3VE1A

The 2.9 angstrom crystal structure of transferrin binding protein b (tbpb) from serogroup b m982 neisseria meningitidis in complex with human transferrin
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
652
structure length
537
Chain Sequence
QGGYGFAMRLKRRNWYPGAEESEVKLNESDWEATGLPTKPKELPKRQKSVIEKVETDGDSDIYSSPYLTPSNHVNQPKNQATGHENFQYVYSGWFYKHAASEKDFSNKKIKSGDDGYIFYHGEKPSRQLPASGKVIYKGVWHFVTDTKKGQDFREIIQPSKKQGDRYSGFSGDGSEEYSNKNESTLKDDHEGYGFTSNLEVDFGNKKLTGKLIRNNASLNNNTNNDKHTTQYYSLDAQITGNRFNGTATATDKKENETKLHPFVSDSSSLSGGFFGPQGEELGFRFLSDDQKVAVVGSAKTKDKLSKLTTVLDAVELTLNDKKIKNLDNFSNAAQLVVDGIMIPLLPKDEFTRKFEHTPETKTYEVEVCCSNLNYLKYGMLTRKNQVEQSMFLQGERTDEKEIPTDQNVVYRGSWYGHIANGTSWSGNASDKEGGNRAEFTVNFADKKITGKLTAENRQAQTFTIEGMIQGNGFEGTAKTAESGFDLDRTPKAYITDAKVKGGFYGPKAEELGGWFAYPGDKASSATVVFGAKRQQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structural basis of transferrin sequestration by transferrin-binding protein B.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transport protein
molecule keywords Transferrin-binding protein 2
total genus 136
structure length 537
sequence length 652
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
A PF17483 TbpB_C C-lobe handle domain of Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.240 Mainly Beta Beta Barrel Lipocalin Lipocalin 3ve1A03
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 3ve1A01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 3ve1A04
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 3ve1A02
4O3ZA 2KC0A 3PQSA 5EE2A 4AYEC 4QQ1A 3KVDD 3VE2A 4O3WA 2Y7SA 4AYNA 2W81C 4O3YA 3PQUA 5T5FA 4O4UA 3V8UA 4AYDC 2KDYA 2LFUA 4O49A 3HOEA 4AYMC 2W80C 3UAQA 2YPVA 4AYID 4U9CA 3HOLA 4O3XB 3VE1A 4O4XA 1YS5A 4Z3TA
chains in the Genus database with same CATH superfamily
1JJUA 1GFQA 3K3LA 2DM5A 3VHIA 2LFOA 3C77X 2PORA 4KR4A 2WSJA 2ERVA 3APVA 3SLJA 2Q4NA 4LKTA 1ZNKA 3KZAA 4U9CA 3STMX 1O1VA 4QYNA 1FE3A 2QOMA 3BX8A 2IZIA 3FW4A 1QY2A 2BT9A 1LNMA 5T5FA 1JZUA 2ACOA 4RJWA 1IJ8A 1BM5A 1SWDA 2CM9A 4CPHA 2G7BA 3NBXX 2LA7A 1OBUA 4GHBA 1SWJA 2AKQA 4DQ4A 2R74A 4G76A 2QMIA 4AUIA 4MEEA 1G90A 4CSBA 2KZ7A 4RLBA 2QM9A 3T1DA 3MBTA 1KZXA 1SWQA 3T2XA 1KL5A 1UZ2X 2MHLA 3RBHA 2NNDA 4WFVA 4ZJ0A 4Z2OA 1LDOA 1MM5A 2WQAE 4I3DA 3VGWA 4Y5DA 4TLJA 4D6AA 4C00A 3UPGA 1ML7A 1SWUA 4GJVA 3FDCA 3RDMA 2W2FA 3IFBA 5H2FO 1GT4A 3VE1A 1S44A 1JJXA 4A1HA 2R89A 1EXSA 5IO5A 2DJGA 2XE2A 4GCSA 1TXLA 1P6PA 1H6S1 4GDAA 3DZMA 3B2IA 5DL6A 2L9CA 4WBKA 4B61A 4YFRA 2CBRA 4M7MA 3WYQA 4GETA 1X8PA 3KZIO 2AMMX 4AKMA 4AKRB 4IB8A 4AZPA 4Y0PA 2RA6A 4GJSA 3MX7A 1VWKB 4K19A 2PY1A 2W2AA 4Z27A 2IWWA 4XMFA 3O2YA 3FIQA 1HMSA 1X89A 5PRNA 3SZIA 1HXLA 5FENA 1BRQA 1LF7A 4NV7A 2GC9A 5IRAA 2K62A 3LK2A 3TGCA 5EEDA 2R88A 4YFQA 3FA8A 1N9YA 3EYCA 3P6FA 5D8JA 2G5LA 5IRWA 3ELXA 5LJBA 3ZI8A 5IRUA 2GTLO 5CYBA 1G7NA 3ZUOA 8PRNA 1NGLA 2X56A 2IZFB 1N4JA 2JMMA 4ES7A 2IZBA 2ZAIA 1BSOA 3DSZA 3PDFA 3TZGA 2RTCB 3A0BO 4FOZA 1SA8A 3VZUX 2POAA 1SY3A 2ZAGA 3D95A 3RSWA 1YUPA 4DQ3A 3QRCA 2W2BA 5LKEA 1UREA 4GGRA 3FENA 2Q2MA 4XMDA 1Y0GA 3SLOA 2M06A 2FGSA 2G78A 2R4PA 4I95A 4I3CA 2VFCA 1I4UA 4FUVA 3ZW1A 4QZTA 2FHLA 2IFBA 4U8UO 4LSEA 2F1TA 2ALLX 4D65A 2K4TA 2OY5O 4I3BA 3POUA 3T6FA 1EPBA 3WZPA 2HZQA 1NBXA 3EW1A 1OPAA 2YPVA 4BX7B 5F7GA 2JGSA 3WU2O 3CKGA 3VY9X 4ZR2A 1YWDA 4AZMA 4GNYA 4BX5A 4ZHGA 3SZHA 4FESA 2Y7SA 4PJ2A 4YKOA 5K68A 4A1YA 3PORA 4C5PA 2OFRX 1SY0A 2X9KA 2FTBA 1ZNHA 2QO5A 2X46A 4I6SA 1HMRA 2XE5A 1BSYA 3VE2A 2FGQX 1OEKA 1DFVA 2OL7A 3B2LA 5IO7A 1VPRA 2M4LA 4M6SA 3GP6A 4GNWA 2M07A 1EW3A 1I05A 4CDDA 5DPQA 2AXTO 2OVEA 5H9KA 3EW2A 1THQA 3U9PC 4LSHA 1MX8A 1D2UA 1DZKA 4NLIA 5EEEA 3WXQA 4QYPA 2BLGA 1L6MA 3APUA 4GUZA 5L8IA 1MVGA 5FQ6E 4HPCA 3JSQA 2OF8A 2A2GA 3WYPA 4Y59A 3S5XA 2WUTA 5F6ZA 1A57A 1HXXA 4KC7A 3GAQA 3KFGA 2X27X 1GT3A 4RLCA 2CZTA 3AKNA 4BJ8A 5F2BA 3D96A 4FSOA 4EEJA 4ORRA 2J4UP 3CBCA 2EU7X 2Q9SA 3D4RA 4MIRA 3L4RA 5DL5A 1Q9FA 4IB6A 1LPJA 6PRNA 3V8UA 3RWXA 1I06A 3KFFA 1GFNA 2MM3A 4HPBA 3WZOA 1SRIA 4KRAA 4Z28A 1SRFA 3VG3A 1LIDA 5BYPA 2NP1A 5IYUA 4U3QA 4JNJA 2AT5X 1KT5A 3WJGA 1KT3A 2BC3A 2CBSA 5AJCA 2WVPA 4N7DA 2IZJA 1PBOA 3PH5A 4U46A 3BRYA 3NX2A 4TKBA 3B2KA 5B5GA 1W5RA 2C1QA 4YKMA 1FTPA 1SY2A 5L8OA 1A18A 1E06A 2F1CX 2WR6A 3WI4A 4YCHA 2N2MA 1B4MA 5LJEA 1QJ9A 2CAMA 3BRZA 2WQ9A 4YFPA 1QQSA 1Z24A 1LUQA 4AZLA 5LKFA 2ASNX 4ZCBA 1B0OA 3TZSA 1SXYA 4C69X 1GXAA 4WFUA 5L3YA 3F6ZB 3LK2B 2HYSA 2R4NA 2GJ5A 1IFCA 1IIUA 1SWNA 2JOZA 1AVGI 4BX5B 2O4VA 5AJBA 1O1UA 4JHQA 1EUOA 4O3XB 1BXWA 3APWA 4DCBA 3BLGA 1S7DA 1MPFA 1MK5A 1BWYA 5HA0A 1SWKA 5GV0A 2XSTA 2NNEA 2JW1A 2FGRA 2AT3X 3O0EA 1SWBA 2IZGB 3TGAA 3PPTA 4GGTA 5BVQA 2OZQA 1EPAA 2RTRB 2PRNA 4EFGA 4IMOA 4MISA 2F73A 4FBOA 4AYMC 2WJRA 1KFFA 2RTPB 1SRHA 2AT8X 3FR4A 3BY0A 2HZRA 5JD2A 3PQSA 1JBHA 4Z6JA 1NQNA 4G75A 1VWOB 1DV9A 4C4VB 4O9SA 2IZDB 4LZUA 3PGUA 3RE6A 3A2SX 1LIEA 4QGWA 3SOTA 1VWDB 4ORUA 1JQPA 2RTNB 1Y9TA 4QRLA 4IMNA 2PI3O 2RTFB 2F1VA 1ORMA 2WJQA 3P02A 3OBLA 4CPHB 2FKJA 1HY2A 1GKAB 3AA6B 3AA6A 3FLLA 2JU3A 1EI5A 2FR3A 4EXZA 4BCSA 3STKA 3GE2A 3QKGA 1FDQA 1LELA 2K23A 2RTEB 4CK4A 2QTKA 2WWPA 3ELZA 4QGVA 2RD7C 3PP6A 4L1NA 2GTLN 2OVSA 1MDCA 1FENA 4MVEA 4ORSA 1EQDA 1AVDA 4JCHA 2RCQA 2Q2PA 2OFAA 1OPBA 3Q6LA 3BX7A 1QY1A 1I9HA 4KT5A 1HXTA 3NJTA 2CM4A 4FT6A 1H91A 