2ZLDA

Structure of ompf co-crystallized with t83
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
340
structure length
339
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Outer membrane protein F
publication title Crystal structures of the OmpF porin: function in a colicin translocon.
pubmed doi rcsb
source organism Escherichia coli
total genus 95
structure length 339
sequence length 340
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2zldA00
5JDPA 1E54A 2J1NA 4FSOA 1MPFA 3VY8X 2ZFGA 6PRNA 1GFOA 2QTKA 3SYBA 2XE1A 3SY9A 3POUA 3SY7A 1HXTA 5DL7A 4JFBA 3VZTX 3SZDA 4FMSA 1OPFA 2PRNA 3HW9A 3HWBA 4FOZA 2ODJA 4GCPA 1H6S1 3PRNA 3T24A 5DL5A 3SYSA 8PRNA 2OMFA 1GFPA 4LSEA 3NSGA 5FVNA 1OSMA 3UPGA 4D64A 3POQA 3VZUX 2Y0HA 5DL8A 3WI4A 4KR8A 3UU2A 4KRAA 2XE2A 2Y2XA 3O0EA 1GFNA 3T20A 2K4TA 2XG6A 4AUIA 3VY9X 3SZVA 4GCSA 1BH3A 1BT9A 2Y0LA 2XE3A 2PORA 2ZLDA 4RJWA 5DL6A 3K19A 4D5UA 4BUMX 1PHOA 2Y0KA 4C69X 1GFQA 4GCQA 4LSHA 4FRTA 2J4UP 3JTYA 1HXXA 3VZWX 4KR4A 3PORA 4D65A 5PRNA 4FSPA 4LSIA 7PRNA 2FGRA 2XE5A 1PRNA 2FGQX 3A2SX 1GFMA 3T0SA 4RJXA 3EMNX 4LSFA 2O4VA 3POXA 4FRXA 1HXUA 3WI5A 4FT6A 3FYXA
chains in the Genus database with same CATH superfamily
3AA6B 4AZLA 5JDPA 2F1VA 3PGRA 4QQ1A 1E54A 2J1NA 4FSOA 5GTHO 1MPFA 3VY8X 2R88A 2X9KA 5G38A 2ZFGA 3BRYA 6PRNA 1QJPA 2Y7SA 1GFOA 1P4TA 2M07A 3AA1B 5E79O 2QTKA 4XNLA 3SYBA 4B61A 2XE1A 5ADXK 3SY9A 3POUA 1IZNB 3AAAA 3KVDD 2R89A 3NJTA 3SY7A 1HXTA 5DL7A 4JFBA 3BRZA 3VZTX 4CTDA 3DA3A 3SZDA 3T20A 3JCUO 4FMSA 1OPFA 2WJQA 2KXPA 2PRNA 3HW9A 4AYMC 5G26A 3HWBA 2IWVA 5B66O 3LK3A 4AKRA 2F1CX 4FOZA 2ODJA 4FZMA 4GCPA 1H6S1 5AFUK 1G90A 3PRNA 2WVPA 3T24A 2X27X 1ORMA 4C4VA 3LK2A 2XMXA 5DL5A 5T5FA 3SYSA 8PRNA 1ZHTA 2OMFA 1GFPA 4LSEA 2KZ7B 3NSGA 5FVNA 4N59A 1QJ9A 1OSMA 2R4OA 4O3WA 3PQSA 4JCHA 7PRNA 3DA4A 1T16A 3UPGA 4N58A 3AA7A 4RLCA 4D64A 3DWOX 3POQA 2YPVA 3VZUX 4F4BA 4U9CA 2Y0HA 5DL8A 3G7GA 3PGUA 4G76A 5EE2A 3DZMA 4IL6O 3WI4A 2KDYA 3PGSA 4KR8A 4KRAA 3UU2A 2XE2A 3TZGA 4N75A 2W81C 2GE4A 5H2FO 1ZHXA 2Y2XA 3LK3B 3O0EA 1GFNA 1YS5A 2K4TA 4O3XB 2XG6A 3UAQA 4AKRB 1THQA 2AXTO 1Q9GA 4O49A 4UB6O 4AYID 2LFUA 1ZHZA 3AA1A 4AUIA 3VY9X 3SZVA 3LK42 4UB8O 3AAEA 4PR7A 5G39A 3BS0A 4GCSA 1BH3A 