2XG6A

Molecular insights into clinically isolated ompc mutants and their role in multi-drug resistance
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
343
structure length
343
Chain Sequence
b'AEIYNKDGNKLDLYGKVEGLHYFSDNDSKDGDKTYMRLGFKGETQVTDQLTGYGQWEYQIQGNEPESDNSSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYDSDNFMQQHGNGFATYRNTDFFGLVDGLDFAVQYQGKNGSAHGEGMTTNGRDDVFEQNGDGVGGSITYNYEGFGIGAAVSSSKRTWDQNNTGLIGTGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPFLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNRFTRDAGINTDDIVALGLVYQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OMPC
publication title Altered Antibiotic Transport in Ompc Mutants Isolated from a Series of Clinical Strains of Multi-Drug Resistant E. Coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 87
structure length 343
sequence length 343
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2xg6A00
4KR4A 4BUMX 2XE2A 4FSPA 4AUIA 1BH3A 4D5UA 3PRNA 2ZFGA 5DL8A 3VZTX 1HXTA 1HXXA 3WI5A 3SY7A 2J4UP 2PORA 1OSMA 2XE5A 2XE1A 2OMFA 8PRNA 1E54A 2XG6A 3SZDA 4RJWA 4RJXA 1OPFA 7PRNA 5PRNA 1MPFA 4LSFA 3T24A 5DL6A 5FVNA 3WI4A 2J1NA 4LSIA 4FRXA 1GFPA 4GCSA 2ODJA 3FYXA 3UU2A 1H6S1 3VY8X 5DL7A 3T20A 3O0EA 5DL5A 3POXA 1PRNA 3SYSA 3VY9X 4FOZA 1GFNA 4FMSA 3T0SA 3PORA 3EMNX 4LSHA 3UPGA 3SZVA 2Y0KA 1GFMA 3K19A 2Y2XA 4JFBA 3NSGA 2FGRA 4KR8A 2Y0LA 5JDPA 4FSOA 1BT9A 1GFOA 4FRTA 3HW9A 3HWBA 4C69X 4LSEA 3SY9A 2ZLDA 4GCQA 2K4TA 3POUA 3SYBA 3VZWX 1GFQA 3JTYA 4GCPA 2QTKA 2PRNA 3VZUX 4KRAA 4D64A 2XE3A 6PRNA 1PHOA 2Y0HA 3POQA 2FGQX 4FT6A 3A2SX 2O4VA 4D65A 1HXUA
chains in the Genus database with same CATH superfamily
2WVPA 1ZHYA 4KR4A 3PF1A 3PGSA 3AA1B 4BUMX 4AZLA 1THQA 3AAAA 4N75A 5ADXK 4O4UA 2XE2A 4FSPA 4FZMA 4AUIA 4AKRB 2IWVA 5IYUA 1BH3A 1ZHTA 4D5UA 2XTRA 3PRNA 4U9CA 2ZFGA 5DL8A 5KAIO 3PGUA 4AFKA 4C00A 3QRAA 3AA0B 3VZTX 5GTHO 2YPVA 1HXTA 1HXXA 3WI5A 3SY7A 3TZGA 4PR7A 2J4UP 2PORA 1OSMA 2XE5A 3A0HO 2XE1A 4K3BA 3UAQA 2OMFA 5T5FA 1ZHWA 2R4LA 1E54A 2XG6A 4F4BA 4Z3TA 4FESA 3LK3A 5D5DA 3PQSA 3SZDA 4RJWA 2KZ7A 4O3ZA 4RJXA 1OPFA 1QJ9A 1ZHXA 7PRNA 3G7GA 5PRNA 1MPFA 3AA7A 2KXPA 2N2LA 2W81C 2JMMA 4N58A 5E79O 4AYEC 4LSFA 3T24A 5DL6A 5FVNA 4O49A 3DWNA 3WI4A 2N2MA 2J1NA 2MHLA 3DA4A 3GP6A 4FRXA 1GFPA 2M06A 4GCSA 1T1LA 4LSIA 5GTIO 