3VE1A

The 2.9 angstrom crystal structure of transferrin binding protein b (tbpb) from serogroup b m982 neisseria meningitidis in complex with human transferrin
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
652
structure length
537
Chain Sequence
b'QGGYGFAMRLKRRNWYPGAEESEVKLNESDWEATGLPTKPKELPKRQKSVIEKVETDGDSDIYSSPYLTPSNHVNQPKNQATGHENFQYVYSGWFYKHAASEKDFSNKKIKSGDDGYIFYHGEKPSRQLPASGKVIYKGVWHFVTDTKKGQDFREIIQPSKKQGDRYSGFSGDGSEEYSNKNESTLKDDHEGYGFTSNLEVDFGNKKLTGKLIRNNASLNNNTNNDKHTTQYYSLDAQITGNRFNGTATATDKKENETKLHPFVSDSSSLSGGFFGPQGEELGFRFLSDDQKVAVVGSAKTKDKLSKLTTVLDAVELTLNDKKIKNLDNFSNAAQLVVDGIMIPLLPKDEFTRKFEHTPETKTYEVEVCCSNLNYLKYGMLTRKNQVEQSMFLQGERTDEKEIPTDQNVVYRGSWYGHIANGTSWSGNASDKEGGNRAEFTVNFADKKITGKLTAENRQAQTFTIEGMIQGNGFEGTAKTAESGFDLDRTPKAYITDAKVKGGFYGPKAEELGGWFAYPGDKASSATVVFGAKRQQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transferrin-binding protein 2
publication title The structural basis of transferrin sequestration by transferrin-binding protein B.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transport protein
total genus 136
structure length 537
sequence length 652
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
A PF17483 TbpB_C C-lobe handle domain of Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.240 Mainly Beta Beta Barrel Lipocalin Lipocalin 3ve1A03
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 3ve1A01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 3ve1A04
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 3ve1A02
4O49A 1YS5A 4AYEC 4AYDC 5T5FA 2KC0A 3VE2A 4QQ1A 3HOEA 4O3XB 3PQUA 4Z3TA 4O4XA 2LFUA 4AYMC 3HOLA 3UAQA 4AYNA 4O4UA 2W81C 2YPVA 2KDYA 3VE1A 5EE2A 2W80C 4AYID 2Y7SA 3PQSA 4O3WA 3KVDD 4U9CA 3V8UA 4O3ZA 4O3YA
chains in the Genus database with same CATH superfamily
3VHMA 1SXWA 1P4TA 2OL7A 5HTDA 4B55A 2LFOA 1OSMA 4GNWA 5LJKA 5KICA 4BCSA 1EIOA 4ZHGA 1RAVA 3WZOA 5LJEA 1I06A 2RTDB 2W2BA 3BX7A 5FQ7E 3POQA 1MM5A 2WQ9A 2FTBA 2I5VO 1KT4A 3GAQA 3SZDA 2RCQA 1ZNKA 4ID2A 1TW4A 2HYSA 4CTDA 2LBAA 1BJ7A 1ZHXA 4Y0RA 1A2DA 5JR8A 2RD7C 1FENA 1NP1A 3AA1A 1YWAA 3P6EA 1KL3A 3FENA 4Y0PA 2Y3EA 2XSTA 4AKRA 1X8NA 4ODDA 2RN4A 2OFRX 2CM4A 2CAMA 5PRNA 3OD9A 3QRAA 3UEUA 3SYBA 2L68A 5FQ8E 3RY2A 2ACOA 4C00A 3BY0A 2KZ7A 3RKGA 2OYBO 3RDUA 2QTKA 1A3YA 3AA0B 1AB0A 3D9WA 1LIFA 3PGRA 4O3YA 1BSQA 2RTCB 2Z4IA 4TJZA 2N2MA 3AA6A 2HZQA 2X55A 1N9YA 1YWBA 5HA1A 4I60A 4XNLA 2Q9SA 2HNXA 1QJPA 5KHPA 3CR6A 4INNA 1EIIA 1JMXA 4OS0A 4FT6A 2AL0X 3FYFA 4YCEA 1ZNDA 2LFUA 4R0BA 5LJDA 3UEXA 3FA8A 3AA7B 4CDDA 3MG5A 3HWFA 2XE3A 3ZI8A 1YUPA 1PBYA 4NP1A 1LKEA 2VFBA 1E02A 3LV4A 2FGSA 3X00A 3FA9A 2OF8A 2IZCB 4AZNA 1MUPA 2R4PA 3NBXX 2RTRB 3VG2A 3AAAB 4NW4A 2OY8A 1MEPA 1LUQA 1ICNA 3POUA 5HWZA 1Y9TA 5B5FA 2OFBA 4BX5B 1X8OA 1SWPA 1PHOA 1PBOA 5CE4A 5F6ZA 6PRNA 4KRAA 3SOTA 1Q9FA 3QQ2A 5B27A 2GJ5A 4LKPA 3BU1A 4Y0SA 1LDOA 3BLGA 2MM3A 2WVPA 1STRB 1KFFA 3GP6A 1UREA 4QGWA 1SWAA 1IKEA 4FSOA 4PR7A 4GNYA 4TQ2A 4NYRA 1VWGB 1YWCA 4LKTA 2A13A 4YDBA 4FQEA 4FSPA 4KH8A 4CPEA 3T20A 4IRWA 4U8UN 4BUMX 1AVGI 2DJGA 4JCHA 2O62A 4GGRA 4EFGA 2UYWA 2DM5A 1ZNLA 1OPFA 4D5UA 1VWPB 2PORA 1MX7A 3BX8A 3DA3A 1RLBE 1ZRYA 1E2TA 1T68X 5DL6A 4BBOA 3E3CA 3APUA 4BOEA 4I9RA 5BVSA 3SYSA 4GJSA 2FKGA 4O49A 1BSYA 5LJCA 3DWOX 4JHQA 4GD9A 1DV9A 2RTNB 2OY7A 1AELA 4IBAA 1GKAB 1VYGA 2OY1O 3FR4A 2RTPB 4QYNA 3KFGA 3PQSA 1GFNA 1NQNA 4IMOA 4EKVA 3SLJA 1AQBA 5IO6A 5GTHO 5ADXK 3MM0A 5TISO 3LK41 3KZIO 4C4VB 2WEWA 3D95A 3HWDA 3UPGA 3RDMA 1KT6A 3T2WA 1N9MA 2G7BA 4ZJ0A 4GJVA 3BU9A 1VWHB 4Z3TA 1SRIA 1GT3A 2F1CX 3DZMA 3QKGA 1JQPA 5K06A 4HWMA 5HCEC 4M6SA 1IZNA 2XG6A 2IZDB 3EBKA 1DF8A 4FUVA 4AZMA 3KZAA 3NQ3A 2JW1A 3EBWA 2AT5X 3WBGA 4LQZA 2RTJA 1WUBA 4KCAA 4MISA 1KGLA 2AKQA 5B5GA 1LCVA 4K3CA 3T24A 3WJCA 2NNQA 3WJBA 1KZXA 3STKA 3C5OA 2GC9A 1BXWA 3EW2A 2J1NA 2W81C 2K23A 2L9CA 1VWBB 4UU2A 1CJ5A 2ERVA 3G7GA 3OE3A 2Y0KA 1MOYA 4HPDA 4KIIA 4ORXA 1OPAA 4YBUA 3VGWA 5KAFO 4LZUA 3U9PC 2FR2A 2QO4A 4D64A 3ZW2A 3OJYC 3SAOA 3PDFA 2VDFA 3NQ9A 5AFUL 3H3IA 3C78X 1MM9A 4RLBA 4AYHA 4A8ZA 1CBRA 3D97A 3CKFA 1A57A 4GK9A 1LCWA 3VZWX 4QGVA 4IB8A 4A60A 4BQUA 2YNKA 4AZQA 4U3QA 1GFPA 1X8QA 2JGSA 4ARHA 2UZ2A 2MHDA 3S26A 2KXPA 3I17A 3AUMO 4YMYA 2F01A 1H6S1 2XTQA 4RUNA 3VHIA 2P8GA 1HMRA 2RCTA 3LK2B 5H8TA 4WHIA 2KT4B 1TVQA 3ZW0B 5C0NA 3AKNA 4WFVA 1SWBA 2RTMA 1HN2A 3CQNA 1PMPA 3TF6A 4CK4A 4AYDC 4JO6A 2FT9A 4RJXA 1RXHA 1Q9GA 1GXAA 4UB8O 2HLVA 3S5XA 3BS2A 5DL8A 1CBIA 1G85A 4Y5DA 2MHLA 3NX1A 2LKKA 2R74A 1GX9A 3AAEA 3NJTA 3WYPA 1GFQA 2F73A 4LSIA 1QJ8A 3KFHA 2KTSA 1QY0A 1CBQA 1I4UA 5FQ6E 4LSHA 3LK3B 4GETA 1Y53X 2GTLN 5H9AA 4CPHA 2R4NA 4XMEA 5EDBA 3HWGA 3A2SX 3EMNX 4OMWA 1VWKB 5HCCC 1T16A 4D65A 4GHBA 2X8TA 5HZ6A 1JV4A 4K19A 5EEEA 2BSZA 4ZHHA 1N0SA 2AF5A 3T6LA 7PRNA 2MF6A 5LKEA 5HZ5A 1SLEB 3VY9X 4DNEA 2R4LA 2AMMX 3SY7A 4O3WA 4Z2VA 1I78A 5LJGA 1BRPA 2BLGA 2K62A 2G5LA 2MWHA 4JNJA 1B8EA 2QOSC 4YH0A 1EPAA 3ZUIA 4YBPA 5G39A 4ML7B 1DZPA 2Q39A 2JU8A 3FW5A 1HBQA 1RBPA 4RUUA 4E1TA 3S5VA 2RTBB 4COTA 1IJ8A 5DL7A 4AYMC 1NC9A 2X46A 2AT3X 3L4RA 3P6FA 1I04A 3RE6A 5KIDA 1S7DA 3B2LA 1HMSA 4DQ3A 2BHVA 2WUTA 1OEJA 2FS6A 2N2LA 3B2IA 2JMMA 3PP6A 5GV0A 1GX8A 1SWKA 5F6BA 4GKCA 4YKMA 3P24A 1G90A 2X32A 1X71A 1ERBA 2HZRA 3PRNA 3BSZE 4ALOA 1QFVA 1RSUB 1P6PA 3RDSA 3PGSA 1THQA 