3JS1A 4CV7A 4D5UA 1OEJA 1KZWA 2RTMA 2Z4HA 3AA7A 4GCPA 3AKMA 3BRNA 2Y32A 1ZHTA 1AQBA 1U17A 3K19A 1JIWI 2DJFA 3WJFA 2W80C 3UAQA 5HZ5A 3LK3B 3HOLA 2IZEB 1LCVA 1XKIA 2F01A 3BSZE 1SWTA 1G74A 1YP6A 1KL4A 1CBSA 1NQMA 1YIVA 1T1LA 4PSQA 1GT1A 2ANSA 3JQOA 2Y0LA 4ARHA 3OE3A 3WJCA 4YGZA 3PGRA 3DWOX 1I78A 4FZMA 2ZLDA 1RAVA 2HKDA 1TOWA 5LJGA 2XKLA 3C76X 2IZLB 5HZQA 1D3SA 5G38A 5LJKA 1IKJA 1IFBA 3KFIA 4EQAC 1ICNA 4GCQA 2VFBA 5HAEA 2BS6A 3LTWA 1EALA 4XMGA 1IZNA 1RXJA 2X32A 4D6BA 3G7GA 4IAXA 2JMBA 3UU2A 1CRBA 1RBPA 2KD2A 4RUUA 1OSPO 1AB0A 1FJ1E 2OMFA 2L67A 4GKCA 4OS0A 3PRNA 2L5PA 4OEMA 5EDCA 2C1SA 3NX1A 2C4IA 2ACPX 5D5DA 3LV4A 2X45A 2RTOB 5DG4A 3HPEA 3ZZVA 2X55A 4FSPA 3EMMA 1SXWA 1U18A 5EZ2A 3C5OA 4LSFA 5IXGA 3BU9A 2G79A 3VHHA 4QQ1A 5H9NA 2GTLM 1SLFB 1MEPA 4IBAA 3CWKA 4QNIA 1X8OA 2R56A 2OY1O 1R0UA 4L3RA 1VWQB 5FVNA 1HQQA 3H3IA 4XMEA 3X00A 1QY0A 5HCCC 1IKEA 1P4TA 3SY7A 4ML7B 3NSGA 1LCWA 4UU3A 4JGLA 2MJIA 1SRJA 3FYFA 4O4SA 2IZKA 3A0HO 5F6BA 2JQYA 5BVTA 4NV8A 3HWFA 2AF5A 3T0SA 2JN3A 4KR8A 1QWDA 2A13A 4AW8A 3UEWA 5D45A 3RDXA 3CQRA 3POQA 5KICA 1PMPA 2RTDB 4N59A 4AFKA 4BUMX 5HCDC 4GK9A 4MVLA 3VG5A 3UEUA 4KIIA 1ZNLA 3IA8A 1QFTA 4I60A 5FQ7E 1OEEA 3TF6A 4BQUA 1HMTA 2CZUA 3EBWA 4NP1A 1DF3A 1GX8A 2YMSA 1ZNEA 3ZUIA 3PECA 2ODJA 5DL8A 4Y0SA 3B2HA 4JFBA 1ZNDA 5FQ8E 1E54A 4EDEA 4LSIA 3FA6A 5BVSA 1GFMA 4D64A 1SWHA 1PEEA 1LICA 1W6FA 4GU8A 2X8SA 3N91A 4AKRA 2XMXA 3WZNA 2WPUA 5E79O 4NW4A 4KCAA 3FEKA 4FQBB 4KH8A 1JJJA 4FRXA 2FWVA 5ADXK 4FZLA 1W4TA 1ERXA 2LHFA 1SMPI 1LDQA 5HCEC 2XG6A 1CBIA 4AYHA 3Q34A 4ZHHA 1GX9A 2IZHB 2GE4A 1VYGA 2KXPA 2KXPB 2KTSA 5B66O 3NP1A 4YBUA 1HXZA 3FA9A 2GTFX 1HBPA 1ZHXA 5B5FA 1U0XA 2QO4A 4AZOA 2OFMX 1VWRB 3NPOA 4AYDC 3RY1A 2LFUA 4FRTA 2MHDA 3ZW0B 1CJ5A 3NQKA 4QAEA 1T16A 4E1SA 2OVDA 1PTSA 4ZHFA 4NNSA 1YWBA 4LZVA 3SYSA 1VWAB 1K3BA 4OS3A 4PR7A 2Y3EA 3WVMA 1RXHA 4OKAA 3VG2A 2AL0X 3P24A 4HPDA 2BS5A 4E1TA 4N58A 3S60A 1MM4A 4IL6O 3POXA 1QG5A 3AA7B 1HQPA 3ZW1B 4BVMA 4FZNA 4O3YA 3WJBA 1PRNA 1Y53X 1RLBE 4IAWA 1SWGA 1MOYA 4GRJA 1HN2A 4NYQA 4PJ0O 2YNKA 1Y55X 5CSEA 2R8AA 2K0LA 1UYOX 5IO6A 2A5CA 5CE4A 1B56A 5H9AA 5LJCA 3MVFA 2BSZA 4N75A 4UB6O 4BX6B 2HLVA 3FMZA 4MVKA 1RSUB 4YMYA 3FR2A 4FBVA 1KT7A 2QCBA 2OVAA 1GX3A 4OELA 5EPQA 5HTDA 3MG5A 3AA1A 1BSQA 1A3YA 4YDBA 3NADA 4NLJA 5EDBA 3O22A 3P6GA 3O19A 2LKKA 1STSB 4XNKA 2I5VO 4CPFA 4O3ZA 1FEMA 1HXUA 1SWRA 4TQ2A 3ZQ3A 1SWEA 4YDAA 1ADLA 4INNA 5HWZA 1WUBA 1NP4A 3AAAB 4ALBA 1CBQA 1E2TA 1KGLA 4NNTA 4YCEA 2RTAA 2A8GA 4COTA 1N7YA 2KZ7B 1VWGB 3FW5A 1SWPA 3VY8X 3CBSA 3WOVA 4ODDA 4ON1A 3WBGA 5D4AA 4ID2A 1EIOA 2E4JA 4ZGUA 1SWOA 3WJEA 1PHOA 2RTKA 3BDRA 5K06A 2KDYA 2FS6A 2A2UA 2J1NA 2X8TA 1TOUA 5TISO 3SLTA 3SZDA 2ZFGA 1YP7A 3WZQA 2JU8A 1VWNB 4I9SA 3APXA 5JR8A 1VWEB 3VU1A 2R4LA 2RTGB 1RSTB 1G5WA 2XE3A 3FYXA 3SZVA 2Y2XA 3I17A 4MVIA 3JTYA 4JO6A 4TKJA 3T6LA 3CQNA 3HOEA 1X8UA 1KT4A 1SXXA 1JMXA 5HBSA 1ALBA 3BS2A 1YS5A 5B2AO 1T8VA 1VWHB 4AYEC 4GE1A 4CDEA 2X4MA 2A0AA 2RCTA 2RN4A 2KT4B 1ZHYA 3PH6A 3SAOA 5F58A 1SLGB 4RL9A 1YWCA 4A60A 1BLRA 2F09A 2OY8A 3ZWEA 5D48A 1KT6A 5G26A 1ZRYA 4IRWA 3AAAA 2QOSC 3VG7A 3SYBA 2RTLA 1BJ7A 3LHNA 1JV4A 3LK41 4YBPA 5KIDA 3KQ0A 3HWEA 2L68A 2AT0X 2FLJA 2AVIA 1OPFA 5EE2A 3PK2A 4FQEA 3KVDD 1JYDA 4N74A 5JDPA 1MM9A 1VWLB 3U03A 4Y0QA 1KL3A 2MNHA 4TJZA 4GD9A 4ALOA 2I5ZO 1ERBA 5AFUL 4DNEA 1AELA 2FR2A 5H8TA 2G8CO 5B10O 2RTJA 3RBYA 1WBIA 2RTIB 3FIDA 3B2JA 1GGLA 3RE5A 3NQ3A 1VYOA 4OMWA 2N2LA 3RZYA 2KC0A 1X8NA 1T0VA 1SLEB 4U8UN 1ZNGA 5ADXL 4WHIA 1OBQA 5KAFO 2IZAA 5B11O 2XTRA 4GH7A 3NR3A 3HWBA 4UB8O 4LQZA 3UEVA 1GKAA 4ZFXA 4OS8A 4CPEA 3FA7A 5KHPA 4K3BA 1JYJA 2UYWA 3AAEB 1BRPA 2WEWA 4BGFA 2X34A 1QJ8A 4N7CA 1FELA 4QZUA 3E3CA 3AA0B 3DA3A 4F4BA 2OY7A 3PF1A 4U8UM 1KXOA 1LIBA 1ACDA 3C78X 3VPJE 4ORXA 5G39A 2Z4IA 3TGBA 2ZSCA 4XMHA 4YH0A 1SY1A 2OYBO 2LBVA 3QQ2A 1RXKA 3HWGA 1IZNB 5LJDA 3ZW0A 2FRSA 4QGXA 4XNLA 1I04A 1DZJA 3NQ9A 1LIFA 5B5EO 4GGZA 4ZH6A 3RY2A 4AYID 1IW2A 3FEPA 4BX6A 1LFOA 3SY9A 1DF8A 5D47A 1S5LO 2NNQA 3RKGA 3AA0A 4Y0RA 1ZHWA 2OL6O 1VWBB 3OJYC 1PBYA 2Y0HA 3PQUA 2RTBB 3KVNA 2R73A 1X8QA 1VWCB 3VHMA 4PUXA 3WJDA 4ORYA 2UZ2A 3RDUA 3G7XA 4YGHA 3P6EA 2IWVA 1NP1A 4CDFA 4RJXA 3RDOA 1DZMA 2O62A 3QRAA 1LKEA 5KAIO 4UU2A 3AEHA 2IZCB 4AZNA 2A5BA 2WEXA 3MM0A 1VWFB 5B27A 3WI5A 5C0NA 4BX7A 2RQ0A 3FELA 1A2DA 2Y3FA 3OD9A 3DA4A 2MF6A 1KQXA 2FKGA 2Q39A 5GTHO 2RTHB 3P6CA 3EBKA 3PGSA 1B8EA 1GFOA 4XMCA 4C4VA 1S2PA 3F9DA 1SXUA 1QABE 1Y52X 2HMBA 3AAEA 1XCAA 1ICMA 1BEBA 5DL7A 5AEOA 4HFOA 4EKVA 4LKPA 1TW4A 1G85A 1BBPA 1E02A 1SLDB 3BS0A 4YVBA 2FHNX 1T68X 3T24A 1VWJB 4KC8A 2OFBA 1DZPA 2P8GA 4IABA 1MUPA 3D97A 1OSMA 4Z3TA 3S5VA 3HWDA 1UYNX 4CTDA 3VG4A 5HTEA 4YGGA 1YWAA 4ZGFA 1BH3A 1N0SA 2KW1A 4K3CA 3CR6A 1KQWA 3CKFA 5K67A 4GDZA 1OBPA 1NDJA 4CPIA 3CMPA 1PM1X 1CBRA 2OF9A 3UEXA 4CDCA 1Y9LA 5HA1A 5G3AA 1JMZA 3RDSA 1VWPB 3AUMO 2FS7A 2FT9A 1AVEA 4Z2PA 2HNXA 4B55A 5HZ6A 4A8ZA 4ZHCA 4FBRA 2XE1A 2LB6A 4R0BA 1E5PA 1KOIA 1SWSA 3P6DA 4RUNA 4OMXA 3EM0A 5AQ6A 1SWLA 5HZ8A 1QFVA 1STPA 4Z2VA 3U0DA 3T20A 2A3FX 1VWMB 5B3MO 5LJHA 3VZTX 3VG6A 2MO5A 4HPAA 2OL8O 5FAZA 2AH7X 3AA1B 1GM6A 3LK42 3EMNX 1NC9A 2N93A 1SRGA 3D9WA 4TNNA 4BOEA 1QJPA 1SWCA 4AZQA 1GT5A 1LCZA 1SREA 1Q9GA 3EC5A 1SWAA 2YG2A 4GZVA 3FR5A 5FFHA 4IB7A 1E00A 1EIIA 4GF4A 2R4OA 1X71A 3ZW2A 5F1EA 3SZJA 1DC9A 3HW9A 4ZHDA 4TKHA 3STNA 2JU7A 1GFPA 2QO6A 5AFUK 1VYFA 2XTQA 3KFHA 2W81C 1N9MA 2GH7A 1HBQA 3DWNA 5B29A 4BBOA 4ORWA 1TVQA 4HWMA 3F8AA 2AT6X 3HTYA 1VWIB 3LK3A 1O8VA 3P6HA 4I9RA 2X8FA 1MX7A 5HZ9A 2RTQB 1BT9A 2LBAA 3DTQA 3I0AA 3RDQA 3PEDA 3T2WA 4NYRA 3HK1A 2BHVA 4AZRA 2MWHA 7PRNA 4IB9A 4ZH9A 1STRB 5CHKA 2KTDA 2Y0KA 4O4OA 4O3WA 4FGIB 5GTIO 4AYNA 1ZHZA 1N43A 3S26A 4O4UA 4FMSA 3JCUO 1K24A 4O49A 5H9LA 2VDFA 1SWFA 5L8NA 3VZWX 3BU1A 4O4XA
