2KDYA

Nmr structure of lp2086-b01
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
261
structure length
261
Chain Sequence
MGSSGGGGSGGGGVTADIGTGLADALTAPLDHKDKGLKSLTLEDSISQNGTLTLSAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTALQTEQEQDPEHSEKMVAKRRFRIGDIAGEHTSFDKLPKDVMATYRGTAFGSDDAGGKLTYTIDFAAKQGHGKIEHLKSPELNVDLAVAYIKPDEKHHAVISGSVLYNQDEKGSYSLGIFGEKAQEVAGSAEVETANGIHHIGLAAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Factor H binding protein variant B01_001
publication title Structural Basis for the Immunogenic Properties of the Meningococcal Vaccine Candidate LP2086.
pubmed doi rcsb
source organism Neisseria meningitidis
total genus 32
structure length 261
sequence length 261
ec nomenclature
pdb deposition date 2009-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2kdyA02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2kdyA01
2W80C 3HOLA 2KC0A 3PQSA 3PQUA 4Z3TA 3HOEA 1YS5A 4AYMC 4O3XB 5T5FA 2W81C 2Y7SA 2KDYA 4AYNA 2YPVA 5EE2A 4O49A 4O4XA 3VE1A 3VE2A 3KVDD 3UAQA 4AYDC 4AYID 4O3WA 4QQ1A 3V8UA 4AYEC 4O3YA 4O3ZA 2LFUA 4O4UA 4U9CA
chains in the Genus database with same CATH superfamily
4N6RA 5AYUH 4G9FD 1EUUA 5GS2H 5JW5B 2F53D 4OD2B 3BFWA 2BIHA 3PL6D 3QJXA 4KTEH 4E0RA 3MRGA 1DBJL 4YBQC 4GG6F 4BXVA 1ZHNA 5FS5A 2PXYD 2W0FA 1I9IH 2WP3O 4HJGA 3N41F 3ARQA 1MI5B 4FZEL 4JN2A 4OM0L 2BY1A 1NZRA 4YSUA 4U1KA 4AQEA 3MX0A 3GRWA 3T3MF 4AYFA 35C8H 1IFHL 3HN5A 4P9MH 2D8KA 3NIGF 1OW0A 3TIEA 2WVVB 3ISWA 4LMQE 4PJAE 1X5AA 3O4LE 4LFHG 4MA7H 3UIYA 3LEYH 2XYBA 4OW6A 2D0GA 1V54B 2M1KA 4XCFH 4IKKA 3B83A 5HGHA 5B7EA 1R9FA 1ITBB 2NX5B 1OSPL 1KYFA 1NIDA 4PWIA 4YGAB 4XB3A 3TFBA 4ABVA 2R7EB 2FX8H 4HCFA 1ASPA 4GW5A 3BT0A 4N5EC 4U4BA 1S9VA 3VG9B 4XTRC 1F3DH 2PYEE 1KIQB 4PREB 3MRMA 1ID5I 2HAZA 3OKKB 5CZVH 3DXAE 4HWBH 3AUVA 4NM4H 3UTTE 2JELL 1PGRB 4XX5A 1F8TL 1U2YA 4G8FA 4GG6E 3T65B 2I5YH 2H41A 1TKWB 4P9HH 3PPSA 2LTQB 3HB3D 3QVAA 4KHTL 4TNVK 4QO1A 1OP5H 4BH8A 4PJHE 5IV2A 4F7EA 3P0YH 4PB9L 5G38A 3PDOB 4XMKL 3W81A 3WY1A 1FFRA 2YNKA 2E6JA 3AQZA 2ORBL 1AXTL 4YHOL 3MA9L 3DYMA 5LGKA 3NIGE 1XF1A 1IARB 1X5LA 5T1MB 5KVGH 3BN9D 3NZUA 4FMSA 1CN4A 1FFNB 3F7VA 1IEAB 1R3HB 1MAJA 3EJJX 3IJSA 4AC4A 1F58L 1W72A 4W1TA 1AS7A 1NKOA 2YLHA 4L2YA 5DA4A 5AW8B 2HT4C 3FTGB 1NFIA 3SZKC 5E24E 1E28B 1KOAA 4GSQA 7PAZA 4HQQH 1NFDF 2CJUH 3F12A 1OXYA 1QJPA 2IPUK 4LIQE 3D8MA 3QRCA 2FEJA 1II4E 2WYTA 1WWCA 2XLLA 3GMMB 1HCVA 1UWGL 5GJSH 4D94A 3FN0H 5D7IA 2B5IB 3RI5F 1TJHL 2X53A 4PG9A 2UXGA 5F6HI 4M62L 3RB7A 5DZPA 4JN1H 1OCOB 1E5BA 1KGYE 4LSEA 1TLKA 5G39A 2CR0A 4LQ1A 4RAUB 3TBVB 3TL5A 1WFUA 3SOBL 3ZDWA 2IIJA 1OGAB 3EYQD 3MZTA 4H8HA 4UZSA 2RACA 3LXCA 1AJ7L 5IQ9B 2AKRB 1AC6A 3ZKMC 3D50A 3PFQA 3Q1SH 4XAWH 1RIHH 1JD9A 2BVOB 4JLRA 2R0KL 4A7VA 1YN6B 3HMXA 1Y7VA 3PGDA 3DV4A 3C5OA 5KJ4A 3GS4A 5F8RC 5E2UL 4F27A 4D8PB 1I8MB 1QP1A 5B1JA 4B9CA 1P2CB 3FYXA 2HTLD 1CYGA 2ZSVB 2FJGA 1IGMH 4JFFA 1FGNL 2NY5L 1BZEA 1KJ2B 4G5AA 2PCXA 3L3OA 2C9UA 4ODHL 2GSGA 2ICWJ 4LSTH 5ID1A 1XF4A 4XMUA 1Q9KB 1QLFA 2XRAH 4NZUH 4PUBH 4MJ5B 2XXCB 1J1OL 1BT9A 4RNRB 5KVDH 3GSQA 3BGMA 3F3HA 1NPNA 1CR9H 3VJ6B 3ABZA 1WAPA 4O3XB 2D7OA 3R0NA 1K5NA 3OMNB 1EZSA 5L2JB 2QT6A 1XL4A 2WM0A 3WSQH 3NUKA 5C7XH 3HNSL 4CMHC 4CSZA 4FQXA 1JPFA 3SDXF 1JUFA 3SGJA 1HL4A 5BUAA 1MJ7H 3VH8G 3KPTA 1KC5H 1ZHKB 5J9PB 4EF3A 5DJDA 4HBCH 1FZKA 3FO1B 4PV1C 5A2BA 2OMVA 4BQ8A 2VERN 2WBKA 3BVWA 4IDLA 1B4JH 4GKNB 2JQYA 4UTBL 1N9PA 2C9AA 1T2XA 2QTKA 4AIOA 3EW3B 3PHOA 3EFDL 3ZKXB 3ZX1A 4XXDA 1CIUA 1PG7X 3IDMB 2MNWA 1NGZA 1EV2E 3GMRB 3ISYA 3BGFB 5CIPA 1BAWA 3AWEA 3VWKB 5MHSE 2XQ0A 4GMTL 2YOCA 5CP3H 4AKRB 4R3SB 4RWYL 3V95A 4U3SA 1ZPUA 2GBTA 4Z18A 2Q8BH 1FBIH 3UIZA 1YEHL 2XETA 4J4PA 4WWKD 5T1DL 3D30A 4I8DA 4J3SA 1DCLA 1A6AB 4BWUA 2PWGA 3NRFA 1FNEA 5FO9A 3UG3A 2DW5A 1M7DB 5JW3H 5IR1A 1FFTB 1ZHBA 3CZGA 5JLZA 3BWZA 1UXSA 5C09D 1KG0A 3CSBA 5GXBB 3KJ6H 1GZQA 5GGTL 1OGPA 2HJKB 4H25A 1F00I 1L5GB 1D5RA 2OXHA 3K5SA 4U7SA 1N2RA 1PU0A 3VZWX 2QHRH 3VG0L 1CBJA 1S5IL 4LVOC 1PKQA 5F88A 3BVVA 2AQ2A 1D5MA 1NC2B 3TYFA 4NKMA 5DHYA 2PWHA 5EZJA 4B5ZA 1KEGL 1DVFA 3WLBA 3H4FA 4M5ZL 3OLIA 4NNXB 3L3HA 4UB0L 1GRWA 3X11A 1EUTA 1AZCA 1QWHA 1WP6A 5EZOL 3OKNA 4BZ1H 2XQYG 15C8L 3L5HA 5HI4C 3NESA 4OBSA 2UWEF 1A4KB 5FWQA 1RIVH 4QRRB 4YNYA 1PTZA 3ZU8A 2Y1VA 2APVA 4NQQA 2OCCB 4LP4A 3GO1H 2L3BA 3GBNL 3KCPB 1WTLA 4LSRH 4OI9A 4XHQA 1A66A 3ARDB 4P59L 2VC2L 3KEDA 5C2BL 3MR9B 1F3JA 1WAAF 4RZCB 1P4LA 2D7TL 5JQ6L 4BIKA 2EZ0D 4G6AC 3FU6A 4PJXB 3CDYA 2BMKB 5FYLH 2YSSB 5KVFL 4B97A 5FECB 2FQGA 5FYJU 3QQ9C 1IBFA 2X4UB 4KUCD 3IU3A 4LDEB 3K1DA 2PO6D 4MCNA 3G04A 4OD1H 1RSFA 3D4GA 3FN9A 4TN9A 4G3YH 3RBHA 1HSAA 3US9A 1H9VA 