2XG6A

Molecular insights into clinically isolated ompc mutants and their role in multi-drug resistance
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
343
structure length
343
Chain Sequence
AEIYNKDGNKLDLYGKVEGLHYFSDNDSKDGDKTYMRLGFKGETQVTDQLTGYGQWEYQIQGNEPESDNSSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYDSDNFMQQHGNGFATYRNTDFFGLVDGLDFAVQYQGKNGSAHGEGMTTNGRDDVFEQNGDGVGGSITYNYEGFGIGAAVSSSKRTWDQNNTGLIGTGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPFLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNRFTRDAGINTDDIVALGLVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Altered Antibiotic Transport in Ompc Mutants Isolated from a Series of Clinical Strains of Multi-Drug Resistant E. Coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords OMPC
total genus 87
structure length 343
sequence length 343
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2xg6A00
4LSEA 5PRNA 1PHOA 1H6S1 4LSHA 3T20A 2ZFGA 2ZLDA 2PORA 5DL6A 3SZVA 5DL7A 1GFOA 4RJXA 2ODJA 1OPFA 2XG6A 3T0SA 3WI5A 5FVNA 4FSOA 4D65A 4RJWA 1E54A 3SY7A 2FGQX 3UPGA 4FMSA 2J4UP 2OMFA 2XE1A 4LSFA 1MPFA 3POUA 4KR8A 3PORA 3VY8X 4FT6A 4C69X 1HXTA 3SYBA 3SY9A 3VZUX 4KR4A 3HWBA 4LSIA 3T24A 3POXA 4BUMX 4FOZA 3VY9X 3VZWX 5DL8A 1GFQA 5DL5A 7PRNA 3JTYA 1OSMA 3A2SX 2J1NA 4D5UA 2FGRA 2Y0HA 1BH3A 4KRAA 4GCSA 1GFPA 4GCQA 4FSPA 4D64A 3SYSA 2Y2XA 2XE5A 2K4TA 2XE2A 1GFMA 3VZTX 6PRNA 4FRXA 4JFBA 8PRNA 5JDPA 2PRNA 1HXXA 4AUIA 1HXUA 3HW9A 3POQA 3UU2A 1PRNA 2Y0LA 3O0EA 2Y0KA 3NSGA 2XE3A 3EMNX 3PRNA 3SZDA 3K19A 4GCPA 3FYXA 2O4VA 3WI4A 1GFNA 4FRTA 2QTKA 1BT9A
chains in the Genus database with same CATH superfamily
4AYEC 5B5EO 3AA0B 5ADXK 2WJRA 4LSEA 4N74A 4O49A 5H2FO 1Q9FA 2KC0A 1ZHYA 1PHOA 5PRNA 4G76A 1H6S1 1T1LA 2F1TA 2WVPA 3PGUA 4LSHA 2W80C 5E79O 2R8AA 3T20A 2ZFGA 2ZLDA 1S5LO 2PORA 5DL6A 3SZVA 3BRZA 4AYMC 2N2LA 3HOLA 1GFOA 4RJXA 2R89A 5DL7A 5T5FA 2ODJA 1OPFA 3DWNA 1THQA 2R4NA 4O4UA 2XG6A 2IWVA 2KXPB 2AXTO 3PGSA 3T0SA 2X9KA 2KXPA 2WJQA 3G7GA 3LK2B 5FVNA 2XMXA 5G38A 3V8UA 3WI5A 4FSOA 4D65A 4RJWA 5ADXL 1E54A 5D5DA 4G75A 3SY7A 3LK41 2FGQX 3GP6A 1ZHXA 4GF4A 2IWWA 4CTDA 4E1SA 4UB6O 4GHBA 4RL9A 3QRCA 1G90A 3UPGA 4JCHA 4IL6O 1Q9GA 4FMSA 4K3BA 1YS5A 2M07A 4O4XA 4B61A 2OMFA 3AA0A 3C5OA 2J4UP 5IYUA 2XTQA 4RLBA 3A0HO 2XE1A 