2ZLDA

Structure of ompf co-crystallized with t83
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
340
structure length
339
Chain Sequence
b'AEIYNKDGNKVDLYGKAVGLHYFSKGGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein F
publication title Crystal structures of the OmpF porin: function in a colicin translocon.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 95
structure length 339
sequence length 340
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2zldA00
2Y0HA 1PHOA 5PRNA 3POQA 4FSPA 3WI4A 2Y0LA 3WI5A 2QTKA 2FGQX 3HWBA 3POXA 1H6S1 3A2SX 3SYSA 3FYXA 1MPFA 3T0SA 1OPFA 4GCSA 2ODJA 3T24A 3SZDA 4C69X 1OSMA 4FSOA 5DL7A 2XE1A 3PRNA 5DL5A 3T20A 4LSFA 2XE3A 8PRNA 2XG6A 3VZWX 3NSGA 2XE2A 4D64A 3UPGA 4D5UA 4FOZA 5JDPA 2XE5A 1PRNA 1GFOA 2ZLDA 2J4UP 2Y0KA 2OMFA 4KR8A 2Y2XA 4FT6A 4FRXA 4D65A 3JTYA 1GFQA 4LSHA 4FMSA 4BUMX 4AUIA 1GFNA 3SZVA 4RJXA 2K4TA 1HXUA 3VY9X 5FVNA 3VZTX 1HXTA 1GFMA 4KRAA 4LSEA 5DL8A 3SYBA 1E54A 1HXXA 4RJWA 1BH3A 2PORA 3SY9A 2O4VA 3UU2A 3POUA 3O0EA 7PRNA 4GCPA 3SY7A 2FGRA 5DL6A 2ZFGA 6PRNA 2J1NA 1GFPA 3PORA 4JFBA 4GCQA 1BT9A 3EMNX 3VZUX 4LSIA 3VY8X 2PRNA 4KR4A 3K19A 3HW9A 4FRTA
chains in the Genus database with same CATH superfamily
1T16A 4N58A 4JCHA 4PJ0O 2Y0HA 1PHOA 4RL9A 4AFKA 5PRNA 3POQA 4FSPA 3WI4A 4C4VB 4F4BA 3NJTA 2Y0LA 2YNKA 4FQEA 2WVPA 3WI5A 1Q9FA 3LK2A 2QTKA 2YPVA 5AFUK 4N74A 3AAEB 3LK41 2FGQX 1T1LA 2X9KA 3HWBA 3C5OA 5D5DA 2MNHA 3DA4A 3KZIO 5G38A 3POXA 5G39A 1H6S1 1ORMA 1QJPA 3A2SX 3VE2A 3DA3A 3PGUA 4O49A 3SYSA 5ADXK 3AA7B 3AA0B 4AYID 4AZLA 2KZ7A 3FYXA 1ZHYA 3PGRA 2XTQA 4AYMC 1MPFA 3KVDD 1OPFA 4FZMA 3T0SA 2R4LA 3LK3A 2F1CX 4GHBA 1QJ8A 4U9CA 1IZNA 4GCSA 3PQSA 2ODJA 4AKRB 3T24A 3AA6B 3HOEA 2R4NA 2KXPB 3SZDA 3PGSA 4C69X 1OSMA 4FSOA 3AA1B 4O4UA 2XE1A 5DL7A 4C00A 4Z3TA 2XTRA 1ZHWA 2R8AA 3DWNA 4C4VA 4E1SA 3PRNA 3TZGA 2N2LA 5DL5A 5GTHO 3DWOX 4RLCA 3T20A 3AAEA 4AYNA 4LSFA 5H2FO 2XE3A 5E79O 5GTIO 5IYUA 8PRNA 4AYDC 4IL6O 3PF1A 2XG6A 1P4TA 2M07A 3VZWX 5AFUL 5GV0A 4PR7A 3AA0A 2GE4A 3NSGA 2R4PA 2XE2A 2JMMA 3AAAB 4QQ1A 3BRYA 4N59A 4GF4A 2W80C 4O3YA 4D64A 1MM5A 4D5UA 3UPGA 4FOZA 3HOLA 5JDPA 2XE5A 5G3AA 5KAFO 1PRNA 1GFOA 2ZLDA 4AKRA 1ZHXA 4AYEC 3PQUA 3AA6A 3UAQA 2J4UP 