2ZLDA

Structure of ompf co-crystallized with t83
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
340
structure length
339
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein F
publication title Crystal structures of the OmpF porin: function in a colicin translocon.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 95
structure length 339
sequence length 340
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2zldA00
4RJXA 3VZWX 3SY9A 3T24A 3EMNX 4AUIA 3A2SX 1OPFA 2PRNA 2XE1A 3POUA 1GFQA 1E54A 6PRNA 3FYXA 4LSHA 4D5UA 3T20A 2XE2A 2FGQX 2ZLDA 2O4VA 5FVNA 3PRNA 3UU2A 3POQA 3T0SA 1PHOA 3O0EA 5PRNA 5DL8A 4FMSA 2ZFGA 2K4TA 1OSMA 1HXUA 1GFNA 3HWBA 2Y0HA 3VZUX 2QTKA 1HXTA 3VY9X 5JDPA 4GCSA 4KRAA 1PRNA 4FSPA 2J4UP 1HXXA 2FGRA 2OMFA 4D65A 3NSGA 2ODJA 2Y0KA 4FSOA 1GFOA 3WI4A 3SYSA 5DL7A 4D64A 3HW9A 4FRTA 4LSIA 4KR4A 3VY8X 3JTYA 4RJWA 3SZDA 8PRNA 1GFPA 3POXA 3PORA 4C69X 5DL5A 2XE5A 3WI5A 1BH3A 2XG6A 4BUMX 3SY7A 1BT9A 2Y2XA 4JFBA 2XE3A 5DL6A 3SYBA 4LSFA 4FT6A 2J1NA 4LSEA 3UPGA 4FOZA 3K19A 4FRXA 3VZTX 4GCQA 4GCPA 1MPFA 4KR8A 7PRNA 1GFMA 3SZVA 2Y0LA 1H6S1 2PORA
chains in the Genus database with same CATH superfamily
2KXPA 2YPVA 3AA7B 4O3ZA 4RJXA 2R8AA 3AA1B 3VZWX 3SY9A 5G38A 4GHBA 4PJ0O 5AFUK 2M07A 3LK3A 3T24A 3EMNX 4FZMA 4AUIA 3A2SX 4IL6O 3DWOX 4FQEA 3QRCA 1OPFA 2PRNA 2XE1A 1ZHWA 4XNLA 5GV0A 1IZNB 3LK41 2XTQA 3POUA 2XMXA 4RLBA 1GFQA 1E54A 4JCHA 6PRNA 3FYXA 4LSHA 5T5FA 2WVPA 4D5UA 4RL9A 2F1CX 4AKMA 3T20A 2XE2A 2FGQX 2ZLDA 2O4VA 4AFKA 5FVNA 2X27X 2Y7SA 3BS0A 3A0HO 3WU2O 3KVDD 1Q9FA 4G75A 3AA6B 3VE1A 4AYMC 4AYNA 2K0LA 5KAIO 3PRNA 3UU2A 3DA4A 3POQA 4XNKA 1PHOA 3AA0A 4O3XB 3T0SA 3V8UA 4N75A 3O0EA 5PRNA 2R88A 3NJTA 4AKRB 5DL8A 4O3WA 4FMSA 4C00A 4N59A 3HOLA 4F4BA 5B5EO 2ZFGA 3JCUO 2K4TA 4K3BA 1OSMA 1QJPA 3BRYA 3QRAA 1HXUA 1GFNA 2KZ7B 3LK2B 4UB6O 5EE2A 4AYID 4C4VB 3HWBA 2Y0HA 2MNHA 4AYDC 1S5LO 3DZMA 3VZUX 2QTKA 1HXTA 1YS5A 1MM5A 3A0BO 4O4XA 3VY9X 5JDPA 4AZLA 5H2FO 3DWNA 4FZNA 4GCSA 4KRAA 3AAEA 1PRNA 4K3CA 5G26A 1ZHZA 4FSPA 2J4UP 3AAAB 4PR7A 2ERVA 1HXXA 2FGRA 1P4TA 2OMFA 2KDYA 3PGRA 4D65A 4CTDA 3AA7A 4O49A 5E79O 5B66O 3AA1A 2KXPB 3C5OA 3NSGA 3PF1A 4N74A 5TISO 2IWVA 1QJ9A 2ODJA 2R4LA 5ADXL 