A;  4K19 A;  1SY3 A;  4ORW A;  2KW1 A;  3LK2 A;  3B2L A;  3EBK A;  1YWC A;  4UU3 A;  1IKJ A;  4ORY A;  3NBX X;  4L3R A;  5HCE C;  2W81 C;  1X89 A;  4NLJ A;  1JJX A;  1FTP A;  3F6Z B;  4LSE A;  4IAB A;  4FSO A;  1LNM A;  3P6H A;  4YBP A;  4O9S A;  3SOT A;  2GTL N;  5L8O A;  2CM4 A;  4ORS A;  3AAA A;  1ML7 A;  3APX A;  1HMT A;  4N58 A;  3SY9 A;  3RSW A;  4NYQ A;  5FQ6 E;  2NP1 A;  1YUP A;  1BM5 A;  2AH7 X;  4FRT A;  3V8U A;  4I3C A;  3FEP A;  3KQ0 A;  4AZO A;  1YS5 A;  1CJ5 A;  3S60 A;  2W2F A;  2GE4 A;  4E1S A;  3QRA A;  4FBV A;  4GNW A;  4A1H A;  4YKM A;  4JGL A;  4Y0S A;  2FGR A;  4TJZ A;  1HMR A;  2AT6 X;  3AA1 A;  1TOW A;  4ZHH A;  1U0X A;  4ZJ0 A;  5B29 A;  3NX2 A;  4BOE A;  4XMH A;  4QGW A;  3VG4 A;  2KZ7 B;  5HZ6 A;  3FIQ A;  3T24 A;  1EXS A;  5D48 A;  3ZI8 A;  2ODJ A;  1QY1 A;  3B2K A;  4O4O A;  1ICN A;  1QJ9 A;  4ORR A;  1SY1 A;  4AFK A;  3O2Y A;  3FW4 A;  2R74 A;  5IO5 A;  4FZM A;  2ANS A;  4QNI A;  3NR3 A;  4JFB A;  1ACD A;  2E4J A;  1GT1 A;  5DG4 A;  4YCH A;  3BX8 A;  1LKE A;  1SXW A;  4IB7 A;  3RBY A;  3VY8 X;  3LK3 B;  3JS1 A;  2M06 A;  4C69 X;  2MHL A;  3S5V A;  4B61 A;  4CSB A;  1OEK A;  3B2I A;  3IA8 A;  3LV4 A;  4FBR A;  2A2U A;  5IO6 A;  4QYP A;  1YWA A;  2FT9 A;  5DL7 A;  4IB8 A;  4QGV A;  4AZP A;  2GJ5 A;  2QO4 A;  3RWX A;  3TGA A;  4AZR A;  2KZ7 A;  1G90 A;  2FLJ A;  3HK1 A;  1KT6 A;  1GXA A;  4XNL A;  3POR A;  2AMM X;  4Y0R A;  2X46 A;  1DZM A;  4XMF A;  4O4U A;  4WHI A;  1KOI A;  2FTB A;  2RD7 C;  4M6S A;  2Q39 A;  2WR6 A;  4XMD A;  1JYD A;  2LFO A;  1Z24 A;  5F6B A;  1YWB A;  2FS7 A;  5DL8 A;  1MX8 A;  1VYG A;  3CBC A;  2HLV A;  4QYN A;  4A8Z A;  1PRN A;  4N7C A;  1KZX A;  3NSG A;  1LIF A;  5HAE A;  1GT5 A;  2JOZ A;  1BRP A;  2FR2 A;  4AUI A;  4YKO A;  5HCC C;  1G85 A;  2HYS A;  2GTL M;  3EM0 A;  1KZW A;  2KC0 A;  2ERV A;  3B2J A;  5L8N A;  1YP7 A;  1OEJ A;  1AB0 A;  2ZLD A;  5AFU L;  1SY2 A;  4BQU A;  4PJ2 A;  2PRN A;  2OVA A;  1KT4 A;  3BRN A;  1GFO A;  1ZHW A;  4FOZ A;  2Q4N A;  2Q9S A;  3P24 A;  2Z4I A;  2W2B A;  2BT9 A;  3VG6 A;  3KFG A;  3WJC A;  1EII A;  5AFU K;  2OVS A;  5LKF A;  2WEX A;  4Y0Q A;  4Z3T A;  3FEL A;  1ZHY A;  3FR2 A;  5LJH A;  4ZR2 A;  4IMO A;  5CYB A;  3G7G A;  1O8V A;  2R73 A;  1IKE A;  3JQO A;  4YDB A;  4I9S A;  5LKE A;  1FE3 A;  1UZ2 X;  4AZN A;  4AKR B;  1EW3 A;  2Y7S A;  5GV0 A;  4YDA A;  4COT A;  4FSP A;  4RLC A;  3OJY C;  1NP4 A;  2CBR A;  5LJC A;  3DTQ A;  5H9N A;  4D64 A;  1OBP A;  1MM5 A;  2MHD A;  2KD2 A;  1EI5 A;  3CMP A;  3FYF A;  1HBQ A;  3FA7 A;  5EZ2 A;  3EBW A;  5HZ5 A;  1B56 A;  3PP6 A;  5LJK A;  2Y0H A;  1E02 A;  4I3B A;  4ZH9 A;  