2Y0KA 2OMFA 2KXPA 2W81C 1YS5A 4FZLA 5TISO 3AA1A 3BRZA 3BS0A 4KR8A 2Y7SA 2R4OA 4FZNA 2Y2XA 4FT6A 3A0BO 4FRXA 3V8UA 5T5FA 5B66O 4D65A 3JTYA 1GFQA 1ZHZA 2KZ7B 3RBHA 4K3BA 2R88A 4LSHA 1BXWA 2X27X 4FMSA 4BUMX 4AUIA 1GFNA 4UB6O 4RJXA 3SZVA 5B5EO 2K4TA 2KC0A 4K3CA 1HXUA 4FESA 3VY9X 3AA7A 5FVNA 3VZTX 2K0LA 2ERVA 2WJQA 1MM4A 1ZHTA 1Q9GA 4XNLA 1HXTA 2F1TA 4E1TA 1GFMA 2R89A 2XMXA 3QRCA 4G76A 4PUXA 5ADXL 1THQA 4KRAA 2JQYA 4LSEA 5DL8A 4O3XB 3LK42 2IWVA 3GP6A 4O3WA 1E54A 4XNKA 3SYBA 3LK2B 3VE1A 1HXXA 3QRAA 4B61A 1S5LO 1G90A 4RJWA 2AXTO 1BH3A 2F1VA 4N75A 2PORA 2N2MA 3SY9A 2WJRA 5EE2A 2LHFA 2O4VA 4AKMA 4G75A 2MHLA 3JCUO 4CTDA 4UB8O 4FUVA 1QJ9A 4O4XA 3POUA 3O0EA 3UU2A 5KAIO 7PRNA 2LFUA 4GCPA 4RLBA 3SY7A 2FGRA 5DL6A 2M06A 2ZFGA 3G7GA 2J1NA 1GFPA 3LK3B 3PORA 4JFBA 6PRNA 3DZMA 4GCQA 3WU2O 1BT9A 1IZNB 3EMNX 4LSIA 5G26A 3VY8X 3VZUX 2PRNA 4KR4A 3A0HO 4O3ZA 3AAAA 3K19A 3HW9A 2IWWA 2KDYA 4FRTA
chains in the Genus database with same CATH topology
4N58A 4JCHA 4AFKA 2Y0HA 1PHOA 4RL9A 5PRNA 3POQA 4FSPA 3WI4A 4F4BA 2Y0LA 2YNKA 5AFUK 3WI5A 1Q9FA 3LK2A 2QTKA 2YPVA 3AAEB 3LK41 2FGQX 3HWBA 3C5OA 5D5DA 2MNHA 3DA4A 3POXA 1H6S1 1ORMA 1QJPA 3A2SX 3VE2A 3DA3A 3SYSA 4O49A 5ADXK 3AA7B 3AA0B 4AYID 4AZLA 2KZ7A 3FYXA 1ZHYA 4AYMC 2XTQA 1MPFA 3KVDD 1OPFA 4FZMA 3T0SA 3LK3A 4GHBA 4U9CA 1QJ8A 1IZNA 4GCSA 3PQSA 2ODJA 4AKRB 3T24A 3AA6B 3HOEA 3SZDA 2KXPB 4C69X 1G90A 1OSMA 4FSOA 3AA1B 4O4UA 2XE1A 5DL7A 4Z3TA 2XTRA 1ZHWA 4E1SA 3PRNA 3TZGA 2N2LA 5DL5A 4RLCA 3T20A 3AAEA 4AYNA 4LSFA 5IYUA 2XE3A 8PRNA 4AYDC 2XG6A 1P4TA 2M07A 3VZWX 5AFUL 5GV0A 3AA0A 2GE4A 3NSGA 2XE2A 2JMMA 3AAAB 4QQ1A 4N59A 4GF4A 2W80C 4O3YA 4D64A 1MM5A 4D5UA 3UPGA 4FOZA 3HOLA 5JDPA 2XE5A 4AKRA 1PRNA 1GFOA 2ZLDA 4AYEC 1ZHXA 2J4UP 3PQUA 3AA6A 3UAQA 2Y0KA 2OMFA 2KXPA 2W81C 1YS5A 4FZLA 3AA1A 4KR8A 2Y7SA 4FZNA 2Y2XA 4FT6A 4FRXA 3V8UA 5T5FA 4D65A 3JTYA 1GFQA 1ZHZA 2KZ7B 3RBHA 4LSHA 1BXWA 2X27X 4FMSA 4BUMX 4AUIA 1GFNA 3SZVA 4RJXA 2K4TA 2KC0A 1HXUA 4FESA 3VY9X 3AA7A 5FVNA 3VZTX 2K0LA 2ERVA 1MM4A 1ZHTA 1Q9GA 4XNLA 1HXTA 2F1TA 4E1TA 1GFMA 2XMXA 3QRCA 4G76A 4PUXA 5ADXL 1THQA 4KRAA 4LSEA 5DL8A 4O3XB 3LK42 3GP6A 4O3WA 4XNKA 1E54A 3SYBA 3VE1A 3LK2B 1HXXA 3QRAA 4B61A 4RJWA 1BH3A 2F1VA 2PORA 2N2MA 