1R0UA 1G74A 2ACPX 2RA6A 4UU3A 4KR8A 1SA8A 4GE1A 4RJWA 4G75A 3QRCA 1VWEB 2Y7SA 1KQWA 1I9HA 2FHNX 1FDQA 3DA4A 2R56A 3T2XA 3AA0A 5AFUK 2A5BA 4YDAA 5HZQA 1SWSA 1SXYA 3A0HO 1VWMB 3P6CA 3BRNA 1EXSA 3T1DA 1ZNEA 5BVQA 4HPBA 1Y52X 5D45A 3ELXA 3FEKA 3WJFA 5B3MO 1OSPO 3NQKA 1G7NA 1E06A 1JYJA 3O2YA 3NPOA 3PGUA 4ZHFA 1TOUA 1VWLB 5IO7A 3IFBA 1VWJB 1SWQA 2OL8O 5AJCA 3AA7A 4Y0QA 3WVMA 1O8VA 1SRFA 1XCAA 3SZHA 3PK2A 1BSOA 1EW3A 1ALBA 3APWA 3WXQA 2A2UA 1HXTA 2X27X 3P6DA 4PSQA 4YCHA 1ML7A 2RTKA 2R4OA 3LK42 1BWYA 2FHLA 1MM4A 3AAAA 3WOVA 1O1UA 1VWAB 4YGZA 3B2JA 4OKAA 4N59A 4AZRA 4GRJA 2QO6A 4YGGA 1BEBA 4BX5A 1W4TA 3VU1A 1NDJA 3P6GA 3G7XA 4O3ZA 1QABE 4ZHCA 3SLTA 3RBYA 4I9SA 3VE2A 1SY0A 1VYFA 3FMZA 3EMMA 3TGCA 1NBXA 1FTPA 3O0EA 1O1VA 1MPFA 5BYPA 3HPEA 4FZMA 4I3DA 1PTSA 4OEMA 3SZIA 2XKLA 1DZMA 2KW1A 1SY2A 2O4VA 3APVA 2C1SA 1PEEA 2WEXA 5HZ8A 1IW2A 1HXXA 2OMFA 2C4IA 3VG5A 4MVKA 1UYNX 1LCZA 4WFUA 3D96A 4U9CA 3WJEA 4BX6B 5B29A 3U03A 2QO5A 2YG2A 1Y0GA 4AZPA 3SY9A 2XE1A 3FA6A 4AW8A 2JN3A 3JTYA 4FBRA 4N75A 4CDFA 4QZTA 2MNHA 3BRZA 3SLOA 2CZTA 2WWPA 3VY8X 4ZCBA 5H2FO 1SLFB 4ORSA 2R8AA 3KQ0A 4QZUA 4ORYA 4O4XA 3UAQA 1LICA 4O4SA 2IZBA 4GGTA 1SRGA 2XTRA 3VHHA 1XKIA 3F6ZB 3VPJE 2N93A 4E1SA 3MBTA 3WZPA 3WI4A 2NNEA 3ZUOA 3VG6A 1BT9A 1YIVA 2OVAA 4I3BA 2PRNA 1TXLA 1N7YA 3PORA 1W5RA 3O22A 2ASNX 2NP1A 2IWVA 2FLJA 1Y55X 1KT3A 2WJRA 3RWXA 4B61A 4C4VA 1SY1A 1E5PA 1GM6A 2L5PA 4IABA 4I95A 4IB6A 2A3FX 1EI5A 3KFFA 1KZWA 1AVDA 4DQ4A 2F1TA 1E54A 1SXXA 1VYOA 3NSGA 4Y59A 3AEHA 3STMX 3RSWA 2ANSA 4YFRA 2X4MA 4XMCA 1RXJA 1LPJA 1SWRA 4GZVA 2M07A 2JU7A 4QRLA 1SWEA 4K3BA 2JMBA 3TZSA 2Q2MA 1RSTB 2W80C 2IZAA 1W6FA 2RTGB 5H9LA 4NNTA 4I3CA 2Z4HA 1E00A 1GX3A 4FMSA 3HOEA 3FDCA 5DPQA 4FBVA 5AJBA 4GUZA 1STSB 2RTLA 2LBVA 3POXA 4AZOA 2ALLX 3FIQA 5IRUA 4Z27A 4ZGUA 3V8UA 5FFHA 4FRTA 1KT7A 5B2AO 3UEVA 2KD2A 5D4AA 2FS7A 2IZLB 2KDYA 4CPIA 2ZLDA 5F1EA 2FR3A 4FRXA 2WR6A 1QQSA 3CMPA 1SWOA 1SWGA 1U17A 5GTIO 1G5WA 3F9DA 2RTOB 1B0OA 4O3XB 4MVIA 2ZAGA 1UYOX 2G8CO 3ZW1B 1B4MA 1D2UA 3NP1A 1BM5A 1S2PA 1S44A 1FJ1E 1VWFB 4TNNA 4FESA 2LA7A 4HPAA 2POAA 2IZKA 4XMGA 4GCPA 3NX2A 3AAEB 1TOWA 2GH7A 1BH3A 5BVTA 4FQBB 1OEEA 5EPQA 2JOZA 3HOLA 2Y0LA 5D8JA 5FVNA 4EEJA 2YPVA 1ICMA 1VWQB 1VWDB 1UZ2X 3LK2A 2A8GA 4BX7B 3P02A 5H9KA 2CZUA 2IZEB 3FIDA 4Z2OA 3ZW0A 1H91A 4CDEA 3U0DA 1VWCB 2MO5A 3VE1A 3VG3A 5E79O 3IA8A 1FELA 4NV8A 2IZGB 4GH7A 2K0LA 2X56A 3FR5A 3P6HA 5HBSA 2ZSCA 4QGXA 2KC0A 5D47A 3KFIA 5K68A 4ZH9A 1JJJA 3OBLA 2M06A 3K3LA 2QCBA 2GTFX 3PPTA 4ZH6A 1ORMA 4YKOA 3WJGA 3LK3A 1QWDA 1KXOA 5EEDA 1BBPA 3O19A 2DJFA 1U0XA 4ON1A 3RBHA 2ZAIA 1OEKA 3T6FA 2Q2PA 5IXGA 1IKJA 3B2HA 4ORUA 4TKJA 5HAEA 1DZKA 3AA1B 2RTHB 5D5DA 2A0AA 1A18A 4AKRB 1ZNHA 3I0AA 4OS8A 3APXA 3RDOA 3SZJA 4YFPA 3JS1A 1I05A 2CBRA 4PJ2A 2BT9A 1VWNB 1YP7A 1SWUA 1DZJA 5IRAA 1LDQA 2IZIA 2WSJA 4Z28A 1T8VA 1SWLA 4NYQA 1QG5A 4AFKA 1ZNGA 3BDRA 2KZ7B 5B5EO 5L8OA 1CRBA 4EDEA 1SXUA 1GT4A 5HZ9A 2IWWA 3F8AA 2RQ0A 4U8UO 2HMBA 3KVNA 3RDQA 1OBPA 4I6SA 1GT5A 4AUIA 4U8UM 3AA6B 3TZGA 5ADXL 4CPFA 8PRNA 2Y32A 4LZVA 4IB7A 2VFCA 2R89A 4IMNA 4M7MA 3UEWA 2BC3A 4ZHDA 3PH6A 4GF4A 4FZLA 2QOMA 4C5PA 1FE3A 2G79A 2NNDA 5L3YA 3A0BO 2AT0X 4HFOA 4CSBA 2KTDA 4IB9A 1KT5A 5L8NA 5IYUA 4ZFXA 1SMPI 2FGRA 3DSZA 2F09A 5EE2A 2E4JA 2AXTO 4N58A 1GFOA 1SWCA 1YWDA 3NADA 4WBKA 3VZUX 4JFBA 4GGZA 5IO5A 5FAZA 2IZFB 5G38A 2RTAA 3LTWA 1YS5A 3HK1A 4KC8A 4D6BA 1RXKA 5H9NA 4TKBA 2JU3A 3RZYA 2MJIA 4FBOA 4F4BA 2FWVA 5B66O 1JJXA 1ACDA 2Q4NA 1D3SA 3WU2O 4TKHA 2JQYA 3D4RA 3T0SA 2QM9A 1JMZA 1SREA 1SY3A 2GE4A 5EDCA 4NNSA 1JBHA 4FOZA 1LELA 1LIBA 1SWFA 5LJBA 4JGLA 2LHFA 3GE2A 4BGFA 5F2BA 1LNMA 4LSFA 3RE5A 5G3AA 4N74A 3K19A 1Y9LA 1CBSA 2CM9A 3FLLA 3TGBA 2WJQA 1SWNA 5HA0A 1ZHZA 3Q34A 1HXZA 3WYQA 4OMXA 5DG4A 2AVIA 4ZGFA 5B11O 4XMHA 5B10O 4G76A 2OVDA 2OZQA 4PUXA 4ORWA 3BRYA 4N7DA 2FGQX 4AYID 3DTQA 1JIWI 1WBIA 3HW9A 5EZ2A 2ODJA 3EW1A 2YMSA 3PF1A 2RTEB 1LIEA 1N43A 3HTYA 1BRQA 4AYNA 5LKFA 1K3BA 1JZUA 3C77X 2OVEA 5LJHA 3DWNA 3EYCA 3NR3A 4O9SA 1HXUA 1ZHYA 3CBCA 5HCDC 1MDCA 1X8UA 2A5CA 4OS3A 3ZQ3A 2Y3FA 2RTIB 1EQDA 3N91A 4O4UA 2AH7X 2IFBA 3FA7A 1VPRA 2W2FA 1EALA 1KL5A 1LIDA 1FEMA 2HKDA 3B2KA 2X34A 5L8IA 5CHKA 2BS6A 4D6AA 1SWHA 4QQ1A 2OVSA 1NQMA 1ADLA 4QYPA 4U46A 5CYBA 2L67A 4PJ0O 4BX6A 4EQAC 3JQOA 4IAWA 3RDXA 1HBPA 3PEDA 4QAEA 5F58A 4UB6O 2BS5A 3FW4A 4TLJA 1GKAA 1IFCA 4YVBA 1IZNB 5T5FA 1QY2A 1SWJA 1U18A 1PRNA 1AVEA 4CV7A 4MVLA 3BS0A 3FELA 1OBQA 3PH5A 3PECA 1SRJA 4RLCA 1X8PA 4ORRA 1MK5A 3ZWEA 3HWEA 2QMIA 2LB6A 3EC5A 2GTLO 4ZR2A 5DL5A 2EU7X 4NLIA 1BLRA 1S5LO 4KT5A 1T1LA 4AZLA 1LF7A 3MVFA 1JYDA 2A2GA 3HWBA 2GTLM 2RTQB 2W2AA 2R88A 4BJ8A 5FENA 3SZVA 4AKMA 1DFVA 1HY2A 3WJDA 4IL6O 2F1VA 4GDAA 3S60A 1NP4A 4MEEA 1GFMA 2AT8X 2OL6O 4GCQA 2K4TA 5IRWA 2Y2XA 3WZNA 1K24A 1DF3A 3CWKA 2XMXA 4L3RA 5AEOA 3ZZVA 3VZTX 4DCBA 4GCSA 1KQXA 5HTEA 3CBSA 4QNIA 4HPCA 1Z24A 1IIUA 5AQ6A 1HQPA 1GGLA 1SLGB 4OELA 2PY1A 3AKMA 2OFMX 1HXLA 2RTFB 3PQUA 4O4OA 1GT1A 1X89A 2OY5O 1KOIA 1ZHTA 2X8SA 2X8FA 1QY1A 2FRSA 4BVMA 1SWTA 3WI5A 3JCUO 3Q6LA 4L1NA 2XE2A 2PI3O 2X9KA 1B56A 1QFTA 2KXPB 2XE5A 3FYXA 5JDPA 4ALBA 1JJUA 1IFBA 1L6MA 3FR2A 1HQQA 1N4JA 2IZHB 4IAXA 5D48A 4RL9A 4NV7A 4AYEC 3LHNA 5K67A 4CDCA 4C69X 2AT6X 2I5ZO 3ELZA 4MIRA 3WZQA 2ZFGA 2FKJA 1PM1X 5KAIO 3MX7A 3CKGA 1LFOA 1YP6A 5CSEA 1EPBA 1VWOB 4FZNA 1VWIB 4A1HA 1DC9A 2J4UP 4MVEA 3EM0A 1KL4A 3UU2A 4XMDA 2R73A 3FEPA 2C1QA 2OF9A 1NGLA 4GDZA 1SWDA 1T0VA 4CPHB 1OPBA 1MX8A 4N7CA 1VWRB 2G78A 4LSEA 3KVDD 1SRHA 3ZW1A 3TGAA 4A1YA 2M4LA 1QJ9A 3VG7A 4XMFA 2IZJA 4NLJA 2OFAA 1HMTA 4KR4A 1EUOA 2CBSA 2Y0HA 1OBUA 5G26A 2WPUA 4KC7A 1ERXA 3CQRA 4Z6JA 4XNKA 1ZHWA 3JSQA 5JD2A 3VG4A 4FGIB 4Z2PA 1SLDB 3STNA 1MVGA 2WQAE 3RY1A 4BX7A 4EXZA 5F7GA 4ES7A 1STPA 3C76X 4GU8A 2X45A 4YGHA 4YFQA