chains in the Genus database with same CATH topology
5AFUL 3T0SA 1PBOA 3PH5A 1GFQA 3NX2A 4TKBA 3B2KA 2JN3A 3K3LA 1AELA 2DM5A 4KR8A 2FR2A 1QWDA 5H8TA 2LFOA 2A13A 4YKMA 4AW8A 3C77X 3UEWA 2PORA 5D45A 3RBYA 1FTPA 4KR4A 1SY2A 3CQRA 2WSJA 2ERVA 3APVA 8PRNA 2Q4NA 3B2JA 5L8OA 1A18A 1E06A 4LKTA 1PMPA 5KICA 3POQA 4N59A 1ZNKA 4AFKA 4BUMX 5HCDC 2WR6A 3KZAA 1GGLA 4YCHA 3WI4A 3NQ3A 4U9CA 4OMWA 4GK9A 2N2LA 2N2MA 3STMX 3RZYA 1B4MA 2KC0A 1X8NA 1O1VA 4MVLA 5LJEA 4QYNA 1FE3A 1QJ9A 3VG5A 1T0VA 3UEUA 3BX8A 1ZNLA 4KIIA 3IA8A 1QFTA 2WQ9A 4YFPA 1QQSA 1Z24A 3FW4A 4AZLA 1QY2A 2BT9A 1LNMA 1OEEA 4U8UN 5FQ7E 3TF6A 1ZNGA 4BQUA 1HMTA 2CZUA 1JZUA 5T5FA 5ADXL 4WHIA 1OBQA 3EBWA 5LKFA 2ASNX 4ZCBA 2ACOA 1B0OA 4NP1A 1DF3A 4RJWA 2XTRA 4GH7A 3NR3A 3TZSA 1BM5A 3HWBA 4LQZA 1SXYA 4C69X 3UEVA 1GKAA 1GXAA 4ZFXA 4OS8A 1GX8A 3FA7A 4WFUA 2YMSA 1ZNEA 3ZUIA 2CM9A 3F6ZB 5KHPA 3PECA 3LK2B 2HYSA 2G7BA 1JYJA 2ODJA 3NBXX 3AAEB 5DL8A 2LA7A 1OBUA 2GJ5A 4Y0SA 3B2HA 4JFBA 4GHBA 1BRPA 2AKQA 1ZNDA 2WEWA 5FQ8E 4DQ4A 1E54A 1IFCA 2R74A 1IIUA 4EDEA 1QJ8A 3FA6A 4G76A 4LSIA 4N7CA 5BVSA 2QMIA 4AUIA 2JOZA 1FELA 1G90A 4CSBA 4QZUA 2KZ7A 1AVGI 1GFMA 4D64A 4RLBA 3E3CA 2QM9A 1PEEA 3T1DA 3MBTA 1KZXA 3AA0B 2O4VA 5AJBA 3DA3A 4F4BA 1O1UA 1UZ2X 1EUOA 1LICA 4O3XB 2MHLA 1BXWA 3RBHA 3APWA 4U8UM 3BLGA 1KXOA 2NNDA 4WFVA 4ZJ0A 4GU8A 1S7DA 1LIBA 1MM5A 1ACDA 1MPFA 1BWYA 2WQAE 3C78X 4I3DA 2X8SA 3N91A 3VPJE 5HA0A 4AKRA 4TLJA 4ORXA 4D6AA 3UPGA 1ML7A 5GV0A 2XMXA 2XSTA 2NNEA 2Z4IA 3TGBA 2JW1A 2W2FA 4XMHA 3IFBA 4YH0A 1SY1A 2FGRA 4NW4A 2AT3X 1GT4A 3O0EA 4KCAA 3VE1A 1S44A 3FEKA 4FQBB 2LBVA 1JJXA 4A1HA 3TGAA 3PPTA 3HWGA 4KH8A 1EXSA 5IO5A 5LJDA 1JJJA 1IZNB 4FRXA 2FWVA 3ZW0A 2XE2A 2FRSA 5ADXK 4GCSA 4QGXA 4XNLA 1I04A 1TXLA 5BVQA 4FZLA 1P6PA 1H6S1 2OZQA 1DZJA 1EPAA 3NQ9A 1ERXA 1LIFA 3B2IA 2LHFA 1SMPI 2L9CA 4WBKA 2PRNA 5DL6A 4B61A 4EFGA 4YFRA 2CBRA 5HCEC 2XG6A 1CBIA 4M7MA 4IMOA 4MISA 4AYHA 4ZHHA 2F73A 4ZH6A 4FBOA 1GX9A 4AYMC 2AT8X 2GE4A 3FR4A 3BY0A 4GETA 1IW2A 1VYGA 4AYID 3FEPA 2HZRA 1X8PA 2KXPA 2KXPB 2KTSA 1LFOA 3NP1A 3SY9A 2AMMX 4AKMA 3PQSA 4YBUA 5D47A 1JBHA 2NNQA 3RKGA 4AKRB 4IB8A 4AZPA 3FA9A 3AA0A 4Y0RA 2GTFX 4G75A 1ZHWA 1HBPA 4Y0PA 1ZHXA 3OJYC 2QO4A 1U0XA 4AZOA 2RA6A 2Y0HA 2OFMX 1DV9A 3PQUA 4O9SA 3NPOA 4LZUA 3MX7A 4K19A 2PY1A 2W2AA 4AYDC 2LFUA 2R73A 2MHDA 4FRTA 3A2SX 1X8QA 1LIEA 3ZW0B 4PUXA 1CJ5A 4XMFA 3NQKA 3O2YA 4QAEA 4QGWA 3SOTA 4E1SA 3WJDA 4ORYA 4ORUA 2OVDA 3G7XA 4YGHA 4ZHFA 4NNSA 1YWBA 3P6EA 1NP1A 4RJXA 1Y9TA 4LZVA 4QRLA 1DZMA 2O62A 3FIQA 4IMNA 3QRAA 3SYSA 1HMSA 1X89A 1LKEA 4OS3A 5PRNA 5FENA 2F1VA 1BRQA 1ORMA 4UU2A 1LF7A 2GC9A 3P02A 2K62A 4AZNA 3WVMA 3LK2A 3OBLA 2WEXA 3TGCA 5EEDA 3VG2A 4YFQA 5B27A 1GKAB 3WI5A 5C0NA 2AL0X 3FA8A 3AA6B 3FLLA 2JU3A 2RQ0A 3FELA 3AA6A 1EI5A 3P24A 1A2DA 2FR3A 3EYCA 3OD9A 3DA4A 4HPDA 2BS5A 3P6FA 4EXZA 1KQXA 5D8JA 4E1TA 4N58A 3S60A 2Q39A 3ELXA 3STKA 5LJBA 1MM4A 3ZI8A 2GTLO 3GE2A 3QKGA 3POXA 1QG5A 1G7NA 1FDQA 3EBKA 3P6CA 5CYBA 3ZUOA 1B8EA 1NGLA 1GFOA 3AA7B 3VZUX 1HQPA 4XMCA 3ZW1B 4BVMA 2K23A 4FZNA 4O3YA 1S2PA 3F9DA 4CK4A 2JMMA 4ES7A 1SXUA 3G7GA 3WJBA 1PRNA 2QTKA 2WWPA 2ZAIA 1QABE 1BSOA 1RLBE 3ELZA 4IAWA 2HMBA 3DSZA 4QGVA 2RD7C 3PP6A 3AAEA 3TZGA 4FOZA 1XCAA 4L1NA 1SA8A 2GTLN 2OVSA 1HN2A 1ICMA 1MDCA 2POAA 4GRJA 4NYQA 1BEBA 1SY3A 2ZAGA 2YNKA 3D95A 1FENA 4MVEA 5DL7A 5AEOA 4HFOA 3RSWA 4ORSA 4LKPA 1EQDA 2K0LA 1TW4A 1YUPA 4DQ3A 3QRCA 4JCHA 2RCQA 2Q2PA 5CE4A 1G85A 1B56A 5H9AA 5IO6A 1OPBA 5LJCA 3MVFA 2W2BA 1BBPA 1E02A 3Q6LA 5LKEA 3BX7A 1QY1A 1UREA 3FENA 4KT5A 1HXTA 2Q2MA 2CM4A 4FT6A 4XMDA 2HLVA 3FMZA 1T68X 3T24A 4MVKA 2M06A 4YMYA 2G78A 3FR2A 4KC8A 1H91A 4FBVA 4I95A 1KT7A 3JS1A 1DZPA 4CV7A 2OVAA 2P8GA 4I3CA 4IABA 1MUPA 4D5UA 3D97A 1OSMA 4Z3TA 3S5VA 3HWDA 1I4UA 1OEJA 5EPQA 1KZWA 4FUVA 2Z4HA 3VG4A 5HTEA 3ZW1A 5HTDA 3AA7A 4QZTA 4YGGA 1YWAA 4GCPA 3AKMA 3BRNA 3AA1A 2IFBA 4U8UO 1BSQA 1ZHTA 4ZGFA 4LSEA 1AQBA 1BH3A 1A3YA 1N0SA 2KW1A 2F1TA 2ALLX 4YDBA 4D65A 2K4TA 1U17A 3NADA 4NLJA 4I3BA 3POUA 3K19A 5EDBA 3O22A 1JIWI 1EPBA 3CR6A 1KQWA 3P6GA 4GDZA 1OBPA 2HZQA 3WJFA 1OPAA 3O19A 2W80C 3UAQA 3CMPA 5HZ5A 2YPVA 1PM1X 2LKKA 1CBRA 5F7GA 3LK3B 4XNKA 3HOLA 3UEXA 4O3ZA 1XKIA 3VY9X 1FEMA 1HXUA 4ZR2A 4TQ2A 1YWDA 3BSZE 3ZQ3A 4GNYA 4AZMA 4ZHGA 1Y9LA 5HA1A 1G74A 4FESA 2Y7SA 1YP6A 4PJ2A 1ADLA 4YDAA 4YKOA 4A1YA 2FS7A 2FT9A 2HNXA 4INNA 2OFRX 3PORA 1CBSA 1YIVA 5HWZA 1SY0A 1NP4A 4PSQA 4ALBA 3AAAB 1GT1A 2ANSA 5HZ6A 1CBQA 4A8ZA 3JQOA 4ZHCA 1KGLA 4NNTA 2Y0LA 4ARHA 2FTBA 4FBRA 3OE3A 4YCEA 2LB6A 1ZNHA 2QO5A 4YGZA 3WJCA 2XE1A 4COTA 4FZMA 2X46A 4I6SA 4R0BA 2KZ7B 1E5PA 1HMRA 1KOIA 3P6DA 4RUNA 2ZLDA 3FW5A 4OMXA 2XE5A 3EM0A 5AQ6A 1TOWA 1BSYA 5LJGA 3VY8X 3CBSA 2XKLA 5HZ8A 4ODDA 4ON1A 1QFVA 3VE2A 3WBGA 5D4AA 4ID2A 3C76X 3WOVA 1EIOA 3U0DA 1OEKA 2E4JA 4ZGUA 2A3FX 2FGQX 3T20A 3WJEA 1PHOA 5HZQA 5LJHA 3BDRA 3VZTX 1D3SA 3VG6A 2MO5A 5K06A 2KDYA 1DFVA 