3VE1A

The 2.9 angstrom crystal structure of transferrin binding protein b (tbpb) from serogroup b m982 neisseria meningitidis in complex with human transferrin
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
652
structure length
537
Chain Sequence
QGGYGFAMRLKRRNWYPGAEESEVKLNESDWEATGLPTKPKELPKRQKSVIEKVETDGDSDIYSSPYLTPSNHVNQPKNQATGHENFQYVYSGWFYKHAASEKDFSNKKIKSGDDGYIFYHGEKPSRQLPASGKVIYKGVWHFVTDTKKGQDFREIIQPSKKQGDRYSGFSGDGSEEYSNKNESTLKDDHEGYGFTSNLEVDFGNKKLTGKLIRNNASLNNNTNNDKHTTQYYSLDAQITGNRFNGTATATDKKENETKLHPFVSDSSSLSGGFFGPQGEELGFRFLSDDQKVAVVGSAKTKDKLSKLTTVLDAVELTLNDKKIKNLDNFSNAAQLVVDGIMIPLLPKDEFTRKFEHTPETKTYEVEVCCSNLNYLKYGMLTRKNQVEQSMFLQGERTDEKEIPTDQNVVYRGSWYGHIANGTSWSGNASDKEGGNRAEFTVNFADKKITGKLTAENRQAQTFTIEGMIQGNGFEGTAKTAESGFDLDRTPKAYITDAKVKGGFYGPKAEELGGWFAYPGDKASSATVVFGAKRQQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structural basis of transferrin sequestration by transferrin-binding protein B.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transport protein
molecule keywords Transferrin-binding protein 2
total genus 136
structure length 537
sequence length 652
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
A PF17483 TbpB_C C-lobe handle domain of Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.240 Mainly Beta Beta Barrel Lipocalin Lipocalin 3ve1A03
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 3ve1A01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 3ve1A04
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 3ve1A02
3KVDD 3VE2A 5EE2A 2W80C 2KDYA 4O4UA 1YS5A 4Z3TA 4U9CA 2W81C 4O3XB 3VE1A 5T5FA 4AYMC 2LFUA 4AYDC 4O4XA 2YPVA 3V8UA 4O49A 4O3YA 3PQUA 2KC0A 3HOLA 4AYNA 4AYID 4QQ1A 4AYEC 3HOEA 4O3WA 4O3ZA 3PQSA 3UAQA 2Y7SA
chains in the Genus database with same CATH superfamily
2FTBA 1VWGB 3IA8A 1CJ5A 1X89A 1KT3A 2NNEA 4L1NA 4ML7B 1BSOA 4MEEA 1SWEA 4Z6JA 2VFBA 4FZLA 3Q34A 1IKJA 3SYBA 3EBWA 5HAEA 1PHOA 1QY0A 4XMHA 1Y52X 1OBPA 4CDEA 3S5VA 1NP4A 2GC9A 2HZQA 5F1EA 3NX2A 4AZMA 1LCWA 4AYDC 1B0OA 1VWQB 1EIOA 3RDMA 1VYOA 1B4MA 4GH7A 2I5VO 4ZGFA 3DWNA 1IKEA 3FMZA 1SREA 3MVFA 3AAEA 3EC5A 4M7MA 3AA6A 4OEMA 3PGSA 2J4UP 1KQXA 1GT3A 1QWDA 2RQ0A 2ANSA 4ZHHA 2RTAA 2F09A 2OFRX 2RTBB 1PMPA 1MUPA 5LJEA 2AT5X 1SRHA 5GTHO 1ZNLA 4O3WA 5D8JA 4OELA 4WHIA 4GGTA 4IBAA 1YP7A 2OVDA 3BU1A 1N9YA 2OL8O 5FVNA 2FGQX 3BY0A 1N4JA 3RDQA 5AFUK 4O3XB 3PF1A 1HXXA 2N93A 2BC3A 1SWDA 3PEDA 4KC7A 2X55A 1NP1A 2FHNX 1VWNB 1X8OA 2DJFA 5EEEA 3ZUOA 5BYPA 4NLJA 2W80C 3U03A 2Y0HA 3BS0A 4LSFA 1VWKB 4FT6A 2XE5A 4IRWA 3PH5A 5AJBA 5JR8A 4GK9A 3HOLA 5KAFO 3AAEB 4YFPA 2XE2A 1Q9GA 4KT5A 1VWCB 3AA6B 3WJDA 1SMPI 4UB6O 2F73A 4KC8A 1Y53X 5FFHA 3AKNA 2GTLO 3ZI8A 1QJPA 4ORRA 3WZQA 3SZVA 3FW5A 1KT5A 2OVSA 2XSTA 2W2FA 3ZW2A 2N2MA 1G74A 3WYPA 2FKJA 4Y0SA 1QQSA 2O4VA 5EZ2A 4CPHA 1BSQA 1ZRYA 4I3BA 5AFUL 3BDRA 4NNTA 1DZMA 2G8CO 1JBHA 1D3SA 5PRNA 1DC9A 3LK42 1PEEA 2R4LA 1STSB 2KT4B 4IL6O 2FHLA 5DL8A 2C1SA 3RWXA 2G7BA 5B3MO 4AZLA 4KRAA 4OKAA 5CE4A 2FR3A 2MO5A 2GE4A 2YNKA 4BUMX 1GFOA 3FELA 4YMYA 3SLTA 4FESA 1PBYA 1HBPA 3TF6A 1VWHB 5D4AA 1SRGA 3ZWEA 2OY8A 2POAA 4KH8A 1SRIA 4D5UA 1I9HA 4JGLA 4CSBA 4I60A 2W2AA 4LSEA 2IZBA 2M06A 1GFMA 5IYUA 3RY1A 3QKGA 1HXZA 3POQA 1EW3A 1ML7A 4WFVA 4U46A 5B66O 3WXQA 3VG2A 4B55A 3HWEA 1CBSA 2MWHA 2A5BA 2R4NA 2FRSA 1LPJA 4C5PA 3U0DA 2A5CA 3POUA 3SY7A 3HOEA 1VWBB 1KL3A 3PGUA 4YDBA 1S2PA 3T2XA 5H9NA 1DZKA 3ZZVA 1ZNKA 3D95A 1SWNA 1K24A 2FS7A 1YS5A 2CM4A 3PQUA 5FENA 2JOZA 4QGWA 3NPOA 1OBQA 1VWDB 4ZHDA 5KHPA 1SWHA 4EEJA 4U8UN 4AZRA 1ZNDA 2OF9A 2OVAA 3APUA 3VZWX 4Y0QA 2IWVA 2L68A 3AA1B 3AKMA 3SZIA 2RN4A 2X4MA 1FJ1E 4O4UA 5G39A 1S7DA 2ZSCA 3HWFA 2QOMA 1OPFA 2A13A 3NX1A 4GNWA 4YCEA 3UEUA 3EM0A 1MDCA 4ARHA 1EPAA 5FAZA 4FBRA 1GFQA 2ACPX 4N7CA 2I5ZO 4NW4A 1AVEA 1FDQA 3ZW0A 2IFBA 4YGZA 3FR4A 2WR6A 1SWGA 4I3CA 3KVNA 2OY1O 1QJ9A 2F1TA 5DL5A 1A57A 2FS6A 5AJCA 2BT9A 2RTJA 3SAOA 2DJGA 2YG2A 2XKLA 1IZNB 4I95A 1QG5A 2JN3A 3PECA 2RTIB 2IZLB 4XMFA 1JMXA 5HCEC 4D6AA 3AA1A 4AYID 3PORA 4YKOA 3FA9A 2R89A 2X46A 4FSPA 4UU3A 3T6FA 2Y7SA 3S60A 4OS3A 5BVTA 1MOYA 3WZPA 4LZUA 4YDAA 3JCUO 2XTRA 1G7NA 2ALLX 2OF8A 3QRCA 5EDBA 1AELA 1IFCA 4ORXA 1T68X 3JSQA 2RTKA 5HZ8A 3FIQA 1ZHYA 4CDDA 1OPAA 5B29A 3BU9A 3RE6A 2HNXA 3JQOA 1PTSA 5L8IA 5IO7A 1FE3A 4XMEA 4BVMA 4AW8A 2L9CA 4RJXA 1EQDA 4GGZA 4F4BA 2RTGB 4HPCA 3FYFA 4FUVA 2DM5A 2RTFB 5B10O 4HPBA 5KAIO 4I3DA 1G5WA 2E4JA 4CTDA 8PRNA 1W6FA 2FGSA 1SWOA 4ALBA 1UREA 1HXLA 3MM0A 2NNQA 1TVQA 4U9CA 2A8GA 2F1CX 3LK2A 2JGSA 4AKMA 3P6CA 4N59A 1OSPO 4JHQA 3P6HA 4EQAC 3HPEA 1IJ8A 2ZAGA 1R0UA 1IFBA 4XNKA 1DZJA 1YUPA 4IABA 3B2LA 3EBKA 1W4TA 4N58A 1SWFA 1VYGA 3KFFA 1DF8A 3T2WA 4IB8A 5HTDA 3F8AA 3SZJA 5LJDA 4QYNA 1T16A 1JJUA 1SWAA 4Z2VA 1SRFA 4EDEA 4GD9A 2RTDB 1RXHA 1MPFA 4JO6A 3KFIA 2IZHB 1HN2A 1Q9FA 4LZVA 4YCHA 3TGBA 2WPUA 1LKEA 3D4RA 3BRZA 2AF5A 2X8SA 2QOSC 1O1VA 1EI5A 1IW2A 1LICA 5LJCA 2AH7X 1RLBE 1BLRA 1NC9A 5LKFA 1DZPA 4O49A 4QGVA 1D2UA 3LK2B 2R88A 4O3ZA 1YIVA 4ID2A 1ADLA 1GT4A 3FR2A 1LIEA 3UEVA 4RJWA 2CBSA 5LJGA 3RY2A 1HMSA 2ZFGA 3EMMA 3NP1A 3GP6A 2GTFX 2AVIA 2CM9A 1ACDA 4GCPA 1T8VA 3D97A 3HW9A 3TGCA 4QAEA 4FZNA 3B2HA 3OBLA 2IZJA 2AKQA 4LKTA 1BBPA 2RD7C 2IZAA 3TZGA 5H9AA 3KFHA 2HZRA 1MM9A 4MVKA 1SWQA 1BT9A 4AYMC 2R56A 3LK3A 1I4UA 1NBXA 4GU8A 2RCTA 