chains in the Genus database with same CATH topology
2QO5A 2YG2A 1SXWA 4HPDA 1YS5A 1P4TA 4AZPA 3SY9A 3HK1A 5HTDA 1OSMA 2LFOA 4KIIA 4ORXA 2XE1A 3FA6A 4KC8A 4D6BA 4GNWA 1OPAA 4AW8A 5LJKA 4YBUA 2JN3A 3JTYA 4FBRA 5H9NA 5KICA 4TKBA 4QZTA 2JU3A 3RZYA 1EIOA 4LZUA 3U9PC 2MNHA 2FR2A 2QO4A 4D64A 2MJIA 4FBOA 4F4BA 4ZHGA 2FWVA 2CZTA 3ZW2A 2WWPA 3VY8X 5LJEA 3OJYC 1I06A 3SAOA 1JJXA 1ACDA 4ZCBA 2Q4NA 3NQ9A 2W2BA 3BX7A 5FQ7E 3POQA 5AFUL 1D3SA 1MM5A 4GCPA 4ORSA 3H3IA 3C78X 4TKHA 3D4RA 2WQ9A 3T0SA 4RLBA 2FTBA 2QM9A 3KQ0A 4QZUA 4A8ZA 4ORYA 4AYHA 1CBRA 4O4XA 1SY3A 3D97A 3UAQA 1A57A 2GE4A 1KT4A 4GK9A 5EDCA 4NNSA 1LICA 4O4SA 1JBHA 3GAQA 4FOZA 3SZDA 2RCQA 1ZNKA 4ID2A 1LIBA 3VZWX 4QGVA 4IB8A 4A60A 4BQUA 2YNKA 2XTRA 4AZQA 4JGLA 5LJBA 2LHFA 4U3QA 1GFPA 1XKIA 1TW4A 1X8QA 3F6ZB 2HYSA 1LNMA 3GE2A 3VPJE 4ARHA 2N93A 4E1SA 4LSFA 3MBTA 2MHDA 2LBAA 1BJ7A 1ZHXA 3S26A 4Y0RA 2NNEA 3I17A 3ZUOA 2KXPA 3K19A 3WI4A 4YMYA 1A2DA 3VG6A 1BT9A 1YIVA 5JR8A 1Y9LA 2RD7C 1CBSA 1FENA 1NP1A 1H6S1 1YWAA 3AA1A 2OVAA 4I3BA 2PRNA 3P6EA 1TXLA 2CM9A 3FLLA 4RUNA 3TGBA 2P8GA 2XTQA 1HMRA 2RCTA 3FENA 4Y0PA 4AKRA 2XSTA 3PORA 3LK2B 5HA0A 1X8NA 4ODDA 2RN4A 4WHIA 2OFRX 2KT4B 5H8TA 2N2LA 1TVQA 1ZHZA 3O22A 2ASNX 3ZW0B 2NP1A 5C0NA 3AKNA 4WFVA 2CM4A 3LK41 1HN2A 5PRNA 2FLJA 3CQNA 1PMPA 1KT3A 3OD9A 3QRAA 3RWXA 4OMXA 3TF6A 3UEUA 5DG4A 4B61A 4CK4A 1SY1A 4AYDC 1E5PA 1GM6A 2FT9A 2L5PA 3SYBA 2L68A 5FQ8E 4ZGFA 4RJXA 1Q9GA 4XMHA 1GXAA 2ACOA 2HLVA 4IABA 3S5XA 4G76A 3BY0A 2OVDA 2OZQA 4PUXA 4ORWA 3BS2A 2KZ7A 5DL8A 4I95A 1CBIA 3RKGA 1G85A 2MHLA 3NX1A 2LKKA 2R74A 4IB6A 1GX9A 4N7DA 2FGQX 4AYID 3DTQA 2A3FX 1JIWI 3AAEA 1EI5A 3KFFA 2QTKA 1KZWA 1GFQA 4LSIA 2F73A 1QJ8A 1A3YA 3AA0B 4DQ4A 2F1TA 3KFHA 3HW9A 5EZ2A 2ODJA 1AB0A 2KTSA 2YMSA 1QY0A 1E54A 1CBQA 1SXXA 1I4UA 3NSGA 1LIFA 5FQ6E 4O3YA 1BSQA 2Z4IA 4TJZA 1LIEA 4LSHA 3LK3B 3STMX 4GETA 3RSWA 2ANSA 2GTLN 5H9AA 4YFRA 2N2MA 3HTYA 4XMCA 1BRQA 4DQ3A 1LPJA 4XMEA 5EDBA 4GZVA 3AA6A 2M07A 4AYNA 2HZQA 5LKFA 3HWGA 1JZUA 3A2SX 2JU7A 3C77X 2OVEA 4QRLA 5LJHA 1YWBA 3EMNX 4OMWA 5HCCC 5HA1A 2JMBA 3TZSA 4D65A 2Q2MA 3EYCA 2W80C 3NR3A 4GHBA 4O9SA 1HXUA 1ZHYA 4XNLA 2Q9SA 2HNXA 2X8TA 1QJPA 5KHPA 5HZ6A 3CR6A 3CBCA 4INNA 1JV4A 4K19A 5EEEA 5HCDC 5H9LA 4ZHHA 1N0SA 4I3CA 4NNTA 1EIIA 2Z4HA 1MDCA 1E00A 1X8UA 4FMSA 4OS0A 4OS3A 2AL0X 4FT6A 7PRNA 3FYFA 3HOEA 3ZQ3A 4YCEA 1ZNDA 5DPQA 2LFUA 1EQDA 5LKEA 4R0BA 5HZ5A 3N91A 4O4UA 5LJDA 2IFBA 2AH7X 3UEXA 3FA8A 3AA7B 3FA7A 4FBVA 1VPRA 2W2FA 1EALA 3VY9X 1LIDA 3HWFA 5AJBA 2XE3A 1FEMA 3B2KA 2LBVA 3POXA 4AZOA 2AMMX 3ZI8A 2ALLX 3FIQA 3SY7A 4O3WA 5L8IA 1YUPA 4NP1A 1LKEA 5LJGA 1BRPA 2BLGA 2MWHA 2K62A 3V8UA 4ZGUA 1E02A 3LV4A 5FFHA 1B8EA 2QOSC 4FRTA 2BS6A 3FA9A 4D6AA 4YH0A 1KT7A 1EPAA 4QQ1A 2OVSA 4QYPA 1ADLA 3UEVA 2KD2A 3ZUIA 4AZNA 5CYBA 4YBPA 5D4AA 1MUPA 2L67A 2FS7A 2KDYA 3NBXX 4ML7B 3VG2A 4EQAC 1DZPA 3JQOA 4IAWA 2Q39A 2ZLDA 3AAAB 1HBPA 2JU8A 3FW5A 4NW4A 5F1EA 2FR3A 4FRXA 2WR6A 1QQSA 3PEDA 4QAEA 1HBQA 3CMPA 5F58A 1RBPA 2BS5A 3FW4A 4RUUA 4E1TA 1U17A 4TLJA 1ICNA 3POUA 1GKAA 1G5WA 3F9DA 1IFCA 3S5VA 5HWZA 1Y9TA 1IZNB 4COTA 5T5FA 5DL7A 1B0OA 1QY2A 4O3XB 1U18A 1PRNA 4MVIA 2ZAGA 1X8OA 4AYMC 4CV7A 4MVLA 3ZW1B 1B4MA 1D2UA 3NP1A 3FELA 2X46A 1OBQA 3PH5A 1BM5A 1S2PA 1PHOA 2AT3X 3L4RA 3PECA 1PBOA 5CE4A 3P6FA 5F6ZA 1I04A 4RLCA 1X8PA 6PRNA 5KIDA 4ORRA 4KRAA 1S44A 1S7DA 4TNNA 3ZWEA 3HWEA 4FESA 2LA7A 3B2LA 3SOTA 1Q9FA 2QMIA 4HPAA 1HMSA 2POAA 2BHVA 2LB6A 5B27A 2GJ5A 2WUTA 4LKPA 4XMGA 2GTLO 2FS6A 1OEJA 3BU1A 3NX2A 4Y0SA 3B2IA 3BLGA 2MM3A 2EU7X 3PP6A 4ZR2A 2JMMA 4NLIA 1BLRA 3AAEB 5DL5A 5GV0A 1TOWA 1GX8A 1BH3A 3GP6A 5BVTA 1UREA 4FQBB 4KT5A 4AZLA 1OEEA 5F6BA 1LF7A 5EPQA 2JOZA 3HOLA 2Y0LA 3MVFA 4QGWA 1JYDA 5D8JA 5FVNA 4EEJA 2A2GA 3HWBA 2YPVA 4GKCA 2GTLM 1ICMA 4YKMA 1IKEA 4FSOA 2W2AA 5FENA 3P24A 1G90A 1X71A 3SZVA 4GNYA 4AKMA 1UZ2X 1ERBA 4TQ2A 1DFVA 4NYRA 1YWCA 4LKTA 2HZRA 3WJDA 3BSZE 3PRNA 2A13A 4ALOA 4YDBA 2F1VA 4FSPA 1QFVA 3S60A 1P6PA 3LK2A 1NP4A 3P02A 5H9KA 1GFMA 2AT8X 2CZUA 3ZW0A 1H91A 3U0DA 1THQA 2K4TA 4KH8A 4GCQA 1R0UA 2Y2XA 1DF3A 1G74A 3T20A 2ACPX 2RA6A 4UU3A 3CWKA 2XMXA 4KR8A 1SA8A 4GE1A 4L3RA 2MO5A 5AEOA 4U8UN 4RJWA 3VE1A 4BUMX 1AVGI 3VG3A 3ZZVA 4G75A 3VZTX 3QRCA 3IA8A 2Y7SA 1FELA 4JCHA 1KQWA 4GCSA 1KQXA 5HTEA 4GH7A 2O62A 1FDQA 3CBSA 4QNIA 4HPCA 2K0LA 1Z24A 1IIUA 3P6HA 3FR5A 5AQ6A 1HQPA 5HBSA 1GGLA 4EFGA 4QGXA 3DA4A 2PY1A 2R56A 2DM5A 3AKMA 2OFMX 2KC0A 1ZNLA 5D47A 1OPFA 3KFIA 4D5UA 3PQUA 4O4OA 1GT1A 4ZH9A 2PORA 1X89A 1JJJA 3OBLA 3AA0A 5AFUK 4YDAA 2M06A 3K3LA 1KOIA 1MX7A 5HZQA 1ZHTA 2GTFX 3BX8A 3PPTA 3DA3A 1SXYA 1RLBE 4ZH6A 2X8SA 1ZRYA 4YKOA 2X8FA 1ORMA 3WJGA 3P6CA 3LK3A 1QWDA 1QY1A 1T68X 5DL6A 2FRSA 3E3CA 1KXOA 3BRNA 4BVMA 3APUA 1EXSA 4I9RA 5EEDA 5BVSA 3T1DA 4BOEA 1ZNEA 5BVQA 1BBPA 3O19A 4HPBA 5D45A 3SYSA 3ELXA 3WI5A 1U0XA 3FEKA 4ON1A 3RBHA 3WJFA 4O49A 1BSYA 3Q6LA 4L1NA 5LJCA 2XE2A 