2FS6A 4HPAA 2A2UA 3B2LA 2J1NA 5FAZA 2X8TA 2AH7X 5LJKA 3AA1B 1GM6A 1TOUA 1IKJA 1IFBA 1VPRA 5IO7A 3LK42 3KFIA 3EMNX 2M4LA 4M6SA 3GP6A 4GNWA 4EQAC 1ICNA 3SZDA 2M07A 4GCQA 1EW3A 2ZFGA 2N93A 1I05A 1YP7A 5DPQA 2JU8A 4I9SA 3APXA 5JR8A 4TNNA 2OVEA 5H9KA 4BOEA 3VU1A 2BS6A 5HAEA 1QJPA 1THQA 4AZQA 3U9PC 1EALA 1G5WA 1MX8A 4LSHA 1GT5A 4XMGA 2XE3A 1IZNA 3FYXA 3SZVA 1D2UA 3I17A 1DZKA 1Q9GA 4MVIA 2Y2XA 3JTYA 4NLIA 4D6BA 5EEEA 2YG2A 4GZVA 2JMBA 3FR5A 4IAXA 4IB7A 4QYPA 4TKJA 5FFHA 3WXQA 3UU2A 1CRBA 1E00A 2BLGA 3CQNA 1EIIA 1RBPA 1L6MA 3HOEA 2KD2A 1X8UA 4RUUA 3APUA 1AB0A 1KT4A 4GF4A 1X71A 5L8IA 1SXXA 2OMFA 2L67A 3ZW2A 1MVGA 4GKCA 5HBSA 1ALBA 3BS2A 4OS0A 5FQ6E 1YS5A 5F1EA 1T8VA 3PRNA 1DC9A 3HW9A 2L5PA 4ZHDA 4TKHA 4AYEC 3STNA 4HPCA 4GE1A 5EDCA 2JU7A 3JSQA 3NX1A 2ACPX 2QO6A 1GFPA 5D5DA 3LV4A 2A2GA 5AFUK 1VYFA 2A0AA 2RCTA 2XTQA 2X45A 2RN4A 2KT4B 3S5XA 1ZHYA 3KFHA 2WUTA 5F6ZA 1A57A 3PH6A 2W81C 3SAOA 1HXXA 1HBQA 4KC7A 5DG4A 5F58A 3ZZVA 3GAQA 3KFGA 4FSPA 3EMMA 4RL9A 1YWCA 5B29A 1SXWA 1U18A 5EZ2A 2X27X 3C5OA 1GT3A 4A60A 1BLRA 4LSFA 2F09A 4ORWA 4RLCA 3ZWEA 1TVQA 2CZTA 4HWMA 3F8AA 3AKNA 5D48A 2AT6X 3HTYA 1KT6A 5G26A 1ZRYA 3D96A 3BU9A 3AAAA 2G79A 2QOSC 4FSOA 4EEJA 3LK3A 4QQ1A 4ORRA 5H9NA 3VG7A 1O8VA 2GTLM 2J4UP 3P6HA 4I9RA 3CBCA 3SYBA 1BJ7A 2EU7X 2Q9SA 3D4RA 1JV4A 2X8FA 3LHNA 1MX7A 3L4RA 4MIRA 3LK41 4IBAA 4YBPA 1Q9FA 5DL5A 4IB6A 5HZ9A 3CWKA 4QNIA 1LPJA 1X8OA 2LBAA 1BT9A 3DTQA 5KIDA 3V8UA 6PRNA 3KQ0A 3I0AA 2R56A 3PEDA 3HWEA 3RWXA 1I06A 3KFFA 2L68A 4NYRA 3HK1A 2BHVA 4AZRA 2AT0X 2MWHA 1GFNA 2MM3A 4HPBA 2FLJA 1R0UA 4IB9A 4ZH9A 7PRNA 1OPFA 4L3RA 2KTDA 5EE2A 4KRAA 2Y0KA 5FVNA 3H3IA 1JYDA 4O4OA 4XMEA 1QY0A 3KVDD 5HCCC 4O3WA 1IKEA 5JDPA 4FGIB 3VG3A 4AYNA 1P4TA 3SY7A 1ZHZA 1LIDA 3U03A 4ML7B 3S26A 4O4UA 2NP1A 5BYPA 3NSGA 4Y0QA 4UU3A 4JGLA 4FMSA 5IYUA 4U3QA 2MJIA 4O49A 2AT5X 5H9LA 3FYFA 1KT5A 2MNHA 4O4SA 4TJZA 3WJGA 1KT3A 5L8NA 2CBSA 4ALOA 3VZWX 5AJCA 5F6BA 3BU1A 1ERBA 4O4XA 4N7DA 5BVTA 3HWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O3Z A;  2KC0 A;  3PQS A;  5EE2 A;  4AYE C;  4QQ1 A;  3KVD D;  3VE2 A;  4O3W A;  2Y7S A;  4AYN A;  2W81 C;  4O3Y A;  3PQU A;  5T5F A;  4O4U A;  3V8U A;  4AYD C;  2KDY A;  2LFU A;  4O49 A;  3HOE A;  4AYM C;  2W80 C;  3UAQ A;  2YPV A;  4AYI D;  4U9C A;  3HOL A;  4O3X B;  3VE1 A;  4O4X A;  1YS5 A;  4Z3T A; 
#chains in the Genus database with same CATH topology
 1JJU A;  1GFQ A;  3K3L A;  2DM5 A;  3VHI A;  2LFO A;  3C77 X;  2POR A;  4KR4 A;  2WSJ A;  2ERV A;  3APV A;  3SLJ A;  2Q4N A;  4LKT A;  1ZNK A;  3KZA A;  4U9C A;  3STM X;  1O1V A;  4QYN A;  1FE3 A;  2QOM A;  3BX8 A;  2IZI A;  3FW4 A;  1QY2 A;  2BT9 A;  1LNM A;  5T5F A;  1JZU A;  2ACO A;  4RJW A;  1IJ8 A;  1BM5 A;  1SWD A;  2CM9 A;  4CPH A;  2G7B A;  3NBX X;  2LA7 A;  1OBU A;  4GHB A;  1SWJ A;  2AKQ A;  4DQ4 A;  2R74 A;  4G76 A;  2QMI A;  4AUI A;  4MEE A;  1G90 A;  4CSB A;  2KZ7 A;  4RLB A;  2QM9 A;  3T1D A;  3MBT A;  1KZX A;  1SWQ A;  3T2X A;  1KL5 A;  1UZ2 X;  2MHL A;  3RBH A;  2NND A;  4WFV A;  4ZJ0 A;  4Z2O A;  1LDO A;  1MM5 A;  2WQA E;  4I3D A;  3VGW A;  4Y5D A;  4TLJ A;  4D6A A;  4C00 A;  3UPG A;  1ML7 A;  1SWU A;  4GJV A;  3FDC A;  3RDM A;  2W2F A;  3IFB A;  5H2F O;  1GT4 A;  3VE1 A;  1S44 A;  1JJX A;  4A1H A;  2R89 A;  1EXS A;  5IO5 A;  2DJG A;  2XE2 A;  4GCS A;  1TXL A;  1P6P A;  1H6S 1;  4GDA A;  3DZM A;  3B2I A;  5DL6 A;  2L9C A;  4WBK A;  4B61 A;  4YFR A;  2CBR A;  4M7M A;  3WYQ A;  4GET A;  1X8P A;  3KZI O;  2AMM X;  4AKM A;  4AKR B;  4IB8 A;  4AZP A;  4Y0P A;  2RA6 A;  4GJS A;  3MX7 A;  1VWK B;  4K19 A;  2PY1 A;  2W2A A;  4Z27 A;  2IWW A;  4XMF A;  3O2Y A;  3FIQ A;  1HMS A;  1X89 A;  5PRN A;  3SZI A;  1HXL A;  5FEN A;  1BRQ A;  1LF7 A;  4NV7 A;  2GC9 A;  5IRA A;  2K62 A;  3LK2 A;  3TGC A;  5EED A;  2R88 A;  4YFQ A;  3FA8 A;  1N9Y A;  3EYC A;  3P6F A;  5D8J A;  2G5L A;  5IRW A;  3ELX A;  5LJB A;  3ZI8 A;  5IRU A;  2GTL O;  5CYB A;  1G7N A;  3ZUO A;  8PRN A;  1NGL A;  2X56 A;  2IZF B;  1N4J A;  2JMM A;  4ES7 A;  2IZB A;  2ZAI A;  1BSO A;  3DSZ A;  3PDF A;  3TZG A;  2RTC B;  3A0B O;  4FOZ A;  1SA8 A;  3VZU X;  2POA A;  1SY3 A;  2ZAG A;  3D95 A;  3RSW A;  1YUP A;  4DQ3 A;  3QRC A;  2W2B A;  5LKE A;  1URE A;  4GGR A;  3FEN A;  2Q2M A;  4XMD A;  1Y0G A;  3SLO A;  2M06 A;  2FGS A;  2G78 A;  2R4P A;  4I95 A;  4I3C A;  2VFC A;  1I4U A;  4FUV A;  3ZW1 A;  4QZT A;  2FHL A;  2IFB A;  4U8U O;  4LSE A;  2F1T A;  2ALL X;  4D65 A;  2K4T A;  2OY5 O;  4I3B A;  3POU A;  3T6F A;  1EPB A;  3WZP A;  2HZQ A;  1NBX A;  3EW1 A;  1OPA A;  2YPV A;  4BX7 B;  5F7G A;  2JGS A;  3WU2 O;  3CKG A;  3VY9 X;  4ZR2 A;  1YWD A;  4AZM A;  4GNY A;  4BX5 A;  4ZHG A;  3SZH A;  4FES A;  2Y7S A;  4PJ2 A;  4YKO A;  5K68 A;  4A1Y A;  3POR A;  4C5P A;  2OFR X;  1SY0 A;  2X9K A;  2FTB A;  1ZNH A;  2QO5 A;  2X46 A;  4I6S A;  1HMR A;  2XE5 A;  1BSY A;  3VE2 A;  2FGQ X;  1OEK A;  1DFV A;  2OL7 A;  3B2L A;  5IO7 A;  1VPR A;  2M4L A;  4M6S A;  3GP6 A;  4GNW A;  2M07 A;  1EW3 A;  1I05 A;  4CDD A;  5DPQ A;  2AXT O;  2OVE A;  5H9K A;  3EW2 A;  1THQ A;  3U9P C;  4LSH A;  1MX8 A;  1D2U A;  1DZK A;  4NLI A;  5EEE A;  3WXQ A;  4QYP A;  2BLG A;  1L6M A;  3APU A;  4GUZ A;  5L8I A;  1MVG A;  5FQ6 E;  4HPC A;  3JSQ A;  2OF8 A;  2A2G A;  3WYP A;  