1GT1A 1JYJA 2ERVA 2X56A 3D96A 4I6SA 4ODDA 2Z4HA 2IZDB 1JMZA 3K19A 3QRAA 2Y0LA 1QABE 4WFUA 2R74A 1TW4A 5AQ6A 4RL9A 2XE1A 1X8NA 3C77X 3RSWA 2WJQA 5DG4A 4N74A 1LCZA 5F58A 3RDXA 2C4IA 1SWUA 4ZHGA 3UAQA 1GX3A 3L4RA 1A2DA 3T6LA 1VWLB 4Z28A 1CRBA 4NYQA 5IO5A 4GNYA 3SLOA 2R4PA 4CV7A 3SLJA 2OFMX 2R4OA 4O3YA 5F7GA 1OEEA 2ZAIA 1SXUA 1ERBA 3KQ0A 2N2LA 1DV9A 2WSJA 1GX8A 3CKFA 4QZTA 5IO6A 3HK1A 4GHBA 2KDYA 2JU7A 3WYQA 4NLIA 4GJVA 4XMDA 4GETA 1RXKA 4BX7B 4TLJA 3AAAB 3PH6A 3VG5A 1FEMA 5HTEA 5IRAA 2K23A 1BEBA 1KFFA 3P6EA 4HFOA 1I04A 2IZKA 2Y32A 3FLLA 5HA0A 3STNA 2IZIA 3FEPA 3WJCA 1ICNA 4TNNA 3SOTA 1VWMB 5HCDC 3P24A 1E00A 2HLVA 5ADXL 4GE1A 2Y3EA 1BRPA 5EDCA 4U3QA 3DSZA 1N7YA 4L3RA 4A1HA 3B2IA 3POXA 1DFVA 1TOWA 1SLDB 4YFQA 2QO6A 1E06A 1VWRB 2WEWA 3BRYA 3RKGA 4KR8A 3ZW0B 1I78A 2CZTA 3V8UA 3C76X 1G85A 1LIDA 1B8EA 2QO5A 2X34A 2CAMA 5H9KA 1QY1A 3RDUA 1YWBA 2PRNA 1SY1A 4BGFA 1CBQA 3AUMO 1LFOA 1SXYA 1IZNA 3TGAA 1SRJA 4WBKA 4I9SA 3AAAA 3VPJE 2OYBO 2KC0A 2OVEA 4ON1A 1KZWA 4UB8O 3BSZE 2R73A 3T20A 2IWWA 2FT9A 1MK5A 3VGWA 1HXUA 1GFNA 4FRTA 2AT3X 4ZH9A 3FYXA 5L8OA 1T1LA 1MEPA 3KZIO 1KL4A 1EIIA 5T5FA 4ORUA 2YPVA 4GKCA 3OD9A 1QY2A 4CDFA 5HZ6A 1BXWA 2IZFB 1MX8A 5K67A 2MJIA 3CMPA 4MVLA 3C78X 1ALBA 4ES7A 4LQZA 1ICMA 1X8QA 5B5GA 1KOIA 4C00A 4G76A 3EMNX 1GGLA 1IIUA 4MVEA 5K68A 4JFBA 1NDJA 1OSMA 2OY7A 4GUZA 2RTRB 1SWBA 4JNJA 4HPDA 1JQPA 2XMXA 4FQBB 1VWJB 4RLCA 2L5PA 2Q2PA 4N7DA 2RTPB 4FMSA 2LBVA 1EUOA 3FEKA 5E79O 4EXZA 3HWGA 3N91A 1N43A 1LNMA 1VWOB 5IXGA 1SLEB 2PY1A 1N0SA 1JYDA 2FWVA 3VE1A 3H3IA 3ZQ3A 1N9MA 1SY0A 3WJBA 1RAVA 4AYNA 4PUXA 5EPQA 3VE2A 4ORYA 3UU2A 1NQMA 2Q4NA 3F9DA 1DF3A 3CBSA 2RTNB 2HMBA 2AL0X 1SWTA 3MG5A 1SWSA 5H9LA 3SYSA 5CSEA 1SLGB 3DZMA 5IRWA 5F6ZA 1A3YA 1YWDA 3WZNA 4BX6A 2WWPA 1RXJA 4GZVA 2HYSA 2MF6A 2FLJA 4KR4A 4NV8A 4AYEC 2Y2XA 3DWOX 1TXLA 5JD2A 1I06A 2JQYA 2OZQA 1AQBA 4RUNA 2OFBA 3HWDA 4OMWA 4IB6A 2KD2A 4IMNA 3WI5A 2LBAA 3CR6A 3DTQA 1QJ8A 4ZGUA 1GXAA 1FENA 4OS8A 4ALOA 1O8VA 1LIFA 4M6SA 1GT5A 1CBRA 2RA6A 2Y3FA 2K62A 2NNDA 2A0AA 4CPFA 2JMMA 2ASNX 1KZXA 3QQ2A 1ZHWA 3RDSA 3P6GA 4AUIA 1SY3A 1LELA 4COTA 1ZHZA 2Q2MA 4MISA 3STMX 1VWPB 1BWYA 4C4VA 2OL6O 2MHLA 3TZSA 3PQSA 1RSTB 3T0SA 1RBPA 5FQ7E 4ZHCA 3I17A 3RBYA 2MM3A 1B56A 3VHIA 2LFUA 1G90A 4UU2A 1OEJA 2IZEB 2QO4A 3NBXX 2C1QA 3LK3B 3MBTA 2WJRA 2F01A 4YBPA 4YKMA 4AZOA 5L3YA 4ZCBA 2VFCA 2XE3A 2LFOA 3NJTA 1PM1X 3U9PC 1MVGA 3F6ZB 1OPBA 5B2AO 3FW4A 5EE2A 3VG6A 1W5RA 1X71A 2A3FX 2QM9A 2RTHB 1XKIA 1T0VA 4EFGA 4IAWA 3VG4A 2QTKA 5D5DA 2AT0X 2CBRA 3DA4A 3ELZA 4ORSA 2M07A 1UYNX 1K3BA 3KZAA 3SY9A 4QZUA 2KW1A 1JJJA 2HKDA 4C69X 4LKPA 3G7XA 1MM4A 4GRJA 2OMFA 3VG7A 4TKHA 1SWKA 4AFKA 1BSYA 1Y0GA 1YWAA 4BX7A 1KGLA 1OEKA 2GH7A 4CK4A 2A2UA 4HWMA 1BM5A 2NP1A 3JTYA 4G75A 2IZGB 2A2GA 4TKBA 2Q9SA 4E1SA 1GFPA 2WVPA 4B61A 4PSQA 5B11O 4TQ2A 3SZDA 2G78A 1O1UA 2W81C 4I9RA 4YBUA 1ERXA 4GGRA 3D9WA 3STKA 3CKGA 4QNIA 2AT8X 2PORA 2X27X 1P6PA 3PK2A 2G79A 3P6DA 4CPIA 2O62A 3B2KA 1SXWA 1SWCA 1VWFB 5F6BA 4XMGA 3UEWA 1E02A 3JS1A 3ZW1A 3RBHA 2QMIA 4TKJA 2KTDA 3SZHA 1JJXA 4YGHA 4Z3TA 5G3AA 2Q39A 2P8GA 2W2BA 4INNA 4GJSA 3BX7A 3A0HO 3FR5A 4IMOA 3HWBA 5HA1A 3FA7A 2LB6A 4AKRA 1EXSA 2RTOB 3KFGA 3G7GA 5B27A 1NGLA 2WUTA 3APVA 2RTQB 2KXPA 3O0EA 5HBSA 2LA7A 1H91A 4TJZA 4YH0A 1Y9TA 3ZUIA 4DNEA 3VHHA 3HTYA 4FRXA 1I05A 1HMTA 3NSGA 1LDQA 3E3CA 1ZHXA 1LDOA 2FGRA 4E1TA 3WJGA 4YGGA 1QFTA 1SWLA 4Y0PA 3NQ3A 3APXA 1EALA 3FENA 1A18A 3OE3A 1WUBA 1VPRA 4QYPA 4GCSA 3VY8X 2LHFA 4U8UO 3UPGA 1NQNA 1GM6A 2ZLDA 5CYBA 5HZQA 3PPTA 4Y5DA 1LIBA 3KVDD 1Y55X 3T1DA 4AKRB 4BCSA 3APWA 1UYOX 3O22A 2RTCB 2R8AA 2GTLN 4AYHA 3VY9X 1STPA 4EKVA 5AEOA 1HQPA 1E5PA 2J1NA 4Z2OA 3MX7A 3NADA 4FQEA 1ZNEA 2LKKA 3B2JA 4NYRA 1YWCA 3VZUX 1WBIA 4YVBA 3ELXA 4MVIA 3O2YA 4ZHFA 2K0LA 1SWRA 4N75A 5GV0A 1U0XA 2L67A 4MIRA 4GDAA 3FA6A 3WJFA 1ZHTA 3NR3A 5B5EO 4Z27A 1PBOA 2UZ2A 1JZUA 1BH3A 3NQKA 4FBVA 2RCQA 1HQQA 3PRNA 2X8FA 2VDFA 3A2SX 4BX6B 3K3LA 3RZYA 2RTMA 1OBUA 5LJBA 1AB0A 1ZNGA 2YMSA 1RSUB 4PR7A 5G38A 1KQWA 3PP6A 5G26A 3VG3A 5FQ8E 4RUUA 1KT6A 4ORWA 3WBGA 5KIDA 4GF4A 5LJKA 3AA7A 4O4XA 2JU3A 1MM5A 4NNSA 4A8ZA 3CBCA 3LK41 2BSZA 5HZ5A 1VWAB 4O4OA 2JW1A 1U18A 2IZCB 5ADXK 4KIIA 4NV7A 3S5XA 4ZR2A 7PRNA 3EYCA 5BVSA 5JDPA 1FELA 4GCQA 2X45A 1VWIB 2WQ9A 1GKAB 3WVMA 1SY2A 1THQA 5K06A 2UYWA 1AVDA 4IAXA 4C4VB 5H8TA 4CPEA 3WI4A 1JV4A 2AXTO 5C0NA 1STRB 4K3BA 4QRLA 5DL6A 1HBQA 2EU7X 3VU1A 2OL7A 1KL5A 3WU2O 1L6MA 1KT4A 2FKGA 4OMXA 5LKEA 4PJ0O 3FIDA 1CBIA 3AA0A 4A60A 4ZFXA 4JCHA 3P02A 4DQ3A 4KCAA 2Z4IA 4ZH6A 1QFVA 3FDCA 1E2TA 1KXOA 4BOEA 4FOZA 3BS2A 3UEXA 3AA7B 4D6BA 4IB7A 6PRNA 3BRNA 2AMMX 2PI3O 3OJYC 4AZPA 5F2BA 4FGIB 1SLFB 5DPQA 4CPHB 3CQRA 2CZUA 3CWKA 1XCAA 1VWEB 1GKAA 5FQ6E 4OS0A 4FBOA 4DQ4A 1X8PA 2KTSA 2ODJA 3LV4A 1ORMA 3EW2A 4K19A 1SWPA 4U8UM 4BX5A 2KZ7A 3WZOA 4R0BA 4O4SA 5KICA 4CDCA 1LUQA 3EW1A 3Q6LA 4GDZA 5EEDA 1E54A 5B5FA 2WEXA 4Y59A 2GTLM 5GTIO 2FR2A 2F1VA 3AA0B 5LJHA 1P4TA 2JMBA 2BLGA 1BJ7A 5DL7A 1BRQA 5D47A 4FZMA 4QQ1A 3WOVA 4AZNA 3O19A 1S44A 4ZJ0A 4FSOA 2X32A 4BJ8A 3T24A 1U17A 4BQUA 2M4LA 2MNHA 3S26A 4LSHA 1HMRA 3LTWA 5H2FO 5TISO 3X00A 4XNLA 5HZ9A 3DA3A 2GJ5A 2XTQA 1X8UA 4K3CA 1HXTA 1SA8A 5HWZA 4Z2PA 4D65A 1LCVA 1AVGI 4Y0RA 2G5LA 3BX8A 2WQAE 2MHDA 3P6FA 3IFBA 3ZW1B 2XG6A 1UZ2X 3FA8A 3PDFA 3RDOA 3BLGA 3NQ9A 1HY2A 2RTLA 4QGXA 4BX5B 2KZ7B 2X9KA 2K4TA 4D64A 4BBOA 1FTPA 4HPAA 2X8TA 3PGRA 1EPBA 1ZNHA 4NP1A 5L8NA 2JU8A 2BS5A 3LHNA 3C5OA 3GAQA 3A0BO 1VYFA 1SXXA 5BVQA 2RTEB 1SWJA 1PRNA 1GX9A 2KXPB 2BHVA 3RE5A 4LSIA 4AZQA 1KT7A 3GE2A 4RLBA 4YFRA 2QCBA 4O9SA 3CQNA 5D48A 2ACOA 2OFAA 5IRUA 5HCCC 4DCBA 5D45A 3I0AA 2BS6A 1H6S1 3WJEA 1S5LO 4A1YA 2AT6X 1JIWI 4PJ2A 3VHMA 1Y9LA 5CHKA 4IB9A 2Y0KA 3VZTX 1Z24A 1LF7A 4XMCA 1YP6A 1TOUA 2OY5O 3AEHA 1MX7A