4LSFA 1MPFA 4N59A 3RBHA 3VE2A 1BXWA 1P4TA 3POUA 4KR8A 2X27X 4N75A 2GE4A 3PORA 4FZLA 3VY8X 4AKMA 4AZLA 4F4BA 4C4VA 2F1CX 3BRYA 3PQSA 4FT6A 4C69X 1HXTA 4XNKA 3SYBA 2Y7SA 2W81C 3SY9A 3VZUX 2YNKA 1MM5A 3HWBA 4KR4A 3AA6B 4AKRA 4E1TA 3BS0A 4FZMA 4LSIA 3T24A 5AFUL 3POXA 2KZ7B 3AA7A 5KAFO 4BUMX 3KZIO 5AFUK 4FOZA 3AAAA 3VY9X 3VZWX 5DL8A 4UB8O 4Z3TA 1GFQA 5DL5A 1IZNB 7PRNA 1OSMA 1ORMA 3A2SX 3AA1A 3JTYA 3LK3B 4PUXA 2J1NA 4D5UA 2XTRA 3PGRA 2R88A 5GV0A 3LK3A 2FGRA 2Y0HA 2N2MA 1BH3A 4AYID 3QRAA 5GTHO 2MNHA 1IZNA 4GCSA 4KRAA 1GFPA 4GCQA 3UAQA 2R4PA 4AFKA 3AAAB 3PQUA 1ZHWA 3WU2O 4N58A 4O3WA 4FSPA 5G26A 4D64A 3AAEA 3SYSA 3TZGA 2Y2XA 2XE5A 2K4TA 3DWOX 3AA6A 4FESA 4O3ZA 4AKRB 4AYNA 5KAIO 2XE2A 1GFMA 3VZTX 4FUVA 6PRNA 2MHLA 3AAEB 4FRXA 4FZNA 4C4VB 3NJTA 3VE1A 2R4LA 3PF1A 1ZHTA 4JFBA 3DZMA 1ZHZA 2F1VA 2YPVA 3LK42 8PRNA 3HOEA 5JDPA 4AYDC 4FQEA 1MM4A 2PRNA 2M06A 3DA4A 1HXXA 2LFUA 3AA1B 3JCUO 4PR7A 2ERVA 5EE2A 5G39A 4AUIA 1HXUA 3HW9A 2KDYA 2LHFA 3POQA 5B66O 3UU2A 1PRNA 1QJ8A 2K0LA 2Y0LA 2KZ7A 3AA7B 3KVDD 4QQ1A 3O0EA 2Y0KA 3NSGA 2R4OA 2XE3A 1T16A 3EMNX 3LK2A 3PRNA 5TISO 4U9CA 3K19A 3SZDA 5GTIO 4K3CA 2JMMA 4GCPA 5G3AA 3FYXA 2O4VA 3A0BO 3WI4A 4O3YA 2JQYA 4PJ0O 4O3XB 4C00A 1QJPA 1GFNA 4RLCA 1QJ9A 3DA3A 4FRTA 4XNLA 2QTKA 1BT9A
chains in the Genus database with same CATH topology
4AYEC 5ADXK 3AA0B 4LSEA 4O49A 1Q9FA 2KC0A 1ZHYA 1PHOA 5PRNA 4G76A 1H6S1 2F1TA 4LSHA 2W80C 3T20A 2ZFGA 2ZLDA 2PORA 5DL6A 3SZVA 4AYMC 2N2LA 3HOLA 1GFOA 4RJXA 5DL7A 5T5FA 2ODJA 1OPFA 1THQA 4O4UA 2XG6A 2KXPB 3T0SA 3G7GA 2KXPA 3WI5A 5FVNA 3LK2B 2XMXA 3V8UA 4FSOA 4D65A 4RJWA 5ADXL 1E54A 5D5DA 4G75A 3SY7A 3LK41 2FGQX 3GP6A 1ZHXA 4GF4A 4E1SA 4GHBA 4RL9A 3QRCA 1G90A 3UPGA 4JCHA 1Q9GA 4FMSA 1YS5A 2M07A 4O4XA 4B61A 2OMFA 3AA0A 3C5OA 2J4UP 5IYUA 2XTQA 4RLBA 2XE1A 4LSFA 1MPFA 4N59A 3RBHA 3VE2A 1BXWA 1P4TA 3POUA 4KR8A 2X27X 2GE4A 3PORA 4FZLA 3VY8X 4AKMA 4AZLA 4F4BA 3PQSA 4FT6A 4C69X 1HXTA 4XNKA 3SYBA 2Y7SA 2W81C 3SY9A 3VZUX 2YNKA 1MM5A 3HWBA 4KR4A 3AA6B 4AKRA 4E1TA 4FZMA 4LSIA 3T24A 5AFUL 3POXA 2KZ7B 3AA7A 4BUMX 5AFUK 4FOZA 3AAAA 3VY9X 3VZWX 5DL8A 4Z3TA 1GFQA 5DL5A 1IZNB 7PRNA 1OSMA 1ORMA 3A2SX 3AA1A 3JTYA 3LK3B 4PUXA 2J1NA 4D5UA 2XTRA 5GV0A 3LK3A 2FGRA 2Y0HA 2N2MA 1BH3A 4AYID 3QRAA 2MNHA 1IZNA 4GCSA 4KRAA 1GFPA 4GCQA 3UAQA 4AFKA 3AAAB 3PQUA 