2GSIB 2N0KA 5I1CH 5D71H 2O5YH 4IKNA 1G7IB 2ICWB 1G4MA 2IPKA 2J1YA 4JFEE 4APQD 4OGYL 5LCVL 1T80A 3BQUA 3EJUA 2R1XA 3LDBB 4H88L 3M7OA 1C08A 4OCRL 5F0MB 2UWEE 3Q2VA 1LILA 3G9AB 4DPBX 5CN2A 5IBTH 5HGAB 4L4TD 1L7IH 1BBDH 4AH2B 5J6HB 2VQTA 2OMFA 3KPNA 4WEMB 3MRHB 1BQSA 2NSMA 5C6TH 1BMGA 1ZVYA 2QPSA 2RD0A 6TAAA 1RJCA 2OV0A 1JWSB 5HDQH 1CGSH 1F1DA 1QG3A 3PWPB 1BREA 1FO0L 1J8HB 4QRPD 4G43B 4A04A 4DVRH 1RZIB 3VE2A 1J88A 4BSVB 4WU7A 4G80B 2VLME 4L29B 2APSA 2F5BH 2JCCA 3V5KA 5E2WL 3H7BA 1SLVA 2VW7A 3MRCA 4Y9EA 3ILPB 4Z9KB 1WZ1L 4MJIE 3ZGIA 3BEVB 3Q5TA 1UOWA 4GI8A 1KCRH 1IMHC 4O2EB 1BWWA 4BFRA 4KC3B 2MCG1 4U6XB 4FFYH 3SQRA 5KVFE 4YDMA 3C8KA 3KWTA 3BKJH 1FF5A 3DO3A 4M8QA 3EJPA 5EOCH 2DQIL 2CHWA 4OZIA 1WWAX 4ZXBB 1EGJH 5HDLA 3V5HB 4HXBL 4DZBB 4NQXA 4I18B 3TA3B 3D69A 5IHWA 2I9TB 1DFBL 2X9YA 3DV6B 2J55A 4X7SH 2C7UA 1IB5A 1GZPB 1SYSB 4WTWA 4MD5A 1CU4L 1D9KC 5DMIL 1Q0YL 1TEFA 3KZ8A 3DROB 1V5JA 1T66D 4L0ZA 3M8OL 1KB3A 4OJFH 1IGJB 4DK5A 1Y07A 2C4FT 3BDYH 4MWFA 1S7WA 1ZEAH 3MV7D 4O58L 1UOVA 1V27A 1WFTA 3GYRA 1PLCA 4NM8L 4P57B 3RVTC 5ISZE 1CT8B 1GVIA 4PBDA 5IFJB 3V52L 3BXNB 5LNDA 3FUKA 1JK8A 3UTZB 3QDMD 5AW6B 3VXTA 4APXA 4Z7QE 2QADB 4LQFH 3VDAA 2Q10A 2YPVH 4FYQA 2VLKE 1KTDA 3UEZA 4JO2L 1MCQA 3N1FC 5FFOA 1KF9B 3W9DA 2F8XC 2Q3ZA 3IFLH 1G9HA 4XGZA 1PZ2A 2GJ6E 3MGTB 3VXRB 4G7VL 4DKFL 4TTDD 4ORGB 4BFIA 4GCPA 5KVGE 3I3BA 1YPZF 3KDMA 2ZCHH 2X3AA 2X7LA 4K0OA 1SNRA 3E80A 1HINH 5IT2H 4I9WD 5LQBH 3NEEA 2R2CA 1QBBA 4QJ3B 5ESQB 2KUTA 4NUJA 1RJLB 5DLML 4NKDB 5IWLA 1U8PB 3UP6A 2Z4QB 2P46B 1IT9H 1G9ML 5I8OH 5DJ2A 1X5FA 3D07A 1RHHB 3JTTB 2YQ2A 2WLYA 4GT7A 1JBJA 3IAQA 5E9DE 2H1PH 5DHDA 4X6FA 3M17A 3BJ91 4G5ZH 3BVNA 5K5YA 1HH6A 5T5FA 3HE6C 3QEGH 3VRIA 3Q8FA 1JHKL 4OLEA 5G5DA 3U36A 1JPSH 3VB8A 4OI8A 1EAOA 5AW3B 1JGLH 1KB9J 3P3TA 4JFSA 2PTVA 1QLRA 5GS1B 4JZOB 2QPEB 1EDHA 4Z3EA 1FV1B 2K6WA 3GSNH 4HK3N 4XCEA 4RMBA 3ATBA 4YR6A 1CI3M 4ZX5A 3V0VA 5DRNB 1YPZE 4YH6A 5IMKA 1KGCD 3V4PL 4OIIL 2IH8A 1C16A 1MHCA 3VTAA 4F9LA 4G1MA 4P3DA 2JLLA 1F13A 1BAFL 2WZ5A 4P2OA 5BUPA 5AWNH 2EDWA 5JQHC 1SF5A 1FPTH 2VZVA 4W93A 2ENYA 5DF0A 1OGSA 5HD8D 4JPWH 5KVDE 1Z9SA 4N20A 1G1KA 1AKJD 3QUYC 1MY7A 3ZKND 2CBPA 4BFEA 3N44B 4L8CA 5DUBA 2BSCA 3K2UL 2GIXA 5H94A 2WLNA 3MGOB 1FLRL 4FADA 1YJDC 4X6CF 2FB4L 4DNLA 1PG7L 1MW2A 2HWZL 2PETA 3G5YA 5DA0B 1XCTA 2BX5A 3IJYB 1GS8A 4G9FE 3GK8H 3VXMD 3WIFA 2R2HB 2F53E 3O41A 5IJCC 1SXCA 1G7QA 3OF6D 3MRNB 4W9LC 3VMNA 3DVGA 5HYSA 3MV9B 2ZP0T 4OIAA 4OZHA 3ESNA 1KTCA 3MJWA 1S7QB 3BWUC 2Q8AL 4XP5L 4E5XG 5DS2A 1CD9B 3RWCA 3BWAB 4PS8A 1CGYA 1TR7A 2HKHH 5I74B 1Q9LA 2KS0A 3UMNA 4TNGA 5D5MF 4BH7A 3P9LA 1F4XH 3GXIA 1I9RL 4H1LB 1XXFC 1A8JH 2CMRH 3AU0A 4DP4X 4DEPB 4HIIB 1IM3B 4HDIA 3POUA 1PBYA 1QEWA 1C5BL 3O2DA 3MJ9A 4ODVL 4O00A 4W9GC 4AMKL 1JTPA 4JDEA 1EMTL 4MHHI 4HAGA 1DVZA 2VZSA 2WUCH 4M3KB 1HHHA 3BHBA 1IKOP 4YE4L 1UM6L 2KLTA 1X5YA 3CN4A 3LQAH 3BKCL 3F00A 1BDYA 1Y6MR 4PS4L 1O7DE 1QLEH 3DHJA 4JFBA 2XWTB 4KVNL 4R8WH 2E75C 2YBGA 3O45A 3TN0D 4X6CE 4G82A 4ETQB 1YQVH 4AQ8C 5EF1A 2XXGA 2LTQC 5FKPA 4X9YA 3BI9X 1N6QL 1T04A 1ZDSA 5C0AA 5TK4A 3HUJF 4PD4K 3D09A 2P3YA 2BY2A 4MTMA 1GA2A 4PRPD 5HI3C 1X5JA 2RFXA 4LZKA 3UZQB 2BSBA 5I1IL 5D5DA 4JPSA 5CWSA 1AD9A 3WY3A 3ZYOA 5GGVH 1DBML 4WSJA 3FUHA 1E4KC 1EZVX 4M00A 3RVWC 2RALA 4HFUH 3HG2A 4OFYA 2WWKO 4Y1AA 5D5ME 4F58L 3I50L 1CFTA 3HG1A 1E4HA 4LKXA 2E47A 5JDSB 4RMWA 4JCLA 4YWGL 1XF3B 2GUOA 3ZVVA 3CVHB 4YQXH 4EBQL 1D9KA 4LCUB 1H9DA 2WQUA 2VW4A 4Y4KB 1KIPB 2ZWYA 2B5IC 1PNCA 4ZSOE 4ADGA 3GMQA 3V8CA 2CKBB 3ZE2B 4OLYH 2JXMB 1JYNA 3BLBA 4KY1L 5KANI 5JA9A 2DLEA 3P3SA 4ZMLA 5C97A 2X1OA 3TZVC 2Y25A 5I71B 1MQKH 3DSFL 1YMMD 3FB7B 5EZLB 5HPMB 3GKWH 1UXWA 4QHMA 3IPEA 1NCWH 1XSIA 3T04D 4KY2A 4HA1A 2O5XL 4HC1A 1U92B 1CE6B 3MKGA 2QQNL 5B39G 5GS3A 4JY4A 3DMMD 3EMNX 4XC3L 1TQBB 2Y3AA 4ZUTA 3B7YA 3SDDB 1FZOA 3OB0K 2E86A 2WKOF 4PJFE 2H32B 2AJUL 4QD2E 5JR1H 3GHBH 3ARFB 1BVLA 4U4IA 1B9ZA 4L8SA 1PQZA 3U46A 5D70L 3VXUD 1I7RA 3IWUA 3B9KC 4LBEB 1CD8A 2A7BA 4KH2A 4XP9H 3UDWC 4PJEB 4U2ZA 1ZGLB 4TUUA 5A40E 4S0SD 2AEIT 4U1JA 2COVD 1UD6A 2J6EL 2KERA 2R69A 1AXSB 3EKCA 5DDHA 5BVJA 4KXBA 3GJFK 4AVJA 1QATA 4EAEA 3QDJD 3SQOH 1QKZH 3F7LA 3D2UA 4HZAA 4QCIB 3PGSA 4KDWA 2HMIC 2NXYC 2M2DA 3LEVL 4HGWB 4UIMB 2K4AA 3MO1A 3LKQA 5ESVB 2E56A 5CLXA 1PZDA 4Q9RH 2ZUVA 1S2EA 1FNSH 5AZUA 2W91A 4AQZA 4BKSC 3TJEL 4Q9QH 1RUKH 4RISH 1NCTA 2YPLA 3LZOA 3RIFF 2XBDA 3ZKXC 4XCYA 4JDTH 4GAJL 4PTTA 2G4EA 2G3NA 3VWKC 2DQMA 3BGFC 1RU9H 1S7SB 4FABH 1PZAA 3BP4B 3ZKQD 1BOYA 2Y6TE 3N43F 4QT5A 3SDCB 3WUWB 2XMXA 1G7HA 5KYWB 3QUYA 3HNVH 5FWRA 4AC2A 1ET8A 1FUNA 3ASWA 1XO8A 5JW5A 4L48A 4YJZL 3TOPA 2FSEB 4OD2A 3VI3F 2C3WA 3EO9L 3QNYB 2YEVB 