3VE1A

The 2.9 angstrom crystal structure of transferrin binding protein b (tbpb) from serogroup b m982 neisseria meningitidis in complex with human transferrin
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
652
structure length
537
Chain Sequence
QGGYGFAMRLKRRNWYPGAEESEVKLNESDWEATGLPTKPKELPKRQKSVIEKVETDGDSDIYSSPYLTPSNHVNQPKNQATGHENFQYVYSGWFYKHAASEKDFSNKKIKSGDDGYIFYHGEKPSRQLPASGKVIYKGVWHFVTDTKKGQDFREIIQPSKKQGDRYSGFSGDGSEEYSNKNESTLKDDHEGYGFTSNLEVDFGNKKLTGKLIRNNASLNNNTNNDKHTTQYYSLDAQITGNRFNGTATATDKKENETKLHPFVSDSSSLSGGFFGPQGEELGFRFLSDDQKVAVVGSAKTKDKLSKLTTVLDAVELTLNDKKIKNLDNFSNAAQLVVDGIMIPLLPKDEFTRKFEHTPETKTYEVEVCCSNLNYLKYGMLTRKNQVEQSMFLQGERTDEKEIPTDQNVVYRGSWYGHIANGTSWSGNASDKEGGNRAEFTVNFADKKITGKLTAENRQAQTFTIEGMIQGNGFEGTAKTAESGFDLDRTPKAYITDAKVKGGFYGPKAEELGGWFAYPGDKASSATVVFGAKRQQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Transferrin-binding protein 2
publication title The structural basis of transferrin sequestration by transferrin-binding protein B.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
total genus 136
structure length 537
sequence length 652
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
A PF17483 TbpB_C C-lobe handle domain of Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.240 Mainly Beta Beta Barrel Lipocalin Lipocalin 3ve1A03
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 3ve1A01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 3ve1A04
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 3ve1A02
3PQSA 3V8UA 3PQUA 1YS5A 3VE1A 3HOLA 3UAQA 4AYNA 2KDYA 4O3ZA 4O3WA 5T5FA 4QQ1A 4O3YA 2YPVA 4O4UA 4AYEC 2Y7SA 4Z3TA 3VE2A 4O49A 4O4XA 5EE2A 3HOEA 2LFUA 3KVDD 4U9CA 4AYDC 4AYMC 2W80C 4AYID 2KC0A 4O3XB 2W81C
chains in the Genus database with same CATH superfamily
1PEEA 3FR5A 3FIDA 4YGHA 2LBAA 3NBXX 1EXSA 3OBLA 1SWKA 2POAA 4BX5A 3MVFA 4HWMA 4GCSA 1TVQA 1GX8A 1K3BA 2FLJA 4FZLA 2O62A 2IZIA 4BX5B 4AYHA 4AFKA 1KZXA 4CPIA 1Y9LA 5B2AO 2ZFGA 2XKLA 2ASNX 2NNEA 1LKEA 3AEHA 3EC5A 5D48A 4TQ2A 2XE1A 4UB6O 3F9DA 3KZAA 1X71A 1BH3A 2RTNB 4KC8A 5KICA 1I4UA 2Y3FA 2Z4HA 2X8SA 4KIIA 4I3CA 5BVSA 1SXXA 1VWFB 3HWFA 4O49A 4FRXA 4COTA 2VFBA 5CHKA 2C1QA 1LIDA 1BLRA 2X9KA 2W81C 1RAVA 4NYRA 1SWOA 5PRNA 2IZBA 4FSPA 4NLIA 1LNMA 2WEXA 1Z24A 1Y55X 1ZHYA 4AYEC 4D6BA 1I04A 2K0LA 4XNKA 4GGRA 2HZRA 3NP1A 3HK1A 4CTDA 4KR8A 2IZJA 3DA3A 2F09A 4WBKA 3IA8A 2RTCB 4BUMX 4NP1A 1OPFA 1PRNA 1SWGA 4I3DA 3UAQA 1QJ9A 1KQWA 2NP1A 4Z2OA 2OFRX 1EPBA 2XE2A 2X55A 2XSTA 2CBRA 5DL7A 3T1DA 1S5LO 1SWJA 1SWLA 4LZUA 4MISA 4TJZA 4A1HA 2Q2PA 4D64A 4JFBA 1OSPO 4U8UM 5EZ2A 3AKMA 1KFFA 5FQ8E 1SWTA 4Z28A 1PBYA 3VG2A 1ICNA 1JBHA 3DSZA 4A8ZA 2GE4A 3D97A 2BLGA 3LK2A 1IJ8A 4N7DA 1Q9FA 4AYNA 5KAIO 2L67A 3CKGA 4YBUA 1GFMA 3ELZA 3UPGA 3RKGA 3VG6A 2HNXA 2PY1A 4RLCA 3PPTA 5IO5A 2K62A 4A1YA 3FEKA 3P6GA 1YWCA 5LKEA 4N75A 1HQPA 3SZVA 4TKBA 1DZMA 3U03A 5FFHA 1NDJA 4ZHHA 5HBSA 4LZVA 4O3ZA 2JOZA 2KW1A 5CYBA 5DPQA 4U8UO 1O1VA 2RTGB 4GD9A 1VWJB 2DJGA 2GTLO 5AFUK 2ZLDA 1HXTA 4U3QA 5H9AA 5HCDC 4ZHFA 1YS5A 3CMPA 1LDOA 3CQNA 4ZR2A 1MM9A 1PMPA 4O3WA 1KL5A 2G7BA 3PP6A 3T6FA 1HY2A 2BS5A 4AKRA 4ZFXA 4Z2PA 3RWXA 4O3XB 3SLOA 4AKRB 1LDQA 4FT6A 4FBVA 4JGLA 5D45A 2MO5A 1LUQA 3APVA 3TGBA 2UYWA 1Y0GA 2LFUA 4U46A 4UU3A 5FENA 5AQ6A 3ZI8A 2OZQA 1KZWA 2BSZA 2HLVA 4CSBA 4YKMA 4ZH9A 3ZW1A 1JYJA 1HMRA 5F1EA 5IXGA 1ZNLA 1NGLA 3CR6A 3ZW1B 2KC0A 1BWYA 3NQKA 3FIQA 1OPAA 3POQA 4CPFA 1SLGB 3EW1A 2CBSA 1VWBB 3VZTX 2RTMA 4HPAA 3O0EA 1T16A 4MVIA 4Y0QA 2G8CO 2R73A 4GETA 4BQUA 3PGSA 1Y9TA 1SWHA 4YGGA 1ALBA 4KT5A 1DF3A 3B2IA 5FVNA 3VG4A 4ZJ0A 1BJ7A 2CM9A 1JIWI 3ZUIA 2IZHB 5JD2A 2OY1O 2VFCA 4GH7A 2RTLA 3OJYC 2AL0X 3I0AA 4HPBA 1SA8A 5TISO 3PF1A 2WUTA 3GP6A 1R0UA 2OY7A 1MEPA 4AZOA 1GX3A 1OBQA 3BX8A 3VHHA 1EQDA 2LA7A 1AQBA 3P6DA 4E1TA 4NW4A 1CBSA 1O1UA 3KZIO 2UZ2A 1P4TA 1DC9A 1FTPA 3WJCA 5IRWA 3UEUA 2WEWA 4I9RA 4G75A 1HXLA 5HTDA 2Y0HA 4DCBA 2RTKA 3HOEA 3MM0A 3WOVA 1SWEA 2BS6A 4NNSA 4OMWA 3A2SX 3KFIA 4IB8A 1AVGI 1KT5A 3FA8A 1NBXA 3VZWX 4JHQA 1AB0A 2K23A 1S44A 1GT1A 1OBUA 3T6LA 4CV7A 3C78X 3B2HA 1SWUA 1EIOA 3FLLA 4U9CA 4E1SA 5H9LA 4AZQA 3RSWA 3VY9X 3D96A 3PQUA 4XMDA 1VWMB 1KL4A 5B66O 2JU7A 5AJBA 5F6ZA 4YGZA 1XKIA 1IZNA 2X4MA 4NLJA 2WR6A 1Y53X 3SYBA 1BBPA 1IZNB 5L8NA 4K3BA 1T1LA 4AYID 4O4OA 4BX6A 4JNJA 1T0VA 2A2GA 4IABA 1SRIA 4DQ3A 4ZGFA 2G78A 2X27X 4AKMA 3DZMA 2OFBA 4BX6B 4FGIB 3RY1A 4AW8A 1ADLA 1OEEA 5LJCA 4Y0RA 3KFFA 2LKKA 3SYSA 1MM4A 1N9MA 1IFBA 3X00A 3HWBA 1CBQA 2QTKA 2A2UA 2IZDB 2IWWA 2W2BA 1AVDA 1OBPA 4OKAA 1B8EA 1TOWA 1SWRA 2J1NA 3AA7A 2I5VO 1P6PA 1SY3A 1YWAA 1G74A 2OVSA 5T5FA 1IFCA 3POUA 5F7GA 4O4UA 4YDAA 3G7XA 4Z3TA 4AUIA 2DM5A 3BY0A 5K68A 5H9KA 3NPOA 2HYSA 2XE5A 3BU9A 1GM6A 2A5CA 4IMOA 5IO7A 3HWDA 3S26A 2HZQA 3SZHA 3VE1A 1BM5A 3WI4A 2XTRA 5B27A 2R56A 1IKJA 4UB8O 4N7CA 4LSHA 3SZDA 4B61A 1G5WA 4HFOA 4WHIA 1SREA 4EDEA 5G26A 1FE3A 3V8UA 4BJ8A 5L8OA 4PJ2A 1RLBE 1RXHA 1QY2A 1SWDA 4GK9A 4XMFA 4LSEA 1N9YA 5HZ9A 3BX7A 1EALA 1MUPA 1NP4A 1SRHA 4ES7A 1STRB 4CPHA 4AZPA 4EFGA 2WVPA 1PBOA 3BSZE 1KT6A 5HCCC 1KL3A 4IBAA 3WZOA 1IW2A 2R74A 2LB6A 2OY5O 5KAFO 1YIVA 1BXWA 2QMIA 1QY1A 2NNDA 4RJWA 2GTLN 2RQ0A 2AT0X 2L5PA 2OF9A 3BS0A 2JGSA 1SWSA 2Z4IA 5EEDA 1GX9A 1GFQA 3RE6A 4LQZA 3D4RA 5H8TA 1VYOA 4GGZA 1ZNDA 1GGLA 2RCTA 3SY7A 2E4JA 