5TISO 1HXUA 4C4VA 2ODJA 3KZIO 4FZLA 1MM5A 3FYXA 3WU2O 4O3WA 4AYID 2R89A 2R4NA 3UU2A 3V8UA 1H6S1 1IZNB 2XMXA 4RL9A 3AA6B 5AFUL 4QQ1A 1Q9FA 1QJPA 2Y7SA 3QRCA 4RLBA 2F1TA 4K3CA 2F1VA 5DL7A 3VY8X 2W80C 3LK2A 4G76A 3T20A 3O0EA 4FZNA 1MM4A 1YS5A 2R4PA 3POXA 5DL5A 5G26A 4N59A 3A0BO 1PRNA 3SYSA 3VY9X 3HOLA 4FOZA 1GFNA 3BS0A 4FMSA 2AXTO 3AA1A 3AAEB 3PORA 2WJQA 3T0SA 4B61A 3EMNX 4LSHA 3UPGA 3DZMA 3SZVA 4D65A 2ERVA 2Y0KA 4AKRA 4GF4A 4O3XB 4E1SA 1GFMA 3K19A 2Y2XA 3AAAB 3AA0A 2R4OA 4JFBA 3DWOX 3NSGA 2GE4A 2LHFA 4FUVA 3RBHA 1QJ8A 2FGRA 3JCUO 5G38A 2X27X 3NJTA 4KR8A 5GV0A 2Y0LA 3HOEA 5JDPA 4FSOA 4UB6O 4AYNA 3VE2A 4AYMC 4RLCA 4XNKA 1S5LO 5H2FO 1G90A 1GFOA 1BT9A 4FRTA 3HW9A 5B66O 3HWBA 5G3AA 4AKMA 8PRNA 4C69X 3LK3B 1T16A 4LSEA 2KZ7B 3SY9A 2ZLDA 4GCQA 2KC0A 3C5OA 2K4TA 4E1TA 3KVDD 2M07A 3AA7B 2KXPB 3POUA 3SYBA 4G75A 3VZWX 1ORMA 4AYDC 4GHBA 1GFQA 3JTYA 3LK41 2IWWA 4GCPA 3PQUA 2X9KA 2YNKA 2QTKA 1IZNA 4O4XA 4PJ0O 2PRNA 2R88A 3VZUX 3AA6A 4C4VB 5ADXL 3BRYA 2XTQA 5AFUK 4JCHA 4CTDA 5G39A 1ZHZA 2JQYA 4KRAA 4D64A 2MNHA 2XE3A 4FQEA 5KAFO 4PUXA 1P4TA 1PHOA 6PRNA 2Y0HA 2K0LA 2LFUA 1BXWA 3POQA 4IL6O 2FGQX 3LK2B 3AAEA 4O3YA 2F1CX 4FT6A 3BRZA 3A2SX 1Q9GA 2O4VA 3DA3A 3LK42 4N74A 4XNLA 5EE2A 3VE1A 5B5EO 2R8AA 2WJRA 2KDYA 3PGRA 4UB8O
chains in the Genus database with same CATH topology
4KR4A 1ZHYA 4BUMX 3AA1B 4AZLA 1THQA 3AAAA 5ADXK 4O4UA 2XE2A 4FSPA 4FZMA 4AUIA 4AKRB 5IYUA 1BH3A 1ZHTA 4D5UA 2XTRA 3PRNA 4U9CA 2ZFGA 5DL8A 4AFKA 3QRAA 3AA0B 3VZTX 2YPVA 1HXTA 1HXXA 3WI5A 3SY7A 3TZGA 2J4UP 2XE5A 1OSMA 2PORA 2XE1A 3UAQA 4F4BA 2OMFA 5T5FA 1ZHWA 4Z3TA 1E54A 2XG6A 8PRNA 4FESA 3LK3A 5D5DA 3PQSA 3SZDA 4RJWA 2KZ7A 4O3ZA 4RJXA 1OPFA 1QJ9A 1ZHXA 7PRNA 3G7GA 5PRNA 1MPFA 3AA7A 2W81C 2N2LA 2KXPA 2JMMA 4N58A 4AYEC 4LSFA 3T24A 5DL6A 5FVNA 4O49A 5ADXL 3WI4A 2N2MA 2J1NA 2MHLA 3DA4A 3GP6A 4FRXA 1GFPA 2M06A 4GCSA 4LSIA 1HXUA 2ODJA 4FZLA 1MM5A 3FYXA 4O3WA 4AYID 3UU2A 3V8UA 1H6S1 1IZNB 2XMXA 4RL9A 3AA6B 5AFUL 4QQ1A 1Q9FA 1QJPA 2Y7SA 3QRCA 4RLBA 2F1TA 3VY8X 2F1VA 5DL7A 2W80C 3LK2A 4G76A 3T20A 3O0EA 4FZNA 1MM4A 1YS5A 5DL5A 3POXA 5G26A 4N59A 1PRNA 3SYSA 3VY9X 3HOLA 4FOZA 1GFNA 4B61A 4FMSA 3AA1A 3AAEB 3T0SA 3PORA 3EMNX 4LSHA 3UPGA 3SZVA 2ERVA 2Y0KA 4AKRA 4GF4A 4O3XB 4E1SA 1GFMA 3K19A 2Y2XA 3AAAB 3AA0A 4JFBA 3NSGA 2GE4A 2LHFA 4FUVA 3RBHA 