2B1AH 1J0KA 2VJ0A 4LNRB 1LYQA 1QSVA 2EKSB 3QFDB 1A6VL 2QKIA 1AOZA 4L4JA 2H2SC 4MJ4A 3BSZL 4F7TB 5C09E 2WPGA 3CSFA 4MBRA 3QJUB 4HZ1A 3IF1B 2GJZB 2J4WL 4AENB 3B7TA 4P48A 4UWQB 2BZCA 1WLHA 3VD5A 3V0HA 2WVVA 4J6IA 2J43A 3QHFL 4RGMB 2IBZX 4Y5XB 4FQ2L 2DTMH 2J2ZA 3QUZD 1QBLL 3OKMA 3REVB 3QUYB 4KUZH 3WU1A 4AYEC 4FI6A 3EH3B 5AW1B 1BF8A 1N6VA 3ARDC 1VF5C 2VDKB 2R7EA 1FGVL 5IOKA 4P46A 3A23A 5LXVA 3DVFA 5ALCH 2D03L 1UH3A 2FDBP 1NUDA 5DMKB 2AAAA 2FBRA 1KIQA 4PREA 1I85A 2WYHA 1JAEA 2YAOA 1I3RB 4IOFC 4ECNA 5L4MA 2OSYA 2WLMA 2YAFA 3OKKA 4LSPL 1CXKA 3EYOB 2COQA 4U1HB 5K93A 4OLZL 4JPIB 4XPFL 4FQIH 4LHUB 3PQYD 5DS1A 4PRDB 1QFUL 3HZMB 1M3JA 4BBWA 4MJ2A 5JIHA 1E4XL 3C08L 1XD0A 1TKWA 1SN2A 5JW4R 3FUDA 5AENA 3P3UA 3V7MA 1COBA 3N42B 3PDOA 4R7DB 3WE6B 1X5KA 1UJ3C 1DJIA 2C8NA 3BAJA 1MFDH 5GTHO 4PW3A 5ANME 3UO1L 4AEIH 1XT5A 3HG5A 2R23B 3MLRH 4OCNC 4TNEA 3L13A 5KTEL 2OJEB 1TJGH 3K0WA 4AZ8B 4YX2H 2FX9H 3LDBC 1KN4H 1MAML 3FMGH 1FFNA 1IEAA 1R3HA 1Q4NX 1TQWA 2PKDA 4KI5C 4LVNC 2GC4C 3PP3K 3RZWA 3HLAB 2GUYA 4F2EA 3FTGA 4L0PB 1A3RL 1CL7I 2YRZA 1E28A 1QRKA 5DC2A 2N2MA 4PS3A 5SWZB 2J4UP 1ADWA 3FU5A 3OKDB 1A64A 4ODSL 3TO4B 2PYFB 3AXHA 4H4NA 4FYTA 3GMMA 1LP9F 1CD1B 3N1QC 1QFWM 3ZT5A 1O75A 4L4TE 5I9QB 4KKQA 5D1QA 2C1OB 2KZBA 4Z1PA 2XU9A 1OGTB 1ZS2A 4PM1A 2FEDD 3ES6B 3K2MC 4NC2B 3CN3A 2XWDA 4WUKH 5T1KB 3TBVA 4RAUA 5GTIO 3NCMA 1MCPH 4KJWD 5C0JB 4I77H 2FGWH 3LHPL 1MIEH 5IQ9A 4QRPE 2CSPA 5KSBF 4JO1H 2BVOA 4DQAA 1YN6A 4BK5A 1ROWA 2BP5M 3H9ZA 1UUNA 4EI5D 2VSMB 1EERB 2NXZB 4D8PA 4E9TA 1P2CA 2X9ZA 2ZSVA 4ZXBC 1MFCH 1KJ2A 3TA3C 4I18C 4XO8A 4ZK8A 5KS9F 3JWOL 3NCWA 4R96B 3OZ9L 2VZOA 1Q9KA 2UX7A 4MAUH 3SE9H 4KJQC 2H9GB 2OSLA 4MJ5A 4YO0B 2O6FA 5SWSB 2E7DA 4PHXA 4RNRA 3FU3A 4TV3A 3JBG7 4LLAA 5AZ2H 2I7SA 1MRDH 4MQ7B 5BOZG 5L9DH 1M1SA 5FM4A 3Q01A 1WDAA 3MXWH 4UQEA 5IW6B 4Q58C 4RH4A 5SX5K 4LLVA 3A22A 1MFBL 5K9JH 4HUMB 4QHNB 3AAEB 3KCWA 4PCSA 4ANKA 3MXVL 4HSCX 2VLJD 1UD8A 1WSST 3EF7A 4OD3L 2ED9A 3I3DA 3HE7D 3JWNG 2UY6B 4N0UE 1CYWA 1ZHKA 5J9PA 4JO8A 3MV7E 5DQDH 3PF2A 4LGPB 4H20H 2K0LA 3FO1A 2DLFH 5B1AB 5KSBE 3MNVB 3J2PA 2NNAB 1AY1L 3DWTA 4MRBA 3LPPA 1DO5A 1AO7B 4AGLA 1DDTA 4GKNA 4BSJA 1SXSA 4EZKA 4X9HA 1I8LC 3BAWA 3AABA 3I9IA 3QDME 4XVJL 3DX7B 3IRCA 4U1SB 5AOKA 5IHZB 1NGQH 3IDMA 3O6ML 4Q14A 5JXEC 4JPQA 3GMRA 5DD3L 3VWKA 4JHWH 1EBAA 3D39D 4AKRA 4R3SA 4QOKD 5KS9E 2XTRA 4IU3B 3ZDYF 2EP6A 3ZHKA 5J3HD 3NA4A 1KCSH 1WS7A 3V9CA 1M7DA 3AS3A 1MCJA 4I9WE 5DWUL 4M6ML 3FU9A 1NEZG 3U2IA 3CXHK 1VHPA 3LMJH 4PJ8D 1CDJA 2HJKA 4UNVA 2A9NH 4XMWA 5FGCB 1DE4B 1L5GA 4IU2B 4ZS6D 2P45B 3MBXH 2XWCA 4MCZB 1V55B 4OVVA 3IBOA 4WFGD 4A63A 2YXVA 1ETA1 5KJRH 1RZJC 1NC2A 2O6EA 3D06A 4AK2A 3RGVD 4OY9A 3JUYA 4HKZB 4LL9A 4FL4B 5GS1C 4NNXA 1HOCB 3ILDA 1FSKB 2AI0H 4YOKA 3UGUA 4WQOA 2R39A 2FT8A 3HR5B 1A4KA 3L7EB 4QRRA 3F7KA 3WXVH 2FUTA 3KCPA 3R7QA 3ARDA 2J8UB 4F2FA 3POQA 2OZNA 3MR9A 5C08D 1PZUB 4YZFF 5I1EL 3KPSB 2Z4TA 5L4FA 1YEJH 4RZCA 2OL3B 3GXDA 3S2CA 2WNXA 3ZDYE 2WGXA 3BP6B 5HHOD 1KGCE 1N64L 3RWHB 4AOFA 4M5TA 3BRZA 4PRHB 4B0MB 4PJXA 4XNUH 3LK42 5M95B 2R29A 2BMKA 2NY1D 1UM5L 2NY6C 2YSSA 2EDNA 1F6FB 4UILH 5GRZA 2X4UA 4MJ6B 1KCLA 5FUZH 2R83A 3ZE0B 2AEQL 4CRPA 4M1GL 2WC7A 3MRFB 3QJFB 1OP9A 4MXWL 4DEWA 1LDSA 3UBXB 2GSIA 4V33A 2JCWA 4YN3A 7PCYA 3T8VA 4MS6A 5BXFB 2R89A 3DGGB 5IB3A 1G7IA 2R0ZH 2ICWA 4LCWB 2I26N 2FRGP 4MAZA 2EDHA 1T83C 1F02I 4G6KL 2HRLA 4GUOA 4WI0B 3VXME 3DYPA 5I74C 4M7LH 3CFBB 1JERA 3QSKB 3DGCR 4A7QA 5EB9A 4FE9A 4FG6C 4ZO8A 4FSOA 5EOTB 5HGAA 5MEND 2NY0D 4TYUA 4JY5L 4DEPC 2WXJA 4O02B 4AH2A 5J6HA 2YD7A 5KBNC 5C92A 2X2JA 4QR7A 4YZFE 3MRHA 3IKCB 2DL2A 4FRWA 1JWSA 1Q8MA 4I3GA 3CX5J 2WJQA 5FB8B 2DD8H 1QFHA 2NT1A 3PWPA 4P07A 1J8HA 3IFNL 5EH1A 4G43A 2FCBA 4HKBB 1OE3A 1RZIA 1URZA 4BSVA 4LLDB 3RWDB 4G80A 4L29A 4CVWA 3C5JA 3MPCA 1MQ8A 3WMPA 4KQ4L 3DO4A 3DRTA 3FB5B 4Z7NF 3L4ZA 1I4FB 1A7QH 1BG9A 3BEVA 4Y1TA 4O2EA 3SCMD 2BVUA 4U6XA 1J8KA 1JRHH 4BWWA 1PSKL 2W38A 1X5MA 3AM8C 1IILE 5BV7H 3QI9B 4HHWA 3FO2B 4Z3GA 1LEKB 5B22A 1OCWH 2FIKB 1IGCH 2F1EA 4PRPE 5IFHH 3V5HA 3TU6A 4DZBA 3TA3A 4I18A 5T1LD 2I9TA 4G8GD 4BV1A 3ZE1E 1EH9A 4KDTC 3EJYD 3DV6A 3ZQWA 1SYSA 1GZPA 4HU8A 1PLBA 1JSYA 2Z35B 2AQTA 2NNRA 4MB5A 1MLBB 2AAVA 3DROA 1XR8B 4PY8I 4ZO7A 3MBED 5G4OA 3OB0H 4PJAB 4Y4KC 3O4LB 1AP2B 4LSVH 4FCAA 3WKMH 2AK4D 1AAJA 2CG9X 2PN5A 3BT2H 3E8UH 1IGJA 4MHHG 3QYNA 1IAOB 3DOHA 1OAUL 4YDIH 4XODA 3RKDC 3QJVB 2G0LA 3CLFH 4Q89A 4OGXL 1IGYB 1DVSA 1JGUL 4P57A 5IKCB 5IFJA 1MF2H 3BXNA 2WTOA 2Z0UA 1OM3H 4LEXL 3KLLA 3UTZA 1RKRA 3EDFA 1DLFH 1HHGB 2PYEB 2OX5B 4Z7NE 3LN9A 4KR8A 3PIQB 3M1CA 5HYIA 1YMME 2N0MA 4HHGA 2ZNWA 3MGTA 2ZUWA 4G71B 3VXRA 2K45A 3DXAB 3R1GL 4ORGA 3LJ3A 3UTTB 