1ZHWA 4N58A 4O3WA 4FSPA 5G26A 4D64A 3AAEA 3SYSA 3TZGA 2Y2XA 2XE5A 2K4TA 4FESA 3AA6A 4O3ZA 4AKRB 4AYNA 2XE2A 1GFMA 3VZTX 4FUVA 6PRNA 2MHLA 3AAEB 4FRXA 4FZNA 3VE1A 1ZHTA 4JFBA 1ZHZA 2F1VA 2YPVA 3LK42 8PRNA 3HOEA 5JDPA 4AYDC 1MM4A 2PRNA 2M06A 3DA4A 1HXXA 2LFUA 3AA1B 2ERVA 5EE2A 4AUIA 1HXUA 3HW9A 2KDYA 2LHFA 3POQA 3UU2A 1PRNA 1QJ8A 2K0LA 2Y0LA 2KZ7A 3AA7B 3KVDD 4QQ1A 3O0EA 2Y0KA 3NSGA 2XE3A 3EMNX 3LK2A 3PRNA 4U9CA 3K19A 3SZDA 2JMMA 4GCPA 3FYXA 2O4VA 3WI4A 4O3YA 4O3XB 1QJPA 1GFNA 4RLCA 1QJ9A 3DA3A 4FRTA 4XNLA 2QTKA 1BT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LSE A;  5PRN A;  1PHO A;  1H6S 1;  4LSH A;  3T20 A;  2ZFG A;  2ZLD A;  2POR A;  5DL6 A;  3SZV A;  5DL7 A;  1GFO A;  4RJX A;  2ODJ A;  1OPF A;  2XG6 A;  3T0S A;  3WI5 A;  5FVN A;  4FSO A;  4D65 A;  4RJW A;  1E54 A;  3SY7 A;  2FGQ X;  3UPG A;  4FMS A;  2J4U P;  2OMF A;  2XE1 A;  4LSF A;  1MPF A;  3POU A;  4KR8 A;  3POR A;  3VY8 X;  4FT6 A;  4C69 X;  1HXT A;  3SYB A;  3SY9 A;  3VZU X;  4KR4 A;  3HWB A;  4LSI A;  3T24 A;  3POX A;  4BUM X;  4FOZ A;  3VY9 X;  3VZW X;  5DL8 A;  1GFQ A;  5DL5 A;  7PRN A;  3JTY A;  1OSM A;  3A2S X;  2J1N A;  4D5U A;  2FGR A;  2Y0H A;  1BH3 A;  4KRA A;  4GCS A;  1GFP A;  4GCQ A;  4FSP A;  4D64 A;  3SYS A;  2Y2X A;  2XE5 A;  2K4T A;  2XE2 A;  1GFM A;  3VZT X;  6PRN A;  4FRX A;  4JFB A;  8PRN A;  5JDP A;  2PRN A;  1HXX A;  4AUI A;  1HXU A;  3HW9 A;  3POQ A;  3UU2 A;  1PRN A;  2Y0L A;  3O0E A;  2Y0K A;  3NSG A;  2XE3 A;  3EMN X;  3PRN A;  3SZD A;  3K19 A;  4GCP A;  3FYX A;  2O4V A;  3WI4 A;  1GFN A;  4FRT A;  2QTK A;  1BT9 A; 
#chains in the Genus database with same CATH topology
 4AYE C;  5B5E O;  3AA0 B;  5ADX K;  2WJR A;  4LSE A;  4N74 A;  4O49 A;  5H2F O;  1Q9F A;  2KC0 A;  1ZHY A;  1PHO A;  5PRN A;  4G76 A;  1H6S 1;  1T1L A;  2F1T A;  2WVP A;  3PGU A;  4LSH A;  2W80 C;  5E79 O;  2R8A A;  3T20 A;  2ZFG A;  2ZLD A;  1S5L O;  2POR A;  5DL6 A;  3SZV A;  3BRZ A;  4AYM C;  2N2L A;  3HOL A;  1GFO A;  4RJX A;  2R89 A;  5DL7 A;  5T5F A;  2ODJ A;  1OPF A;  3DWN A;  1THQ A;  2R4N A;  4O4U A;  2XG6 A;  2IWV A;  2KXP B;  2AXT O;  3PGS A;  3T0S A;  2X9K A;  2KXP A;  2WJQ A;  3G7G A;  3LK2 B;  5FVN A;  2XMX A;  5G38 A;  3V8U A;  3WI5 A;  4FSO A;  4D65 A;  4RJW A;  5ADX L;  1E54 A;  5D5D A;  4G75 A;  