4Y59 A;  3S5X A;  2WUT A;  5F6Z A;  1A57 A;  1HXX A;  4KC7 A;  3GAQ A;  3KFG A;  2X27 X;  1GT3 A;  4RLC A;  2CZT A;  3AKN A;  4BJ8 A;  5F2B A;  3D96 A;  4FSO A;  4EEJ A;  4ORR A;  2J4U P;  3CBC A;  2EU7 X;  2Q9S A;  3D4R A;  4MIR A;  3L4R A;  5DL5 A;  1Q9F A;  4IB6 A;  1LPJ A;  6PRN A;  3V8U A;  3RWX A;  1I06 A;  3KFF A;  1GFN A;  2MM3 A;  4HPB A;  3WZO A;  1SRI A;  4KRA A;  4Z28 A;  1SRF A;  3VG3 A;  1LID A;  5BYP A;  2NP1 A;  5IYU A;  4U3Q A;  4JNJ A;  2AT5 X;  1KT5 A;  3WJG A;  1KT3 A;  2BC3 A;  2CBS A;  5AJC A;  2WVP A;  4N7D A;  2IZJ A;  1PBO A;  3PH5 A;  4U46 A;  3BRY A;  3NX2 A;  4TKB A;  3B2K A;  5B5G A;  1W5R A;  2C1Q A;  4YKM A;  1FTP A;  1SY2 A;  5L8O A;  1A18 A;  1E06 A;  2F1C X;  2WR6 A;  3WI4 A;  4YCH A;  2N2M A;  1B4M A;  5LJE A;  1QJ9 A;  2CAM A;  3BRZ A;  2WQ9 A;  4YFP A;  1QQS A;  1Z24 A;  1LUQ A;  4AZL A;  5LKF A;  2ASN X;  4ZCB A;  1B0O A;  3TZS A;  1SXY A;  4C69 X;  1GXA A;  4WFU A;  5L3Y A;  3F6Z B;  3LK2 B;  2HYS A;  2R4N A;  2GJ5 A;  1IFC A;  1IIU A;  1SWN A;  2JOZ A;  1AVG I;  4BX5 B;  2O4V A;  5AJB A;  1O1U A;  4JHQ A;  1EUO A;  4O3X B;  1BXW A;  3APW A;  4DCB A;  3BLG A;  1S7D A;  1MPF A;  1MK5 A;  1BWY A;  5HA0 A;  1SWK A;  5GV0 A;  2XST A;  2NNE A;  2JW1 A;  2FGR A;  2AT3 X;  3O0E A;  1SWB A;  2IZG B;  3TGA A;  3PPT A;  4GGT A;  5BVQ A;  2OZQ A;  1EPA A;  2RTR B;  2PRN A;  4EFG A;  4IMO A;  4MIS A;  2F73 A;  4FBO A;  4AYM C;  2WJR A;  1KFF A;  2RTP B;  1SRH A;  2AT8 X;  3FR4 A;  3BY0 A;  2HZR A;  5JD2 A;  3PQS A;  1JBH A;  4Z6J A;  1NQN A;  4G75 A;  1VWO B;  1DV9 A;  4C4V B;  4O9S A;  2IZD B;  4LZU A;  3PGU A;  3RE6 A;  3A2S X;  1LIE A;  4QGW A;  3SOT A;  1VWD B;  4ORU A;  1JQP A;  2RTN B;  1Y9T A;  4QRL A;  4IMN A;  2PI3 O;  2RTF B;  2F1V A;  1ORM A;  2WJQ A;  3P02 A;  3OBL A;  4CPH B;  2FKJ A;  1HY2 A;  1GKA B;  3AA6 B;  3AA6 A;  3FLL A;  2JU3 A;  1EI5 A;  2FR3 A;  4EXZ A;  4BCS A;  3STK A;  3GE2 A;  3QKG A;  1FDQ A;  1LEL A;  2K23 A;  2RTE B;  4CK4 A;  2QTK A;  2WWP A;  3ELZ A;  4QGV A;  2RD7 C;  3PP6 A;  4L1N A;  2GTL N;  2OVS A;  1MDC A;  1FEN A;  4MVE A;  4ORS A;  1EQD A;  1AVD A;  4JCH A;  2RCQ A;  2Q2P A;  2OFA A;  1OPB A;  3Q6L A;  3BX7 A;  1QY1 A;  1I9H A;  4KT5 A;  1HXT A;  3NJT A;  2CM4 A;  4FT6 A;  1H91 A;  3JS1 A;  4CV7 A;  4D5U A;  1OEJ A;  1KZW A;  2RTM A;  2Z4H A;  3AA7 A;  4GCP A;  3AKM A;  3BRN A;  2Y32 A;  1ZHT A;  1AQB A;  1U17 A;  3K19 A;  1JIW I;  2DJF A;  3WJF A;  2W80 C;  3UAQ A;  5HZ5 A;  3LK3 B;  3HOL A;  2IZE B;  1LCV A;  1XKI A;  2F01 A;  3BSZ E;  1SWT A;  1G74 A;  1YP6 A;  1KL4 A;  1CBS A;  1NQM A;  1YIV A;  1T1L A;  4PSQ A;  1GT1 A;  2ANS A;  3JQO A;  2Y0L A;  4ARH A;  3OE3 A;  3WJC A;  4YGZ A;  3PGR A;  3DWO X;  1I78 A;  4FZM A;  2ZLD A;  1RAV A;  2HKD A;  1TOW A;  5LJG A;  2XKL A;  3C76 X;  2IZL B;  5HZQ A;  1D3S A;  5G38 A;  5LJK A;  1IKJ A;  1IFB A;  3KFI A;  4EQA C;  1ICN A;  4GCQ A;  2VFB A;  5HAE A;  2BS6 A;  3LTW A;  1EAL A;  4XMG A;  1IZN A;  1RXJ A;  2X32 A;  4D6B A;  3G7G A;  4IAX A;  2JMB A;  3UU2 A;  1CRB A;  1RBP A;  2KD2 A;  4RUU A;  1OSP O;  1AB0 A;  1FJ1 E;  2OMF A;  2L67 A;  4GKC A;  4OS0 A;  3PRN A;  2L5P A;  4OEM A;  5EDC A;  2C1S A;  3NX1 A;  2C4I A;  2ACP X;  5D5D A;  3LV4 A;  2X45 A;  2RTO B;  5DG4 A;  3HPE A;  3ZZV A;  2X55 A;  4FSP A;  3EMM A;  1SXW A;  1U18 A;  5EZ2 A;  3C5O A;  4LSF A;  5IXG A;  3BU9 A;  2G79 A;  3VHH A;  4QQ1 A;  5H9N A;  2GTL M;  1SLF B;  1MEP A;  4IBA A;  3CWK A;  4QNI A;  1X8O A;  2R56 A;  2OY1 O;  1R0U A;  4L3R A;  1VWQ B;  5FVN A;  1HQQ A;  3H3I A;  4XME A;  3X00 A;  1QY0 A;  5HCC C;  1IKE A;  1P4T A;  3SY7 A;  4ML7 B;  3NSG A;  1LCW A;  4UU3 A;  4JGL A;  2MJI A;  1SRJ A;  3FYF A;  4O4S A;  2IZK A;  3A0H O;  5F6B A;  2JQY A;  5BVT A;  4NV8 A;  3HWF A;  2AF5 A;  3T0S A;  2JN3 A;  4KR8 A;  1QWD A;  2A13 A;  4AW8 A;  3UEW A;  5D45 A;  3RDX A;  3CQR A;  3POQ A;  5KIC A;  1PMP A;  2RTD B;  4N59 A;  4AFK A;  4BUM X;  5HCD C;  4GK9 A;  4MVL A;  3VG5 A;  3UEU A;  4KII A;  1ZNL A;  3IA8 A;  1QFT A;  4I60 A;  5FQ7 E;  1OEE A;  3TF6 A;  4BQU A;  1HMT A;  2CZU A;  3EBW A;  4NP1 A;  1DF3 A;  1GX8 A;  2YMS A;  1ZNE A;  3ZUI A;  3PEC A;  2ODJ A;  5DL8 A;  4Y0S A;  3B2H A;  4JFB A;  1ZND A;  5FQ8 E;  1E54 A;  4EDE A;  4LSI A;  3FA6 A;  5BVS A;  1GFM A;  4D64 A;  1SWH A;  1PEE A;  1LIC A;  1W6F A;  4GU8 A;  2X8S A;  3N91 A;  4AKR A;  2XMX A;  3WZN A;  2WPU A;  5E79 O;  4NW4 A;  4KCA A;  3FEK A;  4FQB B;  4KH8 A;  1JJJ A;  4FRX A;  2FWV A;  5ADX K;  4FZL A;  1W4T A;  1ERX A;  2LHF A;  1SMP I;  1LDQ A;  5HCE C;  2XG6 A;  1CBI A;  4AYH A;  3Q34 A;  4ZHH A;  1GX9 A;  2IZH B;  2GE4 A;  1VYG A;  2KXP A;  2KXP B;  2KTS A;  5B66 O;  3NP1 A;  4YBU A;  1HXZ A;  3FA9 A;  2GTF X;  1HBP A;  1ZHX A;  5B5F A;  1U0X A;  2QO4 A;  4AZO A;  2OFM X;  1VWR B;  3NPO A;  4AYD C;  3RY1 A;  2LFU A;  4FRT A;  2MHD A;  3ZW0 B;  1CJ5 A;  3NQK A;  4QAE A;  1T16 A;  4E1S A;  2OVD A;  1PTS A;  4ZHF A;  4NNS A;  1YWB A;  4LZV A;  3SYS A;  1VWA B;  1K3B A;  4OS3 A;  4PR7 A;  2Y3E A;  3WVM A;  1RXH A;  4OKA A;  3VG2 A;  2AL0 X;  3P24 A;  4HPD A;  2BS5 A;  4E1T A;  4N58 A;  3S60 A;  1MM4 A;  4IL6 O;  3POX A;  1QG5 A;  3AA7 B;  1HQP A;  3ZW1 B;  4BVM A;  4FZN A;  4O3Y A;  3WJB A;  1PRN