3LPGA 3ZDXF 1BM3H 1I8LA 3QEUA 2XFGB 3SDDC 1ND0A 1YY8B 2WHVA 2HUHA 5TTRA 1UA7A 2HPOA 2OTUB 4QEGA 1ZE3H 3ARFC 4R83A 3QQ4A 4PJHB 5JXEA 3MLYH 1BPVA 1V7NH 3UTPD 3TH4T 5DJXB 2XTLA 3TONA 4CSPA 5ESQA 4QRQA 5BO1H 2QSQA 1BX2B 1RJLA 2V17H 1OWWA 2NY7H 1U8PA 4KRAA 4DSYA 2Z4QA 1DN0B 3CZFB 3VXUE 5FUOH 4K9EL 1NBCA 1RHHA 1R33A 4EEEA 3JTTA 1MCWM 2QGCA 5KANG 5I0VA 2XN9B 4G6FB 3U79A 3GTNA 1ZXKA 4YBHA 3CPLB 1WVZA 4OH2A 3FQTB 1TYEB 2MNJB 1SHXA 4EOWH 5DZVA 3T0DA 4DPRA 4FQCL 1BQRA 1WG3A 3B8YA 3BUTA 2ARWA 3GI8L 3QDJE 2MPAH 4CU6A 3E1ZA 4AE1A 3IDNB 3ZDZF 5AVYB 5I66B 3KAAA 2Y07L 4JZOA 5IW3A 1FV1A 3UYRL 2IALA 1LE5B 2QGDA 5D8JH 4GAGH 1P4TA 1W8NA 2DLTA 4N9GB 1VZHA 5DRNA 3PWVB 4E9XA 4AGQA 4BEIA 5LWYL 2VWEC 4X7EC 4LPUA 1OLLA 4HIJB 3SDCC 2FAUA 3E7JA 1L7TL 2OFQA 5E08L 3U2JA 1OT2A 8FABB 1EAJA 3WCYA 5FR3A 1H15B 3GBEA 5F2FA 3D4YA 2EVJA 2YFOA 4G8EB 4YHKL 4PYGA 3MGOA 3WFCH 5GS0D 3CUPB 1Z3GH 1MHPL 1VCBC 4OGAC 2IVFC 1HXXA 3V4VL 3HPJB 2CGZA 4JKNA 4ZX6A 2VDPL 2R2HA 4GO9A 2X05A 3RA7H 3JV6B 2IG2L 3MRNA 4YDKH 2P9RA 1I1AD 3MV9A 4DP9X 4LCIH 1T0MB 1IRAY 3KYAA 5KBPA 4U1NB 1S7QA 5AZEL 2GCYB 1B0RA 1T83A 3KHOA 4RGMC 3PGFH 4Y5XC 3BWAA 4ZFOB 1KXQA 4G6MH 3TNMB 3UU2A 1XFPA 2IGFL 3WEOA 5EMYA 2EYSB 3HI6L 1VERA 3LAFA 4Y5VC 1LMIA 1L9NA 4H1LA 2XV0A 4HIIA 1IM3A 3MV11 4PPTA 5EIIA 4QI3A 2AITA 3POCA 4LOVA 1CDIA 4PJDF 3X1NA 1GJWA 2IQ9L 3PP3H 2HT2C 3L45A 4KH9A 3MU3A 3DBSA 4M1CD 3CN1A 3ULVC 4U05A 3HVNA 1KYOK 4LESA 1E4WL 2XWTA 2Q2EB 2QSVA 3W2DL 2Q20A 1M6OB 4H0LC 5AALA 4NQUA 4ETQA 4L3ED 2NZ1A 4OZFG 1AYRA 5JHDB 1TCRB 3CQPA 1JTOA 1S4IA 3QWRD 4PG2A 1NC4B 1U2HA 1UB6B 4GRLB 5IMOB 4GKSB 3PQYE 2L7EA 4FFWC 5EOQH 4D2NA 3UZQA 1T7YA 3GRWH 4ZTOH 3AM8A 3UJJL 1TOXA 3FQWB 1LO3H 3UTSD 4MFHA 4YHML 4AM0B 1UT1A 3KHQA 3QZOA 5J1TC 1I1FB 2MCMA 1ZCRA 4TSAH 3RL1B 2DWXA 2OULB 1JP5A 3KPOB 5JDSA 3H3PL 1XF3A 3M07A 3BZEB 2MWCA 2VOTA 3CVHA 2XPGA 1ZANL 4LCUA 3O8XD 1Q0EA 2LFGA 3ZYZA 2KH2B 3QARA 4QXTA 4PJDE 1KIPA 4Y4KA 1A7OH 4DGVH 3RTLA 5I9QC 1B3JA 3L4UA 1NCCL 1QPXA 2CKBA 5GRJL 3UG5A 2JXMA 4K07A 3WFEL 4I3RL 5D6CA 1NAMA 1J9CT 1NLBH 3OD3A 3ZMRA 5EZLA 3FB7A 5HPMA 4XX1G 4B0MM 1PY9A 3CHOA 4TUKL 1T5WA 3W56A 4DKEL 5HGBB 4MSWA 4KKRA 3ZJAA 4X5QA 3II1A 1CE6A 1BLNB 3RX7A 3KGSA 5TE4L 1VDGA 2WSDA 4AM0Q 2HJFB 3IVKA 5IQNA 5JPMB 1OTTD 2R0WL 2X4SB 4YHZH 1D2PA 1LK2B 1EXGA 2CCVA 2FWOB 3BKYL 4GIAA 3ZHDA 2VXSL 4I0PB 1XCXA 2NXZC 1CDGA 2H32A 4IK7A 2FZ3B 3ARFA 3QHZL 1BQHA 4HISA 5D93B 2AVGA 4LBEA 1JZEA 1FC1A 2Y1ZA 1SVBA 3TTYA 1XAKA 1REIA 3E8VA 4PJEA 1U6AH 1VAHA 4U6VH 1EFXD 4OGQC 5HHVL 2FL5B 1JS4A 2Y5TB 1XGPB 3UC0L 1AXSA 4XWGH 4UUJB 2UWEB 3OMIB 3P77B 3D33A 5CN1A 1D5IH 4S1RL 1R17A 1DBAL 4XMLH 2QGBA 4JL1A 2WSKA 4KMTH 5CKAA 3LH9A 4QCIA 3WHXB 1TZIA 3HEIB 3G7TA 4MASA 5AVUB 2J88L 3IDIB 4HGWA 1YDPB 4N22A 1ZT7B 4UIMA 5ESVA 4UQ3B 4D3CH 3ILQC 1DQIA 4Y4FB 3ARXA 5GGRY 3RIAF 1S9YB 1E8XA 1BYPA 2FNWA 4FFZL 1F4HA 2WQWA 2VLJE 3QISA 3MFGB 4KOCA 3HMXH 3AQYA 3N40P 5IVNA 1SN5A 5ECJE 5BJTA 1BFVH 2VXUH 1E8WA 3KL0A 5CNHA 4JQIA 3AVEA 1A2YB 2DQGL 1IQDB 2FX7H 2GBVA 1S7SA 4MJIB 2R9HC 2ZWZA 3O6KH 4LK4A 3QP3A 3B9DA 3BP4A 4QNPF 4Y9CA 3SDCA 3WUWA 3EXLA 3PNWB 5HGDA 4QHKI 3U1SL 4Y5YC 4LLMB 5KYWA 2I69A 3T0WA 5HDOA 2IANB 2HLFC 2F18A 3D39E 3GP6A 5DD6A 4QOKE 3CU7A 2FSEA 2AVFA 3AGWA 2ZXQA 4ABQA 3QNYA 2XBZA 5EO9B 1UB5B 3EBHA 1YEKH 5EPMB 4ELKA 3BKML 4X2UA 2XKSA 1XH1A 2OS7A 4LNRA 4DTGH 2AGJH 2EKSA 3MTXA 3QFDA 5BRQA 4U49A 3TM6A 5EF0A 1FYTD 1R0AL 4F7TA 5FYJH 2VDQH 1A9BB 2NUPB 4BCXA 1YN7B 2F19L 4R4FL 4FL4C 5TQ2L 3UTQB 3IF1A 1ZV9A 2GJZA 4AENA 4LLUB 4JPKL 4BCYA 2BNRD 5DC4B 3DA3A 1AR1B 1FSKC 3CX2A 4WFGE 4FX5A 5ISZB 1IKFH 1GGBH 1MSPA 1F6LL 3PAVA 4WY7H 3REVA 3SPJA 4XPGH 1JOIA 4Z7QB 4IGBA 2CIIB 4UNUA 4EKJA 4MBOA 3CQFA 2VLKB 3NCYS 4BKTC 4F8QA 5D1ZB 3U6XA 1PZBA 3EYUH 1GYCA 1N0XL 3Q3GB 4RBPK 3B6SB 4XC1L 2ICEA 3PHSA 1IBGH 5FYKD 4ZTPH 2ZXWB 3CH1B 5C6WH 2BNQD 4A2LA 1I3RA 2WVPA 3C5ZB 3L1OH 3TWYA 5AFAA 1VESA 3UMTA 1JPTL 3EYOA 3LH8A 4U1HA 3MCKB 2ZUQB 4JPIA 3VMPA 4LHUA 1WFMA 2D3JA 3E3QE 4PRDA 5HHOE 1ACCA 3HZMA 3WTWA 2AXJA 2X5PA 5GGQL 1V3MA 2WQSA 4KWUA 3ZMNA 3UPGA 3QRBA 4KXZI 5ITFB 5BMFL 1CDHA 1RLWA 4R7DA 3SY6A 3WE6A 3RTQB 4WIQA 3QZPA 2EDBA 3FPXA 4WO4C 2R23A 5KSAB 3DDFA 4NZRH 4K3DL 4WI8A 3U0WL 1YEFH 2I32A 1OAXL 4AQ1B 2XHNA 2G5BB 1P4UA 4PLNC 4Z6AT 4GW1B 4HJIA 5BO0D 3OPZH 3HLAA 1KGJA 1RD6A 2XA8L 4P4KA 3M1BB 5HJ3A 4NUPA 3QRGL 2I25N 2ZYIA 2AXTO 5SWZA 3RAJL 3OKDA 4Z7WF 4XP6H 3PRNA 3TO4A 2UZYB 4MRCA 4E9QA 1H8LA 1CD1A 1N12A 1O6TA 4TUJB 1JRHI 1NDMB 2DDQL 1ET5A 4NJAH 5MENE 1UWEL 2FWUA 2C1OA 1QNIA 4HKJB 2XXMB 1OGTA 2XVBA 2GW5A 3ARGD 2P5WD 1A0QL 3ES6A 3H2QA 2F54B 4MZIA 5T1KA 2PTTB 1HEZB 2XZQH 5DMGC 4S10A 4HJUA 5C0JA 1K6QL 2WXNA 5D6DC 3MLUH 3S88L 