1BT9A 3WU2O 4C00A 4C4VB 3DWNA 3LK2B 2Y0LA 4RLBA 2KC0A 5B5EO 1ZHWA 3VE2A 2XE3A 3PF1A 2PORA 2ZLDA 2ERVA 4N74A 3K19A 4RJWA 5DL6A 3QRAA 4AYDC 4BUMX 2R4PA 4D5UA 5IYUA 4AKMA 4C69X 3GP6A 1PHOA 2Y0KA 3AA0A 2JMMA 2JQYA 1GFQA 3A0BO 3A0HO 3AAAB 2F1TA 4FZLA 4GCQA 4LSHA 3AA7B 4FRTA 3V8UA 1ZHYA 4FUVA 5TISO 2J4UP 4O3YA 4GF4A 3JTYA 4FZNA 4Z3TA 2N2MA 3C5OA 2KXPB 2M06A 4G75A 1HXXA 3VE1A 4KR4A 3VZWX 3AA6A 5ADXL 3LK41 3PORA 4D65A 1MM5A 5GV0A 5KAIO 5D5DA 2N2LA 3QRCA 2R8AA 1Q9FA 5PRNA 4O4XA 5G3AA 4FSPA 1MM4A 2KZ7A 4FQEA 2YNKA 5GTIO 2R4LA 2XTQA 2LHFA 2FGRA 3HOEA 4FESA 4LSIA 4E1TA 1IZNA 2XE5A 3AAEB 4AYEC 4AYNA 2WJRA 1PRNA 2FGQX 3RBHA 3A2SX 1BXWA 1GFMA 3T0SA 4K3BA 4O3ZA 3KZIO 4RJXA 5AFUL 4PJ0O 3EMNX 2K0LA 4O4UA 4GHBA 4LSFA 3HOLA 3AA0B 2O4VA 4XNKA 1S5LO 3POXA 4AFKA 2MNHA 2R4NA 4FRXA 4RL9A 4E1SA 1HXUA 2W80C 1QJ8A 4PUXA 3WI5A 4FT6A 2MHLA 2XTRA 4K3CA 5KAFO 1T1LA 2IWWA 3PQUA 3FYXA
chains in the Genus database with same CATH topology
3AA6B 4AZLA 5JDPA 2F1VA 4QQ1A 1E54A 2J1NA 4FSOA 1MPFA 3VY8X 2ZFGA 6PRNA 1QJPA 2Y7SA 1GFOA 1P4TA 2M07A 3AA1B 4B61A 2QTKA 4XNLA 3SYBA 5ADXK 2XE1A 3SY9A 3POUA 1IZNB 3AAAA 3KVDD 3SY7A 1HXTA 5DL7A 4JFBA 3VZTX 3DA3A 3SZDA 4FMSA 1OPFA 2KXPA 2PRNA 3HW9A 4AYMC 5G26A 3HWBA 3LK3A 4AKRA 4FOZA 2ODJA 4FZMA 4GCPA 1H6S1 5AFUK 1G90A 3PRNA 3T24A 2X27X 1ORMA 3LK2A 2XMXA 5DL5A 5T5FA 3SYSA 8PRNA 1ZHTA 2OMFA 1GFPA 4LSEA 2KZ7B 3NSGA 5FVNA 4N59A 1QJ9A 1OSMA 4O3WA 3PQSA 4JCHA 3DA4A 3UPGA 4N58A 3AA7A 4RLCA 4D64A 3POQA 2YPVA 3VZUX 4F4BA 4U9CA 2Y0HA 5DL8A 3G7GA 4G76A 5EE2A 3WI4A 2KDYA 4KR8A 3UU2A 4KRAA 2XE2A 3TZGA 2W81C 2GE4A 1ZHXA 2Y2XA 3LK3B 3O0EA 1GFNA 1YS5A 2K4TA 4O3XB 2XG6A 3UAQA 4AKRB 1THQA 3T20A 1Q9GA 4O49A 4AYID 2LFUA 1ZHZA 3AA1A 4AUIA 3VY9X 3SZVA 3LK42 3AAEA 4GCSA 1BH3A 1BT9A 3LK2B 2Y0LA 4RLBA 2KC0A 1ZHWA 3VE2A 2XE3A 2PORA 2ZLDA 2ERVA 4RJWA 3K19A 5DL6A 4BUMX 3QRAA 4D5UA 5IYUA 4AKMA 3GP6A 1PHOA 2Y0KA 3AA0A 2JMMA 3AAAB 1GFQA 4FZLA 4GCQA 4C69X 2F1TA 4LSHA 3V8UA 3AA7B 4FRTA 1ZHYA 4FUVA 2J4UP 4O3YA 4GF4A 3JTYA 4FZNA 4Z3TA 2N2MA 3C5OA 2KXPB 2M06A 4G75A 1HXXA 3VE1A 4KR4A 3VZWX 3AA6A 5ADXL 3LK41 3PORA 4D65A 1MM5A 5GV0A 5D5DA 2N2LA 3QRCA 1Q9FA 5PRNA 4O4XA 4FSPA 1MM4A 2KZ7A 2YNKA 4LSIA 2XTQA 2LHFA 2FGRA 3HOEA 4FESA 