2JMMA 2Y0KA 3LK3B 4FSOA 1GFOA 2R4PA 3WI4A 2W81C 3SYSA 3BRZA 2YNKA 5DL7A 3HOEA 1THQA 5KAFO 1IZNA 3TZGA 5D5DA 4D64A 3PQSA 4N58A 3HW9A 4FRTA 4LSIA 5GTHO 4U9CA 4KR4A 2F1TA 3VY8X 3JTYA 4RJWA 2WJQA 4GF4A 1T16A 4O3YA 4QQ1A 3SZDA 1BXWA 1GFPA 3POXA 3VE2A 5AFUL 1ZHXA 8PRNA 3PGSA 2AXTO 1MM4A 3AAAA 1ORMA 2F1VA 3PORA 4C69X 5DL5A 1T1LA 2XE5A 3DA3A 3G7GA 5GTIO 3WI5A 1BH3A 2XG6A 1QJ8A 2N2MA 2WJRA 3AA6A 4FZLA 4BUMX 1G90A 2XTRA 4RLCA 3SY7A 2IWWA 2M06A 5G39A 1BT9A 3AA0B 3UAQA 5G3AA 2Y2XA 4JFBA 2XE3A 4FESA 5DL6A 4AKRA 4Z3TA 3SYBA 3LK42 4LSFA 4B61A 4FUVA 4FT6A 2W80C 2J1NA 2N2LA 2R4OA 1Q9GA 3GP6A 2JQYA 1ZHTA 2KZ7A 3LK2A 4G76A 4LSEA 4C4VA 3UPGA 4UB8O 4E1TA 1ZHYA 2LFUA 4PUXA 4FOZA 4AYEC 2MHLA 5ADXK 2KC0A 3K19A 2GE4A 4FRXA 3VZTX 4GCQA 4GCPA 2LHFA 1MPFA 2R89A 4KR8A 4O4UA 3RBHA 1GFMA 7PRNA 3SZVA 3KZIO 2Y0LA 3AAEB 3PQUA 3PGUA 2X9KA 5IYUA 1H6S1 4E1SA 2R4NA 2PORA
chains in the Genus database with same CATH topology
2KXPA 2YPVA 3AA7B 4O3ZA 4RJXA 3AA1B 3VZWX 3SY9A 4GHBA 5AFUK 2M07A 3LK3A 3T24A 3EMNX 4FZMA 4AUIA 3A2SX 3QRCA 1OPFA 2PRNA 2XE1A 1ZHWA 4XNLA 5GV0A 1IZNB 3LK41 2XTQA 3POUA 2XMXA 4RLBA 1GFQA 1E54A 4JCHA 6PRNA 3FYXA 4LSHA 5T5FA 4D5UA 4RL9A 4AKMA 3T20A 2XE2A 2FGQX 2ZLDA 2O4VA 4AFKA 5FVNA 2X27X 2Y7SA 3KVDD 1Q9FA 4G75A 3AA6B 3VE1A 4AYMC 4AYNA 2K0LA 3PRNA 3UU2A 3DA4A 3POQA 4XNKA 1PHOA 3AA0A 4O3XB 3T0SA 3V8UA 3O0EA 5PRNA 4AKRB 5DL8A 4O3WA 4FMSA 4N59A 3HOLA 4F4BA 2ZFGA 2K4TA 1OSMA 1QJPA 3QRAA 1HXUA 1GFNA 2KZ7B 3LK2B 5EE2A 4AYID 3HWBA 2Y0HA 2MNHA 4AYDC 3VZUX 2QTKA 1HXTA 1YS5A 1MM5A 4O4XA 3VY9X 5JDPA 4AZLA 4FZNA 4GCSA 4KRAA 3AAEA 1PRNA 5G26A 1ZHZA 4FSPA 2J4UP 3AAAB 2ERVA 1HXXA 2FGRA 1P4TA 2OMFA 2KDYA 4D65A 3AA7A 4O49A 3AA1A 2KXPB 3C5OA 3NSGA 1QJ9A 2ODJA 5ADXL 2JMMA 2Y0KA 3LK3B 4FSOA 1GFOA 3WI4A 2W81C 3SYSA 5DL7A 2YNKA 3HOEA 1THQA 1IZNA 3TZGA 5D5DA 4D64A 3PQSA 4N58A 3HW9A 4FRTA 4LSIA 4U9CA 4KR4A 2F1TA 3VY8X 3JTYA 4RJWA 4GF4A 4O3YA 3SZDA 4QQ1A 8PRNA 1BXWA 1GFPA 3POXA 3VE2A 5AFUL 1ZHXA 1MM4A 3AAAA 1ORMA 2F1VA 3PORA 4C69X 5DL5A 2XE5A 3DA3A 3G7GA 3WI5A 1BH3A 2XG6A 1QJ8A 2N2MA 3AA6A 4FZLA 4BUMX 1G90A 2XTRA 4RLCA 3SY7A 2M06A 1BT9A 3AA0B 3UAQA 2Y2XA 4JFBA 2XE3A 4FESA 5DL6A 4AKRA 3SYBA 3LK42 4LSFA 4B61A 4FT6A 2W80C 2J1NA 2N2LA 