3VZTX 1MFEL 3CN0A 3II3A 3B2UD 3PP4H 3MODL 3P54A 5EA0H 3D87B 4PQXA 5E1IA 4YHLH 1H6TA 1JZ2A 1K85A 4GNKB 2ZWSA 3ASOB 4FC3E 3ZSSA 2Q7YB 2MCPH 3QI9C 4BCZA 12E8L 3C6EA 5CGYC 5FGRA 1D5XB 5B1CA 1T1XB 3N85H 4JM0A 4G9FB 1E6JL 2X9XA 5E6ID 1JL8A 2IPUG 3KLHC 5IQLA 3PL6B 2EDTA 2J8OA 5E8DH 4Z0XB 3V7AG 5JPNB 2ZYRA 2O30A 3GZQA 4M5YH 4R96A 4XNXH 1X5GA 4N0YL 1XGRB 4UAHA 4Z7WE 2PXYB 3ESVF 2B1HH 4W9CC 1NFAA 2H9GA 4YO0A 4A68A 1CBVH 5SWSA 1N5YL 4JKPL 3NGBB 1OD9A 4G8GE 4LOEA 1R5VB 4MQ7A 1GOGA 3ENEA 3PV6B 2BOLA 4P5TC 4BQBA 2FHBA 3MLZH 4K2UH 5IW6A 4QHNA 3AAEA 2C9SA 2AK4E 2H0FA 5JHBA 1JXDA 5EOCJ 2R4LA 3RFZB 2UY6A 3LEYL 2Q3AA 1SDDB 4M3HA 4O4YL 2ALAA 3K0YA 1IZKA 1IAKB 3FFDB 5CZRA 3VI4B 3GBDA 3MNVA 3PRZA 5AG8A 2NNAA 4YLQT 4YSDA 1F4YH 1S78D 1AO7A 3R8BB 5AD0B 1EO5A 3VRLF 4W9ZA 3HZ3A 3P0VL 4U1SA 4X6CB 4IOIB 2ADFL 5IHZA 4WF7A 3ZTNL 5JMOC 2VQ4A 2OMTB 1KLUA 2NYYC 5D2NC 4L9DA 3EH1A 2G9HB 4FI8A 3SQBB 2OMYB 2A38A 3PF1A 3FH7A 3HB3B 3UAJD 3NK4A 4NSKB 3CFIC 5GS0L 4OKVA 3OXRB 1P6AB 4NUGL 5EORL 1BZQK 1TFPA 2O1AA 3T3PE 4UDUB 3RRQA 2DIEA 2ZNXA 3UTPE 2EH8L 3VO0A 1JNNH 4N2FA 3SDAC 3NCJL 3LNGA 3RY5A 1E5UI 1DE4A 4NWTL 4IU2A 4FFTA 4TNWK 4NBZB 3BEWB 2XTJD 3TWCH 5ETUA 4MCZA 2XVGA 2L8AA 4NKIH 1E4JA 3ARUA 2B59B 5FW8A 4S1DD 1S46A 1D6EB 4ZSOB 3RX8A 3P9WB 5GSVB 4TSCL 2V4LA 2QPUA 1UKSA 4QAWA 2YZ8A 3APMA 5ICZB 1HOCA 4CC0A 3VRLE 3HR5A 3L7EA 4GF4A 1J0IA 3EJCA 3OM3B 1QNZL 3WIIL 5CD5C 2I27N 4LAJH 3GS7A 2Q6WB 2J8UA 3L5JA 4UNTA 3KPSA 2OL3A 2YD8A 4FNSA 3BP6A 3WNPA 1X9UA 4OCSH 5DUML 3VGEA 2QBWA 4PRHA 4PJFB 5J6SA 1KT2A 4U1LB 4TQ8A 1FAIH 3MCLH 4K7FB 4MJ6A 1RMFL 4QPEA 3W3BA 3AADB 2WCGA 4JUSA 3X1BA 2DQHH 2X87A 1FZMB 2OR8A 4NJ9L 1SYVB 3RJQB 3MRFA 3KEHA 3QJFA 4WI2A 1R75A 3MUHL 4QRUB 4A2HA 1T2JA 3REWB 5CINH 3UBXA 1IGML 2HRPL 3VFMB 5BXFA 3QS3A 5DC9B 3CBRA 3DGGA 3IETB 4POZC 4LCWA 1H3UA 1AI1H 1N7MH 4JPVH 1GR7A 3ARBC 5FHBL 5AOIA 3X3GL 3DJZA 4WI0A 4ZNCD 5ILTL 1EJOH 1T6VN 4OLXH 4P2AA 4NQEA 4TVSa 1RY7B 1YNKH 3N50A 3TV8A 5EOTA 5IB5B 3MLVL 3LX9A 4H26B 4KK8C 4O02A 5DI8B 5F96L 2O93L 3KH4A 4FZ8L 1P5UB 4FSPA 2I60H 3LKNB 4FNLL 3IKCA 4FLOA 3PAUA 1YY9D 3SIKA 1FIGH 4I88A 3JVFC 4XVTH 5FB8A 2G5UA 4EUPB 1F5WA 4AYID 1OSYA 5L6YH 4O9HL 2E74C 4HKBA 3U25A 2JKXA 1ILSA 2YK1H 2AANA 1DSWA 1Z32X 2MTAA 3RWDA 3ZIYA 2IH9A 3B9AA 4JFDB 4PGZA 4LRNH 5T3ZD 5GISL 2WWMD 1ZD6A 1KTKE 3AQDA 4PJBF 4WHTB 5TH2B 4A7SA 4EKXA 5I16B 1UTDA 1Q90A 1KGXA 3SJVD 3O0LA 4GRLC 4Y4HA 1QYGL 2OP4H 1WPCA 1QR1B 4HCRL 1XZ0B 3SPHA 4L3EE 4HJJH 4WWKB 4JHAL 1CGUA 2HZHA 3QI9A 3FO2A 5C3TA 1LEKA 2JMMA 3D52A 1JZ4A 2FIKA 2YGQA 5LG1A 4BUHA 5C09B 1VKXB 1DBBH 3GSOB 4AL8H 3TX4A 2V7HB 3QJHB 4EZLA 1KEMH 3UBFA 1WBYB 1XH2A 1ZT1B 3QR1A 4TRPL 3UTSE 2Z35A 1VACB 2PCFB 1MLBA 4B9YA 1XR8A 3P3YA 4KHXL 4DGWC 5DD1H 3A6CL 4PJAA 3O4LA 1AP2A 1HAUA 1VIWA 3O2DH 3MJ9H 3MNWB 2X42A 4FNPA 3UYPB 3EIFA 2MQGA 1VZIA 1IAOA 1J5OL 1ZDQA 2AXHA 2QVMA 3PGUA 1XSOA 4GXFA 3KH3A 1RXLA 1IGYA 4K8RC 5MI0B 5IKCA 3HJ0A 1QBAA 1LXMA 1OARL 2UV3A 4Y1SA 1UA6H 3IGFA 4X0KB 3RVXD 3MLXL 4HXAH 3WS6C 1F1AA 1UWFA 1HHGA 1IQWH 2APBA 2PYEA 3IFOB 2OX5A 4FRXA 1DBKL 3FTWA 4ORZC 2BM3A 3ULUD 1ZOXA 5JPMC 4ZQTA 2EICA 4B95C 4GKZB 3DXAA 3IJ8A 1JMZA 3FFCD 1F4AA 3UTTA 2W81C 1H6FA 3EOYG 3ME0B 2OTUA 2Z64C 2A6KB 2HP4A 3OKEB 1ILUA 4PJHA 4ZFFB 3SPCA 4ODWB 5JW4M 5D93C 2RHEA 3L9YA 4TLTA 1WZKA 5DJXA 4DP2X 3KW7A 5ANMB 2PO6B 2WUBL 3BW9B 1JZ5A 1BX2A 1PFOA 3VGBA 3DYOA 4QTIL 4R4BB 4ZODA 3NACL 3NH7H 3CZFA 1G1CA 3Q6GL 3WNNA 1LVEA 4DO5A 3NCCB 3H9HB 4MB3A 5D2LF 1YA5A 2IDTA 2RGSA 5E51A 1FNLA 4N8CH 3BVDB 4JFZL 2XN9A 1INDL 4APQB 4K3JH 1R46A 2VH5L 3AS2A 3CPLA 3BD4A 2EJ1A 3NFSL 4E1TA 2VYRE 5CSBA 4DP1X 4CILA 5IJKC 1THCA 1EO7A 4O3WA 4Y4FC 3H54A 4UT7L 4L4TB 4HC1H 4OVUA 3SKOB 2WZ6A 3IDNA 1QO3A 3TXAA 5I66A 3RWFB 2WXQA 3UAFA 3ZOAA 1JHLH 4PWHA 5BW7C 3DHUA 3QULB 1LE5A 4PCYA 1SF3A 2XXFA 2KXPB 3PWVA 5I19L 5C70A 3GI9H 5EEUA 4YDZA 4MVBD 1DCEA 3G3LA 4DFIA 4QRPB 1H8OA 5PAZA 2R1WB 2DJ4A 4N9OB 1OKEA 3RPBA 1SEBB 3W0WD 2E9JA 3QEQD 5E2VH 5FYKL 3TEYA 1T7WA 4PAZA 5BS0E 3CH8A 5BCAA 8FABA 1TJIH 2EIBA 1H15A 1CL7L 2W0PA 3CVIH 2BRRH 3CCHB 4G8EA 2A6JB 1WCBB 3H42L 3QORB 3JVGC 5F7LB 2IWGA 1BM7A 2XG5B 2TAAA 4IMKC 2GTQA 2R69H 2WP3T 1HWHB 4JGJA 4LNVA 5D2LE 3CUPA 1LNUB 4PJ0O 3GD1C 3LTVA 1T1ZB 3W39B 3TPUB 4DN4L 4RBPH 5B8CB 3HPJA 2O4VA 4LASL 5PCYA 1CE1L 5DFVC 1GYWA 4LCVA 3JV6A 4UV4H 3GEWB 1T0MA 1P5VB 4GQ9L 2ADJA 1G7LB 1J10A 1CXHA 4LSQH 4U1NA 3RZCC 3CSYB 1AR1C 1TTBA 1EO8L 1FYTE 1RL1A 2GCYA 2HN7B 2YD6A 1YNLH 3FCGA 4P9HC 5T3ZH 4L1LA 3D18B 4ZFOA 2A6IB 3AXLB 4KFMA 3QCTH 3TNMA 2H26B 1GYUA 4G1EB 4Q4IA 3QWOB 4N0UB 3ZR6A 4NWUL 2EYSA 3GLDA 2BHYA 5AYQA 3MV7B 5CUSL 2BNRE 5KSBB 3II2A 5D7LB 3S34H 4AG4L 4XX1E 4KKCD 4PGBB 3IMTA 4FCHA 