4E1TA 7PRNA 2XE5A 1IZNA 3AAEB 4AYEC 4AYNA 1PRNA 2FGQX 3RBHA 3A2SX 1BXWA 1GFMA 3T0SA 4O3ZA 4RJXA 5AFUL 3EMNX 2K0LA 4O4UA 4GHBA 4LSFA 3HOLA 3AA0B 2O4VA 4XNKA 3POXA 4AFKA 2MNHA 4RL9A 4FRXA 4E1SA 1HXUA 2W80C 1QJ8A 4PUXA 3WI5A 4FT6A 2MHLA 2XTRA 4AYDC 3PQUA 3FYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JDP A;  1E54 A;  2J1N A;  4FSO A;  1MPF A;  3VY8 X;  2ZFG A;  6PRN A;  1GFO A;  2QTK A;  3SYB A;  2XE1 A;  3SY9 A;  3POU A;  3SY7 A;  1HXT A;  5DL7 A;  4JFB A;  3VZT X;  3SZD A;  4FMS A;  1OPF A;  2PRN A;  3HW9 A;  3HWB A;  4FOZ A;  2ODJ A;  4GCP A;  1H6S 1;  3PRN A;  3T24 A;  5DL5 A;  3SYS A;  8PRN A;  2OMF A;  1GFP A;  4LSE A;  3NSG A;  5FVN A;  1OSM A;  3UPG A;  4D64 A;  3POQ A;  3VZU X;  2Y0H A;  5DL8 A;  3WI4 A;  4KR8 A;  3UU2 A;  4KRA A;  2XE2 A;  2Y2X A;  3O0E A;  1GFN A;  3T20 A;  2K4T A;  2XG6 A;  4AUI A;  3VY9 X;  3SZV A;  4GCS A;  1BH3 A;  1BT9 A;  2Y0L A;  2XE3 A;  2POR A;  2ZLD A;  4RJW A;  5DL6 A;  3K19 A;  4D5U A;  4BUM X;  1PHO A;  2Y0K A;  4C69 X;  1GFQ A;  4GCQ A;  4LSH A;  4FRT A;  2J4U P;  3JTY A;  1HXX A;  3VZW X;  4KR4 A;  3POR A;  4D65 A;  5PRN A;  4FSP A;  4LSI A;  7PRN A;  2FGR A;  2XE5 A;  1PRN A;  2FGQ X;  3A2S X;  1GFM A;  3T0S A;  4RJX A;  3EMN X;  4LSF A;  2O4V A;  3POX A;  4FRX A;  1HXU A;  3WI5 A;  4FT6 A;  3FYX A; 
#chains in the Genus database with same CATH topology
 3AA6 B;  4AZL A;  5JDP A;  2F1V A;  3PGR A;  4QQ1 A;  1E54 A;  2J1N A;  4FSO A;  5GTH O;  1MPF A;  3VY8 X;  2R88 A;  2X9K A;  5G38 A;  2ZFG A;  3BRY A;  6PRN A;  1QJP A;  2Y7S A;  1GFO A;  1P4T A;  2M07 A;  3AA1 B;  5E79 O;  2QTK A;  4XNL A;  3SYB A;  4B61 A;  2XE1 A;  5ADX K;  3SY9 A;  3POU A;  1IZN B;  3AAA A;  3KVD D;  2R89 A;  3NJT A;  3SY7 A;  1HXT A;  5DL7 A;  4JFB A;  3BRZ A;  3VZT X;  4CTD A;  3DA3 A;  3SZD A;  3T20 A;  3JCU O;  4FMS A;  1OPF A;  2WJQ A;  2KXP A;  2PRN A;  3HW9 A;  4AYM C;  5G26 A;  3HWB A;  2IWV A;  5B66 O;  3LK3 A;  4AKR A;  2F1C X;  4FOZ A;  2ODJ A;  4FZM A;  4GCP A;  1H6S 1;  5AFU K;  1G90 A;  3PRN A;  2WVP A;  3T24 A;  2X27 X;  1ORM A;  4C4V A;  3LK2 A;  2XMX A;  5DL5 A;  5T5F A;  3SYS A;  8PRN A;  1ZHT A;  2OMF A;  1GFP A;  4LSE A;  2KZ7 B;  3NSG A;  5FVN