4Z3TA 1Q9GA 3GP6A 1ZHTA 2KZ7A 3LK2A 4G76A 4LSEA 3UPGA 4E1TA 1ZHYA 2LFUA 4PUXA 4FOZA 4AYEC 2MHLA 5ADXK 2KC0A 3K19A 2GE4A 4FRXA 3VZTX 4GCQA 4GCPA 2LHFA 1MPFA 4KR8A 4O4UA 3RBHA 1GFMA 7PRNA 3SZVA 2Y0LA 3AAEB 3PQUA 4FUVA 5IYUA 1H6S1 4E1SA 2PORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RJX A;  3VZW X;  3SY9 A;  3T24 A;  3EMN X;  4AUI A;  3A2S X;  1OPF A;  2PRN A;  2XE1 A;  3POU A;  1GFQ A;  1E54 A;  6PRN A;  3FYX A;  4LSH A;  4D5U A;  3T20 A;  2XE2 A;  2FGQ X;  2ZLD A;  2O4V A;  5FVN A;  3PRN A;  3UU2 A;  3POQ A;  3T0S A;  1PHO A;  3O0E A;  5PRN A;  5DL8 A;  4FMS A;  2ZFG A;  2K4T A;  1OSM A;  1HXU A;  1GFN A;  3HWB A;  2Y0H A;  3VZU X;  2QTK A;  1HXT A;  3VY9 X;  5JDP A;  4GCS A;  4KRA A;  1PRN A;  4FSP A;  2J4U P;  1HXX A;  2FGR A;  2OMF A;  4D65 A;  3NSG A;  2ODJ A;  2Y0K A;  4FSO A;  1GFO A;  3WI4 A;  3SYS A;  5DL7 A;  4D64 A;  3HW9 A;  4FRT A;  4LSI A;  4KR4 A;  3VY8 X;  3JTY A;  4RJW A;  3SZD A;  8PRN A;  1GFP A;  3POX A;  3POR A;  4C69 X;  5DL5 A;  2XE5 A;  3WI5 A;  1BH3 A;  2XG6 A;  4BUM X;  3SY7 A;  1BT9 A;  2Y2X A;  4JFB A;  2XE3 A;  5DL6 A;  3SYB A;  4LSF A;  4FT6 A;  2J1N A;  4LSE A;  3UPG A;  4FOZ A;  3K19 A;  4FRX A;  3VZT X;  4GCQ A;  4GCP A;  1MPF A;  4KR8 A;  7PRN A;  1GFM A;  3SZV A;  2Y0L A;  1H6S 1;  2POR A; 
#chains in the Genus database with same CATH topology
 2KXP A;  2YPV A;  3AA7 B;  4O3Z A;  4RJX A;  2R8A A;  3AA1 B;  3VZW X;  3SY9 A;  5G38 A;  4GHB A;  4PJ0 O;  5AFU K;  2M07 A;  3LK3 A;  3T24 A;  3EMN X;  4FZM A;  4AUI A;  3A2S X;  4IL6 O;  3DWO X;  4FQE A;  3QRC A;  1OPF A;  2PRN A;  2XE1 A;  1ZHW A;  4XNL A;  5GV0 A;  1IZN B;  3LK4 1;  2XTQ A;  3POU A;  2XMX A;  4RLB A;  1GFQ A;  1E54 A;  4JCH A;  6PRN A;  3FYX A;  4LSH A;  5T5F A;  2WVP A;  4D5U A;  4RL9 A;  2F1C X;  4AKM A;  3T20 A;  2XE2 A;  2FGQ X;  2ZLD A;  2O4V A;  4AFK A;  5FVN A;  2X27 X;  2Y7S A;  3BS0 A;  3A0H O;  3WU2 O;  3KVD D;  1Q9F A;  4G75 A;  3AA6 B;  3VE1 A;  4AYM C;  4AYN A;  2K0L A;  5KAI O;  3PRN A;  3UU2 A;  3DA4 A;  3POQ A;  4XNK A;  1PHO A;  3AA0 A;  4O3X B;  3T0S A;  3V8U A;  4N75 A;  3O0E A;  5PRN A;  2R88 A;  3NJT A;  4AKR B;  5DL8 A;  4O3W A;  4FMS A;  4C00 A;  4N59 A;  