4YEEA 4S11A 4PJGF 4XE5B 3QDMB 3MVSA 2DI8A 3T24A 4RLDA 2HVJA 4P06A 4KKNA 2VN4A 1D7DA 1WYJA 2YPVL 3QRLA 2V33A 1OAYH 2WANA 2ZUQC 3L7FB 5D4QA 1TTAA 5DYOB 2YAQA 1BJ1J 4ZMPA 2KC0A 1M6OA 3IM1A 5FYKE 4LSIA 4JQXC 1NUGA 2BNQE 4KTDL 1TCRA 2CHZA 5F9JA 5JHDA 4Y9GA 3GLZA 1NC4A 5BZDB 5IMOA 3APNA 1EEZB 5B3SB 4GKSA 1CLOL 4RFNB 2YLKA 5KSAC 4UNIA 1U0QA 1GC1H 3A0BO 3IDXH 4KK9C 3A24A 3FQWA 5AVTB 2X44D 5TE6H 4AM0A 4AQ1C 1RJYB 2A1WL 1C1EH 1I1FA 4WHDA 4ISVB 1UYWH 2PW2B 3NSCA 5DHVB 3RL1A 5EEYA 5LB1A 2FH8A 3KPOA 4OCXH 2PR4H 1YEIL 4PJ9D 1D6VH 3BZEA 3BUBA 4PJ5D 1GZHC 1JDDA 4WCYH 4M93B 3F8UB 4MZ3A 3LH2H 4Y2DD 1P1VA 1KENH 2DYPD 1MW3A 5LAXB 3WFZA 1OSEA 4ES8A 2CKNA 1B4TA 3VX1A 5D7SH 2VR3A 3KVDD 1M7IB 2ENPA 2ZWLT 3CFEB 5FW7A 5EU7E 3ARED 4R26H 4ODBD 3D0LB 2X6CA 4MA8H 5FOBA 5HGBA 3ZDYB 1MG2C 3WS6A 3B2PA 2P5WE 5D1XD 5EN2B 3FCSB 2HJFA 4RA0C 3RX9A 2K4WA 5JPMA 4D7BA 2X4SA 2OK0L 2AFNA 1LK2A 2FWOA 2F5AH 4I0PA 2FO1A 2HUEA 5I17B 3SYBA 1AKJB 1BWMA 1J9SA 2CRYA 2WQRA 2IDSA 3RNQB 5C71A 3F04A 5E99H 2FZ3A 1JGVL 1CD0A 3PL6C 4X6DF 4JANB 2K0RA 3L3DB 5C0IB 1Q9OB 4RAVA 4DGIL 1KN2H 1DUYB 2PXYC 4UYPA 1M7UA 5GGTA 2YAPA 4JFEA 4U6HB 2C7FA 1FE8H 3VXMB 4FULA 3NGBC 2FL5A 4L37B 4C4UA 2Y5TA 3DHPA 1XGPA 5FV1L 2UWEA 4PR7A 3P77A 4JQVC 2C3XA 5TJWK 1ZRUA 4AEHL 3IDYB 2G30A 3C09B 2BNUB 3ZHFA 2FYYB 1YEEL 4K3GA 4M61A 4F9PA 3MGAA 2GTZB 5IVXF 3RFZC 1DVQA 1A25A 1YDPA 1VADB 3IDIA 3LZFL 4FHJA 1E6OL 4QWWD 4UQ3A 4PGDB 3IMSA 3PCYA 3EJQA 1GIGH 4Y4FA 4KKZA 1YYMH 5D7HA 1S9YA 4JRXD 4FOMA 4HJ0D 3T0XA 5KSVB 2QL1A 5EIQA 4DOHE 5CLYA 5F7AA 2Z93B 1A2YA 3ZTEA 1PIGA 4X5PA 4TNVF 1IQDA 2B9BA 4MJIA 2XBTA 3GSVB 1WITA 4X4XA 4X6DE 1KXHA 4OQTL 4RX4D 1KJ2H 4JM2D 4AMXA 3PNWA 1KB9K 3TN0B 4D0DB 3MREA 3T77B 1ETB1 1FH2A 4KRPC 5HPOA 4ZFGL 2GITB 1TVDA 1KBKA 2IANA 1SHSA 4DJMA 5K1NA 1NCDH 2EDOA 2AJSH 1N8OE 1DQTA 4PRPB 5FKAB 2R4SL 4IMKA 1HSBB 4QLRA 2XQYK 2YUWA 1UB5A 1U8LB 4OF7A 2EO9A 5EO9A 5EPMA 4XBPB 3ZE1B 2JI2A 4N2KA 1WQVT 4Z7UF 3RLSA 3A21A 1K4DB 3MJ8B 4M43L 3FT1A 1A9BA 2NUPA 1YN7A 3DJSA 4FFVD 1Q72L 2BCMA 3FNKA 4ERSH 4EVNB 4L3CB 4LLUA 2XTJE 4EPSA 3ERXA 3WYRA 3I6KB 5ISZA 1GKEA 4OZ4B 3E9UA 2P8MA 1QRND 1SFDA 1SFHA 1B6DA 2QSCL 4UZGA 1QQDB 3KYMB 4BA8A 2CIIA 3TEXA 1E27B 4DQOH 2VLKA 4OZGF 3AWFA 1YMMB 5D1ZA 4R84A 2YKKA 1FO0A 2GJ6A 5KYUB 2G2PA 2DM3A 2IFGA 2EIMB 2LU4A 3EYQC 3Q3GA 2X89A 8CGTA 3B6SA 3DX2A 4N1EA 4BZ2L 4L1HA 3SHSA 4GEJA 2WOYA 3L4YA 1JF5A 5J1AB 3C5ZA 1NPJA 3DMMB 2BJMH 1IC7L 2GIYA 3MCKA 1GYVA 3D0VB 1R3LB 4ZUSB 4GMSL 4F8PA 1ORMA 4JQXA 4Q52A 5DJCB 3T08A 5ITFA 4H8WL 4LL4A 5F6HJ 3RTQA 2HJLB 4J3OD 4M6NL 4ZO9A 2P8PA 2Y0HA 1MFVA 2VXVL 3F64A 4V1DB 1T6WA 2DQFB 4F8OA 3RVUD 1CG9B 4X4KA 3VFOB 1F3RB 4CC4C 2G5BA 2UZIH 4Z7AA 2MNHA 4GW1A 3WAKA 3WG7B 2JFCA 4ESKA 2WO3B 4Z7VF 3M1BA 5IBLC 3X1GA 3ARZA 1S7XB 1VPOH 1NIBA 1P5UC 3I3EA 2X70B 4YC2B 2UZYA 5T8IA 5IFAL 1W9XA 4UQAA 2K6ZA 1GZHA 4TUJA 2IAMD 5JOFB 2BFVH 4WTQA 2HT3C 3VGDA 1NDMA 5I1HH 1YPZA 2W65B 4WSGA 1NCBL 1BXWA 4HKJA 3OMAB 5E6ZA 3V0EA 3BPNB 1YEGH 2GKIA 2PWDA 5IBUB 2F54A 3DZMA 2R29H 3FO9B 3KG5A 4ODUB 4U1IB 2E7CA 5AVQB 2PTTA 3EFFB 1VEOA 1HEZA 2HFEB 1A4AA 3FAXA 4ZMZA 1OY3B 3HOGA 5ADPH 3O11B 3WFHB 3ULUL 3ATDA 5I5IA 2XQBL 3ZO0A 1NKGA 1BEXA 4HK0B 2KLSA 2X9WA 1O0VA 1RPKA 3TBWB 4KZDL 2BS9A 3EHBD 4Q6YA 1YAZA 3WY4A 4D9QD 2RIKA 4WWKC 1MPAL 2Y4SA 4GINA 4L4VD 2Q7YA 3UFIA 1DJWA 1PY0A 4FXGB 1D5XA 1S7RB 4IDJH 1T1XA 4MLIA 3SJVE 3NAAH 5LO7A 3ULUF 4G9FA 4DFHA 3G6JB 1LO2H 3L4VA 2QQKH 1BW8A 3PL6A 4Z0XA 1CK0H 5JPNA 5C0DA 4Z7VE 2WAQA 1XGRA 4MKMA 4L1DA 3U9PH 3QA3B 2EC9U 2YPKB 2PXYA 1S5HB 1ORQB 2W92A 2I7OA 2VR6A 4I7ZC 1WEJL 1P4BH 1DLHB 1G9NL 5IROD 1R5VA 1LDPH 2HH0H 3PV6A 5CP3A 4QXUH 4UT9L 5MI0C 1MFAH 1PNDA 1HXYB 1RULH 3UAAA 2WXHA 4EIGB 1GW6A 4M7KL 1LO0L 1K8IB 3ZUNC 1NAKL 3QUZB 3EFOB 1CLCA 3RFZA 2Y36H 3CE1A 1MIMH 1SDDA 2VUYA 4HUCA 2CLRB 3W5MA 1IAKA 3LXAA 3VI4A 1NWOA 2UXTA 1URLA 3OAZK 4WENB 4GI9A 5I6MA 4NQSB 3ASNB 4OFPA 1SOXA 3V4PA 1CS6A 5DFTA 1Y18B 1Z2KA 2FD6H 3NP3A 4HIXL 5AD0A 2VXTL 1J18A 1CXLA 3DUHA 4X5LA 2A73B 4X6CA 4IOIA 3B34A 4YDVB 4R0LB 3MLSH 4ODTH 1M3IA 2JI3A 3ULUE 5KBLA 4DP0X 2M06A 3QNFA 1DVYA 3UZEC 4Q97A 3JWDC 1VFOA 4XP1H 3FFCE 4MGXA 3PQYB 2PO6C 2G9HA 1DJYA 2JJSA 2X3BA 1AIFA 2OMYA 3SQBA 3BE1L 3SBWC 3HC3H 2V5RA 4JR9H 1NGYB 4HUVB 3OXRA 3IFPB 4HETA 1NTDA 1ONQB 1INQB 4UDUA 2EE9A 1TITA 3VFGH 4JY6B 2IEPA 1Y1UA 1YNTF 1JZDC 4NGHL 1ES0B 1C12B 2VDPB 3C6SB 5EO1A 4PBXA 5F7DB 1UADC 1XGYL 2EDJA 4APQC 1NH6A 3BEWA 4NRXB 4JRYD 3T2NL 1B3IA 1PZ3A 4P2QD 4UTAL 1A5FL 2B59A 5DR5H 1D6EA 4ZSOA 5TE7L 2KZ7B 2HKAA 2Y9RT 4YHIB 5GSVA 1BVNT 1PW3A 4NB7A 5ICZA 5EEVA 2J57A 1J86A 3ZTJH 4HUUA 4XWOD 3WFDH 2XKNA 5I1JL 2W8CA 4KQ3H 4M56A 3U1QA 1IEBA 4JHVA 3MRRB 1G0DA 2HXAA 