3SY7 A;  3LK4 1;  2FGQ X;  3GP6 A;  1ZHX A;  4GF4 A;  2IWW A;  4CTD A;  4E1S A;  4UB6 O;  4GHB A;  4RL9 A;  3QRC A;  1G90 A;  3UPG A;  4JCH A;  4IL6 O;  1Q9G A;  4FMS A;  4K3B A;  1YS5 A;  2M07 A;  4O4X A;  4B61 A;  2OMF A;  3AA0 A;  3C5O A;  2J4U P;  5IYU A;  2XTQ A;  4RLB A;  3A0H O;  2XE1 A;  4LSF A;  1MPF A;  4N59 A;  3RBH A;  3VE2 A;  1BXW A;  1P4T A;  3POU A;  4KR8 A;  2X27 X;  4N75 A;  2GE4 A;  3POR A;  4FZL A;  3VY8 X;  4AKM A;  4AZL A;  4F4B A;  4C4V A;  2F1C X;  3BRY A;  3PQS A;  4FT6 A;  4C69 X;  1HXT A;  4XNK A;  3SYB A;  2Y7S A;  2W81 C;  3SY9 A;  3VZU X;  2YNK A;  1MM5 A;  3HWB A;  4KR4 A;  3AA6 B;  4AKR A;  4E1T A;  3BS0 A;  4FZM A;  4LSI A;  3T24 A;  5AFU L;  3POX A;  2KZ7 B;  3AA7 A;  5KAF O;  4BUM X;  3KZI O;  5AFU K;  4FOZ A;  3AAA A;  3VY9 X;  3VZW X;  5DL8 A;  4UB8 O;  4Z3T A;  1GFQ A;  5DL5 A;  1IZN B;  7PRN A;  1OSM A;  1ORM A;  3A2S X;  3AA1 A;  3JTY A;  3LK3 B;  4PUX A;  2J1N A;  4D5U A;  2XTR A;  3PGR A;  2R88 A;  5GV0 A;  3LK3 A;  2FGR A;  2Y0H A;  2N2M A;  1BH3 A;  4AYI D;  3QRA A;  5GTH O;  2MNH A;  1IZN A;  4GCS A;  4KRA A;  1GFP A;  4GCQ A;  3UAQ A;  2R4P A;  4AFK A;  3AAA B;  3PQU A;  1ZHW A;  3WU2 O;  4N58 A;  4O3W A;  4FSP A;  5G26 A;  4D64 A;  3AAE A;  3SYS A;  3TZG A;  2Y2X A;  2XE5 A;  2K4T A;  3DWO X;  3AA6 A;  4FES A;  4O3Z A;  4AKR B;  4AYN A;  5KAI O;  2XE2 A;  1GFM A;  3VZT X;  4FUV A;  6PRN A;  2MHL A;  3AAE B;  4FRX A;  4FZN A;  4C4V B;  3NJT A;  3VE1 A;  2R4L A;  3PF1 A;  1ZHT A;  4JFB A;  3DZM A;  1ZHZ A;  2F1V A;  2YPV A;  3LK4 2;  8PRN A;  3HOE A;  5JDP A;  4AYD C;  4FQE A;  1MM4 A;  2PRN A;  2M06 A;  3DA4 A;  1HXX A;  2LFU A;  3AA1 B;  3JCU O;  4PR7 A;  2ERV A;  5EE2 A;  5G39 A;  4AUI A;  1HXU A;  3HW9 A;  2KDY A;  2LHF A;  3POQ A;  5B66 O;  3UU2 A;  1PRN A;  1QJ8 A;  2K0L A;  2Y0L A;  2KZ7 A;  3AA7 B;  3KVD D;  4QQ1 A;  3O0E A;  2Y0K A;  3NSG A;  2R4O A;  2XE3 A;  1T16 A;  3EMN X;  3LK2 A;  3PRN A;  5TIS O;  4U9C A;  3K19 A;  3SZD A;  5GTI O;  4K3C A;  2JMM A;  4GCP A;  5G3A A;  3FYX A;  2O4V A;  3A0B O;  3WI4 A;  4O3Y A;  2JQY A;  4PJ0 O;  4O3X B;  4C00 A;  1QJP A;  1GFN A;  4RLC A;  1QJ9 A;  3DA3 A;  4FRT A;  4XNL A;  2QTK A;  1BT9 A; 
#chains in the Genus database with same CATH homology