A;  1Y53 X;  1RLB E;  4IAW A;  1SWG A;  1MOY A;  4GRJ A;  1HN2 A;  4NYQ A;  4PJ0 O;  2YNK A;  1Y55 X;  5CSE A;  2R8A A;  2K0L A;  1UYO X;  5IO6 A;  2A5C A;  5CE4 A;  1B56 A;  5H9A A;  5LJC A;  3MVF A;  2BSZ A;  4N75 A;  4UB6 O;  4BX6 B;  2HLV A;  3FMZ A;  4MVK A;  1RSU B;  4YMY A;  3FR2 A;  4FBV A;  1KT7 A;  2QCB A;  2OVA A;  1GX3 A;  4OEL A;  5EPQ A;  5HTD A;  3MG5 A;  3AA1 A;  1BSQ A;  1A3Y A;  4YDB A;  3NAD A;  4NLJ A;  5EDB A;  3O22 A;  3P6G A;  3O19 A;  2LKK A;  1STS B;  4XNK A;  2I5V O;  4CPF A;  4O3Z A;  1FEM A;  1HXU A;  1SWR A;  4TQ2 A;  3ZQ3 A;  1SWE A;  4YDA A;  1ADL A;  4INN A;  5HWZ A;  1WUB A;  1NP4 A;  3AAA B;  4ALB A;  1CBQ A;  1E2T A;  1KGL A;  4NNT A;  4YCE A;  2RTA A;  2A8G A;  4COT A;  1N7Y A;  2KZ7 B;  1VWG B;  3FW5 A;  1SWP A;  3VY8 X;  3CBS A;  3WOV A;  4ODD A;  4ON1 A;  3WBG A;  5D4A A;  4ID2 A;  1EIO A;  2E4J A;  4ZGU A;  1SWO A;  3WJE A;  1PHO A;  2RTK A;  3BDR A;  5K06 A;  2KDY A;  2FS6 A;  2A2U A;  2J1N A;  2X8T A;  1TOU A;  5TIS O;  3SLT A;  3SZD A;  2ZFG A;  1YP7 A;  3WZQ A;  2JU8 A;  1VWN B;  4I9S A;  3APX A;  5JR8 A;  1VWE B;  3VU1 A;  2R4L A;  2RTG B;  1RST B;  1G5W A;  2XE3 A;  3FYX A;  3SZV A;  2Y2X A;  3I17 A;  4MVI A;  3JTY A;  4JO6 A;  4TKJ A;  3T6L A;  3CQN A;  3HOE A;  1X8U A;  1KT4 A;  1SXX A;  1JMX A;  5HBS A;  1ALB A;  3BS2 A;  1YS5 A;  5B2A O;  1T8V A;  1VWH B;  4AYE C;  4GE1 A;  4CDE A;  2X4M A;  2A0A A;  2RCT A;  2RN4 A;  2KT4 B;  1ZHY A;  3PH6 A;  3SAO A;  5F58 A;  1SLG B;  4RL9 A;  1YWC A;  4A60 A;  1BLR A;  2F09 A;  2OY8 A;  3ZWE A;  5D48 A;  1KT6 A;  5G26 A;  1ZRY A;  4IRW A;  3AAA A;  2QOS C;  3VG7 A;  3SYB A;  2RTL A;  1BJ7 A;  3LHN A;  1JV4 A;  3LK4 1;  4YBP A;  5KID A;  3KQ0 A;  3HWE A;  2L68 A;  2AT0 X;  2FLJ A;  2AVI A;  1OPF A;  5EE2 A;  3PK2 A;  4FQE A;  3KVD D;  1JYD A;  4N74 A;  5JDP A;  1MM9 A;  1VWL B;  3U03 A;  4Y0Q A;  1KL3 A;  2MNH A;  4TJZ A;  4GD9 A;  4ALO A;  2I5Z O;  1ERB A;  5AFU L;  4DNE A;  1AEL A;  2FR2 A;  5H8T A;  2G8C O;  5B10 O;  2RTJ A;  3RBY A;  1WBI A;  2RTI B;  3FID A;  3B2J A;  1GGL A;  3RE5 A;  3NQ3 A;  1VYO A;  4OMW A;  2N2L A;  3RZY A;  2KC0 A;  1X8N A;  1T0V A;  1SLE B;  4U8U N;  1ZNG A;  5ADX L;  4WHI A;  1OBQ A;  5KAF O;  2IZA A;  5B11 O;  2XTR A;  4GH7 A;  3NR3 A;  3HWB A;  4UB8 O;  4LQZ A;  3UEV A;  1GKA A;  4ZFX A;  4OS8 A;  4CPE A;  3FA7 A;  5KHP A;  4K3B A;  1JYJ A;  2UYW A;  3AAE B;  1BRP A;  2WEW A;  4BGF A;  2X34 A;  1QJ8 A;  4N7C A;  1FEL A;  4QZU A;  3E3C A;  3AA0 B;  3DA3 A;  4F4B A;  2OY7 A;  3PF1 A;  4U8U M;  1KXO A;  1LIB A;  1ACD A;  3C78 X;  3VPJ E;  4ORX A;  5G39 A;  2Z4I A;  3TGB A;  2ZSC A;  4XMH A;  4YH0 A;  1SY1 A;  2OYB O;  2LBV A;  3QQ2 A;  1RXK A;  3HWG A;  1IZN B;  5LJD A;  3ZW0 A;  2FRS A;  4QGX A;  4XNL A;  1I04 A;  1DZJ A;  3NQ9 A;  1LIF A;  5B5E O;  4GGZ A;  4ZH6 A;  3RY2 A;  4AYI D;  1IW2 A;  3FEP A;  4BX6 A;  1LFO A;  3SY9 A;  1DF8 A;  5D47 A;  1S5L O;  2NNQ A;  3RKG A;  3AA0 A;  4Y0R A;  1ZHW A;  2OL6 O;  1VWB B;  3OJY C;  1PBY A;  2Y0H A;  3PQU A;  2RTB B;  3KVN A;  2R73 A;  1X8Q A;  1VWC B;  3VHM A;  4PUX A;  3WJD A;  4ORY A;  2UZ2 A;  3RDU A;  3G7X A;  4YGH A;  3P6E A;  2IWV A;  1NP1 A;  4CDF A;  4RJX A;  3RDO A;  1DZM A;  2O62 A;  3QRA A;  1LKE A;  5KAI O;  4UU2 A;  3AEH A;  2IZC B;  4AZN A;  2A5B A;  2WEX A;  3MM0 A;  1VWF B;  5B27 A;  3WI5 A;  5C0N A;  4BX7 A;  2RQ0 A;  3FEL A;  1A2D A;  2Y3F A;  3OD9 A;  3DA4 A;  2MF6 A;  1KQX A;  2FKG A;  2Q39 A;  5GTH O;  2RTH B;  3P6C A;  3EBK A;  3PGS A;  1B8E A;  1GFO A;  4XMC A;  4C4V A;  1S2P A;  3F9D A;  1SXU A;  1QAB E;  1Y52 X;  2HMB A;  3AAE A;  1XCA A;  1ICM A;  1BEB A;  5DL7 A;  5AEO A;  4HFO A;  4EKV A;  4LKP A;  1TW4 A;  1G85 A;  1BBP A;  1E02 A;  1SLD B;  3BS0 A;  4YVB A;  2FHN X;  1T68 X;  3T24 A;  1VWJ B;  4KC8 A;  2OFB A;  1DZP A;  2P8G A;  4IAB A;  1MUP A;  3D97 A;  1OSM A;  4Z3T A;  3S5V A;  3HWD A;  1UYN X;  4CTD A;  3VG4 A;  5HTE A;  4YGG A;  1YWA A;  4ZGF A;  1BH3 A;  1N0S A;  2KW1 A;  4K3C A;  3CR6 A;  1KQW A;  3CKF A;  5K67 A;  4GDZ A;  1OBP A;  1NDJ A;  4CPI A;  3CMP A;  1PM1 X;  1CBR A;  2OF9 A;  3UEX A;  4CDC A;  1Y9L A;  5HA1 A;  5G3A A;  1JMZ A;  3RDS A;  1VWP B;  3AUM O;  2FS7 A;  2FT9 A;  1AVE A;  4Z2P A;  2HNX A;  4B55 A;  5HZ6 A;  4A8Z A;  4ZHC A;  4FBR A;  2XE1 A;  2LB6 A;  4R0B A;  1E5P A;  1KOI A;  1SWS A;  3P6D A;  4RUN A;  4OMX A;  3EM0 A;  5AQ6 A;  1SWL A;  5HZ8 A;  1QFV A;  1STP A;  4Z2V A;  3U0D A;  3T20 A;  2A3F X;  1VWM B;  5B3M O;  5LJH A;  3VZT X;  3VG6 A;  2MO5 A;  4HPA A;  2OL8 O;  5FAZ A;  2AH7 X;  3AA1 B;  1GM6 A;  3LK4 2;  3EMN X;  1NC9 A;  2N93 A;  1SRG A;  3D9W A;  4TNN A;  4BOE A;  1QJP A;  1SWC A;  4AZQ A;  1GT5 A;  1LCZ A;  1SRE A;  1Q9G A;  3EC5 A;  1SWA A;  2YG2 A;  4GZV A;  3FR5 A;  5FFH A;  4IB7 A;  1E00 A;  1EII A;  4GF4 A;  2R4O A;  1X71 A;  3ZW2 A;  5F1E A;  3SZJ A;  1DC9 A;  3HW9 A;  4ZHD A;  4TKH A;  3STN A;  2JU7 A;  1GFP A;  2QO6 A;  5AFU K;  1VYF A;  2XTQ A;  3KFH A;  2W81 C;  1N9M A;  2GH7 A;  1HBQ A;  3DWN A;  5B29 A;  4BBO A;  4ORW A;  1TVQ A;  4HWM A;  3F8A A;  2AT6 X;  3HTY A;  1VWI B;  3LK3 A;  1O8V A;  3P6H A;  4I9R A;  2X8F A;  1MX7 A;  5HZ9 A;  2RTQ B;  1BT9 A;  2LBA A;  3DTQ A;  3I0A A;  3RDQ A;  3PED A;  3T2W A;  4NYR A;  3HK1 A;  2BHV A;  4AZR A;  2MWH A;  7PRN A;  4IB9 A;  4ZH9 A;  1STR B;  5CHK A;  2KTD A;  2Y0K A;  4O4O A;  4O3W A;  4FGI B;  5GTI O;  4AYN A;  1ZHZ A;  1N43 A;  3S26 A;  4O4U A;  4FMS A;  3JCU O;  1K24 A;  4O49 A;  5H9L A;  2VDF A;  1SWF A;  5L8N A;  3VZW X;  3BU1 A;  4O4X A; 