4IAWA 4C69X 4ZHDA 3P6EA 5LKFA 3KFHA 2R4PA 3WI5A 2KT4B 1MVGA 5H2FO 4ZH6A 1X89A 2XMXA 4Z27A 3WYQA 2IWVA 2I5ZO 4QAEA 3JQOA 5ADXL 1H91A 2F73A 3S60A 4WFVA 4N59A 1D3SA 1YWBA 2A3FX 1CJ5A 3FYFA 4LSIA 1QJ8A 4HPDA 1A57A 1FEMA 3P6FA 3TF6A 3AA1A 1VWCB 2IZAA 3APXA 3HOLA 1HXUA 4XMHA 3AA1B 3T0SA 4QNIA 1WUBA 2K4TA 2L68A 1VWDB 3STNA 5H9NA 4NV8A 3LV4A 3T20A 3WZNA 3FYXA 5CE4A 3VG7A 3NSGA 2FR2A 4IB9A 3HW9A 3LK2B 2R89A 5EE2A 4YFPA 1DF8A 4UU2A 1SY2A 3DA4A 2F1VA 1ERBA 5EPQA 5B10O 3JCUO 3FA6A 4ML7B 1HMSA 5HA0A 3RZYA 4QZUA 4Z2VA 5GTHO 1JYDA 2PORA 4GNWA 4O9SA 2Q4NA 3NX1A 1YUPA 4ORYA 4ALBA 3RBHA 3WJBA 1HXZA 1I05A 1VYFA 2RTJA 2YNKA 1A2DA 1GKAA 2KZ7A 3ZZVA 3WJFA 1LPJA 5B11O 1GT4A 1KXOA 4I6SA 4FBRA 3VGWA 1GKAB 3LK42 1G90A 2XE3A 2KZ7B 3UU2A 3MX7A 1OSMA 4FRTA 1SWFA 4AZMA 1GT5A 1MX8A 3EBKA 1GT3A 1YWDA 2OF8A 4GRJA 1BEBA 3PRNA 2QO5A 1VWRB 3BRNA 1ZNKA 4JCHA 1ZNEA 4GNYA 2AF5A 5LJBA 1VWNB 2R8AA 1AVEA 2N93A 4IRWA 1S7DA 1PM1X 2AMMX 4D6AA 2CZUA 1BSYA 2AT8X 4ORUA 5BYPA 1BRPA 4ORWA 1NQMA 1E00A 1CRBA 1PTSA 1ZHZA 2AT5X 3HPEA 2FRSA 3K19A 2ERVA 2FGRA 3WVMA 1JV4A 1KOIA 2AXTO 5F6BA 4M6SA 2MJIA 3FENA 1SLDB 1I06A 3WZQA 1U18A 4GDAA 4MEEA 4M7MA 3VG5A 4Y0PA 1N7YA 5B5GA 1HBQA 3NQ9A 3HTYA 5JDPA 1DZPA 1X8PA 1SWCA 1Y52X 1E06A 3P6CA 1MOYA 2HMBA 1SXUA 1OEKA 3P02A 3RE5A 3MBTA 2MHLA 4IL6O 3PGUA 5LJHA 3WJDA 4KCAA 1ZRYA 1E02A 2XTQA 2FS6A 3FW5A 2N2LA 1SXYA 7PRNA 2W2FA 5HA1A 1SRFA 3SAOA 2Y0LA 2Y3EA 3CQRA 3FR2A 4BCSA 1CBRA 1JMXA 1MM5A 6PRNA 2RD7C 3O22A 2KD2A 4ZCBA 2Q2MA 4YBPA 3SZJA 4GUZA 4XNLA 2FKJA 3VZUX 3TZSA 5AJCA 2GH7A 1JMZA 1H6S1 5G3AA 4QQ1A 5D47A 3QQ2A 5LJEA 1GFNA 3SY9A 1QQSA 2FGSA 4XMEA 1QJPA 2YG2A 4NYQA 3PK2A 1VWHB 4BOEA 1BRQA 2JMBA 1VWEB 1L6MA 1OPBA 1LF7A 1N0SA 4OS8A 4MVLA 4OELA 1B56A 4QRLA 4ZHGA 4Y0SA 2L9CA 3D9WA 2OVDA 1LCZA 3BRZA 2ACPX 3KVNA 4KRAA 3AAEA 3RDOA 3VU1A 2G79A 3PORA 3FA7A 1SWBA 1QFTA 4O3YA 1SY1A 4O4SA 3AAEB 1X8OA 3APUA 1UYNX 1K24A 2R4NA 1LIFA 2ZSCA 5LJDA 5L3YA 3AA6A 5CSEA 4FESA 5K06A 1HQQA 3F6ZB 3VE2A 3DWOX 3AA6B 4O4XA 4IMNA 1SWQA 5KHPA 4D5UA 2JMMA 4NV7A 2RTEB 4CDDA 2X56A 4A60A 2RCQA 3GAQA 4R0BA 4ARHA 4L1NA 4RUUA 1UREA 5DG4A 2WPUA 5HCEC 2WWPA 3ZW0A 2OY8A 1EUOA 4AZRA 2Y32A 4ON1A 3AA7B 4GCQA 2BC3A 2KTSA 2M4LA 3WXQA 5IRAA 3BDRA 3ZW0B 2KTDA 5IYUA 4TNNA 3PQSA 5K67A 4YDBA 4ORXA 1SRGA 2Q39A 2O4VA 2QO4A 3BS2A 4GCPA 2RTPB 4YCEA 4MIRA 1ORMA 4KC7A 4LSFA 2JQYA 4FQEA 1G7NA 3TGCA 4ORRA 2X32A 4CPEA 3UEXA 3H3IA 2F1TA 1FJ1E 2XG6A 4YFQA 3FA9A 1VWKB 5DL5A 1DFVA 4ID2A 1NC9A 3DTQA 3FW4A 4YFRA 3AKNA 1SY0A 4FMSA 2CAMA 1T68X 1VWAB 2M06A 2A5BA 3VHIA 3EMMA 1HBPA 5AFUL 1SMPI 2AH7X 1STSB 3GE2A 2A13A 4QYPA 4GGTA 4RUNA 3O19A 2FHLA 3LK3A 3ZUOA 4G76A 4CPHB 4I95A 2KXPA 3ZW2A 2A8GA 2P8GA 3RDSA 4RL9A 3IFBA 4U8UN 3LK3B 1E2TA 2YMSA 2Q9SA 2KXPB 4K3CA 1SXWA 1EW3A 3CBCA 2X34A 1JJUA 3EBWA 3UEWA 3L4RA 4FBOA 1ICMA 1LIBA 5HZQA 2NNQA 3AAAA 2DJFA 3T2XA 2OFMX 4YCHA 5JR8A 5DL6A 3AAAB 2RTBB 1QFVA 1VWPB 3EYCA 3POXA 3PH5A 2MHDA 1I78A 2JN3A 4PJ0O 1KT4A 2Y7SA 5F58A 1NP1A 5F2BA 1W6FA 1KT3A 4CDEA 1E54A 2W2AA 2F01A 1LELA 3FELA 4IAXA 4N74A 4ODDA 3NQ3A 3B2LA 1RXKA 3RY2A 2MF6A 1KGLA 2ZAGA 2KDYA 1RSUB 1AELA 1HMTA 4B55A 5LJKA 1DZJA 1ZHXA 8PRNA 2WQAE 4CK4A 1UZ2X 4TKHA 3A0HO 2WJRA 4AZNA 4RJXA 1WBIA 4GF4A 4ZHCA 3EW2A 1MX7A 4BGFA 1VWLB 3K3LA 4I3BA 2RN4A 1FELA 5B5FA 2IZGB 3WZPA 1LICA 4FZNA 3E3CA 3QRAA 3N91A 3NX2A 4IB7A 1MPFA 5C0NA 2QCBA 1X8NA 1O8VA 1FDQA 4YH0A 3RBYA 1YP7A 2PI3O 1S2PA 3DWNA 1IKEA 4TKJA 4YKOA 5HZ5A 2OVEA 4QYNA 2HKDA 3RDQA 1YP6A 3QRCA 1SWNA 3VPJE 1THQA 2GTLM 3TGAA 1LFOA 5L8IA 4YVBA 1G85A 1SRJA 2QM9A 2JU3A 1SWPA 4D65A 1EPAA 2WQ9A 3F8AA 3KFGA 2BHVA 4MVKA 5BVQA 3APWA 3HWGA 5GTIO 3UEVA 1LCVA 4YMYA 1PHOA 5LJGA 2FHNX 3KVDD 1KQXA 5G39A 1W5RA 3B2KA 4FSOA 1SWAA 4ORSA 3P24A 5KIDA 3PGRA 3LHNA 3RDMA 3FEPA 4XMGA 1D2UA 4AYMC 2OL7A 2IZCB 3D95A 5HZ8A 4QGXA 4INNA 2IFBA 2JW1A 1GXAA 3Q6LA 1HXXA 1U17A 1A3YA 3JSQA 3U9PC 2MNHA 3PECA 3SZIA 3U0DA 4I60A 3C5OA 3NJTA 4OMXA 3CBSA 4AYDC 4KH8A 4GU8A 1TW4A 1GFPA 3ZQ3A 3KQ0A 3OE3A 4NNTA 2RTDB 3S5XA 2EU7X 3TZGA 3T24A 4FOZA 1JJJA 3LK41 3I17A 5DL8A 4EQAC 2GC9A 2RTAA 2R4LA 4AZLA 5D5DA 5B3MO 1MK5A 2R88A 4GKCA 3S5VA 3FR4A 4GJVA 4PR7A 2FT9A 2RTOB 4JO6A 1BSOA 4C00A 3SLTA 5ADXK 5AEOA 2QOSC 2JU8A 4C5PA 4OEMA 4CDCA 2X45A 2J4UP 1RSTB 2AT3X 2VDFA 2OYBO 4Z6JA 2RTFB 4QGWA 1XCAA 3WYPA 4QZTA 2OFAA 2QO6A 3NADA 3QKGA 1Q9GA 1VPRA 2FGQX 3ELXA 1CBIA 4XMCA 1NQNA 3FMZA 3PH6A 1N4JA 1E5PA 1ZHWA 2IZKA 4TLJA 1ML7A 3VY8X 1FENA 1X8QA 3VG3A 3RDXA 5D4AA 5EDBA 1UYOX 3T2WA 3AUMO 3RDUA 4DQ4A 4C4VA 1B0OA 4GJSA 2FS7A 3O2YA 2ACOA 4BVMA 2CM4A 2MM3A 1T8VA 4C4VB 3BRYA 2RTHB 3STMX 3CKFA 2X8TA 5HTEA 2OL8O 3SLJA 1JJXA 4FQBB 2OL6O 1KT7A 2C1SA 5EDCA 1VWOB 2C4IA 5HWZA 3A0BO 2AKQA 2OVAA 1DZKA 2FR3A 1DV9A 4L3RA 3G7GA 2LHFA 1SLEB 4EKVA 5HZ6A 4GE1A 2LBVA 5IO6A 2WSJA 2RA6A 1ACDA 2IZFB 4WFUA 4ALOA 1RBPA 4F4BA 3C76X 3BLGA 3VHMA 2M07A 5B5EO 4PUXA 1SLFB 3EM0A 5G38A 1JQPA 3FDCA 1QWDA 2A0AA 3Q34A 3EMNX 2W80C 1GFOA 3WJGA 1JZUA 4QGVA 3HWEA 1BSQA 2QOMA 4Y5DA 1RXJA 2FKGA 4OS3A 2X8FA 5HAEA 5EEEA 1STPA 3WBGA 3STKA 2OMFA 1LCWA 4MVEA 3ZWEA 2N2MA 3AA0A 4DNEA 4KR4A 3BU1A 1W4TA 1VYGA 2ODJA 2Y0KA 1A18A 3AA0B 2F1CX 4GDZA 5D8JA 1TXLA 2FWVA 1ZNHA 5B29A 2R4OA 2IZLB 2Y2XA 2AVIA 1IIUA 2X46A 1ZNGA 3JS1A 4EEJA 4BX7A 1X8UA 5FAZA 1LIEA 5E79O 4RLBA 2RTRB 1VWQB 4BX7B 3PDFA 3LTWA 5GV0A 4FZMA 3CWKA 3PEDA 4EXZA 1B4MA 2IZEB 4LKTA 4GZVA 3JTYA 4CDFA 4BBOA 4I9SA 2ALLX 4OS0A 2RTIB 1BT9A 2FTBA 1EIIA 3C77X 1QG5A 5FQ6E 2AT6X 4FUVA 3MG5A 4ZGUA 3B2JA 4GHBA 1N43A 4Y59A 2LFOA 3WU2O 2CZTA 1ERXA 1QABE 3SOTA 4PSQA 2GTFX 2WJQA 1TOUA 4K19A 2ZAIA 4IB6A 2PRNA 3WJEA 2YPVA 1MDCA 1HN2A 4HPCA 3P6HA 1U0XA 3OD9A 2ANSA 5IRUA 2BT9A 5BVTA 4N58A 1VWIB 5FQ7E 1ZHTA 3NR3A 1VWGB 2GJ5A 1QY0A 1OEJA 2RTQB 1I9HA 2G5LA 2MWHA 4LKPA 1EI5A