3NQKA 1DV9A 2ZAIA 1OEKA 1AELA 1B56A 4IBAA 2Q2PA 1IKJA 1QFTA 3B2HA 4ORUA 1GKAB 1VYGA 4TKJA 3FR4A 5HAEA 1G7NA 2KXPB 1E06A 2XE5A 1JYJA 3FYXA 3O2YA 3NPOA 5JDPA 1DZKA 4ZHFA 1TOUA 4ALBA 3AA1B 1IFBA 4QYNA 5D5DA 1L6MA 2A0AA 3KFGA 3PQSA 3FR2A 1A18A 1GFNA 4AKRB 1ZNHA 3I0AA 4OS8A 3APXA 5IO7A 5D48A 4IAXA 4IMOA 3IFBA 4YFPA 4RL9A 5AJCA 3JS1A 3AA7A 4Y0QA 3WVMA 1I05A 4AYEC 1O8VA 1XCAA 2CBRA 3LHNA 2BT9A 4PJ2A 1AQBA 5IO6A 1YP7A 5ADXK 1DZJA 4C69X 2AT6X 3ELZA 4MIRA 1BSOA 2ZFGA 1EW3A 1ALBA 1PM1X 3APWA 2A2UA 3WXQA 2WEWA 1HXTA 2X27X 3P6DA 4PSQA 3MX7A 2WSJA 3D95A 3HWDA 1T8VA 1LFOA 4NYQA 1QG5A 1YP6A 4AFKA 4YCHA 3UPGA 1ZNGA 3BDRA 1EPBA 1KT6A 1ML7A 2KZ7B 3LK42 4FZNA 4A1HA 5L8OA 1DC9A 2G7BA 1BWYA 4ZJ0A 1CRBA 4EDEA 1SXUA 1GT4A 3BU9A 5HZ9A 1MM4A 2J4UP 3AAAA 3WOVA 4Z3TA 3F8AA 1O1UA 4MVEA 2RQ0A 1GT3A 4U8UO 3EM0A 3UU2A 2HMBA 4YGZA 4XMDA 3QKGA 3B2JA 2R73A 3FEPA 1OBPA 4I6SA 5K06A 4HWMA 1NGLA 5HCEC 4GDZA 1GT5A 4N59A 4M6SA 4AZRA 4GRJA 4AUIA 1IZNA 1T0VA 1OPBA 4N7CA 1MX8A 2QO6A 4YGGA 3EBKA 1BEBA 4U8UM 2XG6A 4FUVA 3AA6B 3TZGA 2G78A 4LSEA 3KVDD 3VU1A 5ADXL 4AZMA 3ZW1A 3P6GA 3KZAA 3G7XA 3TGAA 3NQ3A 4A1YA 2JW1A 1QABE 4O3ZA 8PRNA 2M4LA 4ZHCA 4LZVA 1QJ9A 4IB7A 3EBWA 3RBYA 2AT5X 3VG7A 4XMFA 4I9SA 4LQZA 3WBGA 4NLJA 3VE2A 4IMNA 4M7MA 1SY0A 3UEWA 4KCAA 1HMTA 1VYFA 4ZHDA 4KR4A 4MISA 1EUOA 3PH6A 3FMZA 3EMMA 2CBSA 4GF4A 4FZLA 3TGCA 1KGLA 2Y0HA 1OBUA 1FE3A 1FTPA 2AKQA 2G79A 2NNDA 5G26A 4KC7A 3T24A 3O0EA 1ERXA 3WJCA 2AT0X 2NNQA 1O1VA 1MPFA 5BYPA 4HFOA 3WJBA 3CQRA 4FZMA 4I3DA 4CSBA 1KZXA 4XNKA 1ZHWA 2XKLA 3JSQA 3STKA 3C5OA 1DZMA 2KW1A 1SY2A 3VG4A 2KTDA 4FGIB 2O4VA 4IB9A 3APVA 1KT5A 2GC9A 1PEEA 5L8NA 1BXWA 2WEXA 5HZ8A 1IW2A 2J1NA 2W81C 1HXXA 5IYUA 2K23A 3STNA 4ZFXA 2OMFA 1SMPI 2FGRA 3DSZA 2F09A 1MVGA 2L9CA 2WQAE 5EE2A 2E4JA 3VG5A 4UU2A 4MVKA 4EXZA 4N58A 1GFOA 1YWDA 5F7GA 1CJ5A 2ERVA 3NADA 4WBKA 4WFUA 4ES7A 3VZUX 4JFBA 3D96A 4U9CA 3G7GA 3OE3A 3WJEA 5IO5A 3C76X 4GU8A 2X45A 4YGHA 5FAZA 5B29A 2Y0KA 4YFQA 3U03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O49 A;  1YS5 A;  4AYE C;  4AYD C;  5T5F A;  2KC0 A;  3VE2 A;  4QQ1 A;  3HOE A;  4O3X B;  3PQU A;  4Z3T A;  4O4X A;  2LFU A;  4AYM C;  3HOL A;  3UAQ A;  4AYN A;  4O4U A;  2W81 C;  2YPV A;  2KDY A;  3VE1 A;  5EE2 A;  2W80 C;  4AYI D;  2Y7S A;  3PQS A;  4O3W A;  3KVD D;  4U9C A;  3V8U A;  4O3Z A;  4O3Y A; 
#chains in the Genus database with same CATH topology
 3VHM A;  1SXW A;  1P4T A;  2OL7 A;  5HTD A;  4B55 A;  2LFO A;  1OSM A;  4GNW A;  5LJK A;  5KIC A;  4BCS A;  1EIO A;  4ZHG A;  1RAV A;  3WZO A;  5LJE A;  1I06 A;  2RTD B;  2W2B A;  3BX7 A;  5FQ7 E;  3POQ A;  1MM5 A;  2WQ9 A;  2FTB A;  2I5V O;  1KT4 A;  3GAQ A;  3SZD A;  2RCQ A;  1ZNK A;  4ID2 A;  1TW4 A;  2HYS A;  4CTD A;  2LBA A;  1BJ7 A;  1ZHX A;  4Y0R A;  1A2D A;  5JR8 A;  2RD7 C;  1FEN A;  1NP1 A;  3AA1 A;  1YWA A;  3P6E A;  1KL3 A;  3FEN A;  4Y0P A;  2Y3E A;  2XST A;  4AKR A;  1X8N A;  4ODD A;  2RN4 A;  2OFR X;  2CM4 A;  2CAM A;  5PRN A;  3OD9 A;  3QRA A;  3UEU A;  3SYB A;  2L68 A;  5FQ8 E;  3RY2 A;  2ACO A;  4C00 A;  3BY0 A;  2KZ7 A;  3RKG A;  2OYB O;  3RDU A;  2QTK A;  1A3Y A;  3AA0 B;  1AB0 A;  3D9W A;  1LIF A;  3PGR A;  4O3Y A;  1BSQ A;  2RTC B;  2Z4I A;  4TJZ A;  2N2M A;  3AA6 A;  2HZQ A;  2X55 A;  1N9Y A;  1YWB A;  5HA1 A;  4I60 A;  4XNL A;  2Q9S A;  2HNX A;  1QJP A;  5KHP A;  3CR6 A;  4INN A;  1EII A;  1JMX A;  4OS0 A;  4FT6 A;  2AL0 X;  3FYF A;  4YCE A;  1ZND A;  2LFU A;  4R0B A;  5LJD A;  3UEX A;  3FA8 A;  3AA7 B;  4CDD A;  3MG5 A;  3HWF A;  2XE3 A;  3ZI8 A;  1YUP A;  1PBY A;  4NP1 A;  1LKE A;  2VFB A;  1E02 A;  3LV4 A;  2FGS A;  3X00 A;  3FA9 A;  2OF8 A;  2IZC B;  4AZN A;  1MUP A;  2R4P A;  3NBX X;  2RTR B;  3VG2 A;  3AAA B;  4NW4 A;  2OY8 A;  1MEP A;  1LUQ A;  1ICN A;  3POU A;  5HWZ A;  1Y9T A;  5B5F A;  2OFB A;  4BX5 B;  1X8O A;  1SWP A;  1PHO A;  1PBO A;  5CE4 A;  5F6Z A;  6PRN A;  4KRA A;  3SOT A;  1Q9F A;  3QQ2 A;  5B27 A;  2GJ5 A;  4LKP A;  3BU1 A;  4Y0S A;  1LDO A;  3BLG A;  2MM3 A;  2WVP A;  1STR B;  1KFF A;  3GP6 A;  1URE A;  4QGW A;  1SWA A;  1IKE A;  4FSO A;  4PR7 A;  4GNY A;  4TQ2 A;  4NYR A;  1VWG B;  1YWC A;  4LKT A;  2A13 A;  4YDB A;  4FQE A;  4FSP A;  4KH8 A;  4CPE A;  3T20 A;  4IRW A;  4U8U N;  4BUM X;  1AVG I;  2DJG A;  4JCH A;  2O62 A;  4GGR A;  4EFG A;  2UYW A;  2DM5 A;  1ZNL A;  1OPF A;  4D5U A;  1VWP B;  2POR A;  1MX7 A;  3BX8 A;  3DA3 A;  1RLB E;  1ZRY A;  1E2T A;  1T68 X;  5DL6 A;  4BBO A;  3E3C A;  3APU A;  4BOE A;  4I9R A;  5BVS A;  3SYS A;  4GJS A;  2FKG A;  4O49 A;  1BSY A;  5LJC A;  3DWO X;  4JHQ A;  4GD9 A;  1DV9 A;  2RTN B;  2OY7 A;  1AEL A;  4IBA A;  1GKA B;  1VYG A;  2OY1 O;  3FR4 A;  2RTP B;  4QYN A;  3KFG A;  3PQS A;  1GFN A;  1NQN A;  4IMO A;  4EKV A;  3SLJ A;  1AQB A;  5IO6 A;  5GTH O;  5ADX K;  3MM0 A;  5TIS O;  3LK4 1;  3KZI O;  4C4V B;  2WEW A;  3D95 A;  3HWD A;  3UPG A;  3RDM A;  1KT6 A;  3T2W A;  1N9M A;  2G7B A;  4ZJ0 A;  4GJV A;  3BU9 A;  1VWH B;  4Z3T A;  1SRI A;  1GT3 A;  2F1C X;  3DZM A;  3QKG A;  1JQP A;  5K06 A;  4HWM A;  5HCE C;  4M6S A;  1IZN A;  2XG6 A;  2IZD B;  3EBK A;  1DF8 A;  4FUV A;  4AZM A;  3KZA A;  3NQ3 A;  2JW1 A;  3EBW A;  2AT5 X;  3WBG A;  4LQZ A;  2RTJ A;  1WUB A;  4KCA A;  4MIS A;  1KGL A;  2AKQ A;  5B5G A;  1LCV