3SY9A 5EE2A 4AKMA 2LHFA 2O4VA 4G75A 2MHLA 4FUVA 1QJ9A 4O4XA 3POUA 3O0EA 3UU2A 7PRNA 2LFUA 4GCPA 4RLBA 3SY7A 2FGRA 5DL6A 2M06A 2ZFGA 3G7GA 2J1NA 1GFPA 3LK3B 3PORA 4JFBA 6PRNA 4GCQA 1BT9A 1IZNB 3EMNX 4LSIA 5G26A 3VY8X 3VZUX 2PRNA 4KR4A 4O3ZA 3AAAA 3K19A 3HW9A 2KDYA 4FRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0H A;  1PHO A;  5PRN A;  3POQ A;  4FSP A;  3WI4 A;  2Y0L A;  3WI5 A;  2QTK A;  2FGQ X;  3HWB A;  3POX A;  1H6S 1;  3A2S X;  3SYS A;  3FYX A;  1MPF A;  3T0S A;  1OPF A;  4GCS A;  2ODJ A;  3T24 A;  3SZD A;  4C69 X;  1OSM A;  4FSO A;  5DL7 A;  2XE1 A;  3PRN A;  5DL5 A;  3T20 A;  4LSF A;  2XE3 A;  8PRN A;  2XG6 A;  3VZW X;  3NSG A;  2XE2 A;  4D64 A;  3UPG A;  4D5U A;  4FOZ A;  5JDP A;  2XE5 A;  1PRN A;  1GFO A;  2ZLD A;  2J4U P;  2Y0K A;  2OMF A;  4KR8 A;  2Y2X A;  4FT6 A;  4FRX A;  4D65 A;  3JTY A;  1GFQ A;  4LSH A;  4FMS A;  4BUM X;  4AUI A;  1GFN A;  3SZV A;  4RJX A;  2K4T A;  1HXU A;  3VY9 X;  5FVN A;  3VZT X;  1HXT A;  1GFM A;  4KRA A;  4LSE A;  5DL8 A;  3SYB A;  1E54 A;  1HXX A;  4RJW A;  1BH3 A;  2POR A;  3SY9 A;  2O4V A;  3UU2 A;  3POU A;  3O0E A;  7PRN A;  4GCP A;  3SY7 A;  2FGR A;  5DL6 A;  2ZFG A;  6PRN A;  2J1N A;  1GFP A;  3POR A;  4JFB A;  4GCQ A;  1BT9 A;  3EMN X;  3VZU X;  4LSI A;  3VY8 X;  2PRN A;  4KR4 A;  3K19 A;  3HW9 A;  4FRT A; 
#chains in the Genus database with same CATH topology
 1T16 A;  4N58 A;  4JCH A;  4PJ0 O;  2Y0H A;  1PHO A;  4RL9 A;  4AFK A;  5PRN A;  3POQ A;  4FSP A;  3WI4 A;  4C4V B;  4F4B A;  3NJT A;  2Y0L A;  2YNK A;  4FQE A;  2WVP A;  3WI5 A;  1Q9F A;  3LK2 A;  2QTK A;  2YPV A;  5AFU K;  4N74 A;  3AAE B;  3LK4 1;  2FGQ X;  1T1L A;  2X9K A;  3HWB A;  3C5O A;  5D5D A;  2MNH A;  3DA4 A;  3KZI O;  5G38 A;  3POX A;  5G39 A;  1H6S 1;  1ORM A;  1QJP A;  3A2S X;  3VE2 A;  3DA3 A;  3PGU A;  4O49 A;  3SYS A;  5ADX K;  3AA7 B;  3AA0 B;  4AYI D;  4AZL A;  2KZ7 A;  3FYX A;  1ZHY A;  3PGR A;  2XTQ A;  4AYM C;  1MPF A;  3KVD D;  1OPF A;  4FZM A;  3T0S A;  2R4L A;  3LK3 A;  2F1C X;  4GHB A;  1QJ8 A;  4U9C A;  1IZN A;  4GCS A;  3PQS A;  2ODJ A;  4AKR B;  3T24 A;  3AA6 B;  3HOE A;  2R4N A;  2KXP B;  3SZD A;  3PGS A;  4C69 X;  1OSM A;  4FSO A;  3AA1 B;  4O4U A;  