2XG6A

Molecular insights into clinically isolated ompc mutants and their role in multi-drug resistance
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
343
structure length
343
Chain Sequence
AEIYNKDGNKLDLYGKVEGLHYFSDNDSKDGDKTYMRLGFKGETQVTDQLTGYGQWEYQIQGNEPESDNSSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYDSDNFMQQHGNGFATYRNTDFFGLVDGLDFAVQYQGKNGSAHGEGMTTNGRDDVFEQNGDGVGGSITYNYEGFGIGAAVSSSKRTWDQNNTGLIGTGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPFLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNRFTRDAGINTDDIVALGLVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords OMPC
publication title Altered Antibiotic Transport in Ompc Mutants Isolated from a Series of Clinical Strains of Multi-Drug Resistant E. Coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 87
structure length 343
sequence length 343
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2xg6A00
2XE2A 2ZFGA 3T24A 4LSEA 4GCSA 3VY8X 1HXUA 4FRXA 1OPFA 4BUMX 1PHOA 2ZLDA 5DL5A 4D5UA 2FGQX 1GFNA 4D64A 4LSIA 2O4VA 2OMFA 3VZWX 2QTKA 2XE5A 3SY9A 5DL6A 4RJXA 1GFOA 4FSPA 2ODJA 3EMNX 3UU2A 8PRNA 2Y0HA 1OSMA 3UPGA 3VY9X 3O0EA 3POUA 2Y0KA 4FMSA 1GFPA 3SYBA 3SZVA 3VZTX 1GFQA 3POXA 3WI4A 3SYSA 1HXXA 1BH3A 6PRNA 1BT9A 1PRNA 3PORA 3NSGA 3A2SX 3T20A 4LSFA 4JFBA 4FOZA 3WI5A 4KRAA 3VZUX 4GCPA 1H6S1 2PORA 5JDPA 4LSHA 4FRTA 3K19A 4AUIA 4FSOA 3PRNA 4FT6A 2Y0LA 2J1NA 4D65A 2J4UP 3HWBA 3T0SA 5FVNA 3SY7A 2K4TA 7PRNA 2XE3A 5DL7A 2XE1A 4C69X 3POQA 1GFMA 4RJWA 2Y2XA 1HXTA 1E54A 3JTYA 2PRNA 3HW9A 2FGRA 2XG6A 3SZDA 5DL8A 1MPFA 4KR8A 4GCQA 3FYXA 4KR4A 5PRNA
chains in the Genus database with same CATH superfamily
5T5FA 2XTQA 2XE2A 2ZFGA 3PQUA 3T24A 1G90A 4LSEA 4GCSA 2F1CX 2WJRA 3AAEA 1IZNA 1HXUA 3AA7B 3KVDD 3VY8X 4FRXA 5AFUK 2X27X 1OPFA 4BUMX 4IL6O 1PHOA 2N2LA 2ZLDA 5G26A 5DL5A 5GTHO 2R8AA 4C4VB 4PUXA 4D5UA 5GTIO 1YS5A 1T1LA 2FGQX 1GFNA 2X9KA 3LK3A 4D64A 4XNLA 4LSIA 4RLCA 1QJ9A 3HOEA 4GF4A 4B61A 3AA0A 2O4VA 4QQ1A 2KZ7B 1S5LO 2LHFA 2QTKA 2M06A 2OMFA 2XE5A 3VZWX 3HOLA 3SY9A 5ADXL 2LFUA 1P4TA 4RLBA 1BXWA 5DL6A 5TISO 2IWWA 4AZLA 2KC0A 4UB8O 2Y7SA 4RJXA 1GFOA 4FSPA 5B66O 4AYEC 4AYMC 3AA6B 2ODJA 3AAAB 2KXPA 3EMNX 3UU2A 4AKRB 4AYNA 2Y0HA 1OSMA 8PRNA 3JCUO 2F1TA 4FESA 5E79O 3UPGA 5ADXK 3A0HO 3VY9X 3O0EA 4O3XB 3POUA 