A;  4K3C A;  3T24 A;  3WJC A;  2NNQ A;  3WJB A;  1KZX A;  3STK A;  3C5O A;  2GC9 A;  1BXW A;  3EW2 A;  2J1N A;  2W81 C;  2K23 A;  2L9C A;  1VWB B;  4UU2 A;  1CJ5 A;  2ERV A;  3G7G A;  3OE3 A;  2Y0K A;  1MOY A;  4HPD A;  4KII A;  4ORX A;  1OPA A;  4YBU A;  3VGW A;  5KAF O;  4LZU A;  3U9P C;  2FR2 A;  2QO4 A;  4D64 A;  3ZW2 A;  3OJY C;  3SAO A;  3PDF A;  2VDF A;  3NQ9 A;  5AFU L;  3H3I A;  3C78 X;  1MM9 A;  4RLB A;  4AYH A;  4A8Z A;  1CBR A;  3D97 A;  3CKF A;  1A57 A;  4GK9 A;  1LCW A;  3VZW X;  4QGV A;  4IB8 A;  4A60 A;  4BQU A;  2YNK A;  4AZQ A;  4U3Q A;  1GFP A;  1X8Q A;  2JGS A;  4ARH A;  2UZ2 A;  2MHD A;  3S26 A;  2KXP A;  3I17 A;  3AUM O;  4YMY A;  2F01 A;  1H6S 1;  2XTQ A;  4RUN A;  3VHI A;  2P8G A;  1HMR A;  2RCT A;  3LK2 B;  5H8T A;  4WHI A;  2KT4 B;  1TVQ A;  3ZW0 B;  5C0N A;  3AKN A;  4WFV A;  1SWB A;  2RTM A;  1HN2 A;  3CQN A;  1PMP A;  3TF6 A;  4CK4 A;  4AYD C;  4JO6 A;  2FT9 A;  4RJX A;  1RXH A;  1Q9G A;  1GXA A;  4UB8 O;  2HLV A;  3S5X A;  3BS2 A;  5DL8 A;  1CBI A;  1G85 A;  4Y5D A;  2MHL A;  3NX1 A;  2LKK A;  2R74 A;  1GX9 A;  3AAE A;  3NJT A;  3WYP A;  1GFQ A;  2F73 A;  4LSI A;  1QJ8 A;  3KFH A;  2KTS A;  1QY0 A;  1CBQ A;  1I4U A;  5FQ6 E;  4LSH A;  3LK3 B;  4GET A;  1Y53 X;  2GTL N;  5H9A A;  4CPH A;  2R4N A;  4XME A;  5EDB A;  3HWG A;  3A2S X;  3EMN X;  4OMW A;  1VWK B;  5HCC C;  1T16 A;  4D65 A;  4GHB A;  2X8T A;  5HZ6 A;  1JV4 A;  4K19 A;  5EEE A;  2BSZ A;  4ZHH A;  1N0S A;  2AF5 A;  3T6L A;  7PRN A;  2MF6 A;  5LKE A;  5HZ5 A;  1SLE B;  3VY9 X;  4DNE A;  2R4L A;  2AMM X;  3SY7 A;  4O3W A;  4Z2V A;  1I78 A;  5LJG A;  1BRP A;  2BLG A;  2K62 A;  2G5L A;  2MWH A;  4JNJ A;  1B8E A;  2QOS C;  4YH0 A;  1EPA A;  3ZUI A;  4YBP A;  5G39 A;  4ML7 B;  1DZP A;  2Q39 A;  2JU8 A;  3FW5 A;  1HBQ A;  1RBP A;  4RUU A;  4E1T A;  3S5V A;  2RTB B;  4COT A;  1IJ8 A;  5DL7 A;  4AYM C;  1NC9 A;  2X46 A;  2AT3 X;  3L4R A;  3P6F A;  1I04 A;  3RE6 A;  5KID A;  1S7D A;  3B2L A;  1HMS A;  4DQ3 A;  2BHV A;  2WUT A;  1OEJ A;  2FS6 A;  2N2L A;  3B2I A;  2JMM A;  3PP6 A;  5GV0 A;  1GX8 A;  1SWK A;  5F6B A;  4GKC A;  4YKM A;  3P24 A;  1G90 A;  2X32 A;  1X71 A;  1ERB A;  2HZR A;  3PRN A;  3BSZ E;  4ALO A;  1QFV A;  1RSU B;  1P6P A;  3RDS A;  3PGS A;  1THQ A;  1R0U A;  1G74 A;  2ACP X;  2RA6 A;  4UU3 A;  4KR8 A;  1SA8 A;  4GE1 A;  4RJW A;  4G75 A;  3QRC A;  1VWE B;  2Y7S A;  1KQW A;  1I9H A;  2FHN X;  1FDQ A;  3DA4 A;  2R56 A;  3T2X A;  3AA0 A;  5AFU K;  2A5B A;  4YDA A;  5HZQ A;  1SWS A;  1SXY A;  3A0H O;  1VWM B;  3P6C A;  3BRN A;  1EXS A;  3T1D A;  1ZNE A;  5BVQ A;  4HPB A;  1Y52 X;  5D45 A;  3ELX A;  3FEK A;  3WJF A;  5B3M O;  1OSP O;  3NQK A;  1G7N A;  1E06 A;  1JYJ A;  3O2Y A;  3NPO A;  3PGU A;  4ZHF A;  1TOU A;  1VWL B;  5IO7 A;  3IFB A;  1VWJ B;  1SWQ A;  2OL8 O;  5AJC A;  3AA7 A;  4Y0Q A;  3WVM A;  1O8V A;  1SRF A;  1XCA A;  3SZH A;  3PK2 A;  1BSO A;  1EW3 A;  1ALB A;  3APW A;  3WXQ A;  2A2U A;  1HXT A;  2X27 X;  3P6D A;  4PSQ A;  4YCH A;  1ML7 A;  2RTK A;  2R4O A;  3LK4 2;  1BWY A;  2FHL A;  1MM4 A;  3AAA A;  3WOV A;  1O1U A;  1VWA B;  4YGZ A;  3B2J A;  4OKA A;  4N59 A;  4AZR A;  4GRJ A;  2QO6 A;  4YGG A;  1BEB A;  4BX5 A;  1W4T A;  3VU1 A;  1NDJ A;  3P6G A;  3G7X A;  4O3Z A;  1QAB E;  4ZHC A;  3SLT A;  3RBY A;  4I9S A;  3VE2 A;  1SY0 A;  1VYF A;  3FMZ A;  3EMM A;  3TGC A;  1NBX A;  1FTP A;  3O0E A;  1O1V A;  1MPF A;  5BYP A;  3HPE A;  4FZM A;  4I3D A;  1PTS A;  4OEM A;  3SZI A;  2XKL A;  1DZM A;  2KW1 A;  1SY2 A;  2O4V A;  3APV A;  2C1S A;  1PEE A;  2WEX A;  5HZ8 A;  1IW2 A;  1HXX A;  2OMF A;  2C4I A;  3VG5 A;  4MVK A;  1UYN X;  1LCZ A;  4WFU A;  3D96 A;  4U9C A;  3WJE A;  4BX6 B;  5B29 A;  3U03 A;  2QO5 A;  2YG2 A;  1Y0G A;  4AZP A;  3SY9 A;  2XE1 A;  3FA6 A;  4AW8 A;  2JN3 A;  3JTY A;  4FBR A;  4N75 A;  4CDF A;  4QZT A;  2MNH A;  3BRZ A;  3SLO A;  2CZT A;  2WWP A;  3VY8 X;  4ZCB A;  5H2F O;  1SLF B;  4ORS A;  2R8A A;  3KQ0 A;  4QZU A;  4ORY A;  4O4X A;  3UAQ A;  1LIC A;  4O4S A;  2IZB A;  4GGT A;  1SRG A;  2XTR A;  3VHH A;  1XKI A;  3F6Z B;  3VPJ E;  2N93 A;  4E1S A;  3MBT A;  3WZP A;  3WI4 A;  2NNE A;  3ZUO A;  3VG6 A;  1BT9 A;  1YIV A;  2OVA A;  4I3B A;  2PRN A;  1TXL A;  1N7Y A;  3POR A;  1W5R A;  3O22 A;  2ASN X;  2NP1 A;  2IWV A;  2FLJ A;  1Y55 X;  1KT3 A;  2WJR A;  3RWX A;  4B61 A;  4C4V A;  1SY1 A;  1E5P A;  1GM6 A;  2L5P A;  4IAB A;  4I95 A;  4IB6 A;  2A3F X;  1EI5 A;  3KFF A;  1KZW A;  1AVD A;  4DQ4 A;  2F1T A;  1E54 A;  1SXX A;  1VYO A;  3NSG A;  4Y59 A;  3AEH A;  3STM X;  3RSW A;  2ANS A;  4YFR A;  2X4M A;  4XMC A;  1RXJ A;  1LPJ A;  1SWR A;  4GZV A;  2M07 A;  2JU7 A;  4QRL A;  1SWE A;  4K3B A;  2JMB A;  3TZS A;  2Q2M A;  1RST B;  2W80 C;  2IZA A;  1W6F A;  2RTG B;  5H9L A;  4NNT A;  4I3C A;  2Z4H A;  1E00 A;  1GX3 A;  4FMS A;  3HOE A;  3FDC A;  5DPQ A;  4FBV A;  5AJB A;  4GUZ A;  1STS B;  2RTL A;  2LBV A;  3POX A;  4AZO A;  2ALL X;  3FIQ A;  5IRU A;  4Z27 A;  4ZGU A;  3V8U A;  5FFH A;  4FRT A;  1KT7 A;  5B2A O;  3UEV A;  2KD2 A;  5D4A A;  2FS7 A;  2IZL B;  2KDY A;  4CPI A;  2ZLD A;  5F1E A;  2FR3 A;  4FRX A;  2WR6 A;  1QQS A;  3CMP A;  1SWO A;  1SWG A;  1U17 A;  5GTI O;  1G5W A;  3F9D A;  2RTO B;  1B0O A;  4O3X B;  4MVI A;  2ZAG A;  