3HOL A;  4F4B A;  5B5E O;  2ZFG A;  3JCU O;  2K4T A;  4K3B A;  1OSM A;  1QJP A;  3BRY A;  3QRA A;  1HXU A;  1GFN A;  2KZ7 B;  3LK2 B;  4UB6 O;  5EE2 A;  4AYI D;  4C4V B;  3HWB A;  2Y0H A;  2MNH A;  4AYD C;  1S5L O;  3DZM A;  3VZU X;  2QTK A;  1HXT A;  1YS5 A;  1MM5 A;  3A0B O;  4O4X A;  3VY9 X;  5JDP A;  4AZL A;  5H2F O;  3DWN A;  4FZN A;  4GCS A;  4KRA A;  3AAE A;  1PRN A;  4K3C A;  5G26 A;  1ZHZ A;  4FSP A;  2J4U P;  3AAA B;  4PR7 A;  2ERV A;  1HXX A;  2FGR A;  1P4T A;  2OMF A;  2KDY A;  3PGR A;  4D65 A;  4CTD A;  3AA7 A;  4O49 A;  5E79 O;  5B66 O;  3AA1 A;  2KXP B;  3C5O A;  3NSG A;  3PF1 A;  4N74 A;  5TIS O;  2IWV A;  1QJ9 A;  2ODJ A;  2R4L A;  5ADX L;  2JMM A;  2Y0K A;  3LK3 B;  4FSO A;  1GFO A;  2R4P A;  3WI4 A;  2W81 C;  3SYS A;  3BRZ A;  2YNK A;  5DL7 A;  3HOE A;  1THQ A;  5KAF O;  1IZN A;  3TZG A;  5D5D A;  4D64 A;  3PQS A;  4N58 A;  3HW9 A;  4FRT A;  4LSI A;  5GTH O;  4U9C A;  4KR4 A;  2F1T A;  3VY8 X;  3JTY A;  4RJW A;  2WJQ A;  4GF4 A;  1T16 A;  4O3Y A;  4QQ1 A;  3SZD A;  1BXW A;  1GFP A;  3POX A;  3VE2 A;  5AFU L;  1ZHX A;  8PRN A;  3PGS A;  2AXT O;  1MM4 A;  3AAA A;  1ORM A;  2F1V A;  3POR A;  4C69 X;  5DL5 A;  1T1L A;  2XE5 A;  3DA3 A;  3G7G A;  5GTI O;  3WI5 A;  1BH3 A;  2XG6 A;  1QJ8 A;  2N2M A;  2WJR A;  3AA6 A;  4FZL A;  4BUM X;  1G90 A;  2XTR A;  4RLC A;  3SY7 A;  2IWW A;  2M06 A;  5G39 A;  1BT9 A;  3AA0 B;  3UAQ A;  5G3A A;  2Y2X A;  4JFB A;  2XE3 A;  4FES A;  5DL6 A;  4AKR A;  4Z3T A;  3SYB A;  3LK4 2;  4LSF A;  4B61 A;  4FUV A;  4FT6 A;  2W80 C;  2J1N A;  2N2L A;  2R4O A;  1Q9G A;  3GP6 A;  2JQY A;  1ZHT A;  2KZ7 A;  3LK2 A;  4G76 A;  4LSE A;  4C4V A;  3UPG A;  4UB8 O;  4E1T A;  1ZHY A;  2LFU A;  4PUX A;  4FOZ A;  4AYE C;  2MHL A;  5ADX K;  2KC0 A;  3K19 A;  2GE4 A;  4FRX A;  3VZT X;  4GCQ A;  4GCP A;  2LHF A;  1MPF A;  2R89 A;  4KR8 A;  4O4U A;  3RBH A;  1GFM A;  7PRN A;  3SZV A;  3KZI O;  2Y0L A;  3AAE B;  3PQU A;  3PGU A;  2X9K A;  5IYU A;  1H6S 1;  4E1S A;  2R4N A;  2POR A; 
#chains in the Genus database with same CATH homology