A;  4N59 A;  1QJ9 A;  1OSM A;  2R4O A;  4O3W A;  3PQS A;  4JCH A;  7PRN A;  3DA4 A;  1T16 A;  3UPG A;  4N58 A;  3AA7 A;  4RLC A;  4D64 A;  3DWO X;  3POQ A;  2YPV A;  3VZU X;  4F4B A;  4U9C A;  2Y0H A;  5DL8 A;  3G7G A;  3PGU A;  4G76 A;  5EE2 A;  3DZM A;  4IL6 O;  3WI4 A;  2KDY A;  3PGS A;  4KR8 A;  4KRA A;  3UU2 A;  2XE2 A;  3TZG A;  4N75 A;  2W81 C;  2GE4 A;  5H2F O;  1ZHX A;  2Y2X A;  3LK3 B;  3O0E A;  1GFN A;  1YS5 A;  2K4T A;  4O3X B;  2XG6 A;  3UAQ A;  4AKR B;  1THQ A;  2AXT O;  1Q9G A;  4O49 A;  4UB6 O;  4AYI D;  2LFU A;  1ZHZ A;  3AA1 A;  4AUI A;  3VY9 X;  3SZV A;  3LK4 2;  4UB8 O;  3AAE A;  4PR7 A;  5G39 A;  3BS0 A;  4GCS A;  1BH3 A;  1BT9 A;  3WU2 O;  4C00 A;  4C4V B;  3DWN A;  3LK2 B;  2Y0L A;  4RLB A;  2KC0 A;  5B5E O;  1ZHW A;  3VE2 A;  2XE3 A;  3PF1 A;  2POR A;  2ZLD A;  2ERV A;  4N74 A;  3K19 A;  4RJW A;  5DL6 A;  3QRA A;  4AYD C;  4BUM X;  2R4P A;  4D5U A;  5IYU A;  4AKM A;  4C69 X;  3GP6 A;  1PHO A;  2Y0K A;  3AA0 A;  2JMM A;  2JQY A;  1GFQ A;  3A0B O;  3A0H O;  3AAA B;  2F1T A;  4FZL A;  4GCQ A;  4LSH A;  3AA7 B;  4FRT A;  3V8U A;  1ZHY A;  4FUV A;  5TIS O;  2J4U P;  4O3Y A;  4GF4 A;  3JTY A;  4FZN A;  4Z3T A;  2N2M A;  3C5O A;  2KXP B;  2M06 A;  4G75 A;  1HXX A;  3VE1 A;  4KR4 A;  3VZW X;  3AA6 A;  5ADX L;  3LK4 1;  3POR A;  4D65 A;  1MM5 A;  5GV0 A;  5KAI O;  5D5D A;  2N2L A;  3QRC A;  2R8A A;  1Q9F A;  5PRN A;  4O4X A;  5G3A A;  4FSP A;  1MM4 A;  2KZ7 A;  4FQE A;  2YNK A;  5GTI O;  2R4L A;  2XTQ A;  2LHF A;  2FGR A;  3HOE A;  4FES A;  4LSI A;  4E1T A;  1IZN A;  2XE5 A;  3AAE B;  4AYE C;  4AYN A;  2WJR A;  1PRN A;  2FGQ X;  3RBH A;  3A2S X;  1BXW A;  1GFM A;  3T0S A;  4K3B A;  4O3Z A;  3KZI O;  4RJX A;  5AFU L;  4PJ0 O;  3EMN X;  2K0L A;  4O4U A;  4GHB A;  4LSF A;  3HOL A;  3AA0 B;  2O4V A;  4XNK A;  1S5L O;  3POX A;  4AFK A;  2MNH A;  2R4N A;  4FRX A;  4RL9 A;  4E1S A;  1HXU A;  2W80 C;  1QJ8 A;  4PUX A;  3WI5 A;  4FT6 A;  2MHL A;  2XTR A;  4K3C A;  5KAF O;  1T1L A;  2IWW A;  3PQU A;  3FYX A; 
#chains in the Genus database with same CATH homology