4FUVA 1ZHYA 2Y0KA 4FMSA 2YNKA 1GFPA 3NJTA 4G76A 4O3YA 4AYDC 3LK42 3SYBA 3SZVA 2W81C 3DZMA 3VZTX 1GFQA 4JCHA 5H2FO 3POXA 3QRAA 3WI4A 4FZMA 5G39A 3RBHA 1Q9FA 3SYSA 1HXXA 2XMXA 1BH3A 4XNKA 1ZHWA 3LK2B 6PRNA 1BT9A 2K0LA 3PF1A 3AA6A 4N74A 4N75A 4E1TA 5G3AA 1PRNA 3PORA 3NSGA 3A2SX 3T20A 2AXTO 4LSFA 4JFBA 5EE2A 3C5OA 4FOZA 3WI5A 3AA7A 4KRAA 2WJQA 3GP6A 1THQA 3V8UA 3VZUX 4AFKA 4G75A 4O3ZA 4GCPA 4UB6O 1QJ8A 4PR7A 5KAIO 4C4VA 3QRCA 2KDYA 1H6S1 1ZHZA 5IYUA 4E1SA 2PORA 4O3WA 4C00A 5JDPA 4K3CA 4LSHA 4FRTA 1T16A 3K19A 4AUIA 2R89A 1IZNB 3PQSA 4RL9A 4Z3TA 2KZ7A 1ZHXA 5D5DA 2N2MA 4FSOA 3DWOX 3PGUA 3PRNA 5G38A 1MM5A 3LK3B 4FT6A 4FQEA 2ERVA 4FZNA 2Y0LA 3G7GA 4O49A 2J1NA 4F4BA 1ORMA 3AA1B 2MHLA 4D65A 4GHBA 2J4UP 2YPVA 2JMMA 3AAAA 1QJPA 3BS0A 4U9CA 4AKRA 3DA4A 3HWBA 3BRZA 3T0SA 1MM4A 2R4OA 5FVNA 3SY7A 3VE2A 2K4TA 3BRYA 4N59A 7PRNA 3A0BO 3DA3A 2XE3A 3TZGA 1ZHTA 4FZLA 4K3BA 1Q9GA 3LK41 5DL7A 2WVPA 2XE1A 3UAQA 3PGRA 2KXPB 3PGSA 4O4XA 3KZIO 4C69X 3POQA 2R4NA 2R88A 1GFMA 2M07A 4RJWA 2Y2XA 4CTDA 1HXTA 4AYID 1E54A 3JTYA 3AAEB 2PRNA 3HW9A 2W80C 4N58A 3DWNA 2FGRA 3LK2A 2XG6A 3AA1A 4PJ0O 4AKMA 3SZDA 5KAFO 2R4PA 5B5EO 2GE4A 2R4LA 5DL8A 1MPFA 2MNHA 4O4UA 5AFUL 4KR8A 4GCQA 3VE1A 3FYXA 3AA0B 2JQYA 4KR4A 5PRNA 2F1VA 3WU2O 2IWVA 5GV0A 2XTRA
chains in the Genus database with same CATH topology
5T5FA 2XTQA 2XE2A 2ZFGA 3PQUA 3T24A 1G90A 4LSEA 4GCSA 3VY8X 3AAEA 1IZNA 1HXUA 3AA7B 3KVDD 4FRXA 5AFUK 2X27X 1OPFA 4BUMX 5G26A 1PHOA 2N2LA 2ZLDA 5DL5A 4PUXA 4D5UA 1YS5A 2FGQX 1GFNA 4D64A 3LK3A 4XNLA 4LSIA 4RLCA 1QJ9A 3HOEA 4GF4A 4B61A 3AA0A 2O4VA 4QQ1A 2KZ7B 2LHFA 2OMFA 2QTKA 2M06A 2XE5A 3VZWX 5ADXL 3HOLA 3SY9A 2LFUA 1P4TA 4RLBA 1BXWA 5DL6A 4AZLA 2KC0A 2Y7SA 4RJXA 1GFOA 4FSPA 4AYEC 4AYMC 3AA6B 2ODJA 3AAAB 2KXPA 3EMNX 3UU2A 4AKRB 4AYNA 2Y0HA 1OSMA 8PRNA 4FESA 2F1TA 3UPGA 5ADXK 3VY9X 3O0EA 4O3XB 3POUA 4FUVA 1ZHYA 2Y0KA 4FMSA 2YNKA 1GFPA 4G76A 4O3YA 4AYDC 3LK42 3SYBA 3SZVA 2W81C 3VZTX 1GFQA 4JCHA 3POXA 3QRAA 3WI4A 4FZMA 3RBHA 1Q9FA 3SYSA 1HXXA 2XMXA 1BH3A 4XNKA 1ZHWA 3LK2B 6PRNA 1BT9A 2K0LA 3AA6A 4E1TA 1PRNA 3PORA 3NSGA 3A2SX 3T20A 4LSFA 5EE2A 4JFBA 3C5OA 4FOZA 3WI5A 3AA7A 4KRAA 4AFKA 3GP6A 1THQA 3V8UA 3VZUX 4G75A 4O3ZA 4GCPA 1QJ8A 3QRCA 2KDYA 1H6S1 1ZHZA 5IYUA 4E1SA 2PORA 4O3WA 5JDPA 4LSHA 4FRTA 3K19A 4AUIA 3PQSA 1IZNB 4RL9A 