1UYO X;  2G8C O;  3ZW1 B;  1B4M A;  1D2U A;  3NP1 A;  1BM5 A;  1S2P A;  1S44 A;  1FJ1 E;  1VWF B;  4TNN A;  4FES A;  2LA7 A;  4HPA A;  2POA A;  2IZK A;  4XMG A;  4GCP A;  3NX2 A;  3AAE B;  1TOW A;  2GH7 A;  1BH3 A;  5BVT A;  4FQB B;  1OEE A;  5EPQ A;  2JOZ A;  3HOL A;  2Y0L A;  5D8J A;  5FVN A;  4EEJ A;  2YPV A;  1ICM A;  1VWQ B;  1VWD B;  1UZ2 X;  3LK2 A;  2A8G A;  4BX7 B;  3P02 A;  5H9K A;  2CZU A;  2IZE B;  3FID A;  4Z2O A;  3ZW0 A;  1H91 A;  4CDE A;  3U0D A;  1VWC B;  2MO5 A;  3VE1 A;  3VG3 A;  5E79 O;  3IA8 A;  1FEL A;  4NV8 A;  2IZG B;  4GH7 A;  2K0L A;  2X56 A;  3FR5 A;  3P6H A;  5HBS A;  2ZSC A;  4QGX A;  2KC0 A;  5D47 A;  3KFI A;  5K68 A;  4ZH9 A;  1JJJ A;  3OBL A;  2M06 A;  3K3L A;  2QCB A;  2GTF X;  3PPT A;  4ZH6 A;  1ORM A;  4YKO A;  3WJG A;  3LK3 A;  1QWD A;  1KXO A;  5EED A;  1BBP A;  3O19 A;  2DJF A;  1U0X A;  4ON1 A;  3RBH A;  2ZAI A;  1OEK A;  3T6F A;  2Q2P A;  5IXG A;  1IKJ A;  3B2H A;  4ORU A;  4TKJ A;  5HAE A;  1DZK A;  3AA1 B;  2RTH B;  5D5D A;  2A0A A;  1A18 A;  4AKR B;  1ZNH A;  3I0A A;  4OS8 A;  3APX A;  3RDO A;  3SZJ A;  4YFP A;  3JS1 A;  1I05 A;  2CBR A;  4PJ2 A;  2BT9 A;  1VWN B;  1YP7 A;  1SWU A;  1DZJ A;  5IRA A;  1LDQ A;  2IZI A;  2WSJ A;  4Z28 A;  1T8V A;  1SWL A;  4NYQ A;  1QG5 A;  4AFK A;  1ZNG A;  3BDR A;  2KZ7 B;  5B5E O;  5L8O A;  1CRB A;  4EDE A;  1SXU A;  1GT4 A;  5HZ9 A;  2IWW A;  3F8A A;  2RQ0 A;  4U8U O;  2HMB A;  3KVN A;  3RDQ A;  1OBP A;  4I6S A;  1GT5 A;  4AUI A;  4U8U M;  3AA6 B;  3TZG A;  5ADX L;  4CPF A;  8PRN A;  2Y32 A;  4LZV A;  4IB7 A;  2VFC A;  2R89 A;  4IMN A;  4M7M A;  3UEW A;  2BC3 A;  4ZHD A;  3PH6 A;  4GF4 A;  4FZL A;  2QOM A;  4C5P A;  1FE3 A;  2G79 A;  2NND A;  5L3Y A;  3A0B O;  2AT0 X;  4HFO A;  4CSB A;  2KTD A;  4IB9 A;  1KT5 A;  5L8N A;  5IYU A;  4ZFX A;  1SMP I;  2FGR A;  3DSZ A;  2F09 A;  5EE2 A;  2E4J A;  2AXT O;  4N58 A;  1GFO A;  1SWC A;  1YWD A;  3NAD A;  4WBK A;  3VZU X;  4JFB A;  4GGZ A;  5IO5 A;  5FAZ A;  2IZF B;  5G38 A;  2RTA A;  3LTW A;  1YS5 A;  3HK1 A;  4KC8 A;  4D6B A;  1RXK A;  5H9N A;  4TKB A;  2JU3 A;  3RZY A;  2MJI A;  4FBO A;  4F4B A;  2FWV A;  5B66 O;  1JJX A;  1ACD A;  2Q4N A;  1D3S A;  3WU2 O;  4TKH A;  2JQY A;  3D4R A;  3T0S A;  2QM9 A;  1JMZ A;  1SRE A;  1SY3 A;  2GE4 A;  5EDC A;  4NNS A;  1JBH A;  4FOZ A;  1LEL A;  1LIB A;  1SWF A;  5LJB A;  4JGL A;  2LHF A;  3GE2 A;  4BGF A;  5F2B A;  1LNM A;  4LSF A;  3RE5 A;  5G3A A;  4N74 A;  3K19 A;  1Y9L A;  1CBS A;  2CM9 A;  3FLL A;  3TGB A;  2WJQ A;  1SWN A;  5HA0 A;  1ZHZ A;  3Q34 A;  1HXZ A;  3WYQ A;  4OMX A;  5DG4 A;  2AVI A;  4ZGF A;  5B11 O;  4XMH A;  5B10 O;  4G76 A;  2OVD A;  2OZQ A;  4PUX A;  4ORW A;  3BRY A;  4N7D A;  2FGQ X;  4AYI D;  3DTQ A;  1JIW I;  1WBI A;  3HW9 A;  5EZ2 A;  2ODJ A;  3EW1 A;  2YMS A;  3PF1 A;  2RTE B;  1LIE A;  1N43 A;  3HTY A;  1BRQ A;  4AYN A;  5LKF A;  1K3B A;  1JZU A;  3C77 X;  2OVE A;  5LJH A;  3DWN A;  3EYC A;  3NR3 A;  4O9S A;  1HXU A;  1ZHY A;  3CBC A;  5HCD C;  1MDC A;  1X8U A;  2A5C A;  4OS3 A;  3ZQ3 A;  2Y3F A;  2RTI B;  1EQD A;  3N91 A;  4O4U A;  2AH7 X;  2IFB A;  3FA7 A;  1VPR A;  2W2F A;  1EAL A;  1KL5 A;  1LID A;  1FEM A;  2HKD A;  3B2K A;  2X34 A;  5L8I A;  5CHK A;  2BS6 A;  4D6A A;  1SWH A;  4QQ1 A;  2OVS A;  1NQM A;  1ADL A;  4QYP A;  4U46 A;  5CYB A;  2L67 A;  4PJ0 O;  4BX6 A;  4EQA C;  3JQO A;  4IAW A;  3RDX A;  1HBP A;  3PED A;  4QAE A;  5F58 A;  4UB6 O;  2BS5 A;  3FW4 A;  4TLJ A;  1GKA A;  1IFC A;  4YVB A;  1IZN B;  5T5F A;  1QY2 A;  1SWJ A;  1U18 A;  1PRN A;  1AVE A;  4CV7 A;  4MVL A;  3BS0 A;  3FEL A;  1OBQ A;  3PH5 A;  3PEC A;  1SRJ A;  4RLC A;  1X8P A;  4ORR A;  1MK5 A;  3ZWE A;  3HWE A;  2QMI A;  2LB6 A;  3EC5 A;  2GTL O;  4ZR2 A;  5DL5 A;  2EU7 X;  4NLI A;  1BLR A;  1S5L O;  4KT5 A;  1T1L A;  4AZL A;  1LF7 A;  3MVF A;  1JYD A;  2A2G A;  3HWB A;  2GTL M;  2RTQ B;  2W2A A;  2R88 A;  4BJ8 A;  5FEN A;  3SZV A;  4AKM A;  1DFV A;  1HY2 A;  3WJD A;  4IL6 O;  2F1V A;  4GDA A;  3S60 A;  1NP4 A;  4MEE A;  1GFM A;  2AT8 X;  2OL6 O;  4GCQ A;  2K4T A;  5IRW A;  2Y2X A;  3WZN A;  1K24 A;  1DF3 A;  3CWK A;  2XMX A;  4L3R A;  5AEO A;  3ZZV A;  3VZT X;  4DCB A;  4GCS A;  1KQX A;  5HTE A;  3CBS A;  4QNI A;  4HPC A;  1Z24 A;  1IIU A;  5AQ6 A;  1HQP A;  1GGL A;  1SLG B;  4OEL A;  2PY1 A;  3AKM A;  2OFM X;  1HXL A;  2RTF B;  3PQU A;  4O4O A;  1GT1 A;  1X89 A;  2OY5 O;  1KOI A;  1ZHT A;  2X8S A;  2X8F A;  1QY1 A;  2FRS A;  4BVM A;  1SWT A;  3WI5 A;  3JCU O;  3Q6L A;  4L1N A;  2XE2 A;  2PI3 O;  2X9K A;  1B56 A;  1QFT A;  2KXP B;  2XE5 A;  3FYX A;  5JDP A;  4ALB A;  1JJU A;  1IFB A;  1L6M A;  3FR2 A;  1HQQ A;  1N4J A;  2IZH B;  4IAX A;  5D48 A;  4RL9 A;  4NV7 A;  4AYE C;  3LHN A;  5K67 A;  4CDC A;  4C69 X;  2AT6 X;  2I5Z O;  3ELZ A;  4MIR A;  3WZQ A;  2ZFG A;  2FKJ A;  1PM1 X;  5KAI O;  3MX7 A;  3CKG A;  1LFO A;  1YP6 A;  5CSE A;  1EPB A;  1VWO B;  4FZN A;  1VWI B;  4A1H A;  1DC9 A;  2J4U P;  4MVE A;  3EM0 A;  1KL4 A;  3UU2 A;  4XMD A;  2R73 A;  3FEP A;  2C1Q A;  2OF9 A;  1NGL A;  4GDZ A;  1SWD A;  1T0V A;  4CPH B;  1OPB A;  1MX8 A;  4N7C A;  1VWR B;  2G78 A;  4LSE A;  3KVD D;  1SRH A;  3ZW1 A;  3TGA A;  4A1Y A;  2M4L A;  1QJ9 A;  3VG7 A;  4XMF A;  2IZJ A;  4NLJ A;  2OFA A;  1HMT A;  4KR4 A;  1EUO A;  2CBS A;  2Y0H A;  1OBU A;  5G26 A;  2WPU A;  4KC7 A;  1ERX A;  3CQR A;  4Z6J A;  4XNK A;  1ZHW A;  3JSQ A;  5JD2 A;  3VG4 A;  4FGI B;  4Z2P A;  1SLD B;  3STN A;  1MVG A;  2WQA E;  3RY1 A;  4BX7 A;  4EXZ A;  5F7G A;  4ES7 A;  1STP A;  3C76 X;  4GU8 A;  2X45 A;  4YGH A;  4YFQ A; 