#chains in the Genus database with same CATH homology
 5AFU L;  3T0S A;  1PBO A;  3PH5 A;  1GFQ A;  3NX2 A;  4TKB A;  3B2K A;  2JN3 A;  3K3L A;  1AEL A;  2DM5 A;  4KR8 A;  2FR2 A;  1QWD A;  5H8T A;  2LFO A;  2A13 A;  4YKM A;  4AW8 A;  3C77 X;  3UEW A;  2POR A;  5D45 A;  3RBY A;  1FTP A;  4KR4 A;  1SY2 A;  3CQR A;  2WSJ A;  2ERV A;  3APV A;  8PRN A;  2Q4N A;  3B2J A;  5L8O A;  1A18 A;  1E06 A;  4LKT A;  1PMP A;  5KIC A;  3POQ A;  4N59 A;  1ZNK A;  4AFK A;  4BUM X;  5HCD C;  2WR6 A;  3KZA A;  1GGL A;  4YCH A;  3WI4 A;  3NQ3 A;  4U9C A;  4OMW A;  4GK9 A;  2N2L A;  2N2M A;  3STM X;  3RZY A;  1B4M A;  2KC0 A;  1X8N A;  1O1V A;  4MVL A;  5LJE A;  4QYN A;  1FE3 A;  1QJ9 A;  3VG5 A;  1T0V A;  3UEU A;  3BX8 A;  1ZNL A;  4KII A;  3IA8 A;  1QFT A;  2WQ9 A;  4YFP A;  1QQS A;  1Z24 A;  3FW4 A;  4AZL A;  1QY2 A;  2BT9 A;  1LNM A;  1OEE A;  4U8U N;  5FQ7 E;  3TF6 A;  1ZNG A;  4BQU A;  1HMT A;  2CZU A;  1JZU A;  5T5F A;  5ADX L;  4WHI A;  1OBQ A;  3EBW A;  5LKF A;  2ASN X;  4ZCB A;  2ACO A;  1B0O A;  4NP1 A;  1DF3 A;  4RJW A;  2XTR A;  4GH7 A;  3NR3 A;  3TZS A;  1BM5 A;  3HWB A;  4LQZ A;  1SXY A;  4C69 X;  3UEV A;  1GKA A;  1GXA A;  4ZFX A;  4OS8 A;  1GX8 A;  3FA7 A;  4WFU A;  2YMS A;  1ZNE A;  3ZUI A;  2CM9 A;  3F6Z B;  5KHP A;  3PEC A;  3LK2 B;  2HYS A;  2G7B A;  1JYJ A;  2ODJ A;  3NBX X;  3AAE B;  5DL8 A;  2LA7 A;  1OBU A;  2GJ5 A;  4Y0S A;  3B2H A;  4JFB A;  4GHB A;  1BRP A;  2AKQ A;  1ZND A;  2WEW A;  5FQ8 E;  4DQ4 A;  1E54 A;  1IFC A;  2R74 A;  1IIU A;  4EDE A;  1QJ8 A;  3FA6 A;  4G76 A;  4LSI A;  4N7C A;  5BVS A;  2QMI A;  4AUI A;  2JOZ A;  1FEL A;  1G90 A;  4CSB A;  4QZU A;  2KZ7 A;  1AVG I;  1GFM A;  4D64 A;  4RLB A;  3E3C A;  2QM9 A;  1PEE A;  3T1D A;  3MBT A;  1KZX A;  3AA0 B;  2O4V A;  5AJB A;  3DA3 A;  4F4B A;  1O1U A;  1UZ2 X;  1EUO A;  1LIC A;  4O3X B;  2MHL A;  1BXW A;  3RBH A;  3APW A;  4U8U M;  3BLG A;  1KXO A;  2NND A;  4WFV A;  4ZJ0 A;  4GU8 A;  1S7D A;  1LIB A;  1MM5 A;  1ACD A;  1MPF A;  1BWY A;  2WQA E;  3C78 X;  4I3D A;  2X8S A;  3N91 A;  3VPJ E;  5HA0 A;  4AKR A;  4TLJ A;  4ORX A;  4D6A A;  3UPG A;  1ML7 A;  5GV0 A;  2XMX A;  2XST A;  2NNE A;  2Z4I A;  3TGB A;  2JW1 A;  2W2F A;  4XMH A;  3IFB A;  4YH0 A;  1SY1 A;  2FGR A;  4NW4 A;  2AT3 X;  1GT4 A;  3O0E A;  4KCA A;  3VE1 A;  1S44 A;  3FEK A;  4FQB B;  2LBV A;  1JJX A;  4A1H A;  3TGA A;  3PPT A;  3HWG A;  4KH8 A;  1EXS A;  5IO5 A;  5LJD A;  1JJJ A;  1IZN B;  4FRX A;  2FWV A;  3ZW0 A;  2XE2 A;  2FRS A;  5ADX K;  4GCS A;  4QGX A;  4XNL A;  1I04 A;  1TXL A;  5BVQ A;  4FZL A;  1P6P A;  1H6S 1;  2OZQ A;  1DZJ A;  1EPA A;  3NQ9 A;  1ERX A;  1LIF A;  3B2I A;  2LHF A;  1SMP I;  2L9C A;  4WBK A;  2PRN A;  5DL6 A;  4B61 A;  4EFG A;  4YFR A;  2CBR A;  5HCE C;  2XG6 A;  1CBI A;  4M7M A;  4IMO A;  4MIS A;  4AYH A;  4ZHH A;  2F73 A;  4ZH6 A;  4FBO A;  1GX9 A;  4AYM C;  2AT8 X;  2GE4 A;  3FR4 A;  3BY0 A;  4GET A;  1IW2 A;  1VYG A;  4AYI D;  3FEP A;  2HZR A;  1X8P A;  2KXP A;  2KXP B;  2KTS A;  1LFO A;  3NP1 A;  3SY9 A;  2AMM X;  4AKM A;  3PQS A;  4YBU A;  5D47 A;  1JBH A;  2NNQ A;  3RKG A;  4AKR B;  4IB8 A;  4AZP A;  3FA9 A;  3AA0 A;  4Y0R A;  2GTF X;  4G75 A;  1ZHW A;  1HBP A;  4Y0P A;  1ZHX A;  3OJY C;  2QO4 A;  1U0X A;  4AZO A;  2RA6 A;  2Y0H A;  2OFM X;  1DV9 A;  3PQU A;  4O9S A;  3NPO A;  4LZU A;  3MX7 A;  4K19 A;  2PY1 A;  2W2A A;  4AYD C;  2LFU A;  2R73 A;  2MHD A;  4FRT A;  3A2S X;  1X8Q A;  1LIE A;  3ZW0 B;  4PUX A;  1CJ5 A;  4XMF A;  3NQK A;  3O2Y A;  4QAE A;  4QGW A;  3SOT A;  4E1S A;  3WJD A;  4ORY A;  4ORU A;  2OVD A;  3G7X A;  4YGH A;  4ZHF A;  4NNS A;  1YWB A;  3P6E A;  1NP1 A;  4RJX A;  1Y9T A;  4LZV A;  4QRL A;  1DZM A;  2O62 A;  3FIQ A;  4IMN A;  3QRA A;  3SYS A;  1HMS A;  1X89 A;  1LKE A;  4OS3 A;  5PRN A;  5FEN A;  2F1V A;  1BRQ A;  1ORM A;  4UU2 A;  1LF7 A;  2GC9 A;  3P02 A;  2K62 A;  4AZN A;  3WVM A;  3LK2 A;  3OBL A;  2WEX A;  3TGC A;  5EED A;  3VG2 A;  4YFQ A;  5B27 A;  1GKA B;  3WI5 A;  5C0N A;  2AL0 X;  3FA8 A;  3AA6 B;  3FLL A;  2JU3 A;  2RQ0 A;  3FEL A;  3AA6 A;  1EI5 A;  3P24 A;  1A2D A;  2FR3 A;  3EYC A;  3OD9 A;  3DA4 A;  4HPD A;  2BS5 A;  3P6F A;  4EXZ A;  1KQX A;  5D8J A;  4E1T A;  4N58 A;  3S60 A;  2Q39 A;  3ELX A;  3STK A;  5LJB A;  1MM4 A;  3ZI8 A;  2GTL O;  3GE2 A;  3QKG A;  3POX A;  1QG5 A;  1G7N A;  1FDQ A;  3EBK A;  3P6C A;  5CYB A;  3ZUO A;  1B8E A;  1NGL A;  1GFO A;  3AA7 B;  3VZU X;  1HQP A;  4XMC A;  3ZW1 B;  4BVM A;  2K23 A;  4FZN A;  4O3Y A;  1S2P A;  3F9D A;  4CK4 A;  2JMM A;  4ES7 A;  1SXU A;  3G7G A;  3WJB A;  1PRN A;  2QTK A;  2WWP A;  2ZAI A;  1QAB E;  1BSO A;  1RLB E;  3ELZ A;  4IAW A;  2HMB A;  3DSZ A;  4QGV A;  2RD7 C;  3PP6 A;  3AAE A;  3TZG A;  4FOZ A;  1XCA A;  4L1N A;  1SA8 A;  2GTL N;  2OVS A;  1HN2 A;  1ICM A;  1MDC A;  2POA A;  4GRJ A;  4NYQ A;  1BEB A;  1SY3 A;  2ZAG A;  2YNK A;  3D95 A;  1FEN A;  4MVE A;  5DL7 A;  5AEO A;  4HFO A;  3RSW A;  