4Z3TA 2KZ7A 1ZHXA 5D5DA 2N2MA 4FSOA 3PRNA 1MM5A 3LK3B 4FT6A 2ERVA 4FZNA 2Y0LA 3G7GA 4O49A 2J1NA 4F4BA 1ORMA 3AA1B 2MHLA 4D65A 4GHBA 2J4UP 2YPVA 2JMMA 3AAAA 1QJPA 4U9CA 4AKRA 3DA4A 3HWBA 3T0SA 1MM4A 3VE2A 5FVNA 3SY7A 2K4TA 4N59A 7PRNA 3DA3A 2XE3A 3TZGA 1ZHTA 4FZLA 5DL7A 1Q9GA 3LK41 2XE1A 3UAQA 2KXPB 4C69X 4O4XA 3POQA 1GFMA 2M07A 4RJWA 2Y2XA 1HXTA 4AYID 1E54A 3JTYA 3AAEB 2PRNA 3HW9A 2W80C 4N58A 2FGRA 3LK2A 2XG6A 3AA1A 4AKMA 3SZDA 2GE4A 5DL8A 1MPFA 2MNHA 4O4UA 5AFUL 4KR8A 4GCQA 3VE1A 3FYXA 3AA0B 4KR4A 5PRNA 2F1VA 5GV0A 2XTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XE2 A;  2ZFG A;  3T24 A;  4LSE A;  4GCS A;  3VY8 X;  1HXU A;  4FRX A;  1OPF A;  4BUM X;  1PHO A;  2ZLD A;  5DL5 A;  4D5U A;  2FGQ X;  1GFN A;  4D64 A;  4LSI A;  2O4V A;  2OMF A;  3VZW X;  2QTK A;  2XE5 A;  3SY9 A;  5DL6 A;  4RJX A;  1GFO A;  4FSP A;  2ODJ A;  3EMN X;  3UU2 A;  8PRN A;  2Y0H A;  1OSM A;  3UPG A;  3VY9 X;  3O0E A;  3POU A;  2Y0K A;  4FMS A;  1GFP A;  3SYB A;  3SZV A;  3VZT X;  1GFQ A;  3POX A;  3WI4 A;  3SYS A;  1HXX A;  1BH3 A;  6PRN A;  1BT9 A;  1PRN A;  3POR A;  3NSG A;  3A2S X;  3T20 A;  4LSF A;  4JFB A;  4FOZ A;  3WI5 A;  4KRA A;  3VZU X;  4GCP A;  1H6S 1;  2POR A;  5JDP A;  4LSH A;  4FRT A;  3K19 A;  4AUI A;  4FSO A;  3PRN A;  4FT6 A;  2Y0L A;  2J1N A;  4D65 A;  2J4U P;  3HWB A;  3T0S A;  5FVN A;  3SY7 A;  2K4T A;  7PRN A;  2XE3 A;  5DL7 A;  2XE1 A;  4C69 X;  3POQ A;  1GFM A;  4RJW A;  2Y2X A;  1HXT A;  1E54 A;  3JTY A;  2PRN A;  3HW9 A;  2FGR A;  2XG6 A;  3SZD A;  5DL8 A;  1MPF A;  4KR8 A;  4GCQ A;  3FYX A;  4KR4 A;  5PRN A; 
#chains in the Genus database with same CATH topology
 5T5F A;  2XTQ A;  2XE2 A;  2ZFG A;  3PQU A;  3T24 A;  1G90 A;  4LSE A;  4GCS A;  2F1C X;  2WJR A;  3AAE A;  1IZN A;  1HXU A;  3AA7 B;  3KVD D;  3VY8 X;  4FRX A;  5AFU K;  2X27 X;  1OPF A;  4BUM X;  4IL6 O;  1PHO A;  2N2L A;  2ZLD A;  5G26 A;  5DL5 A;  5GTH O;  2R8A A;  4C4V B;  4PUX A;  4D5U A;  5GTI O;  1YS5 A;  1T1L A;  2FGQ X;  1GFN A;  2X9K A;  3LK3 A;  4D64 A;  4XNL A;  4LSI A;  4RLC A;  1QJ9 A;  3HOE A;  4GF4 A;  4B61 A;  3AA0 A;  2O4V A;  4QQ1 A;  2KZ7 B;  1S5L O;  2LHF A;  2QTK A;  2M06 A;  2OMF A;  2XE5 A;  3VZW X;  3HOL A;  3SY9 A;  5ADX L;  2LFU A;  1P4T A;  4RLB A;  1BXW A;  5DL6 A;  5TIS O;  2IWW A;  