chains in the Genus database with same CATH topology
3D96A 3PQUA 4XMDA 1E00A 1CRBA 1PEEA 3FR5A 1ZHZA 2AT5X 1S2PA 4YGHA 1IKEA 2JU7A 2LBAA 4TKJA 4YKOA 5AJBA 5F6ZA 5HZ5A 4YGZA 2FRSA 2OVEA 2ERVA 2FGRA 3K19A 3NBXX 3WVMA 4AZQA 1XKIA 1EXSA 1JV4A 4NLJA 1IZNA 4QYNA 1KOIA 2WR6A 3OBLA 1YP6A 3QRCA 5F6BA 4M6SA 3VPJE 2POAA 3SYBA 1THQA 2GTLM 2MJIA 3FENA 3MVFA 3TGAA 1LFOA 4HWMA 5L8IA 1BBPA 1G85A 1I06A 1IZNB 4GCSA 1TVQA 5L8NA 1GX8A 2QM9A 2JU3A 4AYID 4O4OA 2FLJA 4FZLA 2O62A 4D65A 1T0VA 2A2GA 4IABA 1EPAA 4DQ3A 4AYHA 1U18A 4AFKA 1KZXA 4ZGFA 2G78A 2WQ9A 3F8AA 3KFGA 4M7MA 2X27X 4AKMA 3VG5A 4Y0PA 1Y9LA 2BHVA 4FGIB 4MVKA 5BVQA 3APWA 3HWGA 2ZFGA 2XKLA 2ASNX 1HBQA 3NQ9A 3UEVA 3HTYA 4AW8A 2NNEA 1ADLA 4YMYA 5JDPA 1PHOA 1DZPA 1X8PA 5LJGA 1LKEA 3KVDD 1OEEA 5LJCA 4Y0RA 1E06A 1KQXA 3KFFA 3P6CA 5D48A 4TQ2A 2XE1A 3F9DA 3KZAA 1X71A 2LKKA 1BH3A 3B2KA 2HMBA 4KC8A 1SXUA 4FSOA 1OEKA 3SYSA 1MM4A 5KICA 3P02A 4ORSA 3P24A 1I4UA 3MBTA 2MHLA 1IFBA 2Z4HA 2X8SA 4KIIA 5KIDA 5LJHA 4I3CA 5BVSA 3LHNA 1SXXA 3HWBA 1CBQA 3HWFA 2QTKA 3FEPA 2A2UA 4O49A 4FRXA 4COTA 4XMGA 1D2UA 2W2BA 3WJDA 4KCAA 4AYMC 1ZRYA 1E02A 1LIDA 1BLRA 2XTQA 3D95A 5HZ8A 2FS6A 2W81C 4QGXA 4INNA 4NYRA 1OBPA 2IFBA 1B8EA 1TOWA 3FW5A 5PRNA 2N2LA 1SXYA 2J1NA 3AA7A 7PRNA 1P6PA 2JW1A 1SY3A 1GXAA 1YWAA 1G74A 3Q6LA 4FSPA 1HXXA 2OVSA 2W2FA 4NLIA 1LNMA 5HA1A 2WEXA 1Z24A 3SAOA 1U17A 1A3YA 3JSQA 3U9PC 1IFCA 1ZHYA 2MNHA 2Y0LA 3POUA 3CQRA 3FR2A 5T5FA 1CBRA 3PECA 4O4UA 5F7GA 4AYEC 4YDAA 4D6BA 3G7XA 3U0DA 1I04A 4AUIA 4Z3TA 2DM5A 2K0LA 3C5OA 3BY0A 1MM5A 4XNKA 2HZRA 3NP1A 3HK1A 6PRNA 5H9KA 3NPOA 2RD7C 2HYSA 3CBSA 4OMXA 2XE5A 3DA3A 4KR8A 2F09A 4WBKA 4AYDC 3IA8A 4KH8A 3O22A 3BU9A 2KD2A 1GM6A 4IMOA 4ZCBA 4BUMX 4NP1A 4GU8A 2Q2MA 4YBPA 1OPFA 5IO7A 1TW4A 3HWDA 1PRNA 1GFPA 3S26A 2HZQA 3ZQ3A 4I3DA 3KQ0A 3OE3A 3VE1A 1BM5A 4NNTA 4XNLA 3WI4A 3UAQA 1QJ9A 3S5XA 2XTRA 1KQWA 2EU7X 5AJCA 3TZSA 3TZGA 3VZUX 2NP1A 3VY9X 5B27A 2OFRX 4FOZA 1EPBA 2R56A 2XE2A 3T24A 1H6S1 4QQ1A 5D47A 1IKJA 1JJJA 4N7CA 4LSHA 3LK41 3I17A 3SZDA 5LJEA 1GFNA 3SY9A 4B61A 1QQSA 2XSTA 4XMEA 1G5WA 5DL8A 4EQAC 1QJPA 4HFOA 2GC9A 2CBRA 4WHIA 5DL7A 3T1DA 4AZLA 4EDEA 5G26A 2YG2A 5D5DA 4LZUA 4NYQA 1FE3A 4MISA 3V8UA 5L8OA 4TJZA 4BOEA 4A1HA 2Q2PA 4D64A 1BRQA 2JMBA 4JFBA 1L6MA 4U8UM 5EZ2A 4PJ2A 4GKCA 3AKMA 1OPBA 5FQ8E 1LF7A 3FR4A 1N0SA 3S5VA 4OS8A 1RLBE 4MVLA 2FT9A 1B56A 1BSOA 1QY2A 4QRLA 4GK9A 4XMFA 4LSEA 3VG2A 1ICNA 5ADXK 5HZ9A 5AEOA 4ZHGA 3BX7A 2QOSC 1JBHA 2JU8A 4Y0SA 2L9CA 1EALA 2OVDA 1MUPA 1NP4A 3DSZA 4A8ZA 2GE4A 3D97A 2BLGA 2X45A 3LK2A 2J4UP 2AT3X 4N7DA 1Q9FA 4AYNA 2ACPX 4KRAA 4ES7A 3AAEA 2L67A 3VU1A 2G79A 4AZPA 3PORA 3FA7A 4EFGA 4QGWA 4YBUA 1QFTA 4O3YA 1GFMA 1XCAA 3ELZA 3UPGA 3RKGA 4QZTA 3VG6A 1PBOA 2HNXA 1SY1A 2PY1A 4O4SA 2QO6A 3BSZE 4RLCA 1KT6A 3NADA 3QKGA 5HCCC 3AAEB 4IBAA 1Q9GA 1VPRA 3PPTA 1X8OA 5IO5A 2K62A 2FGQX 3ELXA 1CBIA 4XMCA 3APUA 3FMZA 3PH6A 1IW2A 4A1YA 3FEKA 3P6GA 1YWCA 5LKEA 2R74A 2LB6A 1YIVA 1HQPA 1E5PA 1LIFA 1BXWA 2QMIA 1QY1A 5LJDA 1ZHWA 3SZVA 4TKBA 2NNDA 1DZMA 3U03A 2GTLN 4TLJA 1ML7A 5FFHA 3AA6A 4RJWA 2RQ0A 4ZHHA 4FESA 3VY8X 5HBSA 4LZVA 4O3ZA 1FENA 2AT0X 2JOZA 2L5PA 1X8QA 2KW1A 3VG3A 5K06A 3F6ZB 5CYBA 5DPQA 4U8UO 2Z4IA 1O1VA 5D4AA 5EEDA 3VE2A 5EDBA 3AA6B 1GX9A 4O4XA 4IMNA 1GFQA 5KHPA 4DQ4A 4LQZA 1B0OA 2GTLO 4D5UA 2FS7A 3O2YA 5AFUK 2ACOA 4BVMA 2ZLDA 2JMMA 3D4RA 5H8TA 1HXTA 2CM4A 4U3QA 5H9AA 2MM3A 1ZNDA 1GGLA 5HCDC 4A60A 2RCTA 1T8VA 4ZHFA 3SY7A 1YS5A 2E4JA 3CMPA 2RCQA 3CQNA 4IAWA 4ZR2A 3GAQA 4R0BA 3STMX 4ARHA 4L1NA 4RUUA 4C69X 1UREA 5DG4A 4ZHDA 5HCEC 2X8TA 1PMPA 4O3WA 2WWPA 5HTEA 2G7BA 3P6EA 1EUOA 3PP6A 3ZW0A 5LKFA 4AZRA 4FQBB 4ON1A 1JJXA 3AA7B 4GCQA 1KT7A 3KFHA 3WI5A 2BS5A 2KTSA 2KT4B 4AKRA 2M4LA 5EDCA 1MVGA 3WXQA 4ZFXA 5HWZA 3BDRA 3RWXA 4O3XB 2KTDA 4ZH6A 3ZW0B 2AKQA 1X89A 2OVAA 5IYUA 1DZKA 4TNNA 2XMXA 2FR3A 3PQSA 4AKRB 4YDBA 4ORXA 1DV9A 4L3RA 2Q39A 2O4VA 4QAEA 3JQOA 5ADXL 2QO4A 3G7GA 2LHFA 3BS2A 4FT6A 4GCPA 1H91A 4YCEA 2F73A 5HZ6A 4MIRA 1ORMA 4FBVA 3S60A 4GE1A 4KC7A 4JGLA 4LSFA 5D45A 2MO5A 4WFVA 2LBVA 4N59A 5IO6A 3APVA 3TGBA 2WSJA 1D3SA 1G7NA 1YWBA 2A3FX 2RA6A 3FYFA 4ORRA 3TGCA 1CJ5A 2LFUA 4LSIA 1ACDA 4UU3A 3UEXA 1QJ8A 4WFUA 3H3IA 4HPDA 4ALOA 5FENA 2F1TA 5AQ6A 2XG6A 1RBPA 4YFQA 3C76X 3ZI8A 3FA9A 4F4BA 2OZQA 3BLGA 1A57A 1FEMA 3P6FA 3TF6A 3AA1A 1KZWA 2HLVA 3APXA 3HOLA 4YKMA 4CSBA 4ZH9A 1HXUA 2M07A 1DFVA 5DL5A 4XMHA 3RSWA 3ZW1A 1JYJA 1HMRA 4PUXA 4ID2A 3DTQA 3FW4A 5F1EA 4YFRA 3AKNA 1ZNLA 3AA1B 1NGLA 3EM0A 3T0SA 4QNIA 1SY0A 4FMSA 1QWDA 3CR6A 2A0AA 3ZW1B 3EMNX 2W80C 1T68X 2L68A 2K4TA 2KC0A 1GFOA 3WJGA 1BWYA 3NQKA 1JZUA 3FIQA 2M06A 4QGVA 1OPAA 3STNA 3POQA 3HWEA 5H9NA 1BSQA 3LV4A 2CBSA 3EMMA 4OS3A 2X8FA 5HAEA 3VZTX 1HBPA 5EEEA 3T20A 5AFUL 4HPAA 3WBGA 3STKA 5CE4A 2OMFA 3FYXA 4MVIA 4MVEA 3ZWEA 3O0EA 2N2MA 1SMPI 4Y0QA 3AA0A 3VG7A 2R73A 2AH7X 4KR4A 4GETA 3NSGA 2FR2A 4IB9A 3GE2A 3BU1A 3HW9A 