chains in the Genus database with same CATH topology
3NQ3A 5BVTA 2FTBA 3APXA 3FENA 1EALA 3IA8A 4LZUA 4YDAA 1A18A 1CJ5A 3OE3A 1X89A 2XTRA 1G7NA 4GHBA 2ALLX 1MX8A 1VPRA 1KT3A 3QRCA 2NNEA 2MJIA 3CMPA 4L1NA 5EDBA 4QYPA 1AELA 4MVLA 4GCSA 3C78X 2LHFA 1IFCA 3VY8X 4ORXA 1ALBA 4ML7B 1BSOA 4U8UO 1T68X 3UPGA 3JSQA 4ES7A 4LQZA 5HZ8A 1ICMA 3FIQA 4FZLA 1ZHYA 1X8QA 1OPAA 1GM6A 1KOIA 1IKJA 2ZLDA 5B29A 3BU9A 5CYBA 5HZQA 1GGLA 3PPTA 1IIUA 3EMNX 4G76A 3EBWA 4MVEA 2HNXA 1LIBA 5HAEA 3JQOA 1PHOA 5L8IA 3KVDD 1QY0A 4JFBA 4XMHA 3T1DA 5IO7A 1OSMA 4AKRB 1OBPA 3S5VA 1FE3A 1NP4A 2GC9A 3APWA 3K19A 2HZQA 5F1EA 3NX2A 4XMEA 3O22A 4BVMA 4HPDA 4AW8A 2L9CA 2GTLN 4AZMA 4RJXA 2XMXA 1EQDA 5DL7A 4AYHA 3VY9X 4F4BA 5AEOA 4FQBB 4AYDC 4HPCA 3FYFA 1HQPA 4FUVA 2DM5A 2L5PA 4RLCA 1E5PA 2Q2PA 4HPBA 4N7DA 2J1NA 4FMSA 2LBVA 4I3DA 1B0OA 1EUOA 3FEKA 3MX7A 1G5WA 2E4JA 1EIOA 4EXZA 3HWGA 3N91A 3NADA 8PRNA 4ALBA 1LNMA 1ZNEA 1B4MA 2LKKA 3B2JA 1UREA 4GH7A 4NYRA 1YWCA 3VZUX 3ELXA 2PY1A 2NNQA 4MVIA 3O2YA 1TVQA 4ZHFA 4U9CA 1N0SA 4ZGFA 2K0LA 1JYDA 2FWVA 3VE1A 3H3IA 3ZQ3A 3LK2A 5GV0A 1SY0A 3WJBA 1U0XA 2L67A 1IKEA 4AKMA 3P6CA 3FMZA 3RBHA 3MVFA 4MIRA 3AAEA 4N59A 3FA6A 3P6HA 3WJFA 4EQAC 1ZHTA 4AYNA 4M7MA 3NR3A 3AA6A 4D5UA 2ZAGA 4PUXA 1R0UA 5EPQA 1KQXA 2J4UP 1PBOA 1JZUA 1BH3A 1GT3A 1QWDA 3VE2A 2RQ0A 1IFBA 4ORYA 3UU2A 4XNKA 1DZJA 1YUPA 2ANSA 3NQKA 4ZHHA 2Q4NA 4IABA 3F9DA 2F09A 1DF3A 2OFRX 3CBSA 3B2LA 2RCQA 2HMBA 4FBVA 2AL0X 1PMPA 3PRNA 1MUPA 2X8FA 5LJEA 3EBKA 3A2SX 4N58A 3K3LA 2AT5X 5H9LA 1ZNLA 1VYGA 3KFFA 4O3WA 5D8JA 3RZYA 4WHIA 4IB8A 5HTDA 3SYSA 1OBUA 3F8AA 5LJBA 4IBAA 1AB0A 1ZNGA 2YMSA 1YP7A 2OVDA 3BU1A 5LJDA 1KQWA 3PP6A 4QYNA 3SYBA 5G26A 5FVNA 5F6ZA 1A3YA 3BY0A 3VG3A 2FGQX 5FQ8E 4RUUA 1KT6A 1YWDA 4ORWA 5AFUK 4O3XB 3WBGA 2WWPA 4GZVA 5KIDA 1HXXA 4GF4A 2N93A 2HYSA 5LJKA 3AA7A 4EDEA 4O4XA 2JU3A 3PEDA 2FLJA 4KC7A 4KR4A 1MPFA 1MM5A 1NP1A 3KFIA 4NNSA 4A8ZA 1HN2A 3CBCA 3LK41 4AYEC 1Q9FA 2Y2XA 5HZ5A 4O4OA 1X8OA 2JW1A 5EEEA 4LZVA 1TXLA 4YCHA 3ZUOA 1U18A 1I06A 3TGBA 2OZQA 5BYPA 5ADXK 4NLJA 1LKEA 3D4RA 2W80C 3U03A 2Y0HA 4KIIA 4LSFA 4FT6A 1AQBA 4RUNA 3S5XA 3HWDA 2XE5A 4ZR2A 7PRNA 2X8SA 2QOSC 1O1VA 3EYCA 3PH5A 1EI5A 1IW2A 5AJBA 5BVSA 5JDPA 4OMWA 1FELA 1LICA 2KD2A 2X45A 4IB6A 2WQ9A 4IMNA 5LJCA 4GCQA 3WI5A 2LBAA 2AH7X 5JR8A 3CR6A 3DTQA 1RLBE 1QJ8A 4ZGUA 1GKAB 1GXAA 4GK9A 1DZPA 1FENA 1SY2A 4O49A 4OS8A 5LKFA 3WVMA 1D2UA 4ALOA 4QGVA 5K06A 1THQA 1O8VA 3HOLA 3LK2B 4IAXA 1LIFA 4M6SA 1GT5A 4O3ZA 3AAEB 1CBRA 2RA6A 4YFPA 2XE2A 1YIVA 1Q9GA 5H8TA 4KT5A 4ID2A 3AA6B 3WI4A 2K62A 1JV4A 1ADLA 3WJDA 2NNDA 1GT4A 2A0AA 2JMMA 3FR2A 1SMPI 2ASNX 1KZXA 1LIEA 5C0NA 1ZHWA 2F73A 3UEVA 2CBSA 3P6GA 5LJGA 4RJWA 4AUIA 1HMSA 2ZFGA 1SY3A 4KC8A 4COTA 1ZHZA 2Q2MA 4MISA 4QRLA 3EMMA 3STMX 1BWYA 5DL6A 1HBQA 3NP1A 3GP6A 2EU7X 3VU1A 2GTFX 2CM9A 2MHLA 5FFHA 1ACDA 4GCPA 1L6MA 3AKNA 3TZSA 1KT4A 4OMXA 5LKEA 2GTLO 3PQSA 3ZI8A 1QJPA 1T8VA 4ORRA 3SZVA 1CBIA 3AA0A 3FW5A 1KT5A 4A60A 3T0SA 4ZFXA 1RBPA 2OVSA 3D97A 3HW9A 4JCHA 2XSTA 3TGCA 5FQ7E 3P02A 4DQ3A 4KCAA 2Z4IA 3I17A 4ZHCA 2W2FA 4ZH6A 3RBYA 3ZW2A 4QAEA 1QFVA 2N2MA 2MM3A 4FZNA 3B2HA 1B56A 1G74A 3OBLA 4Y0SA 1QQSA 2O4VA 2LFUA 1KXOA 5EZ2A 1G90A 4BOEA 2AKQA 4FOZA 1BSQA 1ZRYA 4UU2A 3BS2A 4I3BA 4LKTA 1BBPA 3UEXA 3AA7B 5AFUL 3BDRA 2RD7C 1DZMA 4NNTA 4D6BA 2KXPB 4IB7A 1OEJA 6PRNA 3BRNA 1JBHA 1D3SA 5PRNA 2QO4A 1DC9A 3LK42 1PEEA 3NBXX 3TZGA 2AMMX 3MBTA 5H9AA 3LK3B 3OJYC 4YBPA 4YKMA 4AZPA 2KT4B 4AZOA 5DL8A 3KFHA 3RWXA 4ZCBA 2G7BA 2HZRA 4FGIB 2XE3A 5DPQA 4AZLA 4MVKA 2LFOA 1BT9A 4AYMC 2R56A 4KRAA 5CE4A 2FR3A 3CQRA 2MO5A 2GE4A 2CZUA 1PM1X 2YNKA 3U9PC 4BUMX 1GFOA 3CWKA 3FELA 1MVGA 1XCAA 3F6ZB 4YMYA 4FESA 3LK3A 1I4UA 1OPBA 1GKAA 1HBPA 4GU8A 3TF6A 5FQ6E 4OS0A 2RCTA 1GT1A 1JYJA 5D4AA 2ERVA 3FW4A 4FBOA 4DQ4A 1X8PA 3VG6A 3ZWEA 5EE2A 2KTSA 3D96A 4I6SA 4ODDA 2Z4HA 3T24A 1X71A 2A3FX 2ODJA 2POAA 2QM9A 4KH8A 5L8NA 1XKIA 1T0VA 4EFGA 3LV4A 4IAWA 3VG4A 1QABE 1ORMA 2Y0LA 2QTKA 4WFUA 4JGLA 4K19A 4CSBA 3QRAA 2R74A 2W2AA 5D5DA 1TW4A 2AT0X 4U8UM 5AQ6A 2CBRA 2KZ7A 3DA4A 3ELZA 4ORSA 2M07A 2XE1A 4LSEA 1X8NA 4R0BA 4RL9A 3C77X 4O4SA 3RSWA 5DG4A 2M06A 1GFMA 5IYUA 5F58A 5KICA 3KZAA 3QKGA 4ZHGA 3SY9A 3Q6LA 3POQA 4QZUA 1EW3A 1ML7A 2KW1A 3UAQA 1JJJA 4GDZA 5EEDA 1E54A 4WFVA 4C69X 3SY7A 4LKPA 3G7XA 2WEXA 4GRJA 1MM4A 2OMFA 3L4RA 1A2DA 3VG7A 4TKHA 2GTLM 3WXQA 4AFKA 2FR2A 2F1VA 3AA0B 1BSYA 3VG2A 1YWAA 1CRBA 4NYQA 5IO5A 4GNYA 3HWEA 1CBSA 2MWHA 5LJHA 1KGLA 2FRSA 1OEKA 1P4TA 4CV7A 1LPJA 2BLGA 2JMBA 2OFMX 4O3YA 2A2UA 1BJ7A 4HWMA 1OEEA 5F7GA 4CK4A 3U0DA 1BLRA 2ZAIA 1BRQA 1BM5A 5D47A 3POUA 4QQ1A 2NP1A 1SXUA 3HOEA 3WOVA 4FZMA 1ERBA 4YDBA 1S2PA 4AZNA 3KQ0A 2N2LA 1DV9A 3JTYA 4G75A 3O19A 1S44A 1GX8A 2WSJA 4ZJ0A 4FSOA 4QZTA 2A2GA 5H9NA 5IO6A 1DZKA 3HK1A 3ZZVA 1U17A 1ZNKA 2M4LA 2JU7A 2Q9SA 3D95A 4NLIA 4BQUA 4XMDA 4TKBA 2KDYA 4E1SA 1GFPA 4GETA 4B61A 2MNHA 2FS7A 