2XE1 A;  5DL7 A;  4C00 A;  4Z3T A;  2XTR A;  1ZHW A;  2R8A A;  3DWN A;  4C4V A;  4E1S A;  3PRN A;  3TZG A;  2N2L A;  5DL5 A;  5GTH O;  3DWO X;  4RLC A;  3T20 A;  3AAE A;  4AYN A;  4LSF A;  5H2F O;  2XE3 A;  5E79 O;  5GTI O;  5IYU A;  8PRN A;  4AYD C;  4IL6 O;  3PF1 A;  2XG6 A;  1P4T A;  2M07 A;  3VZW X;  5AFU L;  5GV0 A;  4PR7 A;  3AA0 A;  2GE4 A;  3NSG A;  2R4P A;  2XE2 A;  2JMM A;  3AAA B;  4QQ1 A;  3BRY A;  4N59 A;  4GF4 A;  2W80 C;  4O3Y A;  4D64 A;  1MM5 A;  4D5U A;  3UPG A;  4FOZ A;  3HOL A;  5JDP A;  2XE5 A;  5G3A A;  5KAF O;  1PRN A;  1GFO A;  2ZLD A;  4AKR A;  1ZHX A;  4AYE C;  3PQU A;  3AA6 A;  3UAQ A;  2J4U P;  2Y0K A;  2OMF A;  2KXP A;  2W81 C;  1YS5 A;  4FZL A;  5TIS O;  3AA1 A;  3BRZ A;  3BS0 A;  4KR8 A;  2Y7S A;  2R4O A;  4FZN A;  2Y2X A;  4FT6 A;  3A0B O;  4FRX A;  3V8U A;  5T5F A;  5B66 O;  4D65 A;  3JTY A;  1GFQ A;  1ZHZ A;  2KZ7 B;  3RBH A;  4K3B A;  2R88 A;  4LSH A;  1BXW A;  2X27 X;  4FMS A;  4BUM X;  4AUI A;  1GFN A;  4UB6 O;  4RJX A;  3SZV A;  5B5E O;  2K4T A;  2KC0 A;  4K3C A;  1HXU A;  4FES A;  3VY9 X;  3AA7 A;  5FVN A;  3VZT X;  2K0L A;  2ERV A;  2WJQ A;  1MM4 A;  1ZHT A;  1Q9G A;  4XNL A;  1HXT A;  2F1T A;  4E1T A;  1GFM A;  2R89 A;  2XMX A;  3QRC A;  4G76 A;  4PUX A;  5ADX L;  1THQ A;  4KRA A;  2JQY A;  4LSE A;  5DL8 A;  4O3X B;  3LK4 2;  2IWV A;  3GP6 A;  4O3W A;  1E54 A;  4XNK A;  3SYB A;  3LK2 B;  3VE1 A;  1HXX A;  3QRA A;  4B61 A;  1S5L O;  1G90 A;  4RJW A;  2AXT O;  1BH3 A;  2F1V A;  4N75 A;  2POR A;  2N2M A;  3SY9 A;  2WJR A;  5EE2 A;  2LHF A;  2O4V A;  4AKM A;  4G75 A;  2MHL A;  3JCU O;  4CTD A;  4UB8 O;  4FUV A;  1QJ9 A;  4O4X A;  3POU A;  3O0E A;  3UU2 A;  5KAI O;  7PRN A;  2LFU A;  4GCP A;  4RLB A;  3SY7 A;  2FGR A;  5DL6 A;  2M06 A;  2ZFG A;  3G7G A;  2J1N A;  1GFP A;  3LK3 B;  3POR A;  4JFB A;  6PRN A;  3DZM A;  4GCQ A;  3WU2 O;  1BT9 A;  1IZN B;  3EMN X;  4LSI A;  5G26 A;  3VY8 X;  3VZU X;  2PRN A;  4KR4 A;  3A0H O;  4O3Z A;  3AAA A;  3K19 A;  3HW9 A;  2IWW A;  2KDY A;  4FRT A; 
#chains in the Genus database with same CATH homology