#chains in the Genus database with same CATH homology
 2QO5 A;  2YG2 A;  1SXW A;  4HPD A;  1YS5 A;  1P4T A;  4AZP A;  3SY9 A;  3HK1 A;  5HTD A;  1OSM A;  2LFO A;  4KII A;  4ORX A;  2XE1 A;  3FA6 A;  4KC8 A;  4D6B A;  4GNW A;  1OPA A;  4AW8 A;  5LJK A;  4YBU A;  2JN3 A;  3JTY A;  4FBR A;  5H9N A;  5KIC A;  4TKB A;  4QZT A;  2JU3 A;  3RZY A;  1EIO A;  4LZU A;  3U9P C;  2MNH A;  2FR2 A;  2QO4 A;  4D64 A;  2MJI A;  4FBO A;  4F4B A;  4ZHG A;  2FWV A;  2CZT A;  3ZW2 A;  2WWP A;  3VY8 X;  5LJE A;  3OJY C;  1I06 A;  3SAO A;  1JJX A;  1ACD A;  4ZCB A;  2Q4N A;  3NQ9 A;  2W2B A;  3BX7 A;  5FQ7 E;  3POQ A;  5AFU L;  1D3S A;  1MM5 A;  4GCP A;  4ORS A;  3H3I A;  3C78 X;  4TKH A;  3D4R A;  2WQ9 A;  3T0S A;  4RLB A;  2FTB A;  2QM9 A;  3KQ0 A;  4QZU A;  4A8Z A;  4ORY A;  4AYH A;  1CBR A;  4O4X A;  1SY3 A;  3D97 A;  3UAQ A;  1A57 A;  2GE4 A;  1KT4 A;  4GK9 A;  5EDC A;  4NNS A;  1LIC A;  4O4S A;  1JBH A;  3GAQ A;  4FOZ A;  3SZD A;  2RCQ A;  1ZNK A;  4ID2 A;  1LIB A;  3VZW X;  4QGV A;  4IB8 A;  4A60 A;  4BQU A;  2YNK A;  2XTR A;  4AZQ A;  4JGL A;  5LJB A;  2LHF A;  4U3Q A;  1GFP A;  1XKI A;  1TW4 A;  1X8Q A;  3F6Z B;  2HYS A;  1LNM A;  3GE2 A;  3VPJ E;  4ARH A;  2N93 A;  4E1S A;  4LSF A;  3MBT A;  2MHD A;  2LBA A;  1BJ7 A;  1ZHX A;  3S26 A;  4Y0R A;  2NNE A;  3I17 A;  3ZUO A;  2KXP A;  3K19 A;  3WI4 A;  4YMY A;  1A2D A;  3VG6 A;  1BT9 A;  1YIV A;  5JR8 A;  1Y9L A;  2RD7 C;  1CBS A;  1FEN A;  1NP1 A;  1H6S 1;  1YWA A;  3AA1 A;  2OVA A;  4I3B A;  2PRN A;  3P6E A;  1TXL A;  2CM9 A;  3FLL A;  4RUN A;  3TGB A;  2P8G A;  2XTQ A;  1HMR A;  2RCT A;  3FEN A;  4Y0P A;  4AKR A;  2XST A;  3POR A;  3LK2 B;  5HA0 A;  1X8N A;  4ODD A;  2RN4 A;  4WHI A;  2OFR X;  2KT4 B;  5H8T A;  2N2L A;  1TVQ A;  1ZHZ A;  3O22 A;  2ASN X;  3ZW0 B;  2NP1 A;  5C0N A;  3AKN A;  4WFV A;  2CM4 A;  3LK4 1;  1HN2 A;  5PRN A;  2FLJ A;  3CQN A;  1PMP A;  1KT3 A;  3OD9 A;  3QRA A;  3RWX A;  4OMX A;  3TF6 A;  3UEU A;  5DG4 A;  4B61 A;  4CK4 A;  1SY1 A;  4AYD C;  1E5P A;  1GM6 A;  2FT9 A;  2L5P A;  3SYB A;  2L68 A;  5FQ8 E;  4ZGF A;  4RJX A;  1Q9G A;  4XMH A;  1GXA A;  2ACO A;  2HLV A;  4IAB A;  3S5X A;  4G76 A;  3BY0 A;  2OVD A;  2OZQ A;  4PUX A;  4ORW A;  3BS2 A;  2KZ7 A;  5DL8 A;  4I95 A;  1CBI A;  3RKG A;  1G85 A;  2MHL A;  3NX1 A;  2LKK A;  2R74 A;  4IB6 A;  1GX9 A;  4N7D A;  2FGQ X;  4AYI D;  3DTQ A;  2A3F X;  1JIW I;  3AAE A;  1EI5 A;  3KFF A;  2QTK A;  1KZW A;  1GFQ A;  4LSI A;  2F73 A;  1QJ8 A;  1A3Y A;  3AA0 B;  4DQ4 A;  2F1T A;  3KFH A;  3HW9 A;  5EZ2 A;  2ODJ A;  1AB0 A;  2KTS A;  2YMS A;  1QY0 A;  1E54 A;  1CBQ A;  1SXX A;  1I4U A;  3NSG A;  1LIF A;  5FQ6 E;  4O3Y A;  1BSQ A;  2Z4I A;  4TJZ A;  1LIE A;  4LSH A;  3LK3 B;  3STM X;  4GET A;  3RSW A;  2ANS A;  2GTL N;  5H9A A;  4YFR A;  2N2M A;  3HTY A;  4XMC A;  1BRQ A;  4DQ3 A;  1LPJ A;  4XME A;  5EDB A;  4GZV A;  3AA6 A;  2M07 A;  4AYN A;  2HZQ A;  5LKF A;  3HWG A;  1JZU A;  3A2S X;  2JU7 A;  3C77 X;  2OVE A;  4QRL A;  5LJH A;  1YWB A;  3EMN X;  4OMW A;  5HCC C;  5HA1 A;  2JMB A;  3TZS A;  4D65 A;  2Q2M A;  3EYC A;  2W80 C;  3NR3 A;  4GHB A;  4O9S A;  1HXU A;  1ZHY A;  4XNL A;  2Q9S A;  2HNX A;  2X8T A;  1QJP A;  5KHP A;  5HZ6 A;  3CR6 A;  3CBC A;  4INN A;  1JV4 A;  4K19 A;  5EEE A;  5HCD C;  5H9L A;  4ZHH A;  1N0S A;  4I3C A;  4NNT A;  1EII A;  2Z4H A;  1MDC A;  1E00 A;  1X8U A;  4FMS A;  4OS0 A;  4OS3 A;  2AL0 X;  4FT6 A;  7PRN A;  3FYF A;  3HOE A;  3ZQ3 A;  4YCE A;  1ZND A;  5DPQ A;  2LFU A;  1EQD A;  5LKE A;  4R0B A;  5HZ5 A;  3N91 A;  4O4U A;  5LJD A;  2IFB A;  2AH7 X;  3UEX A;  3FA8 A;  3AA7 B;  3FA7 A;  4FBV A;  1VPR A;  2W2F A;  1EAL A;  3VY9 X;  1LID A;  3HWF A;  5AJB A;  2XE3 A;  1FEM A;  3B2K A;  2LBV A;  3POX A;  4AZO A;  2AMM X;  3ZI8 A;  2ALL X;  3FIQ A;  3SY7 A;  4O3W A;  5L8I A;  1YUP A;  4NP1 A;  1LKE A;  5LJG A;  1BRP A;  2BLG A;  2MWH A;  2K62 A;  3V8U A;  4ZGU A;  1E02 A;  3LV4 A;  5FFH A;  1B8E A;  2QOS C;  4FRT A;  2BS6 A;  3FA9 A;  4D6A A;  4YH0 A;  1KT7 A;  1EPA A;  4QQ1 A;  2OVS A;  4QYP A;  1ADL A;  3UEV A;  2KD2 A;  3ZUI A;  4AZN A;  5CYB A;  4YBP A;  5D4A A;  1MUP A;  2L67 A;  2FS7 A;  2KDY A;  3NBX X;  4ML7 B;  3VG2 A;  4EQA C;  1DZP A;  3JQO A;  4IAW A;  2Q39 A;  2ZLD A;  3AAA B;  1HBP A;  2JU8 A;  3FW5 A;  4NW4 A;  5F1E A;  2FR3 A;  4FRX A;  2WR6 A;  1QQS A;  3PED A;  4QAE A;  1HBQ A;  3CMP A;  5F58 A;  1RBP A;  2BS5 A;  3FW4 A;  4RUU A;  4E1T A;  1U17 A;  4TLJ A;  1ICN A;  3POU A;  1GKA A;  1G5W A;  3F9D A;  1IFC A;  3S5V A;  5HWZ A;  1Y9T A;  1IZN B;  4COT A;  5T5F A;  5DL7 A;  1B0O A;  1QY2 A;  4O3X B;  1U18 A;  1PRN A;  4MVI A;  2ZAG A;  1X8O A;  4AYM C;  4CV7 A;  4MVL A;  3ZW1 B;  1B4M A;  1D2U A;  3NP1 A;  3FEL A;  2X46 A;  1OBQ A;  3PH5 A;  1BM5 A;  1S2P A;  1PHO A;  2AT3 X;  3L4R A;  3PEC A;  1PBO A;  5CE4 A;  3P6F A;  5F6Z A;  1I04 A;  4RLC A;  1X8P A;  6PRN A;  5KID A;  4ORR A;  4KRA A;  1S44 A;  1S7D A;  