1X7TA 2IBBA 3MRQB 3ECBA 5ECGA 4AIEA 5KBMA 2Q6WA 3OLEA 3P30L 3EOTL 3HI5H 4TSBH 2R15A 5LGHL 3AG2B 5LJYH 4U1MB 4GIOA 4AXWB 3P11L 4OLWL 4N2AA 4K3EH 4N5UA 1MJUL 2CGRH 4LSSL 1QHOA 4PJFA 3CFTA 5AW0B 3QORC 4U1LA 3VD2A 3W0WE 1H3WM 3FSAA 3CZLA 4K7FA 1CFVL 5CGMA 7FABL 3NJLA 4L8DB 4EI5B 4U0RB 3KL5A 2ZT9C 2DQJH 2UXFA 5B8CC 1FZMA 3QDGD 1SYVA 1SZNA 2A9ML 2QTVA 5CEXA 4QRUA 1AGFB 4XPBL 3REWA 1ZLSH 4OLUH 1NSNL 3ZN6A 5LAPA 3V4UL 1TMCB 3TF7C 1N4XL 1N5AB 3VFMA 3LQAC 4MNGB 5EUOF 2WAHA 2JB5L 3IETA 5GIRB 2EIDA 4S1QL 4Y9FA 4N85A 4CC4A 4L3AA 3I02B 4PJ7F 3CZJA 1K3ZA 4A55A 4ZAKB 3H2WA 3S36H 4WRLA 5C0EB 5HYEA 5IB5A 2MPVA 4P2RE 4H26A 4TQEH 1QFWH 2MRYA 5DI8A 1Q9FA 5DWPA 5E2JA 1P5UA 1MRFH 3FHQA 3LKNA 3WEMA 2DMKA 4YAQB 3K8LA 3HE7B 2Y22A 5AAWC 1OD7A 2H3XC 2APWA 2PPEA 4QMEA 3GZPA 4V2BA 2WKOA 4OV6F 4EUPA 3BP7B 4H20L 1HHIB 5I82A 1RK7A 1M53A 1NCIA 1IJ9A 1X7QB 4UDTB 5KW9L 5ALBL 4M4PA 3O3DB 2NOYA 3SGEI 4J5VA 3FF8A 9CGTA 2IDUA 2YARA 3SYSA 2DKUA 4WHTA 5TH2A 2A2QT 5I16A 4HOWA 4TPRL 4FQLL 4W9FC 1HZHL 5E7BA 3D39B 3P4NB 3NJTA 3S5ZA 1UEYA 1IAIL 4RFNC 4AV0A 1QR1A 5EUOE 1MZZA 4JG1H 1XZ0A 4LSUL 4HULB 3GTTA 3DA4A 1UZ6F 4WWKA 1A7NL 4FQQB 3JWOC 5CO1A 2EUZA 1ZK9A 2O61B 3U4BH 1Z3RA 2GB2A 2ZAGA 4W68A 3G9VA 5C09A 4PGEB 1VKXA 3GSOA 2AEPL 3LZNA 2V7HA 3QJHA 5GRWA 2J6EA 3PV7A 5AKRA 1WBYA 1T22B 1ZT1A 5FCUL 3I6LD 4W9EC 3SYCA 1N67A 1ORSB 1VACA 5MEQB 2PCFA 1IUZA 2XTQA 1DJGA 5IIEB 2CM5A 3NABH 1GFNA 3FQYA 3MNWA 4A7TA 4AKMA 3UYPA 3RGVB 2NPLX 5A2KH 1MVYA 1KTBA 2Y2XA 2W9LA 3GFUA 3JSSA 1CICD 4PJ5E 5CGBA 3RY4A 1Q1JH 1WGVA 5I30H 1PX4A 1KBGH 1ZA6B 2GJJA 1XH0A 3WKYA 4X0KA 2YD1A 2F08A 5FGSA 3WY2A 3IFOA 4AYBA 5F9DC 1UXMA 5C08B 2WQAA 5MEPB 2X6MA 3PWJB 4IBYA 1JGDB 4GKZA 4IJTA 5T3XD 2IQAB 3MN8A 3V0GA 5HHOB 4HWZB 3ZKNC 4KV5F 1IE5A 5D1XE 4XB8A 2QVTA 2XZCH 4HOXA 2A6KA 3OKEA 4ZFFA 5C0CD 4NXKA 2EYTB 2NY1B 4BA0A 5JXAH 3K71B 4ODWA 3S98A 4F15C 1AH1A 4UOJA 5JUEL 1RUPL 3LKPB 3ZTDC 1OL0A 1V3KA 1TLMA 3FTVA 1I8IB 4GYBA 1FH5H 2PO6A 4UQ9A 5ANMA 1NIAA 4XPTL 3BW9A 4ADIA 1NBVH 3SBWA 3IGAB 3WEXB 1KELH 1QTYT 3CVHH 2SODB 4AYDC 4FP8H 4R4BA 3PWUA 1KJVB 5IZ7A 3OAUH 2Z7YA 4LSDA 2ARJB 4BYHA 3H9HA 3UJTL 1C8PA 3BSZA 5FUCC 1DQML 3IDYC 3C09C 3H1ZA 4P49A 4Z0BH 3UJIH 3GNML 2XTSA 4JGUA 4APQA 4K5PA 3FRUA 3ZZLA 1NAMH 2ITCB 3DIDA 2VDRL 1GHFL 3AA6A 1GMEA 4EN3D 4LSHA 4NNPH 1HWGB 4L4TA 5AFUK 5MENB 3SKOA 2NY0B 4OUUB 4P23D 1KCWA 3FBKA 3QPQD 1INEH 4R9HA 3RWFA 3QG7L 5HDBF 4R90H 2ZPKH 2R0LH 3LIZL 2HG5B 4K5LA 5JYLA 5IESH 3QULA 1QVOB 2FEEL 4JO4H 2KXPA 4YFDB 1X9QA 4WKZB 3SKJH 2EDYA 4JRXE 1AMYA 3R06A 4QRPA 2H32H 1XB3A 2R1WA 2VO8A 5K39B 2HKFH 1PMYA 4Z78B 4XVOA 1VCAA 3DSNB 1SEBA 1OTUD 3O2VL 3TN0C 1MCOL 4S2SB 5F7EL 5IMMB 3JZYA 1KPVB 4J12A 3QCUL 2DQTH 3CCHA 1NMBH 1WCBA 1CXIA 1ADQL 2A6JA 3ECWA 2HLAB 2XG5A 2ZX9A 4WK2B 2YMXH 2YWZA 3SCMB 3HFMH 3IKKA 3HZYB 2DF3A 5AB9A 5F1NA 5JDJA 3QT2A 1LNUA 4X8CA 4IK6A 4YBQD 4KVCL 1T1ZA 2XWBB 3W39A 3TPUA 2P26A 1ZLDA 5B8CA 4N8UA 4XMPL 4G72B 4E9LA 4KZ0A 4Q4EA 5I5RA 1MWOA 5C07D 2EO7A 5DJZB 5CEZH 1WC7B 4G8GB 1PKOA 3Q9QA 1XGQB 2TSBA 1P5VA 3QUKB 2PUQT 1G7LA 1RJZB 3LNHA 4NXSA 3CSYA 2HN7A 3MBEB 2X0VA 1O9ZA 2NR6C 3H55A 4IMLB 3D18A 5IY5B 2A6IA 2AK4B 1OAQH 3L08A 3K2IA 3QFGA 4PRID 2H26A 2W0FB 4G1EA 1PY4A 7PRNA 3QWOA 4KAQH 4N0UA 4EDWH 5CKGA 4RRPM 3MV7A 4U0QB 3DPDA 4JQIH 5KSBA 3LD8C 5B3JF 4PGBA 5LVEA 4ZMNA 3Q2LA 3VYNA 4N5ED 3ZT7A 2YZ1A 4ONGH 3QDMA 5AAWA 4FEIA 3VXSD 4AYGA 3DMMC 1ERNA 5DT1L 2LR4A 5DZAA 3L7FA 3GBML 3B9EA 5DYOA 2X3CA 1OO2A 2R88A 3QXUA 3T1FB 2BIOA 2EXYD 4MMXA 4CN4A 4Z5RA 5KOMC 2KZ1B 2Z92B 3DBXB 3U6XS 1U8KB 5BZDA 5L0QB 3T3PB 1RZGA 3WAJA 3CX5K 2ICES 1ZS8A 1MEXH 5DO2D 4ZUWB 4WFED 3KBHE 4KRLB 1G9EA 1HJBC 1RJYA 4ONFL 4DF9A 4ISVA 4DP6X 2JKJA 2PW2A 5DHVA 2FJSA 4L23A 5JZ7D 1JXJA 3SE4C 2HT4D 2IWWA 2E27L 2Z31D 4DCQB 1OT4A 2GK0A 4OFVA 3NIDB 5B3JE 5E2TL 1P84K 4YC2C 2Y24A 2NSQA 4BJLA 1T89C 2VDKH 5SV3A 4Y7MA 3OB8A 4MLSA 2FATH 4WUUB 2R4OA 5GGSB 3CC5A 5LAXA 4WAFA 1RZ7H 2ICWI 3IJSB 4AEEA 4GB9A 5F9AC 2H8PB 1M7IA 2I07B 3NJFA 4PS7A 3CFEA 1BCIA 5E4EB 4HMEA 1IIKA 2B4CL 3EYSL 3D0LA 1ITCA 1M05B 4OV5A 4LO9A 1QBML 2GI7A 4XP4L 3ZKMD 3GHEH 4O4XA 3W5NA 1D7BA 2X4QB 5EN2A 5D7IB 5IGXH 3GM0A 3FCSA 3GLEA 3OC5A 5CR8A 4PG9B 3R18A 4J28A 1NJ9B 1CC3A 5JHLL 1TF4A 4Z8FH 4LHJB 3FS9A 2X4OB 5I17A 1AKJA 4NPKA 4HVBA 1GFQA 3RNQA 2CE6A 4YXKL 1WWBX 4N90D 2NLJB 1VEPA 4N2MA 4D9QE 4XVSH 4K94H 4JANA 3AA0B 3L3DA 4L4VE 5C0IA 4FJYA 4ES9A 1Q9OA 5AB2A 1GTFA 1BMWA 1MG3C 1DUYA 3HBQA 1A14H 2AHIA 4U6HA 4XNDA 3VXMA 3OF6A 4L37A 1LO4H 2F0CA 5HYSG 1I1AB 3TT1H 3SGKC 4PFEA 4LPCA 4XOAA 3S35X 2BNUA 2FYYA 1MH5B 2N2LA 1IGIH 3B2VH 3GRGA 3N1GC 1XMWA 2GTZA 4F2ME 4F33A 4PHZA 5A2IH 1VADA 2X1WL 5CXPA 4XBMA 2VDLH 4UI2A 5HJGA 