 4N58 A;  4JCH A;  4AFK A;  2Y0H A;  1PHO A;  4RL9 A;  5PRN A;  3POQ A;  4FSP A;  3WI4 A;  4F4B A;  2Y0L A;  2YNK A;  5AFU K;  3WI5 A;  1Q9F A;  3LK2 A;  2QTK A;  2YPV A;  3AAE B;  3LK4 1;  2FGQ X;  3HWB A;  3C5O A;  5D5D A;  2MNH A;  3DA4 A;  3POX A;  1H6S 1;  1ORM A;  1QJP A;  3A2S X;  3VE2 A;  3DA3 A;  3SYS A;  4O49 A;  5ADX K;  3AA7 B;  3AA0 B;  4AYI D;  4AZL A;  2KZ7 A;  3FYX A;  1ZHY A;  4AYM C;  2XTQ A;  1MPF A;  3KVD D;  1OPF A;  4FZM A;  3T0S A;  3LK3 A;  4GHB A;  4U9C A;  1QJ8 A;  1IZN A;  4GCS A;  3PQS A;  2ODJ A;  4AKR B;  3T24 A;  3AA6 B;  3HOE A;  3SZD A;  2KXP B;  4C69 X;  1G90 A;  1OSM A;  4FSO A;  3AA1 B;  4O4U A;  2XE1 A;  5DL7 A;  4Z3T A;  2XTR A;  1ZHW A;  4E1S A;  3PRN A;  3TZG A;  2N2L A;  5DL5 A;  4RLC A;  3T20 A;  3AAE A;  4AYN A;  4LSF A;  5IYU A;  2XE3 A;  8PRN A;  4AYD C;  2XG6 A;  1P4T A;  2M07 A;  3VZW X;  5AFU L;  5GV0 A;  3AA0 A;  2GE4 A;  3NSG A;  2XE2 A;  2JMM A;  3AAA B;  4QQ1 A;  4N59 A;  4GF4 A;  2W80 C;  4O3Y A;  4D64 A;  1MM5 A;  4D5U A;  3UPG A;  4FOZ A;  3HOL A;  5JDP A;  2XE5 A;  4AKR A;  1PRN A;  1GFO A;  2ZLD A;  4AYE C;  1ZHX A;  2J4U P;  3PQU A;  3AA6 A;  3UAQ A;  2Y0K A;  2OMF A;  2KXP A;  2W81 C;  1YS5 A;  4FZL A;  3AA1 A;  4KR8 A;  2Y7S A;  4FZN A;  2Y2X A;  4FT6 A;  4FRX A;  3V8U A;  5T5F A;  4D65 A;  3JTY A;  1GFQ A;  1ZHZ A;  2KZ7 B;  3RBH A;  4LSH A;  1BXW A;  2X27 X;  4FMS A;  4BUM X;  4AUI A;  1GFN A;  3SZV A;  4RJX A;  2K4T A;  2KC0 A;  1HXU A;  4FES A;  3VY9 X;  3AA7 A;  5FVN A;  3VZT X;  2K0L A;  2ERV A;  1MM4 A;  1ZHT A;  1Q9G A;  4XNL A;  1HXT A;  2F1T A;  4E1T A;  1GFM A;  2XMX A;  3QRC A;  4G76 A;  4PUX A;  5ADX L;  1THQ A;  4KRA A;  4LSE A;  5DL8 A;  4O3X B;  3LK4 2;  3GP6 A;  4O3W A;  4XNK A;  1E54 A;  3SYB A;  3VE1 A;  3LK2 B;  1HXX A;  3QRA A;  4B61 A;  4RJW A;  1BH3 A;  2F1V A;  2POR A;  2N2M A;  3SY9 A;  5EE2 A;  4AKM A;  2LHF A;  2O4V A;  4G75 A;  2MHL A;  4FUV A;  1QJ9 A;  4O4X A;  3POU A;  3O0E A;  3UU2 A;  7PRN A;  2LFU A;  4GCP A;  4RLB A;  3SY7 A;  2FGR A;  5DL6 A;  2M06 A;  2ZFG A;  3G7G A;  2J1N A;  1GFP A;  3LK3 B;  3POR A;  4JFB A;  6PRN A;  4GCQ A;  1BT9 A;  1IZN B;  3EMN X;  4LSI A;  5G26 A;  3VY8 X;  3VZU X;  2PRN A;  4KR4 A;  4O3Z A;  3AAA A;  3K19 A;  3HW9 A;  2KDY A;  4FRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...