2A13A 3LK2B 4QYPA 1VYGA 4RUNA 3O19A 4BQUA 5EE2A 4YFPA 4G76A 2ODJA 3ZUOA 2Y0KA 1Y9TA 1A18A 4I95A 4UU2A 3AA0B 4GDZA 4YGGA 2KXPA 1SY2A 1ALBA 1TXLA 2FWVA 5D8JA 3ZW2A 3DA4A 3LK3A 4KT5A 1DF3A 1ZNHA 3B2IA 2F1VA 5FVNA 5B29A 2P8GA 1ERBA 4RL9A 5EPQA 2Y2XA 3VG4A 3IFBA 4U8UN 3LK3B 2YMSA 2Q9SA 1BJ7A 4ZJ0A 2CM9A 1IIUA 2KXPB 2X46A 1ZNGA 3JS1A 4EEJA 3FA6A 1SXWA 1EW3A 1JIWI 3CBCA 4ML7B 1HMSA 1X8UA 5HA0A 3RZYA 3UEWA 3EBWA 4QZUA 5FAZA 3ZUIA 1LIEA 3L4RA 4GH7A 4FBOA 1JYDA 2PORA 3OJYC 4RLBA 1ICMA 2AL0X 4GNWA 4O9SA 3I0AA 4HPBA 1LIBA 2Q4NA 5GV0A 1SA8A 3NX1A 1YUPA 5HZQA 3CWKA 4ORYA 4FZMA 2NNQA 3PEDA 4ALBA 4EXZA 2WUTA 3AAAA 1B4MA 4LKTA 4GZVA 3GP6A 3JTYA 2OFMX 1R0UA 3RBHA 4YCHA 4I9SA 2ALLX 4AZOA 1OBQA 4OS0A 5JR8A 5DL6A 3WJBA 1BT9A 3AAAB 2FTBA 3BX8A 1EIIA 1I05A 1VYFA 3C77X 1EQDA 1QG5A 1QFVA 2LA7A 3EYCA 5FQ6E 2AT6X 3POXA 3PH5A 2MHDA 4FUVA 1AQBA 2JN3A 3P6DA 4E1TA 4NW4A 2YNKA 1KT4A 2Y7SA 1A2DA 1GKAA 5F58A 1NP1A 4ZGUA 1CBSA 3B2JA 2KZ7A 1O1UA 3ZZVA 4GHBA 1KT3A 3WJFA 1P4TA 1LPJA 1DC9A 1FTPA 1GT4A 1KXOA 2W2AA 4I6SA 3WJCA 4FBRA 1E54A 2LFOA 3FELA 1GKAB 4IAXA 3LK42 2CZTA 1G90A 1ERXA 2XE3A 2KZ7B 1QABE 3SOTA 4PSQA 4ODDA 3UU2A 3MX7A 3UEUA 2WEWA 3NQ3A 3B2LA 2GTFX 1KGLA 4I9RA 1OSMA 4G75A 4FRTA 2ZAGA 2KDYA 1TOUA 5HTDA 4K19A 2ZAIA 4IB6A 2PRNA 1AELA 2Y0HA 4AZMA 3WJEA 2YPVA 1MDCA 1HN2A 1GT5A 1MX8A 1HMTA 4HPCA 5LJKA 3EBKA 1DZJA 1GT3A 3P6HA 3HOEA 1U0XA 3OD9A 1ZHXA 2ANSA 3WOVA 8PRNA 2BS6A 1YWDA 4NNSA 4OMWA 2BT9A 2WQAE 5BVTA 4CK4A 1UZ2X 4GRJA 1BEBA 4TKHA 3A2SX 3KFIA 4IB8A 1AVGI 5FQ7E 4AZNA 1KT5A 3PRNA 4N58A 4RJXA 4GF4A 2QO5A 3FA8A 3BRNA 4ZHCA 1ZNKA 1ZHTA 3VZWX 1AB0A 4JCHA 1MX7A 1ZNEA 2K23A 3K3LA 3NR3A 4I3BA 2RN4A 2GJ5A 1FELA 4GNYA 1QY0A 5LJBA 1S44A 1GT1A 1OBUA 1LICA 4CV7A 4FZNA 1OEJA 2N93A 3C78X 3B2HA 3E3CA 1S7DA 1EIOA 3N91A 3QRAA 3NX2A 3FLLA 1PM1X 2AMMX 4IB7A 4D6AA 2MWHA 1MPFA 2CZUA 5C0NA 4U9CA 1X8NA 4E1SA 4LKPA 1O8VA 1FDQA 4YH0A 1BSYA 2AT8X 4ORUA 5H9LA 5BYPA 3RBYA 1EI5A 1BRPA 4ORWA 1YP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PQS A;  3V8U A;  3PQU A;  1YS5 A;  3VE1 A;  3HOL A;  3UAQ A;  4AYN A;  2KDY A;  4O3Z A;  4O3W A;  5T5F A;  4QQ1 A;  4O3Y A;  2YPV A;  4O4U A;  4AYE C;  2Y7S A;  4Z3T A;  3VE2 A;  4O49 A;  4O4X A;  5EE2 A;  3HOE A;  2LFU A;  3KVD D;  4U9C A;  4AYD C;  4AYM C;  2W80 C;  4AYI D;  2KC0 A;  4O3X B;  2W81 C; 
#chains in the Genus database with same CATH topology
 1PEE A;  3FR5 A;  3FID A;  4YGH A;  2LBA A;  3NBX X;  1EXS A;  3OBL A;  1SWK A;  2POA A;  4BX5 A;  3MVF A;  4HWM A;  4GCS A;  1TVQ A;  1GX8 A;  1K3B A;  2FLJ A;  4FZL A;  2O62 A;  2IZI A;  4BX5 B;  4AYH A;  4AFK A;  1KZX A;  4CPI A;  1Y9L A;  5B2A O;  2ZFG A;  2XKL A;  2ASN X;  2NNE A;  1LKE A;  3AEH A;  3EC5 A;  5D48 A;  4TQ2 A;  2XE1 A;  4UB6 O;  3F9D A;  3KZA A;  1X71 A;  1BH3 A;  2RTN B;  4KC8 A;  5KIC A;  1I4U A;  2Y3F A;  2Z4H A;  2X8S A;  4KII A;  4I3C A;  5BVS A;  1SXX A;  1VWF B;  3HWF A;  4O49 A;  4FRX A;  4COT A;  2VFB A;  5CHK A;  2C1Q A;  1LID A;  1BLR A;  2X9K A;  2W81 C;  1RAV A;  4NYR A;  1SWO A;  5PRN A;  2IZB A;  4FSP A;  4NLI A;  1LNM A;  2WEX A;  1Z24 A;  1Y55 X;  1ZHY A;  4AYE C;  4D6B A;  1I04 A;  2K0L A;  4XNK A;  4GGR A;  2HZR A;  3NP1 A;  3HK1 A;  4CTD A;  4KR8 A;  2IZJ A;  3DA3 A;  2F09 A;  4WBK A;  3IA8 A;  2RTC B;  4BUM X;  4NP1 A;  1OPF A;  1PRN A;  1SWG A;  4I3D A;  3UAQ A;  1QJ9 A;  1KQW A;  2NP1 A;  4Z2O A;  2OFR X;  1EPB A;  2XE2 A;  2X55 A;  2XST A;  2CBR A;  5DL7 A;  3T1D A;  1S5L O;  1SWJ A;  1SWL A;  4LZU A;  4MIS A;  4TJZ A;  4A1H A;  2Q2P A;  4D64 A;  4JFB A;  1OSP O;  4U8U M;  5EZ2 A;  3AKM A;  1KFF A;  5FQ8 E;  1SWT A;  4Z28 A;  1PBY A;  3VG2 A;  1ICN A;  1JBH A;  3DSZ A;  4A8Z A;  2GE4 A;  3D97 A;  2BLG A;  3LK2 A;  1IJ8 A;  4N7D A;  1Q9F A;  4AYN A;  5KAI O;  2L67 A;  3CKG A;  4YBU A;  1GFM A;  3ELZ A;  3UPG A;  3RKG A;  3VG6 A;  2HNX A;  2PY1 A;  4RLC A;  3PPT A;  5IO5 A;  2K62 A;  4A1Y A;  3FEK A;  3P6G A;  1YWC A;  5LKE A;  4N75 A;  1HQP A;  3SZV A;  4TKB A;  1DZM A;  3U03 A;  5FFH A;  1NDJ A;  4ZHH A;  5HBS A;  4LZV A;  4O3Z A;  2JOZ A;  2KW1 A;  5CYB A;  5DPQ A;  4U8U O;  1O1V A;  2RTG B;  4GD9 A;  1VWJ B;  2DJG A;  2GTL O;  5AFU K;  2ZLD A;  1HXT A;  4U3Q A;  5H9A A;  5HCD C;  4ZHF A;  1YS5 A;  3CMP A;  1LDO A;  3CQN A;  4ZR2 A;  1MM9 A;  1PMP A;  4O3W A;  1KL5 A;  2G7B A;  3PP6 A;  3T6F A;  1HY2 A;  2BS5 A;  4AKR A;  4ZFX A;  4Z2P A;  3RWX A;  4O3X B;  3SLO A;  4AKR B;  1LDQ A;  4FT6 A;  4FBV A;  4JGL A;  5D45 A;  2MO5 A;  1LUQ A;  3APV A;  3TGB A;  2UYW A;  1Y0G A;  2LFU A;  4U46 A;  4UU3 A;  5FEN A;  5AQ6 A;  3ZI8 A;  2OZQ A;  1KZW A;  2BSZ A;  2HLV A;  4CSB A;  4YKM A;  4ZH9 A;  3ZW1 A;  1JYJ A;  1HMR A;  5F1E A;  5IXG A;  1ZNL A;  1NGL A;  3CR6 A;  3ZW1 B;  2KC0 A;  1BWY A;  3NQK A;  3FIQ A;  1OPA A;  3POQ A;  4CPF A;  1SLG B;  3EW1 A;  2CBS A;  1VWB B;  3VZT X;  2RTM A;  4HPA A;  3O0E A;  1T16 A;  4MVI A;  4Y0Q A;  2G8C O;  2R73 A;  4GET A;  4BQU A;  3PGS A;  1Y9T A;  1SWH A;  4YGG A;  1ALB A;  4KT5 A;  1DF3 A;  3B2I A;  5FVN A;  3VG4 A;  4ZJ0 A;  1BJ7 A;  2CM9 A;  1JIW I;  3ZUI A;  2IZH B;  5JD2 A;  2OY1 O;  2VFC A;  4GH7 A;  2RTL A;  3OJY C;  2AL0 X;  3I0A A;  4HPB A;  1SA8 A;  5TIS O;  3PF1 A;  2WUT A;  3GP6 A;  1R0U A;  2OY7 A;  1MEP A;  4AZO