4PSQA 4TQ2A 3S26A 1YS5A 4TLJA 4LSHA 3SZDA 1HMRA 2G78A 3AAAB 1O1UA 2W81C 4I9RA 3PH6A 3VG5A 4YBUA 1ERXA 1FEMA 2CM4A 4XNLA 5HTEA 2K23A 5HZ9A 3DA3A 1BEBA 3PQUA 3STKA 2GJ5A 2XTQA 1X8UA 5FENA 2JOZA 1HXTA 3P6EA 4HFOA 4QGWA 1SA8A 3NPOA 5HWZA 1OBQA 1I04A 4QNIA 4ZHDA 5KHPA 4D65A 2AT8X 1AVGI 2PORA 4EEJA 2X27X 4U8UN 4Y0RA 3FLLA 5HA0A 1P6PA 4AZRA 1ZNDA 3BX8A 2WQAE 2MHDA 3P6FA 2G79A 3STNA 3IFBA 3ZW1B 3FEPA 2XG6A 1UZ2X 2OVAA 3APUA 3VZWX 3P6DA 4Y0QA 2O62A 3WJCA 2L68A 3B2KA 3FA8A 1ICNA 1SXWA 3AA1B 3AKMA 4TNNA 3BLGA 3NQ9A 3SOTA 5HCDC 3P24A 1E00A 2HLVA 4QGXA 2KZ7B 5ADXL 5F6BA 4KR8A 4GE1A 4XMGA 1BRPA 2K4TA 5EDCA 4D64A 2RN4A 3UEWA 1FTPA 4HPAA 1E02A 3JS1A 2X8TA 3ZW1A 1EPBA 1ZNHA 4NP1A 2QMIA 3DSZA 4U3QA 2JU8A 4TKJA 2BS5A 2KTDA 4O4UA 3LHNA 4L3RA 3GAQA 4A1HA 3C5OA 1JJXA 3B2IA 1VYFA 3POXA 4YGHA 1DFVA 1TOWA 1SXXA 4Z3TA 5BVQA 4YFQA 1S7DA 2QO6A 1E06A 2Q39A 1PRNA 2P8GA 2WEWA 1GX9A 3HWFA 3RKGA 2W2BA 3ZW0B 4INNA 2BHVA 2A13A 2CZTA 3NX1A 4GNWA 4YCEA 1OPFA 3BX7A 3UEUA 3V8UA 4AZQA 4LSIA 3EM0A 1KT7A 1MDCA 3C76X 3FR5A 4IMOA 4ARHA 3HWBA 3GE2A 1EPAA 5HA1A 4RLBA 1G85A 1LIDA 1B8EA 3FA7A 2QO5A 4YFRA 2LB6A 4AKRA 1EXSA 5FAZA 5H9KA 4FBRA 1GFQA 1QY1A 3KFGA 5B27A 2ACPX 1NGLA 4O9SA 3G7GA 3CQNA 4N7CA 1YWBA 5D48A 4NW4A 2ACOA 2PRNA 1SY1A 2WUTA 5HCCC 1FDQA 3APVA 5D45A 3ZW0A 3I0AA 1CBQA 2BS6A 1H6S1 2KXPA 3WJEA 3O0EA 1LFOA 1SXYA 2IFBA 5HBSA 1IZNA 3TGAA 4YGZA 4WBKA 2LA7A 4I9SA 3AAAA 3VPJE 3FR4A 1H91A 4A1YA 2WR6A 2KC0A 2OVEA 4I3CA 4TJZA 4YH0A 1Y9TA 4ON1A 2AT6X 1JIWI 1KZWA 4PJ2A 1QJ9A 2F1TA 5DL5A 3BSZE 1A57A 2FS6A 5AJCA 1Y9LA 2R73A 3ZUIA 3T20A 2BT9A 2FT9A 1HXUA 4IB9A 1GFNA 3SAOA 2Y0KA 4FRTA 2AT3X 4ZH9A 3FYXA 2YG2A 2XKLA 3HTYA 5L8OA 1IZNB 4I95A 1I05A 4FRXA 3VZTX 1QG5A 1Z24A 2JN3A 1HMTA 3PECA 3NSGA 1EIIA 5T5FA 1LF7A 4XMFA 4ORUA 4XMCA 2YPVA 5HCEC 3E3CA 1YP6A 4GKCA 3OD9A 1QY2A 4D6AA 1ZHXA 2FGRA 3AA1A 4AYID 5HZ6A 4E1TA 1TOUA 3WJGA 4YGGA 3PORA 1QFTA 4YKOA 3FA9A 4Y0PA 2X46A 1BXWA 4FSPA 4UU3A 1MX7A 2Y7SA 3S60A 4OS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KVD D;  3VE2 A;  5EE2 A;  2W80 C;  2KDY A;  4O4U A;  1YS5 A;  4Z3T A;  4U9C A;  2W81 C;  4O3X B;  3VE1 A;  5T5F A;  4AYM C;  2LFU A;  4AYD C;  4O4X A;  2YPV A;  3V8U A;  4O49 A;  4O3Y A;  3PQU A;  2KC0 A;  3HOL A;  4AYN A;  4AYI D;  4QQ1 A;  4AYE C;  3HOE A;  4O3W A;  4O3Z A;  3PQS A;  3UAQ A;  2Y7S A; 
#chains in the Genus database with same CATH topology
 2FTB A;  1VWG B;  3IA8 A;  1CJ5 A;  1X89 A;  1KT3 A;  2NNE A;  4L1N A;  4ML7 B;  1BSO A;  4MEE A;  1SWE A;  4Z6J A;  2VFB A;  4FZL A;  3Q34 A;  1IKJ A;  3SYB A;  3EBW A;  5HAE A;  1PHO A;  1QY0 A;  4XMH A;  1Y52 X;  1OBP A;  4CDE A;  3S5V A;  1NP4 A;  2GC9 A;  2HZQ A;  5F1E A;  3NX2 A;  4AZM A;  1LCW A;  4AYD C;  1B0O A;  1VWQ B;  1EIO A;  3RDM A;  1VYO A;  1B4M A;  4GH7 A;  2I5V O;  4ZGF A;  3DWN A;  1IKE A;  3FMZ A;  1SRE A;  3MVF A;  3AAE A;  3EC5 A;  4M7M A;  3AA6 A;  4OEM A;  3PGS A;  2J4U P;  1KQX A;  1GT3 A;  1QWD A;  2RQ0 A;  2ANS A;  4ZHH A;  2RTA A;  2F09 A;  2OFR X;  2RTB B;  1PMP A;  1MUP A;  5LJE A;  2AT5 X;  1SRH A;  5GTH O;  1ZNL A;  4O3W A;  5D8J A;  4OEL A;  4WHI A;  4GGT A;  4IBA A;  1YP7 A;  2OVD A;  3BU1 A;  1N9Y A;  2OL8 O;  5FVN A;  2FGQ X;  3BY0 A;  1N4J A;  3RDQ A;  5AFU K;  4O3X B;  3PF1 A;  1HXX A;  2N93 A;  2BC3 A;  1SWD A;  3PED A;  4KC7 A;  2X55 A;  1NP1 A;  2FHN X;  1VWN B;  1X8O A;  2DJF A;  5EEE A;  3ZUO A;  5BYP A;  4NLJ A;  2W80 C;  3U03 A;  2Y0H A;  3BS0 A;  4LSF A;  1VWK B;  4FT6 A;  2XE5 A;  4IRW A;  3PH5 A;  5AJB A;  5JR8 A;  4GK9 A;  3HOL A;  5KAF O;  3AAE B;  4YFP A;  2XE2 A;  1Q9G A;  4KT5 A;  1VWC B;  3AA6 B;  3WJD A;  1SMP I;  4UB6 O;  2F73 A;  4KC8 A;  1Y53 X;  5FFH A;  3AKN A;  2GTL O;  3ZI8 A;  1QJP A;  4ORR A;  3WZQ A;  3SZV A;  3FW5 A;  1KT5 A;  2OVS A;  2XST A;  2W2F A;  3ZW2 A;  2N2M A;  1G74 A;  3WYP A;  2FKJ A;  4Y0S A;  1QQS A;  2O4V A;  5EZ2 A;  4CPH A;  1BSQ A;  1ZRY A;  4I3B A;  5AFU L;  3BDR A;  4NNT A;  1DZM A;  2G8C O;  1JBH A;  1D3S A;  5PRN A;  1DC9 A;  3LK4 2;  1PEE A;  2R4L A;  1STS B;  2KT4 B;  4IL6 O;  2FHL A;  5DL8 A;  2C1S A;  3RWX A;  2G7B A;  5B3M O;  4AZL A;  4KRA A;  4OKA A;  5CE4 A;  2FR3 A;  2MO5 A;  2GE4 A;  2YNK A;  4BUM X;  1GFO A;  3FEL A;  4YMY A;  3SLT A;  4FES A;  1PBY A;  1HBP A;  3TF6 A;  1VWH B;  5D4A A;  1SRG A;  3ZWE A;  2OY8 A;  2POA A;  4KH8 A;  1SRI A;  4D5U A;  1I9H A;  4JGL A;  4CSB A;  4I60 A;  2W2A A;  4LSE A;  2IZB A;  2M06 A;  1GFM A;  5IYU A;  3RY1 A;  3QKG A;  1HXZ A;  3POQ A;  1EW3 A;  1ML7 A;  4WFV A;  4U46 A;  5B66 O;  3WXQ A;  3VG2 A;  4B55 A;  3HWE A;  1CBS A;  2MWH A;  2A5B A;  2R4N A;  2FRS A;  1LPJ A;  4C5P A;  3U0D A;  2A5C A;  3POU A;  3SY7 A;  3HOE A;  1VWB B;  1KL3 A;  3PGU A;  4YDB A;  1S2P A;  3T2X A;  5H9N A;  1DZK A;  3ZZV A;  1ZNK A;  3D95 A;  1SWN A;  1K24 A;  2FS7 A;  1YS5 A;  2CM4 A;  3PQU A;  5FEN A;  2JOZ A;  4QGW A;  3NPO A;  1OBQ A;  1VWD B;  4ZHD A;  5KHP A;  1SWH A;  4EEJ A;  4U8U N;  4AZR A;  1ZND A;  2OF9 A;  2OVA A;  3APU A;  3VZW X;  4Y0Q A;  2IWV A;  2L68 A;  3AA1 B;  3AKM A;  3SZI A;  2RN4 A;  2X4M A;  1FJ1 E;  4O4U A;  5G39 A;  1S7D A;  2ZSC A;  3HWF A;  2QOM A;  1OPF A;  2A13 A;  3NX1 A;  4GNW A;  4YCE A;  3UEU A;  3EM0 A;  1MDC A;  4ARH A;  1EPA A;  5FAZ A;  4FBR A;  