4AZL A;  2KC0 A;  4UB8 O;  2Y7S A;  4RJX A;  1GFO A;  4FSP A;  5B66 O;  4AYE C;  4AYM C;  3AA6 B;  2ODJ A;  3AAA B;  2KXP A;  3EMN X;  3UU2 A;  4AKR B;  4AYN A;  2Y0H A;  1OSM A;  8PRN A;  3JCU O;  2F1T A;  4FES A;  5E79 O;  3UPG A;  5ADX K;  3A0H O;  3VY9 X;  3O0E A;  4O3X B;  3POU A;  4FUV A;  1ZHY A;  2Y0K A;  4FMS A;  2YNK A;  1GFP A;  3NJT A;  4G76 A;  4O3Y A;  4AYD C;  3LK4 2;  3SYB A;  3SZV A;  2W81 C;  3DZM A;  3VZT X;  1GFQ A;  4JCH A;  5H2F O;  3POX A;  3QRA A;  3WI4 A;  4FZM A;  5G39 A;  3RBH A;  1Q9F A;  3SYS A;  1HXX A;  2XMX A;  1BH3 A;  4XNK A;  1ZHW A;  3LK2 B;  6PRN A;  1BT9 A;  2K0L A;  3PF1 A;  3AA6 A;  4N74 A;  4N75 A;  4E1T A;  5G3A A;  1PRN A;  3POR A;  3NSG A;  3A2S X;  3T20 A;  2AXT O;  4LSF A;  4JFB A;  5EE2 A;  3C5O A;  4FOZ A;  3WI5 A;  3AA7 A;  4KRA A;  2WJQ A;  3GP6 A;  1THQ A;  3V8U A;  3VZU X;  4AFK A;  4G75 A;  4O3Z A;  4GCP A;  4UB6 O;  1QJ8 A;  4PR7 A;  5KAI O;  4C4V A;  3QRC A;  2KDY A;  1H6S 1;  1ZHZ A;  5IYU A;  4E1S A;  2POR A;  4O3W A;  4C00 A;  5JDP A;  4K3C A;  4LSH A;  4FRT A;  1T16 A;  3K19 A;  4AUI A;  2R89 A;  1IZN B;  3PQS A;  4RL9 A;  4Z3T A;  2KZ7 A;  1ZHX A;  5D5D A;  2N2M A;  4FSO A;  3DWO X;  3PGU A;  3PRN A;  5G38 A;  1MM5 A;  3LK3 B;  4FT6 A;  4FQE A;  2ERV A;  4FZN A;  2Y0L A;  3G7G A;  4O49 A;  2J1N A;  4F4B A;  1ORM A;  3AA1 B;  2MHL A;  4D65 A;  4GHB A;  2J4U P;  2YPV A;  2JMM A;  3AAA A;  1QJP A;  3BS0 A;  4U9C A;  4AKR A;  3DA4 A;  3HWB A;  3BRZ A;  3T0S A;  1MM4 A;  2R4O A;  5FVN A;  3SY7 A;  3VE2 A;  2K4T A;  3BRY A;  4N59 A;  7PRN A;  3A0B O;  3DA3 A;  2XE3 A;  3TZG A;  1ZHT A;  4FZL A;  4K3B A;  1Q9G A;  3LK4 1;  5DL7 A;  2WVP A;  2XE1 A;  3UAQ A;  3PGR A;  2KXP B;  3PGS A;  4O4X A;  3KZI O;  4C69 X;  3POQ A;  2R4N A;  2R88 A;  1GFM A;  2M07 A;  4RJW A;  2Y2X A;  4CTD A;  1HXT A;  4AYI D;  1E54 A;  3JTY A;  3AAE B;  2PRN A;  3HW9 A;  2W80 C;  4N58 A;  3DWN A;  2FGR A;  3LK2 A;  2XG6 A;  3AA1 A;  4PJ0 O;  4AKM A;  3SZD A;  5KAF O;  2R4P A;  5B5E O;  2GE4 A;  2R4L A;  5DL8 A;  1MPF A;  2MNH A;  4O4U A;  5AFU L;  4KR8 A;  4GCQ A;  3VE1 A;  3FYX A;  3AA0 B;  2JQY A;  4KR4 A;  5PRN A;  2F1V A;  3WU2 O;  2IWV A;  5GV0 A;  2XTR A; 
#chains in the Genus database with same CATH homology