1QJ8A 2FGRA 2X27X 4KR8A 5GV0A 2Y0LA 3HOEA 5JDPA 4FSOA 4AYNA 3VE2A 4AYMC 4RLCA 4XNKA 1G90A 1GFOA 1BT9A 4FRTA 3HW9A 3HWBA 4AKMA 4C69X 3LK3B 4LSEA 2KZ7B 3SY9A 2ZLDA 4GCQA 2KC0A 3C5OA 2K4TA 4E1TA 3KVDD 2M07A 3AA7B 2KXPB 3POUA 3SYBA 4G75A 3VZWX 1ORMA 4AYDC 4GHBA 1GFQA 3JTYA 3LK41 4GCPA 3PQUA 2YNKA 2QTKA 1IZNA 4O4XA 2PRNA 3VZUX 3AA6A 2XTQA 5AFUK 4JCHA 1ZHZA 4KRAA 4D64A 2MNHA 2XE3A 4PUXA 1P4TA 1PHOA 6PRNA 2Y0HA 2K0LA 2LFUA 1BXWA 3POQA 2FGQX 3LK2B 3AAEA 4O3YA 4XNLA 4FT6A 3LK42 3A2SX 1Q9GA 2O4VA 3DA3A 5EE2A 3VE1A 4D65A 2KDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KR4 A;  4BUM X;  2XE2 A;  4FSP A;  4AUI A;  1BH3 A;  4D5U A;  3PRN A;  2ZFG A;  5DL8 A;  3VZT X;  1HXT A;  1HXX A;  3WI5 A;  3SY7 A;  2J4U P;  2POR A;  1OSM A;  2XE5 A;  2XE1 A;  2OMF A;  8PRN A;  1E54 A;  2XG6 A;  3SZD A;  4RJW A;  4RJX A;  1OPF A;  7PRN A;  5PRN A;  1MPF A;  4LSF A;  3T24 A;  5DL6 A;  5FVN A;  3WI4 A;  2J1N A;  4LSI A;  4FRX A;  1GFP A;  4GCS A;  2ODJ A;  3FYX A;  3UU2 A;  1H6S 1;  3VY8 X;  5DL7 A;  3T20 A;  3O0E A;  5DL5 A;  3POX A;  1PRN A;  3SYS A;  3VY9 X;  4FOZ A;  1GFN A;  4FMS A;  3T0S A;  3POR A;  3EMN X;  4LSH A;  3UPG A;  3SZV A;  2Y0K A;  1GFM A;  3K19 A;  2Y2X A;  4JFB A;  3NSG A;  2FGR A;  4KR8 A;  2Y0L A;  5JDP A;  4FSO A;  1BT9 A;  1GFO A;  4FRT A;  3HW9 A;  3HWB A;  4C69 X;  4LSE A;  3SY9 A;  2ZLD A;  4GCQ A;  2K4T A;  3POU A;  3SYB A;  3VZW X;  1GFQ A;  3JTY A;  4GCP A;  2QTK A;  2PRN A;  3VZU X;  4KRA A;  4D64 A;  2XE3 A;  6PRN A;  1PHO A;  2Y0H A;  3POQ A;  2FGQ X;  4FT6 A;  3A2S X;  2O4V A;  4D65 A;  1HXU A; 
#chains in the Genus database with same CATH topology
 2WVP A;  1ZHY A;  4KR4 A;  3PF1 A;  3PGS A;  3AA1 B;  4BUM X;  4AZL A;  1THQ A;  3AAA A;  4N75 A;  5ADX K;  4O4U A;  2XE2 A;  4FSP A;  4FZM A;  4AUI A;  4AKR B;  2IWV A;  5IYU A;  1BH3 A;  1ZHT A;  4D5U A;  2XTR A;  3PRN A;  4U9C A;  2ZFG A;  5DL8 A;  5KAI O;  3PGU A;  4AFK A;  4C00 A;  3QRA A;  3AA0 B;  3VZT X;  5GTH O;  2YPV A;  1HXT A;  1HXX A;  3WI5 A;  3SY7 A;  3TZG A;  4PR7 A;  2J4U P;  2POR A;  1OSM A;  2XE5 A;  3A0H O;  2XE1 A;  4K3B A;  3UAQ A;  2OMF A;  5T5F A;  1ZHW A;  2R4L A;  1E54 A;  2XG6 A;  4F4B A;  4Z3T A;  4FES A;  3LK3 A;  5D5D A;  3PQS A;  3SZD A;  4RJW A;  2KZ7 A;  4O3Z A;  4RJX A;  1OPF A;  