A;  1GX3 A;  1OBQ A;  3BX8 A;  3VHH A;  1EQD A;  2LA7 A;  1AQB A;  3P6D A;  4E1T A;  4NW4 A;  1CBS A;  1O1U A;  3KZI O;  2UZ2 A;  1P4T A;  1DC9 A;  1FTP A;  3WJC A;  5IRW A;  3UEU A;  2WEW A;  4I9R A;  4G75 A;  1HXL A;  5HTD A;  2Y0H A;  4DCB A;  2RTK A;  3HOE A;  3MM0 A;  3WOV A;  1SWE A;  2BS6 A;  4NNS A;  4OMW A;  3A2S X;  3KFI A;  4IB8 A;  1AVG I;  1KT5 A;  3FA8 A;  1NBX A;  3VZW X;  4JHQ A;  1AB0 A;  2K23 A;  1S44 A;  1GT1 A;  1OBU A;  3T6L A;  4CV7 A;  3C78 X;  3B2H A;  1SWU A;  1EIO A;  3FLL A;  4U9C A;  4E1S A;  5H9L A;  4AZQ A;  3RSW A;  3VY9 X;  3D96 A;  3PQU A;  4XMD A;  1VWM B;  1KL4 A;  5B66 O;  2JU7 A;  5AJB A;  5F6Z A;  4YGZ A;  1XKI A;  1IZN A;  2X4M A;  4NLJ A;  2WR6 A;  1Y53 X;  3SYB A;  1BBP A;  1IZN B;  5L8N A;  4K3B A;  1T1L A;  4AYI D;  4O4O A;  4BX6 A;  4JNJ A;  1T0V A;  2A2G A;  4IAB A;  1SRI A;  4DQ3 A;  4ZGF A;  2G78 A;  2X27 X;  4AKM A;  3DZM A;  2OFB A;  4BX6 B;  4FGI B;  3RY1 A;  4AW8 A;  1ADL A;  1OEE A;  5LJC A;  4Y0R A;  3KFF A;  2LKK A;  3SYS A;  1MM4 A;  1N9M A;  1IFB A;  3X00 A;  3HWB A;  1CBQ A;  2QTK A;  2A2U A;  2IZD B;  2IWW A;  2W2B A;  1AVD A;  1OBP A;  4OKA A;  1B8E A;  1TOW A;  1SWR A;  2J1N A;  3AA7 A;  2I5V O;  1P6P A;  1SY3 A;  1YWA A;  1G74 A;  2OVS A;  5T5F A;  1IFC A;  3POU A;  5F7G A;  4O4U A;  4YDA A;  3G7X A;  4Z3T A;  4AUI A;  2DM5 A;  3BY0 A;  5K68 A;  5H9K A;  3NPO A;  2HYS A;  2XE5 A;  3BU9 A;  1GM6 A;  2A5C A;  4IMO A;  5IO7 A;  3HWD A;  3S26 A;  2HZQ A;  3SZH A;  3VE1 A;  1BM5 A;  3WI4 A;  2XTR A;  5B27 A;  2R56 A;  1IKJ A;  4UB8 O;  4N7C A;  4LSH A;  3SZD A;  4B61 A;  1G5W A;  4HFO A;  4WHI A;  1SRE A;  4EDE A;  5G26 A;  1FE3 A;  3V8U A;  4BJ8 A;  5L8O A;  4PJ2 A;  1RLB E;  1RXH A;  1QY2 A;  1SWD A;  4GK9 A;  4XMF A;  4LSE A;  1N9Y A;  5HZ9 A;  3BX7 A;  1EAL A;  1MUP A;  1NP4 A;  1SRH A;  4ES7 A;  1STR B;  4CPH A;  4AZP A;  4EFG A;  2WVP A;  1PBO A;  3BSZ E;  1KT6 A;  5HCC C;  1KL3 A;  4IBA A;  3WZO A;  1IW2 A;  2R74 A;  2LB6 A;  2OY5 O;  5KAF O;  1YIV A;  1BXW A;  2QMI A;  1QY1 A;  2NND A;  4RJW A;  2GTL N;  2RQ0 A;  2AT0 X;  2L5P A;  2OF9 A;  3BS0 A;  2JGS A;  1SWS A;  2Z4I A;  5EED A;  1GX9 A;  1GFQ A;  3RE6 A;  4LQZ A;  3D4R A;  5H8T A;  1VYO A;  4GGZ A;  1ZND A;  1GGL A;  2RCT A;  3SY7 A;  2E4J A;  4IAW A;  4C69 X;  4ZHD A;  3P6E A;  5LKF A;  3KFH A;  2R4P A;  3WI5 A;  2KT4 B;  1MVG A;  5H2F O;  4ZH6 A;  1X89 A;  2XMX A;  4Z27 A;  3WYQ A;  2IWV A;  2I5Z O;  4QAE A;  3JQO A;  5ADX L;  1H91 A;  2F73 A;  3S60 A;  4WFV A;  4N59 A;  1D3S A;  1YWB A;  2A3F X;  1CJ5 A;  3FYF A;  4LSI A;  1QJ8 A;  4HPD A;  1A57 A;  1FEM A;  3P6F A;  3TF6 A;  3AA1 A;  1VWC B;  2IZA A;  3APX A;  3HOL A;  1HXU A;  4XMH A;  3AA1 B;  3T0S A;  4QNI A;  1WUB A;  2K4T A;  2L68 A;  1VWD B;  3STN A;  5H9N A;  4NV8 A;  3LV4 A;  3T20 A;  3WZN A;  3FYX A;  5CE4 A;  3VG7 A;  3NSG A;  2FR2 A;  4IB9 A;  3HW9 A;  3LK2 B;  2R89 A;  5EE2 A;  4YFP A;  1DF8 A;  4UU2 A;  1SY2 A;  3DA4 A;  2F1V A;  1ERB A;  5EPQ A;  5B10 O;  3JCU O;  3FA6 A;  4ML7 B;  1HMS A;  5HA0 A;  3RZY A;  4QZU A;  4Z2V A;  5GTH O;  1JYD A;  2POR A;  4GNW A;  4O9S A;  2Q4N A;  3NX1 A;  1YUP A;  4ORY A;  4ALB A;  3RBH A;  3WJB A;  1HXZ A;  1I05 A;  1VYF A;  2RTJ A;  2YNK A;  1A2D A;  1GKA A;  2KZ7 A;  3ZZV A;  3WJF A;  1LPJ A;  5B11 O;  1GT4 A;  1KXO A;  4I6S A;  4FBR A;  3VGW A;  1GKA B;  3LK4 2;  1G90 A;  2XE3 A;  2KZ7 B;  3UU2 A;  3MX7 A;  1OSM A;  4FRT A;  1SWF A;  4AZM A;  1GT5 A;  1MX8 A;  3EBK A;  1GT3 A;  1YWD A;  2OF8 A;  4GRJ A;  1BEB A;  3PRN A;  2QO5 A;  1VWR B;  3BRN A;  1ZNK A;  4JCH A;  1ZNE A;  4GNY A;  2AF5 A;  5LJB A;  1VWN B;  2R8A A;  1AVE A;  2N93 A;  4IRW A;  1S7D A;  1PM1 X;  2AMM X;  4D6A A;  2CZU A;  1BSY A;  2AT8 X;  4ORU A;  5BYP A;  1BRP A;  4ORW A;  1NQM A;  1E00 A;  1CRB A;  1PTS A;  1ZHZ A;  2AT5 X;  3HPE A;  2FRS A;  3K19 A;  2ERV A;  2FGR A;  3WVM A;  1JV4 A;  1KOI A;  2AXT O;  5F6B A;  4M6S A;  2MJI A;  3FEN A;  1SLD B;  1I06 A;  3WZQ A;  1U18 A;  4GDA A;  4MEE A;  4M7M A;  3VG5 A;  4Y0P A;  1N7Y A;  5B5G A;  1HBQ A;  3NQ9 A;  3HTY A;  5JDP A;  1DZP A;  1X8P A;  1SWC A;  1Y52 X;  1E06 A;  3P6C A;  1MOY A;  2HMB A;  1SXU A;  1OEK A;  3P02 A;  3RE5 A;  3MBT A;  2MHL A;  4IL6 O;  3PGU A;  5LJH A;  3WJD A;  4KCA A;  1ZRY A;  1E02 A;  2XTQ A;  2FS6 A;  3FW5 A;  2N2L A;  1SXY A;  7PRN A;  2W2F A;  5HA1 A;  1SRF A;  3SAO A;  2Y0L A;  2Y3E A;  3CQR A;  3FR2 A;  4BCS A;  1CBR A;  1JMX A;  1MM5 A;  6PRN A;  2RD7 C;  3O22 A;  2KD2 A;  4ZCB A;  2Q2M A;  4YBP A;  3SZJ A;  4GUZ A;  4XNL A;  2FKJ A;  3VZU X;  3TZS A;  5AJC A;  2GH7 A;  1JMZ A;  1H6S 1;  5G3A A;  4QQ1 A;  5D47 A;  3QQ2 A;  5LJE A;  1GFN A;  3SY9 A;  1QQS A;  2FGS A;  4XME A;  1QJP A;  2YG2 A;  4NYQ A;  3PK2 A;  1VWH B;  4BOE A;  1BRQ A;  2JMB A;  1VWE B;  1L6M A;  1OPB A;  1LF7 A;  1N0S A;  4OS8 A;  4MVL A;  4OEL A;  1B56 A;  4QRL A;  4ZHG A;  4Y0S A;  2L9C A;  3D9W A;  2OVD A;  1LCZ A;  3BRZ A;  2ACP X;  3KVN A;  4KRA A;  3AAE A;  3RDO A;  3VU1 A;  2G79 A;  3POR A;  3FA7 A;  1SWB A;  1QFT A;  4O3Y A;  1SY1 A;  4O4S A;  3AAE B;  1X8O A;  3APU A;  1UYN X;  1K24 A;  2R4N A;  1LIF A;  2ZSC A;  5LJD A;  5L3Y A;  3AA6 A;  5CSE A;  4FES A;  5K06 A;  1HQQ A;  3F6Z B;  3VE2 A;  