1B4M A;  1QAB E;  2RA6 A;  1DZK A;  4ORU A;  4XMC A;  3S26 A;  1JYJ A;  2YNK A;  1I06 A;  1BLR A;  2FR3 A;  2G78 A;  4GCS A;  1GX8 A;  3PH5 A;  3PQS A;  2RCQ A;  3DA3 A;  4KRA A;  4IB9 A;  3ZW1 A;  2ACP X;  1ZND A;  3SAO A;  3SZV A;  3BU1 A;  1FEM A;  1GGL A;  1QWD A;  4ID2 A;  5F1E A;  3SZD A;  4YCE A;  4IBA A;  3FA6 A;  4NP1 A;  3AA6 A;  1LIB A;  3KZA A;  3LK4 1;  4TLJ A;  1BSQ A;  4NLI A;  1SY0 A;  5DL6 A;  4O4S A;  1EPA A;  2F09 A;  3TGC A;  1KQX A;  5JR8 A;  5HA1 A;  3NQ9 A;  4RJX A;  1FEN A;  4I3D A;  4ZFX A;  2X27 X;  3GE2 A;  2NNE A;  3PEC A;  1A3Y A;  3POX A;  2NND A;  2OFM X;  3TGB A;  5ADX L;  4XME A;  1CBQ A;  2XMX A;  1MX7 A;  3P6E A;  2JU8 A;  4NNS A;  3OE3 A;  1I4U A;  2KTD A;  4FBO A;  1DC9 A;  3N91 A;  5ADX K;  2CZT A;  4LKT A;  2KTS A;  1AVG I;  1HN2 A;  4OS3 A;  2R56 A;  3KFI A;  4YGZ A;  2N2M A;  3A2S X;  1X8P A;  4L1N A;  2ALL X;  4OS8 A;  4ZCB A;  3WJE A;  5BVT A;  1G7N A;  4WFV A;  4NYR A;  7PRN A;  1B0O A;  2AL0 X;  5HWZ A;  3FLL A;  1BSO A;  4MVI A;  4HPD A;  3BY0 A;  2KXP B;  2ASN X;  5HZ8 A;  1BH3 A;  3WI4 A;  1JV4 A;  2JMB A;  1GFP A;  1BXW A;  5D5D A;  1JZU A;  1YP6 A;  1U18 A;  3VY9 X;  1SA8 A;  1KT5 A;  2PY1 A;  3SYB A;  3B2H A;  2Y2X A;  4ZHC A;  4FUV A;  4QQ1 A;  5F7G A;  2CBS A;  4O49 A;  5D8J A;  1EIO A;  4O3Y A;  1LFO A;  1KT3 A;  2Q2P A;  2ZAG A;  4XMG A;  3NQ3 A;  3UEX A;  3FR4 A;  1NGL A;  2QO6 A;  1IW2 A;  1QFT A;  1D2U A;  3KFF A;  3FYX A;  4HPA A;  3CWK A;  1TW4 A;  5AJB A;  5FQ8 E;  1DV9 A;  2A2G A;  4YGG A;  1ZNL A;  5CE4 A;  4FZL A;  5EDB A;  4KR4 A;  3D96 A;  1OBU A;  3U9P C;  1HQP A;  2X8T A;  1E54 A;  4ES7 A;  4O3W A;  1I04 A;  4ZGU A;  3AAE B;  3L4R A;  5B27 A;  3NX1 A;  3KVD D;  3UAQ A;  1KT7 A;  2GTF X;  3D4R A;  3G7X A;  4ARH A;  1KQW A;  5DPQ A;  6PRN A;  1QJ8 A;  4PUX A;  1PBO A;  3UEW A;  3PQU A;  4DQ3 A;  1NP1 A;  3EYC A;  1Y9T A;  5HBS A;  1D3S A;  4GE1 A;  4TKB A;  5AEO A;  4EFG A;  3AA7 B;  3WOV A;  1JIW I;  1QY2 A;  2LBA A;  3ZUI A;  5BYP A;  1TVQ A;  2JU7 A;  3WVM A;  2KT4 B;  1BEB A;  2AT0 X;  2M4L A;  3AKN A;  3OBL A;  4PSQ A;  5BVQ A;  4ORX A;  2IFB A;  3AA0 B;  4AKM A;  2RQ0 A;  4NNT A;  3HOE A;  3JTY A;  1ERB A;  2RN4 A;  2AT3 X;  3APV A;  4MIS A;  2K62 A;  3NP1 A;  2BS6 A;  3JSQ A;  4LZU A;  1JBH A;  4RL9 A;  1CRB A;  2W2A A;  2WWP A;  3BS2 A;  3WBG A;  4GK9 A;  4I6S A;  1B8E A;  1DZP A;  1IZN B;  3VG2 A;  1LF7 A;  3HTY A;  3EMM A;  3O19 A;  2XKL A;  3VG7 A;  4YFQ A;  5H9L A;  3LK3 A;  2WQA E;  3UEV A;  3GP6 A;  2DM5 A;  4KC7 A;  5EEE A;  2FWV A;  3ZW2 A;  4GHB A;  4CK4 A;  2WUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...