1QJ9 A;  1ZHX A;  7PRN A;  3G7G A;  5PRN A;  1MPF A;  3AA7 A;  2KXP A;  2N2L A;  2W81 C;  2JMM A;  4N58 A;  5E79 O;  4AYE C;  4LSF A;  3T24 A;  5DL6 A;  5FVN A;  4O49 A;  3DWN A;  3WI4 A;  2N2M A;  2J1N A;  2MHL A;  3DA4 A;  3GP6 A;  4FRX A;  1GFP A;  2M06 A;  4GCS A;  1T1L A;  4LSI A;  5GTI O;  5TIS O;  1HXU A;  4C4V A;  2ODJ A;  3KZI O;  4FZL A;  1MM5 A;  3FYX A;  3WU2 O;  4O3W A;  4AYI D;  2R89 A;  2R4N A;  3UU2 A;  3V8U A;  1H6S 1;  1IZN B;  2XMX A;  4RL9 A;  3AA6 B;  5AFU L;  4QQ1 A;  1Q9F A;  1QJP A;  2Y7S A;  3QRC A;  4RLB A;  2F1T A;  4K3C A;  2F1V A;  5DL7 A;  3VY8 X;  2W80 C;  3LK2 A;  4G76 A;  3T20 A;  3O0E A;  4FZN A;  1MM4 A;  1YS5 A;  2R4P A;  3POX A;  5DL5 A;  5G26 A;  4N59 A;  3A0B O;  1PRN A;  3SYS A;  3VY9 X;  3HOL A;  4FOZ A;  1GFN A;  3BS0 A;  4FMS A;  2AXT O;  3AA1 A;  3AAE B;  3POR A;  2WJQ A;  3T0S A;  4B61 A;  3EMN X;  4LSH A;  3UPG A;  3DZM A;  3SZV A;  4D65 A;  2ERV A;  2Y0K A;  4AKR A;  4GF4 A;  4O3X B;  4E1S A;  1GFM A;  3K19 A;  2Y2X A;  3AAA B;  3AA0 A;  2R4O A;  4JFB A;  3DWO X;  3NSG A;  2GE4 A;  2LHF A;  4FUV A;  3RBH A;  1QJ8 A;  2FGR A;  3JCU O;  5G38 A;  2X27 X;  3NJT A;  4KR8 A;  5GV0 A;  2Y0L A;  3HOE A;  5JDP A;  4FSO A;  4UB6 O;  4AYN A;  3VE2 A;  4AYM C;  4RLC A;  4XNK A;  1S5L O;  5H2F O;  1G90 A;  1GFO A;  1BT9 A;  4FRT A;  3HW9 A;  5B66 O;  3HWB A;  5G3A A;  4AKM A;  8PRN A;  4C69 X;  3LK3 B;  1T16 A;  4LSE A;  2KZ7 B;  3SY9 A;  2ZLD A;  4GCQ A;  2KC0 A;  3C5O A;  2K4T A;  4E1T A;  3KVD D;  2M07 A;  3AA7 B;  2KXP B;  3POU A;  3SYB A;  4G75 A;  3VZW X;  1ORM A;  4AYD C;  4GHB A;  1GFQ A;  3JTY A;  3LK4 1;  2IWW A;  4GCP A;  3PQU A;  2X9K A;  2YNK A;  2QTK A;  1IZN A;  4O4X A;  4PJ0 O;  2PRN A;  2R88 A;  3VZU X;  3AA6 A;  4C4V B;  5ADX L;  3BRY A;  2XTQ A;  5AFU K;  4JCH A;  4CTD A;  5G39 A;  1ZHZ A;  2JQY A;  4KRA A;  4D64 A;  2MNH A;  2XE3 A;  4FQE A;  5KAF O;  4PUX A;  1P4T A;  1PHO A;  6PRN A;  2Y0H A;  2K0L A;  2LFU A;  1BXW A;  3POQ A;  4IL6 O;  2FGQ X;  3LK2 B;  3AAE A;  4O3Y A;  2F1C X;  4FT6 A;  3BRZ A;  3A2S X;  1Q9G A;  2O4V A;  3DA3 A;  3LK4 2;  4N74 A;  4XNL A;  5EE2 A;  3VE1 A;  5B5E O;  2R8A A;  2WJR A;  2KDY A;  3PGR A;  4UB8 O; 
#chains in the Genus database with same CATH homology