4ORS A;  4LKP A;  1EQD A;  2K0L A;  1TW4 A;  1YUP A;  4DQ3 A;  3QRC A;  4JCH A;  2RCQ A;  2Q2P A;  5CE4 A;  1G85 A;  1B56 A;  5H9A A;  5IO6 A;  1OPB A;  5LJC A;  3MVF A;  2W2B A;  1BBP A;  1E02 A;  3Q6L A;  5LKE A;  3BX7 A;  1QY1 A;  1URE A;  3FEN A;  4KT5 A;  1HXT A;  2Q2M A;  2CM4 A;  4FT6 A;  4XMD A;  2HLV A;  3FMZ A;  1T68 X;  3T24 A;  4MVK A;  2M06 A;  4YMY A;  2G78 A;  3FR2 A;  4KC8 A;  1H91 A;  4FBV A;  4I95 A;  1KT7 A;  3JS1 A;  1DZP A;  4CV7 A;  2OVA A;  2P8G A;  4I3C A;  4IAB A;  1MUP A;  4D5U A;  3D97 A;  1OSM A;  4Z3T A;  3S5V A;  3HWD A;  1I4U A;  1OEJ A;  5EPQ A;  1KZW A;  4FUV A;  2Z4H A;  3VG4 A;  5HTE A;  3ZW1 A;  5HTD A;  3AA7 A;  4QZT A;  4YGG A;  1YWA A;  4GCP A;  3AKM A;  3BRN A;  3AA1 A;  2IFB A;  4U8U O;  1BSQ A;  1ZHT A;  4ZGF A;  4LSE A;  1AQB A;  1BH3 A;  1A3Y A;  1N0S A;  2KW1 A;  2F1T A;  2ALL X;  4YDB A;  4D65 A;  2K4T A;  1U17 A;  3NAD A;  4NLJ A;  4I3B A;  3POU A;  3K19 A;  5EDB A;  3O22 A;  1JIW I;  1EPB A;  3CR6 A;  1KQW A;  3P6G A;  4GDZ A;  1OBP A;  2HZQ A;  3WJF A;  1OPA A;  3O19 A;  2W80 C;  3UAQ A;  3CMP A;  5HZ5 A;  2YPV A;  1PM1 X;  2LKK A;  1CBR A;  5F7G A;  3LK3 B;  4XNK A;  3HOL A;  3UEX A;  4O3Z A;  1XKI A;  3VY9 X;  1FEM A;  1HXU A;  4ZR2 A;  4TQ2 A;  1YWD A;  3BSZ E;  3ZQ3 A;  4GNY A;  4AZM A;  4ZHG A;  1Y9L A;  5HA1 A;  1G74 A;  4FES A;  2Y7S A;  1YP6 A;  4PJ2 A;  1ADL A;  4YDA A;  4YKO A;  4A1Y A;  2FS7 A;  2FT9 A;  2HNX A;  4INN A;  2OFR X;  3POR A;  1CBS A;  1YIV A;  5HWZ A;  1SY0 A;  1NP4 A;  4PSQ A;  4ALB A;  3AAA B;  1GT1 A;  2ANS A;  5HZ6 A;  1CBQ A;  4A8Z A;  3JQO A;  4ZHC A;  1KGL A;  4NNT A;  2Y0L A;  4ARH A;  2FTB A;  4FBR A;  3OE3 A;  4YCE A;  2LB6 A;  1ZNH A;  2QO5 A;  4YGZ A;  3WJC A;  2XE1 A;  4COT A;  4FZM A;  2X46 A;  4I6S A;  4R0B A;  2KZ7 B;  1E5P A;  1HMR A;  1KOI A;  3P6D A;  4RUN A;  2ZLD A;  3FW5 A;  4OMX A;  2XE5 A;  3EM0 A;  5AQ6 A;  1TOW A;  1BSY A;  5LJG A;  3VY8 X;  3CBS A;  2XKL A;  5HZ8 A;  4ODD A;  4ON1 A;  1QFV A;  3VE2 A;  3WBG A;  5D4A A;  4ID2 A;  3C76 X;  3WOV A;  1EIO A;  3U0D A;  1OEK A;  2E4J A;  4ZGU A;  2A3F X;  2FGQ X;  3T20 A;  3WJE A;  1PHO A;  5HZQ A;  5LJH A;  3BDR A;  3VZT X;  1D3S A;  3VG6 A;  2MO5 A;  5K06 A;  2KDY A;  1DFV A;  2FS6 A;  4HPA A;  2A2U A;  3B2L A;  2J1N A;  5FAZ A;  2X8T A;  2AH7 X;  5LJK A;  3AA1 B;  1GM6 A;  1TOU A;  1IKJ A;  1IFB A;  1VPR A;  5IO7 A;  3LK4 2;  3KFI A;  3EMN X;  2M4L A;  4M6S A;  3GP6 A;  4GNW A;  4EQA C;  1ICN A;  3SZD A;  2M07 A;  4GCQ A;  1EW3 A;  2ZFG A;  2N93 A;  1I05 A;  1YP7 A;  5DPQ A;  2JU8 A;  4I9S A;  3APX A;  5JR8 A;  4TNN A;  2OVE A;  5H9K A;  4BOE A;  3VU1 A;  2BS6 A;  5HAE A;  1QJP A;  1THQ A;  4AZQ A;  3U9P C;  1EAL A;  1G5W A;  1MX8 A;  4LSH A;  1GT5 A;  4XMG A;  2XE3 A;  1IZN A;  3FYX A;  3SZV A;  1D2U A;  3I17 A;  1DZK A;  1Q9G A;  4MVI A;  2Y2X A;  3JTY A;  4NLI A;  4D6B A;  5EEE A;  2YG2 A;  4GZV A;  2JMB A;  3FR5 A;  4IAX A;  4IB7 A;  4QYP A;  4TKJ A;  5FFH A;  3WXQ A;  3UU2 A;  1CRB A;  1E00 A;  2BLG A;  3CQN A;  1EII A;  1RBP A;  1L6M A;  3HOE A;  2KD2 A;  1X8U A;  4RUU A;  3APU A;  1AB0 A;  1KT4 A;  4GF4 A;  1X71 A;  5L8I A;  1SXX A;  2OMF A;  2L67 A;  3ZW2 A;  1MVG A;  4GKC A;  5HBS A;  1ALB A;  3BS2 A;  4OS0 A;  5FQ6 E;  1YS5 A;  5F1E A;  1T8V A;  3PRN A;  1DC9 A;  3HW9 A;  2L5P A;  4ZHD A;  4TKH A;  4AYE C;  3STN A;  4HPC A;  4GE1 A;  5EDC A;  2JU7 A;  3JSQ A;  3NX1 A;  2ACP X;  2QO6 A;  1GFP A;  5D5D A;  3LV4 A;  2A2G A;  5AFU K;  1VYF A;  2A0A A;  2RCT A;  2XTQ A;  2X45 A;  2RN4 A;  2KT4 B;  3S5X A;  1ZHY A;  3KFH A;  2WUT A;  5F6Z A;  1A57 A;  3PH6 A;  2W81 C;  3SAO A;  1HXX A;  1HBQ A;  4KC7 A;  5DG4 A;  5F58 A;  3ZZV A;  3GAQ A;  3KFG A;  4FSP A;  3EMM A;  4RL9 A;  1YWC A;  5B29 A;  1SXW A;  1U18 A;  5EZ2 A;  2X27 X;  3C5O A;  1GT3 A;  4A60 A;  1BLR A;  4LSF A;  2F09 A;  4ORW A;  4RLC A;  3ZWE A;  1TVQ A;  2CZT A;  4HWM A;  3F8A A;  3AKN A;  5D48 A;  2AT6 X;  3HTY A;  1KT6 A;  5G26 A;  1ZRY A;  3D96 A;  3BU9 A;  3AAA A;  2G79 A;  2QOS C;  4FSO A;  4EEJ A;  3LK3 A;  4QQ1 A;  4ORR A;  5H9N A;  3VG7 A;  1O8V A;  2GTL M;  2J4U P;  3P6H A;  4I9R A;  3CBC A;  3SYB A;  1BJ7 A;  2EU7 X;  2Q9S A;  3D4R A;  1JV4 A;  2X8F A;  3LHN A;  1MX7 A;  3L4R A;  4MIR A;  3LK4 1;  4IBA A;  4YBP A;  1Q9F A;  5DL5 A;  4IB6 A;  5HZ9 A;  3CWK A;  4QNI A;  1LPJ A;  1X8O A;  2LBA A;  1BT9 A;  3DTQ A;  5KID A;  3V8U A;  6PRN A;  3KQ0 A;  3I0A A;  2R56 A;  3PED A;  3HWE A;  3RWX A;  1I06 A;  3KFF A;  2L68 A;  4NYR A;  3HK1 A;  2BHV A;  4AZR A;  2AT0 X;  2MWH A;  1GFN A;  2MM3 A;  4HPB A;  2FLJ A;  1R0U A;  4IB9 A;  4ZH9 A;  7PRN A;  1OPF A;  4L3R A;  2KTD A;  5EE2 A;  4KRA A;  2Y0K A;  5FVN A;  3H3I A;  1JYD A;  4O4O A;  4XME A;  1QY0 A;  3KVD D;  5HCC C;  4O3W A;  1IKE A;  5JDP A;  4FGI B;  3VG3 A;  4AYN A;  1P4T A;  3SY7 A;  1ZHZ A;  1LID A;  3U03 A;  4ML7 B;  3S26 A;  4O4U A;  2NP1 A;  5BYP A;  3NSG A;  4Y0Q A;  4UU3 A;  4JGL A;  4FMS A;  5IYU A;  4U3Q A;  2MJI A;  4O49 A;  2AT5 X;  5H9L A;  3FYF A;  1KT5 A;  2MNH A;  4O4S A;  4TJZ A;  3WJG A;  1KT3 A;  5L8N A;  2CBS A;  4ALO A;  3VZW X;  5AJC A;  5F6B A;  3BU1 A;  1ERB A;  4O4X A;  4N7D A;  5BVT A;  3HWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...