 2KXP A;  2YPV A;  3AA7 B;  4O3Z A;  4RJX A;  3AA1 B;  3VZW X;  3SY9 A;  4GHB A;  5AFU K;  2M07 A;  3LK3 A;  3T24 A;  3EMN X;  4FZM A;  4AUI A;  3A2S X;  3QRC A;  1OPF A;  2PRN A;  2XE1 A;  1ZHW A;  4XNL A;  5GV0 A;  1IZN B;  3LK4 1;  2XTQ A;  3POU A;  2XMX A;  4RLB A;  1GFQ A;  1E54 A;  4JCH A;  6PRN A;  3FYX A;  4LSH A;  5T5F A;  4D5U A;  4RL9 A;  4AKM A;  3T20 A;  2XE2 A;  2FGQ X;  2ZLD A;  2O4V A;  4AFK A;  5FVN A;  2X27 X;  2Y7S A;  3KVD D;  1Q9F A;  4G75 A;  3AA6 B;  3VE1 A;  4AYM C;  4AYN A;  2K0L A;  3PRN A;  3UU2 A;  3DA4 A;  3POQ A;  4XNK A;  1PHO A;  3AA0 A;  4O3X B;  3T0S A;  3V8U A;  3O0E A;  5PRN A;  4AKR B;  5DL8 A;  4O3W A;  4FMS A;  4N59 A;  3HOL A;  4F4B A;  2ZFG A;  2K4T A;  1OSM A;  1QJP A;  3QRA A;  1HXU A;  1GFN A;  2KZ7 B;  3LK2 B;  5EE2 A;  4AYI D;  3HWB A;  2Y0H A;  2MNH A;  4AYD C;  3VZU X;  2QTK A;  1HXT A;  1YS5 A;  1MM5 A;  4O4X A;  3VY9 X;  5JDP A;  4AZL A;  4FZN A;  4GCS A;  4KRA A;  3AAE A;  1PRN A;  5G26 A;  1ZHZ A;  4FSP A;  2J4U P;  3AAA B;  2ERV A;  1HXX A;  2FGR A;  1P4T A;  2OMF A;  2KDY A;  4D65 A;  3AA7 A;  4O49 A;  3AA1 A;  2KXP B;  3C5O A;  3NSG A;  1QJ9 A;  2ODJ A;  5ADX L;  2JMM A;  2Y0K A;  3LK3 B;  4FSO A;  1GFO A;  3WI4 A;  2W81 C;  3SYS A;  5DL7 A;  2YNK A;  3HOE A;  1THQ A;  1IZN A;  3TZG A;  5D5D A;  4D64 A;  3PQS A;  4N58 A;  3HW9 A;  4FRT A;  4LSI A;  4U9C A;  4KR4 A;  2F1T A;  3VY8 X;  3JTY A;  4RJW A;  4GF4 A;  4O3Y A;  3SZD A;  4QQ1 A;  8PRN A;  1BXW A;  1GFP A;  3POX A;  3VE2 A;  5AFU L;  1ZHX A;  1MM4 A;  3AAA A;  1ORM A;  2F1V A;  3POR A;  4C69 X;  5DL5 A;  2XE5 A;  3DA3 A;  3G7G A;  3WI5 A;  1BH3 A;  2XG6 A;  1QJ8 A;  2N2M A;  3AA6 A;  4FZL A;  4BUM X;  1G90 A;  2XTR A;  4RLC A;  3SY7 A;  2M06 A;  1BT9 A;  3AA0 B;  3UAQ A;  2Y2X A;  4JFB A;  2XE3 A;  4FES A;  5DL6 A;  4AKR A;  3SYB A;  3LK4 2;  4LSF A;  4B61 A;  4FT6 A;  2W80 C;  2J1N A;  2N2L A;  4Z3T A;  1Q9G A;  3GP6 A;  1ZHT A;  2KZ7 A;  3LK2 A;  4G76 A;  4LSE A;  3UPG A;  4E1T A;  1ZHY A;  2LFU A;  4PUX A;  4FOZ A;  4AYE C;  2MHL A;  5ADX K;  2KC0 A;  3K19 A;  2GE4 A;  4FRX A;  3VZT X;  4GCQ A;  4GCP A;  2LHF A;  1MPF A;  4KR8 A;  4O4U A;  3RBH A;  1GFM A;  7PRN A;  3SZV A;  2Y0L A;  3AAE B;  3PQU A;  4FUV A;  5IYU A;  1H6S 1;  4E1S A;  2POR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...