 3AA6 B;  4AZL A;  5JDP A;  2F1V A;  4QQ1 A;  1E54 A;  2J1N A;  4FSO A;  1MPF A;  3VY8 X;  2ZFG A;  6PRN A;  1QJP A;  2Y7S A;  1GFO A;  1P4T A;  2M07 A;  3AA1 B;  4B61 A;  2QTK A;  4XNL A;  3SYB A;  5ADX K;  2XE1 A;  3SY9 A;  3POU A;  1IZN B;  3AAA A;  3KVD D;  3SY7 A;  1HXT A;  5DL7 A;  4JFB A;  3VZT X;  3DA3 A;  3SZD A;  4FMS A;  1OPF A;  2KXP A;  2PRN A;  3HW9 A;  4AYM C;  5G26 A;  3HWB A;  3LK3 A;  4AKR A;  4FOZ A;  2ODJ A;  4FZM A;  4GCP A;  1H6S 1;  5AFU K;  1G90 A;  3PRN A;  3T24 A;  2X27 X;  1ORM A;  3LK2 A;  2XMX A;  5DL5 A;  5T5F A;  3SYS A;  8PRN A;  1ZHT A;  2OMF A;  1GFP A;  4LSE A;  2KZ7 B;  3NSG A;  5FVN A;  4N59 A;  1QJ9 A;  1OSM A;  4O3W A;  3PQS A;  4JCH A;  3DA4 A;  3UPG A;  4N58 A;  3AA7 A;  4RLC A;  4D64 A;  3POQ A;  2YPV A;  3VZU X;  4F4B A;  4U9C A;  2Y0H A;  5DL8 A;  3G7G A;  4G76 A;  5EE2 A;  3WI4 A;  2KDY A;  4KR8 A;  3UU2 A;  4KRA A;  2XE2 A;  3TZG A;  2W81 C;  2GE4 A;  1ZHX A;  2Y2X A;  3LK3 B;  3O0E A;  1GFN A;  1YS5 A;  2K4T A;  4O3X B;  2XG6 A;  3UAQ A;  4AKR B;  1THQ A;  3T20 A;  1Q9G A;  4O49 A;  4AYI D;  2LFU A;  1ZHZ A;  3AA1 A;  4AUI A;  3VY9 X;  3SZV A;  3LK4 2;  3AAE A;  4GCS A;  1BH3 A;  1BT9 A;  3LK2 B;  2Y0L A;  4RLB A;  2KC0 A;  1ZHW A;  3VE2 A;  2XE3 A;  2POR A;  2ZLD A;  2ERV A;  4RJW A;  3K19 A;  5DL6 A;  4BUM X;  3QRA A;  4D5U A;  5IYU A;  4AKM A;  3GP6 A;  1PHO A;  2Y0K A;  3AA0 A;  2JMM A;  3AAA B;  1GFQ A;  4FZL A;  4GCQ A;  4C69 X;  2F1T A;  4LSH A;  3V8U A;  3AA7 B;  4FRT A;  1ZHY A;  4FUV A;  2J4U P;  4O3Y A;  4GF4 A;  3JTY A;  4FZN A;  4Z3T A;  2N2M A;  3C5O A;  2KXP B;  2M06 A;  4G75 A;  1HXX A;  3VE1 A;  4KR4 A;  3VZW X;  3AA6 A;  5ADX L;  3LK4 1;  3POR A;  4D65 A;  1MM5 A;  5GV0 A;  5D5D A;  2N2L A;  3QRC A;  1Q9F A;  5PRN A;  4O4X A;  4FSP A;  1MM4 A;  2KZ7 A;  2YNK A;  4LSI A;  2XTQ A;  2LHF A;  2FGR A;  3HOE A;  4FES A;  4E1T A;  7PRN A;  2XE5 A;  1IZN A;  3AAE B;  4AYE C;  4AYN A;  1PRN A;  2FGQ X;  3RBH A;  3A2S X;  1BXW A;  1GFM A;  3T0S A;  4O3Z A;  4RJX A;  5AFU L;  3EMN X;  2K0L A;  4O4U A;  4GHB A;  4LSF A;  3HOL A;  3AA0 B;  2O4V A;  4XNK A;  3POX A;  4AFK A;  2MNH A;  4RL9 A;  4FRX A;  4E1S A;  1HXU A;  2W80 C;  1QJ8 A;  4PUX A;  3WI5 A;  4FT6 A;  2MHL A;  2XTR A;  4AYD C;  3PQU A;  3FYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...