1GFQ A;  2ACP X;  4N7C A;  2I5Z O;  4NW4 A;  1AVE A;  1FDQ A;  3ZW0 A;  2IFB A;  4YGZ A;  3FR4 A;  2WR6 A;  1SWG A;  4I3C A;  3KVN A;  2OY1 O;  1QJ9 A;  2F1T A;  5DL5 A;  1A57 A;  2FS6 A;  5AJC A;  2BT9 A;  2RTJ A;  3SAO A;  2DJG A;  2YG2 A;  2XKL A;  1IZN B;  4I95 A;  1QG5 A;  2JN3 A;  3PEC A;  2RTI B;  2IZL B;  4XMF A;  1JMX A;  5HCE C;  4D6A A;  3AA1 A;  4AYI D;  3POR A;  4YKO A;  3FA9 A;  2R89 A;  2X46 A;  4FSP A;  4UU3 A;  3T6F A;  2Y7S A;  3S60 A;  4OS3 A;  5BVT A;  1MOY A;  3WZP A;  4LZU A;  4YDA A;  3JCU O;  2XTR A;  1G7N A;  2ALL X;  2OF8 A;  3QRC A;  5EDB A;  1AEL A;  1IFC A;  4ORX A;  1T68 X;  3JSQ A;  2RTK A;  5HZ8 A;  3FIQ A;  1ZHY A;  4CDD A;  1OPA A;  5B29 A;  3BU9 A;  3RE6 A;  2HNX A;  3JQO A;  1PTS A;  5L8I A;  5IO7 A;  1FE3 A;  4XME A;  4BVM A;  4AW8 A;  2L9C A;  4RJX A;  1EQD A;  4GGZ A;  4F4B A;  2RTG B;  4HPC A;  3FYF A;  4FUV A;  2DM5 A;  2RTF B;  5B10 O;  4HPB A;  5KAI O;  4I3D A;  1G5W A;  2E4J A;  4CTD A;  8PRN A;  1W6F A;  2FGS A;  1SWO A;  4ALB A;  1URE A;  1HXL A;  3MM0 A;  2NNQ A;  1TVQ A;  4U9C A;  2A8G A;  2F1C X;  3LK2 A;  2JGS A;  4AKM A;  3P6C A;  4N59 A;  1OSP O;  4JHQ A;  3P6H A;  4EQA C;  3HPE A;  1IJ8 A;  2ZAG A;  1R0U A;  1IFB A;  4XNK A;  1DZJ A;  1YUP A;  4IAB A;  3B2L A;  3EBK A;  1W4T A;  4N58 A;  1SWF A;  1VYG A;  3KFF A;  1DF8 A;  3T2W A;  4IB8 A;  5HTD A;  3F8A A;  3SZJ A;  5LJD A;  4QYN A;  1T16 A;  1JJU A;  1SWA A;  4Z2V A;  1SRF A;  4EDE A;  4GD9 A;  2RTD B;  1RXH A;  1MPF A;  4JO6 A;  3KFI A;  2IZH B;  1HN2 A;  1Q9F A;  4LZV A;  4YCH A;  3TGB A;  2WPU A;  1LKE A;  3D4R A;  3BRZ A;  2AF5 A;  2X8S A;  2QOS C;  1O1V A;  1EI5 A;  1IW2 A;  1LIC A;  5LJC A;  2AH7 X;  1RLB E;  1BLR A;  1NC9 A;  5LKF A;  1DZP A;  4O49 A;  4QGV A;  1D2U A;  3LK2 B;  2R88 A;  4O3Z A;  1YIV A;  4ID2 A;  1ADL A;  1GT4 A;  3FR2 A;  1LIE A;  3UEV A;  4RJW A;  2CBS A;  5LJG A;  3RY2 A;  1HMS A;  2ZFG A;  3EMM A;  3NP1 A;  3GP6 A;  2GTF X;  2AVI A;  2CM9 A;  1ACD A;  4GCP A;  1T8V A;  3D97 A;  3HW9 A;  3TGC A;  4QAE A;  4FZN A;  3B2H A;  3OBL A;  2IZJ A;  2AKQ A;  4LKT A;  1BBP A;  2RD7 C;  2IZA A;  3TZG A;  5H9A A;  3KFH A;  2HZR A;  1MM9 A;  4MVK A;  1SWQ A;  1BT9 A;  4AYM C;  2R56 A;  3LK3 A;  1I4U A;  1NBX A;  4GU8 A;  2RCT A;  1GT1 A;  1JYJ A;  2ERV A;  2X56 A;  3D96 A;  4I6S A;  4ODD A;  2Z4H A;  2IZD B;  1JMZ A;  3K19 A;  3QRA A;  2Y0L A;  1QAB E;  4WFU A;  2R74 A;  1TW4 A;  5AQ6 A;  4RL9 A;  2XE1 A;  1X8N A;  3C77 X;  3RSW A;  2WJQ A;  5DG4 A;  4N74 A;  1LCZ A;  5F58 A;  3RDX A;  2C4I A;  1SWU A;  4ZHG A;  3UAQ A;  1GX3 A;  3L4R A;  1A2D A;  3T6L A;  1VWL B;  4Z28 A;  1CRB A;  4NYQ A;  5IO5 A;  4GNY A;  3SLO A;  2R4P A;  4CV7 A;  3SLJ A;  2OFM X;  2R4O A;  4O3Y A;  5F7G A;  1OEE A;  2ZAI A;  1SXU A;  1ERB A;  3KQ0 A;  2N2L A;  1DV9 A;  2WSJ A;  1GX8 A;  3CKF A;  4QZT A;  5IO6 A;  3HK1 A;  4GHB A;  2KDY A;  2JU7 A;  3WYQ A;  4NLI A;  4GJV A;  4XMD A;  4GET A;  1RXK A;  4BX7 B;  4TLJ A;  3AAA B;  3PH6 A;  3VG5 A;  1FEM A;  5HTE A;  5IRA A;  2K23 A;  1BEB A;  1KFF A;  3P6E A;  4HFO A;  1I04 A;  2IZK A;  2Y32 A;  3FLL A;  5HA0 A;  3STN A;  2IZI A;  3FEP A;  3WJC A;  1ICN A;  4TNN A;  3SOT A;  1VWM B;  5HCD C;  3P24 A;  1E00 A;  2HLV A;  5ADX L;  4GE1 A;  2Y3E A;  1BRP A;  5EDC A;  4U3Q A;  3DSZ A;  1N7Y A;  4L3R A;  4A1H A;  3B2I A;  3POX A;  1DFV A;  1TOW A;  1SLD B;  4YFQ A;  2QO6 A;  1E06 A;  1VWR B;  2WEW A;  3BRY A;  3RKG A;  4KR8 A;  3ZW0 B;  1I78 A;  2CZT A;  3V8U A;  3C76 X;  1G85 A;  1LID A;  1B8E A;  2QO5 A;  2X34 A;  2CAM A;  5H9K A;  1QY1 A;  3RDU A;  1YWB A;  2PRN A;  1SY1 A;  4BGF A;  1CBQ A;  3AUM O;  1LFO A;  1SXY A;  1IZN A;  3TGA A;  1SRJ A;  4WBK A;  4I9S A;  3AAA A;  3VPJ E;  2OYB O;  2KC0 A;  2OVE A;  4ON1 A;  1KZW A;  4UB8 O;  3BSZ E;  2R73 A;  3T20 A;  2IWW A;  2FT9 A;  1MK5 A;  3VGW A;  1HXU A;  1GFN A;  4FRT A;  2AT3 X;  4ZH9 A;  3FYX A;  5L8O A;  1T1L A;  1MEP A;  3KZI O;  1KL4 A;  1EII A;  5T5F A;  4ORU A;  2YPV A;  4GKC A;  3OD9 A;  1QY2 A;  4CDF A;  5HZ6 A;  1BXW A;  2IZF B;  1MX8 A;  5K67 A;  2MJI A;  3CMP A;  4MVL A;  3C78 X;  1ALB A;  4ES7 A;  4LQZ A;  1ICM A;  1X8Q A;  5B5G A;  1KOI A;  4C00 A;  4G76 A;  3EMN X;  1GGL A;  1IIU A;  4MVE A;  5K68 A;  4JFB A;  1NDJ A;  1OSM A;  2OY7 A;  4GUZ A;  2RTR B;  1SWB A;  4JNJ A;  4HPD A;  1JQP A;  2XMX A;  4FQB B;  1VWJ B;  4RLC A;  2L5P A;  2Q2P A;  4N7D A;  2RTP B;  4FMS A;  2LBV A;  1EUO A;  3FEK A;  5E79 O;  4EXZ A;  3HWG A;  3N91 A;  1N43 A;  1LNM A;  1VWO B;  5IXG A;  1SLE B;  2PY1 A;  1N0S A;  1JYD A;  2FWV A;  3VE1 A;  3H3I A;  3ZQ3 A;  1N9M A;  1SY0 A;  3WJB A;  1RAV A;  4AYN A;  4PUX A;  5EPQ A;  3VE2 A;  4ORY A;  3UU2 A;  1NQM A;  2Q4N A;  3F9D A;  1DF3 A;  3CBS A;  2RTN B;  2HMB A;  2AL0 X;  1SWT A;  3MG5 A;  1SWS A;  5H9L A;  3SYS A;  5CSE A;  1SLG B;  3DZM A;  5IRW A;  5F6Z A;  1A3Y A;  1YWD A;  3WZN A;  4BX6 A;  2WWP A;  1RXJ A;  4GZV A;  2HYS A;  2MF6 A;  2FLJ A;  4KR4 A;  4NV8 A;  4AYE C;  2Y2X A;  3DWO X;  1TXL A;  5JD2 A;  1I06 A;  2JQY A;  2OZQ A;  1AQB A;  4RUN A;  2OFB A;  3HWD A;  4OMW A;  4IB6 A;  2KD2 A;  4IMN A;  3WI5 A;  2LBA A;  3CR6 A;  3DTQ A;  1QJ8 A;  4ZGU A;  1GXA A;  1FEN A;  4OS8 A;  4ALO A;  1O8V A;  1LIF A;  4M6S