3DWO X;  3AA6 B;  4O4X A;  4IMN A;  1SWQ A;  5KHP A;  4D5U A;  2JMM A;  4NV7 A;  2RTE B;  4CDD A;  2X56 A;  4A60 A;  2RCQ A;  3GAQ A;  4R0B A;  4ARH A;  4L1N A;  4RUU A;  1URE A;  5DG4 A;  2WPU A;  5HCE C;  2WWP A;  3ZW0 A;  2OY8 A;  1EUO A;  4AZR A;  2Y32 A;  4ON1 A;  3AA7 B;  4GCQ A;  2BC3 A;  2KTS A;  2M4L A;  3WXQ A;  5IRA A;  3BDR A;  3ZW0 B;  2KTD A;  5IYU A;  4TNN A;  3PQS A;  5K67 A;  4YDB A;  4ORX A;  1SRG A;  2Q39 A;  2O4V A;  2QO4 A;  3BS2 A;  4GCP A;  2RTP B;  4YCE A;  4MIR A;  1ORM A;  4KC7 A;  4LSF A;  2JQY A;  4FQE A;  1G7N A;  3TGC A;  4ORR A;  2X32 A;  4CPE A;  3UEX A;  3H3I A;  2F1T A;  1FJ1 E;  2XG6 A;  4YFQ A;  3FA9 A;  1VWK B;  5DL5 A;  1DFV A;  4ID2 A;  1NC9 A;  3DTQ A;  3FW4 A;  4YFR A;  3AKN A;  1SY0 A;  4FMS A;  2CAM A;  1T68 X;  1VWA B;  2M06 A;  2A5B A;  3VHI A;  3EMM A;  1HBP A;  5AFU L;  1SMP I;  2AH7 X;  1STS B;  3GE2 A;  2A13 A;  4QYP A;  4GGT A;  4RUN A;  3O19 A;  2FHL A;  3LK3 A;  3ZUO A;  4G76 A;  4CPH B;  4I95 A;  2KXP A;  3ZW2 A;  2A8G A;  2P8G A;  3RDS A;  4RL9 A;  3IFB A;  4U8U N;  3LK3 B;  1E2T A;  2YMS A;  2Q9S A;  2KXP B;  4K3C A;  1SXW A;  1EW3 A;  3CBC A;  2X34 A;  1JJU A;  3EBW A;  3UEW A;  3L4R A;  4FBO A;  1ICM A;  1LIB A;  5HZQ A;  2NNQ A;  3AAA A;  2DJF A;  3T2X A;  2OFM X;  4YCH A;  5JR8 A;  5DL6 A;  3AAA B;  2RTB B;  1QFV A;  1VWP B;  3EYC A;  3POX A;  3PH5 A;  2MHD A;  1I78 A;  2JN3 A;  4PJ0 O;  1KT4 A;  2Y7S A;  5F58 A;  1NP1 A;  5F2B A;  1W6F A;  1KT3 A;  4CDE A;  1E54 A;  2W2A A;  2F01 A;  1LEL A;  3FEL A;  4IAX A;  4N74 A;  4ODD A;  3NQ3 A;  3B2L A;  1RXK A;  3RY2 A;  2MF6 A;  1KGL A;  2ZAG A;  2KDY A;  1RSU B;  1AEL A;  1HMT A;  4B55 A;  5LJK A;  1DZJ A;  1ZHX A;  8PRN A;  2WQA E;  4CK4 A;  1UZ2 X;  4TKH A;  3A0H O;  2WJR A;  4AZN A;  4RJX A;  1WBI A;  4GF4 A;  4ZHC A;  3EW2 A;  1MX7 A;  4BGF A;  1VWL B;  3K3L A;  4I3B A;  2RN4 A;  1FEL A;  5B5F A;  2IZG B;  3WZP A;  1LIC A;  4FZN A;  3E3C A;  3QRA A;  3N91 A;  3NX2 A;  4IB7 A;  1MPF A;  5C0N A;  2QCB A;  1X8N A;  1O8V A;  1FDQ A;  4YH0 A;  3RBY A;  1YP7 A;  2PI3 O;  1S2P A;  3DWN A;  1IKE A;  4TKJ A;  4YKO A;  5HZ5 A;  2OVE A;  4QYN A;  2HKD A;  3RDQ A;  1YP6 A;  3QRC A;  1SWN A;  3VPJ E;  1THQ A;  2GTL M;  3TGA A;  1LFO A;  5L8I A;  4YVB A;  1G85 A;  1SRJ A;  2QM9 A;  2JU3 A;  1SWP A;  4D65 A;  1EPA A;  2WQ9 A;  3F8A A;  3KFG A;  2BHV A;  4MVK A;  5BVQ A;  3APW A;  3HWG A;  5GTI O;  3UEV A;  1LCV A;  4YMY A;  1PHO A;  5LJG A;  2FHN X;  3KVD D;  1KQX A;  5G39 A;  1W5R A;  3B2K A;  4FSO A;  1SWA A;  4ORS A;  3P24 A;  5KID A;  3PGR A;  3LHN A;  3RDM A;  3FEP A;  4XMG A;  1D2U A;  4AYM C;  2OL7 A;  2IZC B;  3D95 A;  5HZ8 A;  4QGX A;  4INN A;  2IFB A;  2JW1 A;  1GXA A;  3Q6L A;  1HXX A;  1U17 A;  1A3Y A;  3JSQ A;  3U9P C;  2MNH A;  3PEC A;  3SZI A;  3U0D A;  4I60 A;  3C5O A;  3NJT A;  4OMX A;  3CBS A;  4AYD C;  4KH8 A;  4GU8 A;  1TW4 A;  1GFP A;  3ZQ3 A;  3KQ0 A;  3OE3 A;  4NNT A;  2RTD B;  3S5X A;  2EU7 X;  3TZG A;  3T24 A;  4FOZ A;  1JJJ A;  3LK4 1;  3I17 A;  5DL8 A;  4EQA C;  2GC9 A;  2RTA A;  2R4L A;  4AZL A;  5D5D A;  5B3M O;  1MK5 A;  2R88 A;  4GKC A;  3S5V A;  3FR4 A;  4GJV A;  4PR7 A;  2FT9 A;  2RTO B;  4JO6 A;  1BSO A;  4C00 A;  3SLT A;  5ADX K;  5AEO A;  2QOS C;  2JU8 A;  4C5P A;  4OEM A;  4CDC A;  2X45 A;  2J4U P;  1RST B;  2AT3 X;  2VDF A;  2OYB O;  4Z6J A;  2RTF B;  4QGW A;  1XCA A;  3WYP A;  4QZT A;  2OFA A;  2QO6 A;  3NAD A;  3QKG A;  1Q9G A;  1VPR A;  2FGQ X;  3ELX A;  1CBI A;  4XMC A;  1NQN A;  3FMZ A;  3PH6 A;  1N4J A;  1E5P A;  1ZHW A;  2IZK A;  4TLJ A;  1ML7 A;  3VY8 X;  1FEN A;  1X8Q A;  3VG3 A;  3RDX A;  5D4A A;  5EDB A;  1UYO X;  3T2W A;  3AUM O;  3RDU A;  4DQ4 A;  4C4V A;  1B0O A;  4GJS A;  2FS7 A;  3O2Y A;  2ACO A;  4BVM A;  2CM4 A;  2MM3 A;  1T8V A;  4C4V B;  3BRY A;  2RTH B;  3STM X;  3CKF A;  2X8T A;  5HTE A;  2OL8 O;  3SLJ A;  1JJX A;  4FQB B;  2OL6 O;  1KT7 A;  2C1S A;  5EDC A;  1VWO B;  2C4I A;  5HWZ A;  3A0B O;  2AKQ A;  2OVA A;  1DZK A;  2FR3 A;  1DV9 A;  4L3R A;  3G7G A;  2LHF A;  1SLE B;  4EKV A;  5HZ6 A;  4GE1 A;  2LBV A;  5IO6 A;  2WSJ A;  2RA6 A;  1ACD A;  2IZF B;  4WFU A;  4ALO A;  1RBP A;  4F4B A;  3C76 X;  3BLG A;  3VHM A;  2M07 A;  5B5E O;  4PUX A;  1SLF B;  3EM0 A;  5G38 A;  1JQP A;  3FDC A;  1QWD A;  2A0A A;  3Q34 A;  3EMN X;  2W80 C;  1GFO A;  3WJG A;  1JZU A;  4QGV A;  3HWE A;  1BSQ A;  2QOM A;  4Y5D A;  1RXJ A;  2FKG A;  4OS3 A;  2X8F A;  5HAE A;  5EEE A;  1STP A;  3WBG A;  3STK A;  2OMF A;  1LCW A;  4MVE A;  3ZWE A;  2N2M A;  3AA0 A;  4DNE A;  4KR4 A;  3BU1 A;  1W4T A;  1VYG A;  2ODJ A;  2Y0K A;  1A18 A;  3AA0 B;  2F1C X;  4GDZ A;  5D8J A;  1TXL A;  2FWV A;  1ZNH A;  5B29 A;  2R4O A;  2IZL B;  2Y2X A;  2AVI A;  1IIU A;  2X46 A;  1ZNG A;  3JS1 A;  4EEJ A;  4BX7 A;  1X8U A;  5FAZ A;  1LIE A;  5E79 O;  4RLB A;  2RTR B;  1VWQ B;  4BX7 B;  3PDF A;  3LTW A;  5GV0 A;  4FZM A;  3CWK A;  3PED A;  4EXZ A;  1B4M A;  2IZE B;  4LKT A;  4GZV A;  3JTY A;  4CDF A;  4BBO A;  4I9S A;  2ALL X;  4OS0 A;  2RTI B;  1BT9 A;  2FTB A;  1EII A;  3C77 X;  1QG5 A;  5FQ6 E;  2AT6 X;  4FUV A;  3MG5 A;  4ZGU A;  3B2J A;  4GHB A;  1N43 A;  4Y59 A;  2LFO A;  3WU2 O;  2CZT A;  1ERX A;  1QAB E;  3SOT A;  4PSQ A;  2GTF X;  2WJQ A;  1TOU A;  4K19 A;  2ZAI A;  4IB6 A;  2PRN A;  3WJE A;  2YPV A;  1MDC A;  1HN2 A;  4HPC A;  3P6H A;  1U0X A;  3OD9 A;  2ANS A;  5IRU A;  2BT9 A;  5BVT A;  4N58 A;  1VWI B;  5FQ7 E;  1ZHT A;  3NR3 A;  1VWG B;  2GJ5 A;  1QY0 A;  1OEJ A;  2RTQ B;  1I9H A;  2G5L A;  2MWH A;  4LKP A;  1EI5 A; 