 4AYE C;  5ADX K;  3AA0 B;  4LSE A;  4O49 A;  1Q9F A;  2KC0 A;  1ZHY A;  1PHO A;  5PRN A;  4G76 A;  1H6S 1;  2F1T A;  4LSH A;  2W80 C;  3T20 A;  2ZFG A;  2ZLD A;  2POR A;  5DL6 A;  3SZV A;  4AYM C;  2N2L A;  3HOL A;  1GFO A;  4RJX A;  5DL7 A;  5T5F A;  2ODJ A;  1OPF A;  1THQ A;  4O4U A;  2XG6 A;  2KXP B;  3T0S A;  3G7G A;  2KXP A;  3WI5 A;  5FVN A;  3LK2 B;  2XMX A;  3V8U A;  4FSO A;  4D65 A;  4RJW A;  5ADX L;  1E54 A;  5D5D A;  4G75 A;  3SY7 A;  3LK4 1;  2FGQ X;  3GP6 A;  1ZHX A;  4GF4 A;  4E1S A;  4GHB A;  4RL9 A;  3QRC A;  1G90 A;  3UPG A;  4JCH A;  1Q9G A;  4FMS A;  1YS5 A;  2M07 A;  4O4X A;  4B61 A;  2OMF A;  3AA0 A;  3C5O A;  2J4U P;  5IYU A;  2XTQ A;  4RLB A;  2XE1 A;  4LSF A;  1MPF A;  4N59 A;  3RBH A;  3VE2 A;  1BXW A;  1P4T A;  3POU A;  4KR8 A;  2X27 X;  2GE4 A;  3POR A;  4FZL A;  3VY8 X;  4AKM A;  4AZL A;  4F4B A;  3PQS A;  4FT6 A;  4C69 X;  1HXT A;  4XNK A;  3SYB A;  2Y7S A;  2W81 C;  3SY9 A;  3VZU X;  2YNK A;  1MM5 A;  3HWB A;  4KR4 A;  3AA6 B;  4AKR A;  4E1T A;  4FZM A;  4LSI A;  3T24 A;  5AFU L;  3POX A;  2KZ7 B;  3AA7 A;  4BUM X;  5AFU K;  4FOZ A;  3AAA A;  3VY9 X;  3VZW X;  5DL8 A;  4Z3T A;  1GFQ A;  5DL5 A;  1IZN B;  7PRN A;  1OSM A;  1ORM A;  3A2S X;  3AA1 A;  3JTY A;  3LK3 B;  4PUX A;  2J1N A;  4D5U A;  2XTR A;  5GV0 A;  3LK3 A;  2FGR A;  2Y0H A;  2N2M A;  1BH3 A;  4AYI D;  3QRA A;  2MNH A;  1IZN A;  4GCS A;  4KRA A;  1GFP A;  4GCQ A;  3UAQ A;  4AFK A;  3AAA B;  3PQU A;  1ZHW A;  4N58 A;  4O3W A;  4FSP A;  5G26 A;  4D64 A;  3AAE A;  3SYS A;  3TZG A;  2Y2X A;  2XE5 A;  2K4T A;  4FES A;  3AA6 A;  4O3Z A;  4AKR B;  4AYN A;  2XE2 A;  1GFM A;  3VZT X;  4FUV A;  6PRN A;  2MHL A;  3AAE B;  4FRX A;  4FZN A;  3VE1 A;  1ZHT A;  4JFB A;  1ZHZ A;  2F1V A;  2YPV A;  3LK4 2;  8PRN A;  3HOE A;  5JDP A;  4AYD C;  1MM4 A;  2PRN A;  2M06 A;  3DA4 A;  1HXX A;  2LFU A;  3AA1 B;  2ERV A;  5EE2 A;  4AUI A;  1HXU A;  3HW9 A;  2KDY A;  2LHF A;  3POQ A;  3UU2 A;  1PRN A;  1QJ8 A;  2K0L A;  2Y0L A;  2KZ7 A;  3AA7 B;  3KVD D;  4QQ1 A;  3O0E A;  2Y0K A;  3NSG A;  2XE3 A;  3EMN X;  3LK2 A;  3PRN A;  4U9C A;  3K19 A;  3SZD A;  2JMM A;  4GCP A;  3FYX A;  2O4V A;  3WI4 A;  4O3Y A;  4O3X B;  1QJP A;  1GFN A;  4RLC A;  1QJ9 A;  3DA3 A;  4FRT A;  4XNL A;  2QTK A;  1BT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...