A;  1GT5 A;  1CBR A;  2RA6 A;  2Y3F A;  2K62 A;  2NND A;  2A0A A;  4CPF A;  2JMM A;  2ASN X;  1KZX A;  3QQ2 A;  1ZHW A;  3RDS A;  3P6G A;  4AUI A;  1SY3 A;  1LEL A;  4COT A;  1ZHZ A;  2Q2M A;  4MIS A;  3STM X;  1VWP B;  1BWY A;  4C4V A;  2OL6 O;  2MHL A;  3TZS A;  3PQS A;  1RST B;  3T0S A;  1RBP A;  5FQ7 E;  4ZHC A;  3I17 A;  3RBY A;  2MM3 A;  1B56 A;  3VHI A;  2LFU A;  1G90 A;  4UU2 A;  1OEJ A;  2IZE B;  2QO4 A;  3NBX X;  2C1Q A;  3LK3 B;  3MBT A;  2WJR A;  2F01 A;  4YBP A;  4YKM A;  4AZO A;  5L3Y A;  4ZCB A;  2VFC A;  2XE3 A;  2LFO A;  3NJT A;  1PM1 X;  3U9P C;  1MVG A;  3F6Z B;  1OPB A;  5B2A O;  3FW4 A;  5EE2 A;  3VG6 A;  1W5R A;  1X71 A;  2A3F X;  2QM9 A;  2RTH B;  1XKI A;  1T0V A;  4EFG A;  4IAW A;  3VG4 A;  2QTK A;  5D5D A;  2AT0 X;  2CBR A;  3DA4 A;  3ELZ A;  4ORS A;  2M07 A;  1UYN X;  1K3B A;  3KZA A;  3SY9 A;  4QZU A;  2KW1 A;  1JJJ A;  2HKD A;  4C69 X;  4LKP A;  3G7X A;  1MM4 A;  4GRJ A;  2OMF A;  3VG7 A;  4TKH A;  1SWK A;  4AFK A;  1BSY A;  1Y0G A;  1YWA A;  4BX7 A;  1KGL A;  1OEK A;  2GH7 A;  4CK4 A;  2A2U A;  4HWM A;  1BM5 A;  2NP1 A;  3JTY A;  4G75 A;  2IZG B;  2A2G A;  4TKB A;  2Q9S A;  4E1S A;  1GFP A;  2WVP A;  4B61 A;  4PSQ A;  5B11 O;  4TQ2 A;  3SZD A;  2G78 A;  1O1U A;  2W81 C;  4I9R A;  4YBU A;  1ERX A;  4GGR A;  3D9W A;  3STK A;  3CKG A;  4QNI A;  2AT8 X;  2POR A;  2X27 X;  1P6P A;  3PK2 A;  2G79 A;  3P6D A;  4CPI A;  2O62 A;  3B2K A;  1SXW A;  1SWC A;  1VWF B;  5F6B A;  4XMG A;  3UEW A;  1E02 A;  3JS1 A;  3ZW1 A;  3RBH A;  2QMI A;  4TKJ A;  2KTD A;  3SZH A;  1JJX A;  4YGH A;  4Z3T A;  5G3A A;  2Q39 A;  2P8G A;  2W2B A;  4INN A;  4GJS A;  3BX7 A;  3A0H O;  3FR5 A;  4IMO A;  3HWB A;  5HA1 A;  3FA7 A;  2LB6 A;  4AKR A;  1EXS A;  2RTO B;  3KFG A;  3G7G A;  5B27 A;  1NGL A;  2WUT A;  3APV A;  2RTQ B;  2KXP A;  3O0E A;  5HBS A;  2LA7 A;  1H91 A;  4TJZ A;  4YH0 A;  1Y9T A;  3ZUI A;  4DNE A;  3VHH A;  3HTY A;  4FRX A;  1I05 A;  1HMT A;  3NSG A;  1LDQ A;  3E3C A;  1ZHX A;  1LDO A;  2FGR A;  4E1T A;  3WJG A;  4YGG A;  1QFT A;  1SWL A;  4Y0P A;  3NQ3 A;  3APX A;  1EAL A;  3FEN A;  1A18 A;  3OE3 A;  1WUB A;  1VPR A;  4QYP A;  4GCS A;  3VY8 X;  2LHF A;  4U8U O;  3UPG A;  1NQN A;  1GM6 A;  2ZLD A;  5CYB A;  5HZQ A;  3PPT A;  4Y5D A;  1LIB A;  3KVD D;  1Y55 X;  3T1D A;  4AKR B;  4BCS A;  3APW A;  1UYO X;  3O22 A;  2RTC B;  2R8A A;  2GTL N;  4AYH A;  3VY9 X;  1STP A;  4EKV A;  5AEO A;  1HQP A;  1E5P A;  2J1N A;  4Z2O A;  3MX7 A;  3NAD A;  4FQE A;  1ZNE A;  2LKK A;  3B2J A;  4NYR A;  1YWC A;  3VZU X;  1WBI A;  4YVB A;  3ELX A;  4MVI A;  3O2Y A;  4ZHF A;  2K0L A;  1SWR A;  4N75 A;  5GV0 A;  1U0X A;  2L67 A;  4MIR A;  4GDA A;  3FA6 A;  3WJF A;  1ZHT A;  3NR3 A;  5B5E O;  4Z27 A;  1PBO A;  2UZ2 A;  1JZU A;  1BH3 A;  3NQK A;  4FBV A;  2RCQ A;  1HQQ A;  3PRN A;  2X8F A;  2VDF A;  3A2S X;  4BX6 B;  3K3L A;  3RZY A;  2RTM A;  1OBU A;  5LJB A;  1AB0 A;  1ZNG A;  2YMS A;  1RSU B;  4PR7 A;  5G38 A;  1KQW A;  3PP6 A;  5G26 A;  3VG3 A;  5FQ8 E;  4RUU A;  1KT6 A;  4ORW A;  3WBG A;  5KID A;  4GF4 A;  5LJK A;  3AA7 A;  4O4X A;  2JU3 A;  1MM5 A;  4NNS A;  4A8Z A;  3CBC A;  3LK4 1;  2BSZ A;  5HZ5 A;  1VWA B;  4O4O A;  2JW1 A;  1U18 A;  2IZC B;  5ADX K;  4KII A;  4NV7 A;  3S5X A;  4ZR2 A;  7PRN A;  3EYC A;  5BVS A;  5JDP A;  1FEL A;  4GCQ A;  2X45 A;  1VWI B;  2WQ9 A;  1GKA B;  3WVM A;  1SY2 A;  1THQ A;  5K06 A;  2UYW A;  1AVD A;  4IAX A;  4C4V B;  5H8T A;  4CPE A;  3WI4 A;  1JV4 A;  2AXT O;  5C0N A;  1STR B;  4K3B A;  4QRL A;  5DL6 A;  1HBQ A;  2EU7 X;  3VU1 A;  2OL7 A;  1KL5 A;  3WU2 O;  1L6M A;  1KT4 A;  2FKG A;  4OMX A;  5LKE A;  4PJ0 O;  3FID A;  1CBI A;  3AA0 A;  4A60 A;  4ZFX A;  4JCH A;  3P02 A;  4DQ3 A;  4KCA A;  2Z4I A;  4ZH6 A;  1QFV A;  3FDC A;  1E2T A;  1KXO A;  4BOE A;  4FOZ A;  3BS2 A;  3UEX A;  3AA7 B;  4D6B A;  4IB7 A;  6PRN A;  3BRN A;  2AMM X;  2PI3 O;  3OJY C;  4AZP A;  5F2B A;  4FGI B;  1SLF B;  5DPQ A;  4CPH B;  3CQR A;  2CZU A;  3CWK A;  1XCA A;  1VWE B;  1GKA A;  5FQ6 E;  4OS0 A;  4FBO A;  4DQ4 A;  1X8P A;  2KTS A;  2ODJ A;  3LV4 A;  1ORM A;  3EW2 A;  4K19 A;  1SWP A;  4U8U M;  4BX5 A;  2KZ7 A;  3WZO A;  4R0B A;  4O4S A;  5KIC A;  4CDC A;  1LUQ A;  3EW1 A;  3Q6L A;  4GDZ A;  5EED A;  1E54 A;  5B5F A;  2WEX A;  4Y59 A;  2GTL M;  5GTI O;  2FR2 A;  2F1V A;  3AA0 B;  5LJH A;  1P4T A;  2JMB A;  2BLG A;  1BJ7 A;  5DL7 A;  1BRQ A;  5D47 A;  4FZM A;  4QQ1 A;  3WOV A;  4AZN A;  3O19 A;  1S44 A;  4ZJ0 A;  4FSO A;  2X32 A;  4BJ8 A;  3T24 A;  1U17 A;  4BQU A;  2M4L A;  2MNH A;  3S26 A;  4LSH A;  1HMR A;  3LTW A;  5H2F O;  5TIS O;  3X00 A;  4XNL A;  5HZ9 A;  3DA3 A;  2GJ5 A;  2XTQ A;  1X8U A;  4K3C A;  1HXT A;  1SA8 A;  5HWZ A;  4Z2P A;  4D65 A;  1LCV A;  1AVG I;  4Y0R A;  2G5L A;  3BX8 A;  2WQA E;  2MHD A;  3P6F A;  3IFB A;  3ZW1 B;  2XG6 A;  1UZ2 X;  3FA8 A;  3PDF A;  3RDO A;  3BLG A;  3NQ9 A;  1HY2 A;  2RTL A;  4QGX A;  4BX5 B;  2KZ7 B;  2X9K A;  2K4T A;  4D64 A;  4BBO A;  1FTP A;  4HPA A;  2X8T A;  3PGR A;  1EPB A;  1ZNH A;  4NP1 A;  5L8N A;  2JU8 A;  2BS5 A;  3LHN A;  3C5O A;  3GAQ A;  3A0B O;  1VYF A;  1SXX A;  5BVQ A;  2RTE B;  1SWJ A;  1PRN A;  1GX9 A;  2KXP B;  2BHV A;  3RE5 A;  4LSI A;  4AZQ A;  1KT7 A;  3GE2 A;  4RLB A;  4YFR A;  2QCB A;  4O9S A;  3CQN A;  5D48 A;  2ACO A;  2OFA A;  5IRU A;  5HCC C;  4DCB A;  5D45 A;  3I0A A;  2BS6 A;  1H6S 1;  3WJE A;  1S5L O;  4A1Y A;  2AT6 X;  1JIW I;  4PJ2 A;  3VHM A;  1Y9L A;  5CHK A;  4IB9 A;  2Y0K A;  3VZT X;  1Z24 A;  1LF7 A;  4XMC A;  1YP6 A;  1TOU A;  2OY5 O;  3AEH A;  1MX7 A; 