#chains in the Genus database with same CATH homology
 3D96 A;  3PQU A;  4XMD A;  1E00 A;  1CRB A;  1PEE A;  3FR5 A;  1ZHZ A;  2AT5 X;  1S2P A;  4YGH A;  1IKE A;  2JU7 A;  2LBA A;  4TKJ A;  4YKO A;  5AJB A;  5F6Z A;  5HZ5 A;  4YGZ A;  2FRS A;  2OVE A;  2ERV A;  2FGR A;  3K19 A;  3NBX X;  3WVM A;  4AZQ A;  1XKI A;  1EXS A;  1JV4 A;  4NLJ A;  1IZN A;  4QYN A;  1KOI A;  2WR6 A;  3OBL A;  1YP6 A;  3QRC A;  5F6B A;  4M6S A;  3VPJ E;  2POA A;  3SYB A;  1THQ A;  2GTL M;  2MJI A;  3FEN A;  3MVF A;  3TGA A;  1LFO A;  4HWM A;  5L8I A;  1BBP A;  1G85 A;  1I06 A;  1IZN B;  4GCS A;  1TVQ A;  5L8N A;  1GX8 A;  2QM9 A;  2JU3 A;  4AYI D;  4O4O A;  2FLJ A;  4FZL A;  2O62 A;  4D65 A;  1T0V A;  2A2G A;  4IAB A;  1EPA A;  4DQ3 A;  4AYH A;  1U18 A;  4AFK A;  1KZX A;  4ZGF A;  2G78 A;  2WQ9 A;  3F8A A;  3KFG A;  4M7M A;  2X27 X;  4AKM A;  3VG5 A;  4Y0P A;  1Y9L A;  2BHV A;  4FGI B;  4MVK A;  5BVQ A;  3APW A;  3HWG A;  2ZFG A;  2XKL A;  2ASN X;  1HBQ A;  3NQ9 A;  3UEV A;  3HTY A;  4AW8 A;  2NNE A;  1ADL A;  4YMY A;  5JDP A;  1PHO A;  1DZP A;  1X8P A;  5LJG A;  1LKE A;  3KVD D;  1OEE A;  5LJC A;  4Y0R A;  1E06 A;  1KQX A;  3KFF A;  3P6C A;  5D48 A;  4TQ2 A;  2XE1 A;  3F9D A;  3KZA A;  1X71 A;  2LKK A;  1BH3 A;  3B2K A;  2HMB A;  4KC8 A;  1SXU A;  4FSO A;  1OEK A;  3SYS A;  1MM4 A;  5KIC A;  3P02 A;  4ORS A;  3P24 A;  1I4U A;  3MBT A;  2MHL A;  1IFB A;  2Z4H A;  2X8S A;  4KII A;  5KID A;  5LJH A;  4I3C A;  5BVS A;  3LHN A;  1SXX A;  3HWB A;  1CBQ A;  3HWF A;  2QTK A;  3FEP A;  2A2U A;  4O49 A;  4FRX A;  4COT A;  4XMG A;  1D2U A;  2W2B A;  3WJD A;  4KCA A;  4AYM C;  1ZRY A;  1E02 A;  1LID A;  1BLR A;  2XTQ A;  3D95 A;  5HZ8 A;  2FS6 A;  2W81 C;  4QGX A;  4INN A;  4NYR A;  1OBP A;  2IFB A;  1B8E A;  1TOW A;  3FW5 A;  5PRN A;  2N2L A;  1SXY A;  2J1N A;  3AA7 A;  7PRN A;  1P6P A;  2JW1 A;  1SY3 A;  1GXA A;  1YWA A;  1G74 A;  3Q6L A;  4FSP A;  1HXX A;  2OVS A;  2W2F A;  4NLI A;  1LNM A;  5HA1 A;  2WEX A;  1Z24 A;  3SAO A;  1U17 A;  1A3Y A;  3JSQ A;  3U9P C;  1IFC A;  1ZHY A;  2MNH A;  2Y0L A;  3POU A;  3CQR A;  3FR2 A;  5T5F A;  1CBR A;  3PEC A;  4O4U A;  5F7G A;  4AYE C;  4YDA A;  4D6B A;  3G7X A;  3U0D A;  1I04 A;  4AUI A;  4Z3T A;  2DM5 A;  2K0L A;  3C5O A;  3BY0 A;  1MM5 A;  4XNK A;  2HZR A;  3NP1 A;  3HK1 A;  6PRN A;  5H9K A;  3NPO A;  2RD7 C;  2HYS A;  3CBS A;  4OMX A;  2XE5 A;  3DA3 A;  4KR8 A;  2F09 A;  4WBK A;  4AYD C;  3IA8 A;  4KH8 A;  3O22 A;  3BU9 A;  2KD2 A;  1GM6 A;  4IMO A;  4ZCB A;  4BUM X;  4NP1 A;  4GU8 A;  2Q2M A;  4YBP A;  1OPF A;  5IO7 A;  1TW4 A;  3HWD A;  1PRN A;  1GFP A;  3S26 A;  2HZQ A;  3ZQ3 A;  4I3D A;  3KQ0 A;  3OE3 A;  3VE1 A;  1BM5 A;  4NNT A;  4XNL A;  3WI4 A;  3UAQ A;  1QJ9 A;  3S5X A;  2XTR A;  1KQW A;  2EU7 X;  5AJC A;  3TZS A;  3TZG A;  3VZU X;  2NP1 A;  3VY9 X;  5B27 A;  2OFR X;  4FOZ A;  1EPB A;  2R56 A;  2XE2 A;  3T24 A;  1H6S 1;  4QQ1 A;  5D47 A;  1IKJ A;  1JJJ A;  4N7C A;  4LSH A;  3LK4 1;  3I17 A;  3SZD A;  5LJE A;  1GFN A;  3SY9 A;  4B61 A;  1QQS A;  2XST A;  4XME A;  1G5W A;  5DL8 A;  4EQA C;  1QJP A;  4HFO A;  2GC9 A;  2CBR A;  4WHI A;  5DL7 A;  3T1D A;  4AZL A;  4EDE A;  5G26 A;  2YG2 A;  5D5D A;  4LZU A;  4NYQ A;  1FE3 A;  4MIS A;  3V8U A;  5L8O A;  4TJZ A;  4BOE A;  4A1H A;  2Q2P A;  4D64 A;  1BRQ A;  2JMB A;  4JFB A;  1L6M A;  4U8U M;  5EZ2 A;  4PJ2 A;  4GKC A;  3AKM A;  1OPB A;  5FQ8 E;  1LF7 A;  3FR4 A;  1N0S A;  3S5V A;  4OS8 A;  1RLB E;  4MVL A;  2FT9 A;  1B56 A;  1BSO A;  1QY2 A;  4QRL A;  4GK9 A;  4XMF A;  4LSE A;  3VG2 A;  1ICN A;  5ADX K;  5HZ9 A;  5AEO A;  4ZHG A;  3BX7 A;  2QOS C;  1JBH A;  2JU8 A;  4Y0S A;  2L9C A;  1EAL A;  2OVD A;  1MUP A;  1NP4 A;  3DSZ A;  4A8Z A;  2GE4 A;  3D97 A;  2BLG A;  2X45 A;  3LK2 A;  2J4U P;  2AT3 X;  4N7D A;  1Q9F A;  4AYN A;  2ACP X;  4KRA A;  4ES7 A;  3AAE A;  2L67 A;  3VU1 A;  2G79 A;  4AZP A;  3POR A;  3FA7 A;  4EFG A;  4QGW A;  4YBU A;  1QFT A;  4O3Y A;  1GFM A;  1XCA A;  3ELZ A;  3UPG A;  3RKG A;  4QZT A;  3VG6 A;  1PBO A;  2HNX A;  1SY1 A;  2PY1 A;  4O4S A;  2QO6 A;  3BSZ E;  4RLC A;  1KT6 A;  3NAD A;  3QKG A;  5HCC C;  3AAE B;  4IBA A;  1Q9G A;  1VPR A;  3PPT A;  1X8O A;  5IO5 A;  2K62 A;  2FGQ X;  3ELX A;  1CBI A;  4XMC A;  3APU A;  3FMZ A;  3PH6 A;  1IW2 A;  4A1Y A;  3FEK A;  3P6G A;  1YWC A;  5LKE A;  2R74 A;  2LB6 A;  1YIV A;  1HQP A;  1E5P A;  1LIF A;  1BXW A;  2QMI A;  1QY1 A;  5LJD A;  1ZHW A;  3SZV A;  4TKB A;  2NND A;  1DZM A;  3U03 A;  2GTL N;  4TLJ A;  1ML7 A;  5FFH A;  3AA6 A;  4RJW A;  2RQ0 A;  4ZHH A;  4FES A;  3VY8 X;  5HBS A;  4LZV A;  4O3Z A;  1FEN A;  2AT0 X;  2JOZ A;  2L5P A;  1X8Q A;  2KW1 A;  3VG3 A;  5K06 A;  3F6Z B;  5CYB A;  5DPQ A;  4U8U O;  2Z4I A;  1O1V A;  5D4A A;  5EED A;  3VE2 A;  5EDB A;  3AA6 B;  1GX9 A;  4O4X A;  4IMN A;  1GFQ A;  5KHP A;  4DQ4 A;  4LQZ A;  1B0O A;  2GTL O;  4D5U A;  2FS7 A;  3O2Y A;  5AFU K;  2ACO A;  4BVM A;  2ZLD A;  2JMM A;  