 5T5F A;  2XTQ A;  2XE2 A;  2ZFG A;  3PQU A;  3T24 A;  1G90 A;  4LSE A;  4GCS A;  3VY8 X;  3AAE A;  1IZN A;  1HXU A;  3AA7 B;  3KVD D;  4FRX A;  5AFU K;  2X27 X;  1OPF A;  4BUM X;  5G26 A;  1PHO A;  2N2L A;  2ZLD A;  5DL5 A;  4PUX A;  4D5U A;  1YS5 A;  2FGQ X;  1GFN A;  4D64 A;  3LK3 A;  4XNL A;  4LSI A;  4RLC A;  1QJ9 A;  3HOE A;  4GF4 A;  4B61 A;  3AA0 A;  2O4V A;  4QQ1 A;  2KZ7 B;  2LHF A;  2OMF A;  2QTK A;  2M06 A;  2XE5 A;  3VZW X;  5ADX L;  3HOL A;  3SY9 A;  2LFU A;  1P4T A;  4RLB A;  1BXW A;  5DL6 A;  4AZL A;  2KC0 A;  2Y7S A;  4RJX A;  1GFO A;  4FSP A;  4AYE C;  4AYM C;  3AA6 B;  2ODJ A;  3AAA B;  2KXP A;  3EMN X;  3UU2 A;  4AKR B;  4AYN A;  2Y0H A;  1OSM A;  8PRN A;  4FES A;  2F1T A;  3UPG A;  5ADX K;  3VY9 X;  3O0E A;  4O3X B;  3POU A;  4FUV A;  1ZHY A;  2Y0K A;  4FMS A;  2YNK A;  1GFP A;  4G76 A;  4O3Y A;  4AYD C;  3LK4 2;  3SYB A;  3SZV A;  2W81 C;  3VZT X;  1GFQ A;  4JCH A;  3POX A;  3QRA A;  3WI4 A;  4FZM A;  3RBH A;  1Q9F A;  3SYS A;  1HXX A;  2XMX A;  1BH3 A;  4XNK A;  1ZHW A;  3LK2 B;  6PRN A;  1BT9 A;  2K0L A;  3AA6 A;  4E1T A;  1PRN A;  3POR A;  3NSG A;  3A2S X;  3T20 A;  4LSF A;  5EE2 A;  4JFB A;  3C5O A;  4FOZ A;  3WI5 A;  3AA7 A;  4KRA A;  4AFK A;  3GP6 A;  1THQ A;  3V8U A;  3VZU X;  4G75 A;  4O3Z A;  4GCP A;  1QJ8 A;  3QRC A;  2KDY A;  1H6S 1;  1ZHZ A;  5IYU A;  4E1S A;  2POR A;  4O3W A;  5JDP A;  4LSH A;  4FRT A;  3K19 A;  4AUI A;  3PQS A;  1IZN B;  4RL9 A;  4Z3T A;  2KZ7 A;  1ZHX A;  5D5D A;  2N2M A;  4FSO A;  3PRN A;  1MM5 A;  3LK3 B;  4FT6 A;  2ERV A;  4FZN A;  2Y0L A;  3G7G A;  4O49 A;  2J1N A;  4F4B A;  1ORM A;  3AA1 B;  2MHL A;  4D65 A;  4GHB A;  2J4U P;  2YPV A;  2JMM A;  3AAA A;  1QJP A;  4U9C A;  4AKR A;  3DA4 A;  3HWB A;  3T0S A;  1MM4 A;  3VE2 A;  5FVN A;  3SY7 A;  2K4T A;  4N59 A;  7PRN A;  3DA3 A;  2XE3 A;  3TZG A;  1ZHT A;  4FZL A;  5DL7 A;  1Q9G A;  3LK4 1;  2XE1 A;  3UAQ A;  2KXP B;  4C69 X;  4O4X A;  3POQ A;  1GFM A;  2M07 A;  4RJW A;  2Y2X A;  1HXT A;  4AYI D;  1E54 A;  3JTY A;  3AAE B;  2PRN A;  3HW9 A;  2W80 C;  4N58 A;  2FGR A;  3LK2 A;  2XG6 A;  3AA1 A;  4AKM A;  3SZD A;  2GE4 A;  5DL8 A;  1MPF A;  2MNH A;  4O4U A;  5AFU L;  4KR8 A;  4GCQ A;  3VE1 A;  3FYX A;  3AA0 B;  4KR4 A;  5PRN A;  2F1V A;  5GV0 A;  2XTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...