4TNN A;  3ZWE A;  3HWE A;  4FES A;  2LA7 A;  3B2L A;  3SOT A;  1Q9F A;  2QMI A;  4HPA A;  1HMS A;  2POA A;  2BHV A;  2LB6 A;  5B27 A;  2GJ5 A;  2WUT A;  4LKP A;  4XMG A;  2GTL O;  2FS6 A;  1OEJ A;  3BU1 A;  3NX2 A;  4Y0S A;  3B2I A;  3BLG A;  2MM3 A;  2EU7 X;  3PP6 A;  4ZR2 A;  2JMM A;  4NLI A;  1BLR A;  3AAE B;  5DL5 A;  5GV0 A;  1TOW A;  1GX8 A;  1BH3 A;  3GP6 A;  5BVT A;  1URE A;  4FQB B;  4KT5 A;  4AZL A;  1OEE A;  5F6B A;  1LF7 A;  5EPQ A;  2JOZ A;  3HOL A;  2Y0L A;  3MVF A;  4QGW A;  1JYD A;  5D8J A;  5FVN A;  4EEJ A;  2A2G A;  3HWB A;  2YPV A;  4GKC A;  2GTL M;  1ICM A;  4YKM A;  1IKE A;  4FSO A;  2W2A A;  5FEN A;  3P24 A;  1G90 A;  1X71 A;  3SZV A;  4GNY A;  4AKM A;  1UZ2 X;  1ERB A;  4TQ2 A;  1DFV A;  4NYR A;  1YWC A;  4LKT A;  2HZR A;  3WJD A;  3BSZ E;  3PRN A;  2A13 A;  4ALO A;  4YDB A;  2F1V A;  4FSP A;  1QFV A;  3S60 A;  1P6P A;  3LK2 A;  1NP4 A;  3P02 A;  5H9K A;  1GFM A;  2AT8 X;  2CZU A;  3ZW0 A;  1H91 A;  3U0D A;  1THQ A;  2K4T A;  4KH8 A;  4GCQ A;  1R0U A;  2Y2X A;  1DF3 A;  1G74 A;  3T20 A;  2ACP X;  2RA6 A;  4UU3 A;  3CWK A;  2XMX A;  4KR8 A;  1SA8 A;  4GE1 A;  4L3R A;  2MO5 A;  5AEO A;  4U8U N;  4RJW A;  3VE1 A;  4BUM X;  1AVG I;  3VG3 A;  3ZZV A;  4G75 A;  3VZT X;  3QRC A;  3IA8 A;  2Y7S A;  1FEL A;  4JCH A;  1KQW A;  4GCS A;  1KQX A;  5HTE A;  4GH7 A;  2O62 A;  1FDQ A;  3CBS A;  4QNI A;  4HPC A;  2K0L A;  1Z24 A;  1IIU A;  3P6H A;  3FR5 A;  5AQ6 A;  1HQP A;  5HBS A;  1GGL A;  4EFG A;  4QGX A;  3DA4 A;  2PY1 A;  2R56 A;  2DM5 A;  3AKM A;  2OFM X;  2KC0 A;  1ZNL A;  5D47 A;  1OPF A;  3KFI A;  4D5U A;  3PQU A;  4O4O A;  1GT1 A;  4ZH9 A;  2POR A;  1X89 A;  1JJJ A;  3OBL A;  3AA0 A;  5AFU K;  4YDA A;  2M06 A;  3K3L A;  1KOI A;  1MX7 A;  5HZQ A;  1ZHT A;  2GTF X;  3BX8 A;  3PPT A;  3DA3 A;  1SXY A;  1RLB E;  4ZH6 A;  2X8S A;  1ZRY A;  4YKO A;  2X8F A;  1ORM A;  3WJG A;  3P6C A;  3LK3 A;  1QWD A;  1QY1 A;  1T68 X;  5DL6 A;  2FRS A;  3E3C A;  1KXO A;  3BRN A;  4BVM A;  3APU A;  1EXS A;  4I9R A;  5EED A;  5BVS A;  3T1D A;  4BOE A;  1ZNE A;  5BVQ A;  1BBP A;  3O19 A;  4HPB A;  5D45 A;  3SYS A;  3ELX A;  3WI5 A;  1U0X A;  3FEK A;  4ON1 A;  3RBH A;  3WJF A;  4O49 A;  1BSY A;  3Q6L A;  4L1N A;  5LJC A;  2XE2 A;  3NQK A;  1DV9 A;  2ZAI A;  1OEK A;  1AEL A;  1B56 A;  4IBA A;  2Q2P A;  1IKJ A;  1QFT A;  3B2H A;  4ORU A;  1GKA B;  1VYG A;  4TKJ A;  3FR4 A;  5HAE A;  1G7N A;  2KXP B;  1E06 A;  2XE5 A;  1JYJ A;  3FYX A;  3O2Y A;  3NPO A;  5JDP A;  1DZK A;  4ZHF A;  1TOU A;  4ALB A;  3AA1 B;  1IFB A;  4QYN A;  5D5D A;  1L6M A;  2A0A A;  3KFG A;  3PQS A;  3FR2 A;  1A18 A;  1GFN A;  4AKR B;  1ZNH A;  3I0A A;  4OS8 A;  3APX A;  5IO7 A;  5D48 A;  4IAX A;  4IMO A;  3IFB A;  4YFP A;  4RL9 A;  5AJC A;  3JS1 A;  3AA7 A;  4Y0Q A;  3WVM A;  1I05 A;  4AYE C;  1O8V A;  1XCA A;  2CBR A;  3LHN A;  2BT9 A;  4PJ2 A;  1AQB A;  5IO6 A;  1YP7 A;  5ADX K;  1DZJ A;  4C69 X;  2AT6 X;  3ELZ A;  4MIR A;  1BSO A;  2ZFG A;  1EW3 A;  1ALB A;  1PM1 X;  3APW A;  2A2U A;  3WXQ A;  2WEW A;  1HXT A;  2X27 X;  3P6D A;  4PSQ A;  3MX7 A;  2WSJ A;  3D95 A;  3HWD A;  1T8V A;  1LFO A;  4NYQ A;  1QG5 A;  1YP6 A;  4AFK A;  4YCH A;  3UPG A;  1ZNG A;  3BDR A;  1EPB A;  1KT6 A;  1ML7 A;  2KZ7 B;  3LK4 2;  4FZN A;  4A1H A;  5L8O A;  1DC9 A;  2G7B A;  1BWY A;  4ZJ0 A;  1CRB A;  4EDE A;  1SXU A;  1GT4 A;  3BU9 A;  5HZ9 A;  1MM4 A;  2J4U P;  3AAA A;  3WOV A;  4Z3T A;  3F8A A;  1O1U A;  4MVE A;  2RQ0 A;  1GT3 A;  4U8U O;  3EM0 A;  3UU2 A;  2HMB A;  4YGZ A;  4XMD A;  3QKG A;  3B2J A;  2R73 A;  3FEP A;  1OBP A;  4I6S A;  5K06 A;  4HWM A;  1NGL A;  5HCE C;  4GDZ A;  1GT5 A;  4N59 A;  4M6S A;  4AZR A;  4GRJ A;  4AUI A;  1IZN A;  1T0V A;  1OPB A;  4N7C A;  1MX8 A;  2QO6 A;  4YGG A;  3EBK A;  1BEB A;  4U8U M;  2XG6 A;  4FUV A;  3AA6 B;  3TZG A;  2G78 A;  4LSE A;  3KVD D;  3VU1 A;  5ADX L;  4AZM A;  3ZW1 A;  3P6G A;  3KZA A;  3G7X A;  3TGA A;  3NQ3 A;  4A1Y A;  2JW1 A;  1QAB E;  4O3Z A;  8PRN A;  2M4L A;  4ZHC A;  4LZV A;  1QJ9 A;  4IB7 A;  3EBW A;  3RBY A;  2AT5 X;  3VG7 A;  4XMF A;  4I9S A;  4LQZ A;  3WBG A;  4NLJ A;  3VE2 A;  4IMN A;  4M7M A;  1SY0 A;  3UEW A;  4KCA A;  1HMT A;  1VYF A;  4ZHD A;  4KR4 A;  4MIS A;  1EUO A;  3PH6 A;  3FMZ A;  3EMM A;  2CBS A;  4GF4 A;  4FZL A;  3TGC A;  1KGL A;  2Y0H A;  1OBU A;  1FE3 A;  1FTP A;  2AKQ A;  2G79 A;  2NND A;  5G26 A;  4KC7 A;  3T24 A;  3O0E A;  1ERX A;  3WJC A;  2AT0 X;  2NNQ A;  1O1V A;  1MPF A;  5BYP A;  4HFO A;  3WJB A;  3CQR A;  4FZM A;  4I3D A;  4CSB A;  1KZX A;  4XNK A;  1ZHW A;  2XKL A;  3JSQ A;  3STK A;  3C5O A;  1DZM A;  2KW1 A;  1SY2 A;  3VG4 A;  2KTD A;  4FGI B;  2O4V A;  4IB9 A;  3APV A;  1KT5 A;  2GC9 A;  1PEE A;  5L8N A;  1BXW A;  2WEX A;  5HZ8 A;  1IW2 A;  2J1N A;  2W81 C;  1HXX A;  5IYU A;  2K23 A;  3STN A;  4ZFX A;  2OMF A;  1SMP I;  2FGR A;  3DSZ A;  2F09 A;  1MVG A;  2L9C A;  2WQA E;  5EE2 A;  2E4J A;  3VG5 A;  4UU2 A;  4MVK A;  4EXZ A;  4N58 A;  1GFO A;  1YWD A;  5F7G A;  1CJ5 A;  2ERV A;  3NAD A;  4WBK A;  4WFU A;  4ES7 A;  3VZU X;  4JFB A;  3D96 A;  4U9C A;  3G7G A;  3OE3 A;  3WJE A;  5IO5 A;  3C76 X;  4GU8 A;  2X45 A;  4YGH A;  5FAZ A;  5B29 A;  2Y0K A;  4YFQ A;  3U03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...