#chains in the Genus database with same CATH homology
 3NQ3 A;  5BVT A;  2FTB A;  3APX A;  3FEN A;  1EAL A;  3IA8 A;  4LZU A;  4YDA A;  1A18 A;  1CJ5 A;  3OE3 A;  1X89 A;  2XTR A;  1G7N A;  4GHB A;  2ALL X;  1MX8 A;  1VPR A;  1KT3 A;  3QRC A;  2NNE A;  2MJI A;  3CMP A;  4L1N A;  5EDB A;  4QYP A;  1AEL A;  4MVL A;  4GCS A;  3C78 X;  2LHF A;  1IFC A;  3VY8 X;  4ORX A;  1ALB A;  4ML7 B;  1BSO A;  4U8U O;  1T68 X;  3UPG A;  3JSQ A;  4ES7 A;  4LQZ A;  5HZ8 A;  1ICM A;  3FIQ A;  4FZL A;  1ZHY A;  1X8Q A;  1OPA A;  1GM6 A;  1KOI A;  1IKJ A;  2ZLD A;  5B29 A;  3BU9 A;  5CYB A;  5HZQ A;  1GGL A;  3PPT A;  1IIU A;  3EMN X;  4G76 A;  3EBW A;  4MVE A;  2HNX A;  1LIB A;  5HAE A;  3JQO A;  1PHO A;  5L8I A;  3KVD D;  1QY0 A;  4JFB A;  4XMH A;  3T1D A;  5IO7 A;  1OSM A;  4AKR B;  1OBP A;  3S5V A;  1FE3 A;  1NP4 A;  2GC9 A;  3APW A;  3K19 A;  2HZQ A;  5F1E A;  3NX2 A;  4XME A;  3O22 A;  4BVM A;  4HPD A;  4AW8 A;  2L9C A;  2GTL N;  4AZM A;  4RJX A;  2XMX A;  1EQD A;  5DL7 A;  4AYH A;  3VY9 X;  4F4B A;  5AEO A;  4FQB B;  4AYD C;  4HPC A;  3FYF A;  1HQP A;  4FUV A;  2DM5 A;  2L5P A;  4RLC A;  1E5P A;  2Q2P A;  4HPB A;  4N7D A;  2J1N A;  4FMS A;  2LBV A;  4I3D A;  1B0O A;  1EUO A;  3FEK A;  3MX7 A;  1G5W A;  2E4J A;  1EIO A;  4EXZ A;  3HWG A;  3N91 A;  3NAD A;  8PRN A;  4ALB A;  1LNM A;  1ZNE A;  1B4M A;  2LKK A;  3B2J A;  1URE A;  4GH7 A;  4NYR A;  1YWC A;  3VZU X;  3ELX A;  2PY1 A;  2NNQ A;  4MVI A;  3O2Y A;  1TVQ A;  4ZHF A;  4U9C A;  1N0S A;  4ZGF A;  2K0L A;  1JYD A;  2FWV A;  3VE1 A;  3H3I A;  3ZQ3 A;  3LK2 A;  5GV0 A;  1SY0 A;  3WJB A;  1U0X A;  2L67 A;  1IKE A;  4AKM A;  3P6C A;  3FMZ A;  3RBH A;  3MVF A;  4MIR A;  3AAE A;  4N59 A;  3FA6 A;  3P6H A;  3WJF A;  4EQA C;  1ZHT A;  4AYN A;  4M7M A;  3NR3 A;  3AA6 A;  4D5U A;  2ZAG A;  4PUX A;  1R0U A;  5EPQ A;  1KQX A;  2J4U P;  1PBO A;  1JZU A;  1BH3 A;  1GT3 A;  1QWD A;  3VE2 A;  2RQ0 A;  1IFB A;  4ORY A;  3UU2 A;  4XNK A;  1DZJ A;  1YUP A;  2ANS A;  3NQK A;  4ZHH A;  2Q4N A;  4IAB A;  3F9D A;  2F09 A;  1DF3 A;  2OFR X;  3CBS A;  3B2L A;  2RCQ A;  2HMB A;  4FBV A;  2AL0 X;  1PMP A;  3PRN A;  1MUP A;  2X8F A;  5LJE A;  3EBK A;  3A2S X;  4N58 A;  3K3L A;  2AT5 X;  5H9L A;  1ZNL A;  1VYG A;  3KFF A;  4O3W A;  5D8J A;  3RZY A;  4WHI A;  4IB8 A;  5HTD A;  3SYS A;  1OBU A;  3F8A A;  5LJB A;  4IBA A;  1AB0 A;  1ZNG A;  2YMS A;  1YP7 A;  2OVD A;  3BU1 A;  5LJD A;  1KQW A;  3PP6 A;  4QYN A;  3SYB A;  5G26 A;  5FVN A;  5F6Z A;  1A3Y A;  3BY0 A;  3VG3 A;  2FGQ X;  5FQ8 E;  4RUU A;  1KT6 A;  1YWD A;  4ORW A;  5AFU K;  4O3X B;  3WBG A;  2WWP A;  4GZV A;  5KID A;  1HXX A;  4GF4 A;  2N93 A;  2HYS A;  5LJK A;  3AA7 A;  4EDE A;  4O4X A;  2JU3 A;  3PED A;  2FLJ A;  4KC7 A;  4KR4 A;  1MPF A;  1MM5 A;  1NP1 A;  3KFI A;  4NNS A;  4A8Z A;  1HN2 A;  3CBC A;  3LK4 1;  4AYE C;  1Q9F A;  2Y2X A;  5HZ5 A;  4O4O A;  1X8O A;  2JW1 A;  5EEE A;  4LZV A;  1TXL A;  4YCH A;  3ZUO A;  1U18 A;  1I06 A;  3TGB A;  2OZQ A;  5BYP A;  5ADX K;  4NLJ A;  1LKE A;  3D4R A;  2W80 C;  3U03 A;  2Y0H A;  4KII A;  4LSF A;  4FT6 A;  1AQB A;  4RUN A;  3S5X A;  3HWD A;  2XE5 A;  4ZR2 A;  7PRN A;  2X8S A;  2QOS C;  1O1V A;  3EYC A;  3PH5 A;  1EI5 A;  1IW2 A;  5AJB A;  5BVS A;  5JDP A;  4OMW A;  1FEL A;  1LIC A;  2KD2 A;  2X45 A;  4IB6 A;  2WQ9 A;  4IMN A;  5LJC A;  4GCQ A;  3WI5 A;  2LBA A;  2AH7 X;  5JR8 A;  3CR6 A;  3DTQ A;  1RLB E;  1QJ8 A;  4ZGU A;  1GKA B;  1GXA A;  4GK9 A;  1DZP A;  1FEN A;  1SY2 A;  4O49 A;  4OS8 A;  5LKF A;  3WVM A;  1D2U A;  4ALO A;  4QGV A;  5K06 A;  1THQ A;  1O8V A;  3HOL A;  3LK2 B;  4IAX A;  1LIF A;  4M6S A;  1GT5 A;  4O3Z A;  3AAE B;  1CBR A;  2RA6 A;  4YFP A;  2XE2 A;  1YIV A;  1Q9G A;  5H8T A;  4KT5 A;  4ID2 A;  3AA6 B;  3WI4 A;  2K62 A;  1JV4 A;  1ADL A;  3WJD A;  2NND A;  1GT4 A;  2A0A A;  2JMM A;  3FR2 A;  1SMP I;  2ASN X;  1KZX A;  1LIE A;  5C0N A;  1ZHW A;  2F73 A;  3UEV A;  2CBS A;  3P6G A;  5LJG A;  4RJW A;  4AUI A;  1HMS A;  2ZFG A;  1SY3 A;  4KC8 A;  4COT A;  1ZHZ A;  2Q2M A;  4MIS A;  4QRL A;  3EMM A;  3STM X;  1BWY A;  5DL6 A;  1HBQ A;  3NP1 A;  3GP6 A;  2EU7 X;  3VU1 A;  2GTF X;  2CM9 A;  2MHL A;  5FFH A;  1ACD A;  4GCP A;  1L6M A;  3AKN A;  3TZS A;  1KT4 A;  4OMX A;  5LKE A;  2GTL O;  3PQS A;  3ZI8 A;  1QJP A;  1T8V A;  4ORR A;  3SZV A;  1CBI A;  3AA0 A;  3FW5 A;  1KT5 A;  4A60 A;  3T0S A;  4ZFX A;  1RBP A;  2OVS A;  3D97 A;  3HW9 A;  4JCH A;  2XST A;  3TGC A;  5FQ7 E;  3P02 A;  4DQ3 A;  4KCA A;  2Z4I A;  3I17 A;  4ZHC A;  2W2F A;  4ZH6 A;  3RBY A;  3ZW2 A;  4QAE A;  1QFV A;  2N2M A;  2MM3 A;  4FZN A;  3B2H A;  1B56 A;  1G74 A;  3OBL A;  4Y0S A;  1QQS A;  2O4V A;  2LFU A;  1KXO A;  5EZ2 A;  1G90 A;  4BOE A;  2AKQ A;  4FOZ A;  1BSQ A;  1ZRY A;  4UU2 A;  3BS2 A;  4I3B A;  4LKT A;  1BBP A;  3UEX A;  3AA7 B;  5AFU L;  3BDR A;  2RD7 C;  1DZM A;  4NNT A;  4D6B A;  2KXP B;  4IB7 A;  1OEJ A;  6PRN A;  3BRN A;  1JBH A;  1D3S A;  