3D4R A;  5H8T A;  1HXT A;  2CM4 A;  4U3Q A;  5H9A A;  2MM3 A;  1ZND A;  1GGL A;  5HCD C;  4A60 A;  2RCT A;  1T8V A;  4ZHF A;  3SY7 A;  1YS5 A;  2E4J A;  3CMP A;  2RCQ A;  3CQN A;  4IAW A;  4ZR2 A;  3GAQ A;  4R0B A;  3STM X;  4ARH A;  4L1N A;  4RUU A;  4C69 X;  1URE A;  5DG4 A;  4ZHD A;  5HCE C;  2X8T A;  1PMP A;  4O3W A;  2WWP A;  5HTE A;  2G7B A;  3P6E A;  1EUO A;  3PP6 A;  3ZW0 A;  5LKF A;  4AZR A;  4FQB B;  4ON1 A;  1JJX A;  3AA7 B;  4GCQ A;  1KT7 A;  3KFH A;  3WI5 A;  2BS5 A;  2KTS A;  2KT4 B;  4AKR A;  2M4L A;  5EDC A;  1MVG A;  3WXQ A;  4ZFX A;  5HWZ A;  3BDR A;  3RWX A;  4O3X B;  2KTD A;  4ZH6 A;  3ZW0 B;  2AKQ A;  1X89 A;  2OVA A;  5IYU A;  1DZK A;  4TNN A;  2XMX A;  2FR3 A;  3PQS A;  4AKR B;  4YDB A;  4ORX A;  1DV9 A;  4L3R A;  2Q39 A;  2O4V A;  4QAE A;  3JQO A;  5ADX L;  2QO4 A;  3G7G A;  2LHF A;  3BS2 A;  4FT6 A;  4GCP A;  1H91 A;  4YCE A;  2F73 A;  5HZ6 A;  4MIR A;  1ORM A;  4FBV A;  3S60 A;  4GE1 A;  4KC7 A;  4JGL A;  4LSF A;  5D45 A;  2MO5 A;  4WFV A;  2LBV A;  4N59 A;  5IO6 A;  3APV A;  3TGB A;  2WSJ A;  1D3S A;  1G7N A;  1YWB A;  2A3F X;  2RA6 A;  3FYF A;  4ORR A;  3TGC A;  1CJ5 A;  2LFU A;  4LSI A;  1ACD A;  4UU3 A;  3UEX A;  1QJ8 A;  4WFU A;  3H3I A;  4HPD A;  4ALO A;  5FEN A;  2F1T A;  5AQ6 A;  2XG6 A;  1RBP A;  4YFQ A;  3C76 X;  3ZI8 A;  3FA9 A;  4F4B A;  2OZQ A;  3BLG A;  1A57 A;  1FEM A;  3P6F A;  3TF6 A;  3AA1 A;  1KZW A;  2HLV A;  3APX A;  3HOL A;  4YKM A;  4CSB A;  4ZH9 A;  1HXU A;  2M07 A;  1DFV A;  5DL5 A;  4XMH A;  3RSW A;  3ZW1 A;  1JYJ A;  1HMR A;  4PUX A;  4ID2 A;  3DTQ A;  3FW4 A;  5F1E A;  4YFR A;  3AKN A;  1ZNL A;  3AA1 B;  1NGL A;  3EM0 A;  3T0S A;  4QNI A;  1SY0 A;  4FMS A;  1QWD A;  3CR6 A;  2A0A A;  3ZW1 B;  3EMN X;  2W80 C;  1T68 X;  2L68 A;  2K4T A;  2KC0 A;  1GFO A;  3WJG A;  1BWY A;  3NQK A;  1JZU A;  3FIQ A;  2M06 A;  4QGV A;  1OPA A;  3STN A;  3POQ A;  3HWE A;  5H9N A;  1BSQ A;  3LV4 A;  2CBS A;  3EMM A;  4OS3 A;  2X8F A;  5HAE A;  3VZT X;  1HBP A;  5EEE A;  3T20 A;  5AFU L;  4HPA A;  3WBG A;  3STK A;  5CE4 A;  2OMF A;  3FYX A;  4MVI A;  4MVE A;  3ZWE A;  3O0E A;  2N2M A;  1SMP I;  4Y0Q A;  3AA0 A;  3VG7 A;  2R73 A;  2AH7 X;  4KR4 A;  4GET A;  3NSG A;  2FR2 A;  4IB9 A;  3GE2 A;  3BU1 A;  3HW9 A;  2A13 A;  3LK2 B;  4QYP A;  1VYG A;  4RUN A;  3O19 A;  4BQU A;  5EE2 A;  4YFP A;  4G76 A;  2ODJ A;  3ZUO A;  2Y0K A;  1Y9T A;  1A18 A;  4I95 A;  4UU2 A;  3AA0 B;  4GDZ A;  4YGG A;  2KXP A;  1SY2 A;  1ALB A;  1TXL A;  2FWV A;  5D8J A;  3ZW2 A;  3DA4 A;  3LK3 A;  4KT5 A;  1DF3 A;  1ZNH A;  3B2I A;  2F1V A;  5FVN A;  5B29 A;  2P8G A;  1ERB A;  4RL9 A;  5EPQ A;  2Y2X A;  3VG4 A;  3IFB A;  4U8U N;  3LK3 B;  2YMS A;  2Q9S A;  1BJ7 A;  4ZJ0 A;  2CM9 A;  1IIU A;  2KXP B;  2X46 A;  1ZNG A;  3JS1 A;  4EEJ A;  3FA6 A;  1SXW A;  1EW3 A;  1JIW I;  3CBC A;  4ML7 B;  1HMS A;  1X8U A;  5HA0 A;  3RZY A;  3UEW A;  3EBW A;  4QZU A;  5FAZ A;  3ZUI A;  1LIE A;  3L4R A;  4GH7 A;  4FBO A;  1JYD A;  2POR A;  3OJY C;  4RLB A;  1ICM A;  2AL0 X;  4GNW A;  4O9S A;  3I0A A;  4HPB A;  1LIB A;  2Q4N A;  5GV0 A;  1SA8 A;  3NX1 A;  1YUP A;  5HZQ A;  3CWK A;  4ORY A;  4FZM A;  2NNQ A;  3PED A;  4ALB A;  4EXZ A;  2WUT A;  3AAA A;  1B4M A;  4LKT A;  4GZV A;  3GP6 A;  3JTY A;  2OFM X;  1R0U A;  3RBH A;  4YCH A;  4I9S A;  2ALL X;  4AZO A;  1OBQ A;  4OS0 A;  5JR8 A;  5DL6 A;  3WJB A;  1BT9 A;  3AAA B;  2FTB A;  3BX8 A;  1EII A;  1I05 A;  1VYF A;  3C77 X;  1EQD A;  1QG5 A;  1QFV A;  2LA7 A;  3EYC A;  5FQ6 E;  2AT6 X;  3POX A;  3PH5 A;  2MHD A;  4FUV A;  1AQB A;  2JN3 A;  3P6D A;  4E1T A;  4NW4 A;  2YNK A;  1KT4 A;  2Y7S A;  1A2D A;  1GKA A;  5F58 A;  1NP1 A;  4ZGU A;  1CBS A;  3B2J A;  2KZ7 A;  1O1U A;  3ZZV A;  4GHB A;  1KT3 A;  3WJF A;  1P4T A;  1LPJ A;  1DC9 A;  1FTP A;  1GT4 A;  1KXO A;  2W2A A;  4I6S A;  3WJC A;  4FBR A;  1E54 A;  2LFO A;  3FEL A;  1GKA B;  4IAX A;  3LK4 2;  2CZT A;  1G90 A;  1ERX A;  2XE3 A;  2KZ7 B;  1QAB E;  3SOT A;  4PSQ A;  4ODD A;  3UU2 A;  3MX7 A;  3UEU A;  2WEW A;  3NQ3 A;  3B2L A;  2GTF X;  1KGL A;  4I9R A;  1OSM A;  4G75 A;  4FRT A;  2ZAG A;  2KDY A;  1TOU A;  5HTD A;  4K19 A;  2ZAI A;  4IB6 A;  2PRN A;  1AEL A;  2Y0H A;  4AZM A;  3WJE A;  2YPV A;  1MDC A;  1HN2 A;  1GT5 A;  1MX8 A;  1HMT A;  4HPC A;  5LJK A;  3EBK A;  1DZJ A;  1GT3 A;  3P6H A;  3HOE A;  1U0X A;  3OD9 A;  1ZHX A;  2ANS A;  3WOV A;  8PRN A;  2BS6 A;  1YWD A;  4NNS A;  4OMW A;  2BT9 A;  2WQA E;  5BVT A;  4CK4 A;  1UZ2 X;  4GRJ A;  1BEB A;  4TKH A;  3A2S X;  3KFI A;  4IB8 A;  1AVG I;  5FQ7 E;  4AZN A;  1KT5 A;  3PRN A;  4N58 A;  4RJX A;  4GF4 A;  2QO5 A;  3FA8 A;  3BRN A;  4ZHC A;  1ZNK A;  1ZHT A;  3VZW X;  1AB0 A;  4JCH A;  1MX7 A;  1ZNE A;  2K23 A;  3K3L A;  3NR3 A;  4I3B A;  2RN4 A;  2GJ5 A;  1FEL A;  4GNY A;  1QY0 A;  5LJB A;  1S44 A;  1GT1 A;  1OBU A;  1LIC A;  4CV7 A;  4FZN A;  1OEJ A;  2N93 A;  3C78 X;  3B2H A;  3E3C A;  1S7D A;  1EIO A;  3N91 A;  3QRA A;  3NX2 A;  3FLL A;  1PM1 X;  2AMM X;  4IB7 A;  4D6A A;  2MWH A;  1MPF A;  2CZU A;  5C0N A;  4U9C A;  1X8N A;  4E1S A;  4LKP A;  1O8V A;  1FDQ A;  4YH0 A;  1BSY A;  2AT8 X;  4ORU A;  5H9L A;  5BYP A;  3RBY A;  1EI5 A;  1BRP A;  4ORW A;  1YP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...