 4KR4 A;  1ZHY A;  4BUM X;  3AA1 B;  4AZL A;  1THQ A;  3AAA A;  5ADX K;  4O4U A;  2XE2 A;  4FSP A;  4FZM A;  4AUI A;  4AKR B;  5IYU A;  1BH3 A;  1ZHT A;  4D5U A;  2XTR A;  3PRN A;  4U9C A;  2ZFG A;  5DL8 A;  4AFK A;  3QRA A;  3AA0 B;  3VZT X;  2YPV A;  1HXT A;  1HXX A;  3WI5 A;  3SY7 A;  3TZG A;  2J4U P;  2XE5 A;  1OSM A;  2POR A;  2XE1 A;  3UAQ A;  4F4B A;  2OMF A;  5T5F A;  1ZHW A;  4Z3T A;  1E54 A;  2XG6 A;  8PRN A;  4FES A;  3LK3 A;  5D5D A;  3PQS A;  3SZD A;  4RJW A;  2KZ7 A;  4O3Z A;  4RJX A;  1OPF A;  1QJ9 A;  1ZHX A;  7PRN A;  3G7G A;  5PRN A;  1MPF A;  3AA7 A;  2W81 C;  2N2L A;  2KXP A;  2JMM A;  4N58 A;  4AYE C;  4LSF A;  3T24 A;  5DL6 A;  5FVN A;  4O49 A;  5ADX L;  3WI4 A;  2N2M A;  2J1N A;  2MHL A;  3DA4 A;  3GP6 A;  4FRX A;  1GFP A;  2M06 A;  4GCS A;  4LSI A;  1HXU A;  2ODJ A;  4FZL A;  1MM5 A;  3FYX A;  4O3W A;  4AYI D;  3UU2 A;  3V8U A;  1H6S 1;  1IZN B;  2XMX A;  4RL9 A;  3AA6 B;  5AFU L;  4QQ1 A;  1Q9F A;  1QJP A;  2Y7S A;  3QRC A;  4RLB A;  2F1T A;  3VY8 X;  2F1V A;  5DL7 A;  2W80 C;  3LK2 A;  4G76 A;  3T20 A;  3O0E A;  4FZN A;  1MM4 A;  1YS5 A;  5DL5 A;  3POX A;  5G26 A;  4N59 A;  1PRN A;  3SYS A;  3VY9 X;  3HOL A;  4FOZ A;  1GFN A;  4B61 A;  4FMS A;  3AA1 A;  3AAE B;  3T0S A;  3POR A;  3EMN X;  4LSH A;  3UPG A;  3SZV A;  2ERV A;  2Y0K A;  4AKR A;  4GF4 A;  4O3X B;  4E1S A;  1GFM A;  3K19 A;  2Y2X A;  3AAA B;  3AA0 A;  4JFB A;  3NSG A;  2GE4 A;  2LHF A;  4FUV A;  3RBH A;  1QJ8 A;  2FGR A;  2X27 X;  4KR8 A;  5GV0 A;  2Y0L A;  3HOE A;  5JDP A;  4FSO A;  4AYN A;  3VE2 A;  4AYM C;  4RLC A;  4XNK A;  1G90 A;  1GFO A;  1BT9 A;  4FRT A;  3HW9 A;  3HWB A;  4AKM A;  4C69 X;  3LK3 B;  4LSE A;  2KZ7 B;  3SY9 A;  2ZLD A;  4GCQ A;  2KC0 A;  3C5O A;  2K4T A;  4E1T A;  3KVD D;  2M07 A;  3AA7 B;  2KXP B;  3POU A;  3SYB A;  4G75 A;  3VZW X;  1ORM A;  4AYD C;  4GHB A;  1GFQ A;  3JTY A;  3LK4 1;  4GCP A;  3PQU A;  2YNK A;  2QTK A;  1IZN A;  4O4X A;  2PRN A;  3VZU X;  3AA6 A;  2XTQ A;  5AFU K;  4JCH A;  1ZHZ A;  4KRA A;  4D64 A;  2MNH A;  2XE3 A;  4PUX A;  1P4T A;  1PHO A;  6PRN A;  2Y0H A;  2K0L A;  2LFU A;  1BXW A;  3POQ A;  2FGQ X;  3LK2 B;  3AAE A;  4O3Y A;  4XNL A;  4FT6 A;  3LK4 2;  3A2S X;  1Q9G A;  2O4V A;  3DA3 A;  5EE2 A;  3VE1 A;  4D65 A;  2KDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...