5PRN A;  2QO4 A;  1DC9 A;  3LK4 2;  1PEE A;  3NBX X;  3TZG A;  2AMM X;  3MBT A;  5H9A A;  3LK3 B;  3OJY C;  4YBP A;  4YKM A;  4AZP A;  2KT4 B;  4AZO A;  5DL8 A;  3KFH A;  3RWX A;  4ZCB A;  2G7B A;  2HZR A;  4FGI B;  2XE3 A;  5DPQ A;  4AZL A;  4MVK A;  2LFO A;  1BT9 A;  4AYM C;  2R56 A;  4KRA A;  5CE4 A;  2FR3 A;  3CQR A;  2MO5 A;  2GE4 A;  2CZU A;  1PM1 X;  2YNK A;  3U9P C;  4BUM X;  1GFO A;  3CWK A;  3FEL A;  1MVG A;  1XCA A;  3F6Z B;  4YMY A;  4FES A;  3LK3 A;  1I4U A;  1OPB A;  1GKA A;  1HBP A;  4GU8 A;  3TF6 A;  5FQ6 E;  4OS0 A;  2RCT A;  1GT1 A;  1JYJ A;  5D4A A;  2ERV A;  3FW4 A;  4FBO A;  4DQ4 A;  1X8P A;  3VG6 A;  3ZWE A;  5EE2 A;  2KTS A;  3D96 A;  4I6S A;  4ODD A;  2Z4H A;  3T24 A;  1X71 A;  2A3F X;  2ODJ A;  2POA A;  2QM9 A;  4KH8 A;  5L8N A;  1XKI A;  1T0V A;  4EFG A;  3LV4 A;  4IAW A;  3VG4 A;  1QAB E;  1ORM A;  2Y0L A;  2QTK A;  4WFU A;  4JGL A;  4K19 A;  4CSB A;  3QRA A;  2R74 A;  2W2A A;  5D5D A;  1TW4 A;  2AT0 X;  4U8U M;  5AQ6 A;  2CBR A;  2KZ7 A;  3DA4 A;  3ELZ A;  4ORS A;  2M07 A;  2XE1 A;  4LSE A;  1X8N A;  4R0B A;  4RL9 A;  3C77 X;  4O4S A;  3RSW A;  5DG4 A;  2M06 A;  1GFM A;  5IYU A;  5F58 A;  5KIC A;  3KZA A;  3QKG A;  4ZHG A;  3SY9 A;  3Q6L A;  3POQ A;  4QZU A;  1EW3 A;  1ML7 A;  2KW1 A;  3UAQ A;  1JJJ A;  4GDZ A;  5EED A;  1E54 A;  4WFV A;  4C69 X;  3SY7 A;  4LKP A;  3G7X A;  2WEX A;  4GRJ A;  1MM4 A;  2OMF A;  3L4R A;  1A2D A;  3VG7 A;  4TKH A;  2GTL M;  3WXQ A;  4AFK A;  2FR2 A;  2F1V A;  3AA0 B;  1BSY A;  3VG2 A;  1YWA A;  1CRB A;  4NYQ A;  5IO5 A;  4GNY A;  3HWE A;  1CBS A;  2MWH A;  5LJH A;  1KGL A;  2FRS A;  1OEK A;  1P4T A;  4CV7 A;  1LPJ A;  2BLG A;  2JMB A;  2OFM X;  4O3Y A;  2A2U A;  1BJ7 A;  4HWM A;  1OEE A;  5F7G A;  4CK4 A;  3U0D A;  1BLR A;  2ZAI A;  1BRQ A;  1BM5 A;  5D47 A;  3POU A;  4QQ1 A;  2NP1 A;  1SXU A;  3HOE A;  3WOV A;  4FZM A;  1ERB A;  4YDB A;  1S2P A;  4AZN A;  3KQ0 A;  2N2L A;  1DV9 A;  3JTY A;  4G75 A;  3O19 A;  1S44 A;  1GX8 A;  2WSJ A;  4ZJ0 A;  4FSO A;  4QZT A;  2A2G A;  5H9N A;  5IO6 A;  1DZK A;  3HK1 A;  3ZZV A;  1U17 A;  1ZNK A;  2M4L A;  2JU7 A;  2Q9S A;  3D95 A;  4NLI A;  4BQU A;  4XMD A;  4TKB A;  2KDY A;  4E1S A;  1GFP A;  4GET A;  4B61 A;  2MNH A;  2FS7 A;  4PSQ A;  4TQ2 A;  3S26 A;  1YS5 A;  4TLJ A;  4LSH A;  3SZD A;  1HMR A;  2G78 A;  3AAA B;  1O1U A;  2W81 C;  4I9R A;  3PH6 A;  3VG5 A;  4YBU A;  1ERX A;  1FEM A;  2CM4 A;  4XNL A;  5HTE A;  2K23 A;  5HZ9 A;  3DA3 A;  1BEB A;  3PQU A;  3STK A;  2GJ5 A;  2XTQ A;  1X8U A;  5FEN A;  2JOZ A;  1HXT A;  3P6E A;  4HFO A;  4QGW A;  1SA8 A;  3NPO A;  5HWZ A;  1OBQ A;  1I04 A;  4QNI A;  4ZHD A;  5KHP A;  4D65 A;  2AT8 X;  1AVG I;  2POR A;  4EEJ A;  2X27 X;  4U8U N;  4Y0R A;  3FLL A;  5HA0 A;  1P6P A;  4AZR A;  1ZND A;  3BX8 A;  2WQA E;  2MHD A;  3P6F A;  2G79 A;  3STN A;  3IFB A;  3ZW1 B;  3FEP A;  2XG6 A;  1UZ2 X;  2OVA A;  3APU A;  3VZW X;  3P6D A;  4Y0Q A;  2O62 A;  3WJC A;  2L68 A;  3B2K A;  3FA8 A;  1ICN A;  1SXW A;  3AA1 B;  3AKM A;  4TNN A;  3BLG A;  3NQ9 A;  3SOT A;  5HCD C;  3P24 A;  1E00 A;  2HLV A;  4QGX A;  2KZ7 B;  5ADX L;  5F6B A;  4KR8 A;  4GE1 A;  4XMG A;  1BRP A;  2K4T A;  5EDC A;  4D64 A;  2RN4 A;  3UEW A;  1FTP A;  4HPA A;  1E02 A;  3JS1 A;  2X8T A;  3ZW1 A;  1EPB A;  1ZNH A;  4NP1 A;  2QMI A;  3DSZ A;  4U3Q A;  2JU8 A;  4TKJ A;  2BS5 A;  2KTD A;  4O4U A;  3LHN A;  4L3R A;  3GAQ A;  4A1H A;  3C5O A;  1JJX A;  3B2I A;  1VYF A;  3POX A;  4YGH A;  1DFV A;  1TOW A;  1SXX A;  4Z3T A;  5BVQ A;  4YFQ A;  1S7D A;  2QO6 A;  1E06 A;  2Q39 A;  1PRN A;  2P8G A;  2WEW A;  1GX9 A;  3HWF A;  3RKG A;  2W2B A;  3ZW0 B;  4INN A;  2BHV A;  2A13 A;  2CZT A;  3NX1 A;  4GNW A;  4YCE A;  1OPF A;  3BX7 A;  3UEU A;  3V8U A;  4AZQ A;  4LSI A;  3EM0 A;  1KT7 A;  1MDC A;  3C76 X;  3FR5 A;  4IMO A;  4ARH A;  3HWB A;  3GE2 A;  1EPA A;  5HA1 A;  4RLB A;  1G85 A;  1LID A;  1B8E A;  3FA7 A;  2QO5 A;  4YFR A;  2LB6 A;  4AKR A;  1EXS A;  5FAZ A;  5H9K A;  4FBR A;  1GFQ A;  1QY1 A;  3KFG A;  5B27 A;  2ACP X;  1NGL A;  4O9S A;  3G7G A;  3CQN A;  4N7C A;  1YWB A;  5D48 A;  4NW4 A;  2ACO A;  2PRN A;  1SY1 A;  2WUT A;  5HCC C;  1FDQ A;  3APV A;  5D45 A;  3ZW0 A;  3I0A A;  1CBQ A;  2BS6 A;  1H6S 1;  2KXP A;  3WJE A;  3O0E A;  1LFO A;  1SXY A;  2IFB A;  5HBS A;  1IZN A;  3TGA A;  4YGZ A;  4WBK A;  2LA7 A;  4I9S A;  3AAA A;  3VPJ E;  3FR4 A;  1H91 A;  4A1Y A;  2WR6 A;  2KC0 A;  2OVE A;  4I3C A;  4TJZ A;  4YH0 A;  1Y9T A;  4ON1 A;  2AT6 X;  1JIW I;  1KZW A;  4PJ2 A;  1QJ9 A;  2F1T A;  5DL5 A;  3BSZ E;  1A57 A;  2FS6 A;  5AJC A;  1Y9L A;  2R73 A;  3ZUI A;  3T20 A;  2BT9 A;  2FT9 A;  1HXU A;  4IB9 A;  1GFN A;  3SAO A;  2Y0K A;  4FRT A;  2AT3 X;  4ZH9 A;  3FYX A;  2YG2 A;  2XKL A;  3HTY A;  5L8O A;  1IZN B;  4I95 A;  1I05 A;  4FRX A;  3VZT X;  1QG5 A;  1Z24 A;  2JN3 A;  1HMT A;  3PEC A;  3NSG A;  1EII A;  5T5F A;  1LF7 A;  4XMF A;  4ORU A;  4XMC A;  2YPV A;  5HCE C;  3E3C A;  1YP6 A;  4GKC A;  3OD9 A;  1QY2 A;  4D6A A;  1ZHX A;  2FGR A;  3AA1 A;  4AYI D;  5HZ6 A;  4E1T A;  1TOU A;  3WJG A;  4YGG A;  3POR A;  1QFT A;  4YKO A;  3FA9 A;  4Y0P A;  2X46 A;  1BXW A;  4FSP A;  4UU3 A;  1MX7 A;  2Y7S A;  3S60 A;  4OS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...