4EI6B 4PGDA 1RPUA 3GSQB 4JS7A 1NLDH 3QPXL 3QR2A 1X44A 1V7MH 5KSVA 1OZTG 1H6UA 2ZOUA 4YUEH 2Z93A 4MQXC 1HVXA 4WV1C 2G9KA 4DW2L 4IW4C 1GCYA 2EH7H 1P9MC 3ZR5A 3GSVA 1SOQA 5TQ0L 4B9GA 4FYSA 5FLVA 4RJXA 1YLBB 3TN0A 3EAKA 4D0DA 5I2IB 4L3EB 1FJ1B 3T77A 1JV2B 3BIBX 1H6EA 3M6DA 2W59A 4HIEB 4C56D 3PHOB 5KJ7E 4WO0A 5LNGA 4PRPA 5FKAA 1KNOB 4KO6A 2IPTL 3B7SA 4GH7B 1NGZB 3MZGB 1HSBA 1Z66A 1NKRA 4XBPA 4O3YA 4X5WB 3NA9L 3UTSB 1JZHA 2OLDA 3K6DA 3KR3L 3TLRA 1CMOA 1AS6A 1K4DA 1I7ZB 4H40A 3MJ8A 4Z95L 4BDVB 4LPYA 2ZKWA 4BGDA 5A2CA 1DANU 4TVPL 2DKMA 4HS8H 4AVIA 4EVNA 4JM4L 4L3CA 4X80H 2VDOH 1XMEB 3V9EA 3R8QA 4JRYE 3O8XB 1UH2A 3QS2A 5FO8B 4Y19D 1DL7H 2NR6A 4OZ4A 5HI4D 4HCGA 5EE2A 2QQLH 3MOAL 2FBJH 1QQDA 3DA0A 3NJVA 1A7OL 4J23A 3KYMA 1AFVL 1E9QA 1E27A 4RGNB 4CMMB 3ELQA 4XOBA 1YMMA 4TULL 2M26A 4ELMF 1DVFB 3BZ4B 4YK4B 5KYUA 3CFCL 3L4TA 1H3TA 2IV8A 5FDWB 2AABH 2X2UA 4LARL 5J1AA 3DMMA 1UFGA 3QQ9D 4EI5C 4LAQL 2Q5BA 1R3LA 1MZYA 2DOCA 3G6AB 1RZKH 3GIVB 4FKEA 5T1JA 4ZUSA 1E3FA 3INUL 4OCWL 1F3JB 4JO5A 2E9GA 5DJCA 3TS8A 4A2MA 3ZUCA 4K7PH 2OXGB 1H3VA 2HJLA 1GL4B 5DCCA 3M45A 1W72L 2YRLA 3QDGE 3AJ7A 2DQFA 2OMNA 3Q6FA 1CG9A 5GRVK 1PL3A 4LPXA 4X42A 3LN4B 2EE2A 1EFXB 1U33A 4MX7B 5HDWA 3DRQB 5I8KL 3VFOA 1GGIL 1RUML 2C3VB 4MQTB 2E9WA 3KBPA 3VW3L 4ZAKC 3LQMA 3TYGL 4KNUA 3QDJA 1S7XA 4IBUA 1ZTXL 4NO5B 2AJYL 1E2ZA 3F7RA 4TVPE 4POUB 1G6RL 4BFGA 4ELME 2X70A 1B2WL 3HC4H 2F6AA 4XMLL 4ZMYA 3Q8CA 3HE7C 1T89A 3EZJB 5JOFA 1SXNA 4F80A 1B0GB 2W65A 1T1LA 3BQUB 5CLWA 1F86A 4DO4A 3GSXB 1IO4C 2OCFD 1KCKA 3F84A 2FLMA 3PABB 4ODUA 3FO9A 4U1IA 5KAIO 4GY4A 5FV2A 4Q0XL 2HFEA 4FQ1L 4TLUA 2CUIA 3O11A 3WFHA 1P6WA 1S3KL 4JO3L 5DU7A 1J0ZA 5CJ8A 1A3LL 1FDLL 2WLJA 1HNFA 1ZIAA 4GBXD 5T3XL 4YSQA 1FAKT 2AJVH 4HK0A 1H8NA 3TBWA 3RE0A 1M56B 2IWFA 4ZW6A 4EIZC 4XHJC 3H53A 2B77A 5D2LB 2WTRB 3APDA 5J3HC 4HS6B 4FXGA 1IU1A 5J0BA 5TD4A 1S7RA 4C4BA 2DWDB 3V5KB 1G7MB 2VNCA 2AV1B 2V7NB 3MDJA 4C55A 1DR9A 1ZSDB 4DPCX 1JWMB 1RUQL 4IIQB 2BINA 4PJCF 1IC5L 1JD7A 2DQDH 3IK2A 2WKLA 2YPKA 3QA3A 1MELA 2VUKA 1GFOA 2F58L 1S5HA 1ORQA 4JFPB 4JJHA 4O02H 1FYTB 3B8SA 1OAKL 4P2YA 3TT3L 1ZE3C 1KCUH 5EDSA 3RGVC 1Z6JT 2B0SH 5E5MA 3I6LE 3SGKA 2H5UA 3C2AL 5JYMA 2BNRB 1HXYA 4KDVA 4N28A 3RVTD 4BINA 5AAMA 2JK5B 3QBTB 1HL5A 1ZTXE 2C7UB 3QUZA 4ZI8A 1RVFH 3EFOA 4MD5B 3QDAA 4H5SA 4GHBA 1RCYA 3TCXA 1GPOH 5TFSL 3VYOA 3WFBL 1KY6A 2K70A 2D7NA 1OK8A 3IN2A 3B7UX 3QJTB 3I75B 2H7WA 2GTWB 5E4OA 3SDYH 4NQSA 4RRPA 1HOEA 1Y18A 2BDNL 1LE9B 3E3QC 4NC1E 2DIJA 2CHDA 5I1KL 4HSQA 5A2JH 2A73A 1MNUH 2X4TB 3MOBH 4R0LA 4YDVA 3CJJA 2KZKA 5I1LB 4PUXA 2ZF9A 3K74B 3DARA 4M48H 1P9MA 1T3FB 3HKZA 4X5RA 5T3XE 2ODJA 3PQYA 4KTYA 5L7XL 2EACA 3HNTH 4PJCE 3BZFB 4ICWA 3ZL4H 2ENJA 4X99B 5CFAA 1CDBA 5C0CE 1NGYA 4HUVA 3IFPA 3SSGA 1ONQA 5BJTB 2Y7MA 1INQA 1IGFH 3V4VA 2V6HA 3JYBA 3GMPA 2X7LB 3A6OA 4G6JH 4JY6A 4M7JH 4MXQD 4Y2NA 4OT1H 5IF0B 1ES0A 1C12A 1JCVA 3C6SA 5F7DA 1OV8A 1TO4A 2N59A 4LU5L 1SLUA 2J44A 4NRXA 2IDCA 3HE6D 2K1MA 4Y0GA 3VFRA 2W94A 2OR9L 4PJDA 1LWHA 3D3VD 2KZ7A 4YHIA 4OJDH 5SWQB 1T0NB 3US0A 1ZT4B 3D48R 1Q9WB 3T2LA 1IM9D 1EFQA 1X4ZA 1H5BC 4NLAA 5GGVY 4UIKH 1OSMA 2RCSH 1R5IA 5BOJA 4AYSA 3PWNB 2OSXA 5ADOL 3MRRA 3MRQA 1MFNA 1SN0A 5IHUL 3CHRA 3O3EB 3S35L 3ARGB 4GSRA 2P5WB 4WSKA 4XRCB 1IBZA 3SGDI 3S8WA 2DBLL 3HZKB 3T0EC 2WBXA 3TC9A 3NVQA 3K19A 1NA8A 1U8IB 1CYXA 3V0VB 3EBAA 5E8PA 2WXRA 3SCMC 1DBJH 3WHE0 4GXUN 1GFPA 5IOPB 3DETD 4L8DA 2E0PA 4EI5A 4P2OB 4IHOB 4NRZB 4BQ6A 4FZEH 4OM0H 3OLGA 4ONHB 4X7TB 1QZ1A 2F15A 1AGFA 2RR3A 1MI5D 1FA4A 3DUUB 1YQ2A 3C60C 3DJRA 4M1DL 1Z9SB 1IFHH 2BFGA 1N5AA 3AT0A 5GZNC 4MNGA 1SXAA 2RJMA 5J13B 5GIRA 5H94B 3MBEC 1X5XA 4FG0A 3OX8B 1JV5B 1UC6A 3HBZA 5C07E 2A74B 3I02A 2WXLA 3HIZA 1KIUA 1OSPH 3JTBA 4G70B 4P5KB 1GW0A 4L9LB 4D8OA 5C0EA 4HAFA 2NX5D 5SV4A 2XDHA 1V10A 3V55A 5DL6A 1WZAA 1CO1A 4PRIE 4HMCA 4YAQA 3HE7A 1OW0C 4DOHB 1K4CB 3ULAB 3EH4B 4ZUUB 4AV5A 2JELH 2CK0L 5C7ZA 3C12A 1F8TH 1HHIA 4IBWA 4X6DB 3C6LD 1X7QA 2MTPA 1AC0A 4KHTH 3O3DA 3BAIA 1J5CA 3AT9A 2BVEA 4KKLC 3PDDA 1BZOA 2FE0A 4PB9H 4XMKH 3VXSE 5INDB 4TQIA 3CDFA 3AY2A 1HXMB 3ESMA 3NSDA 2ORBH 1AXTH 3CTTA 3MA9H 4XMZA 4YHOH 5L0QC 3D39A 1RURH 3L9EA 3P4NA 4W9HC 1MJ8L 4NHUB 5KUMA 3T5WA 1BIIB 1J0JA 1F90L 1FLTX 4QOKA 1VFBA 1U4EA 4OSUL 1RPQA 2QMJA 4U6YB 2X4RA 1RZFL 2WCSA 4FQQA 2O61A 1F58H 5IYUA 1VENA 2XY1A 4MDJB 2JLPA 1SM3L 3RVWD 1KUMA 4GPVA 4PGEA 1QJ8A 5I18L 2VL5B 1S8DA 4BGLA 4PJ8A 4IM8A 4WFEE 3UBHA 5I75B 3TH2T 1UWGH 1T22A 3J8F7 5MEQA 4OZIF 1ORSA 3GUTB 1R1CA 2XTJB 3V0DA 5IIEA 1TJHH 2O26U 2EIJB 4M62H 5EBLB 1UURA 1IC4L 3KGRA 3LK3A 4R97B 3ESOA 1NGPL 1HX0A 3RGVA 2XX1A 5I5MA 5CWSB 4Y9BA 3E2HB 4J2XA 1HEHC 3P4LA 3TZVD 4HT1L 3SOBH 4L0YA 5E4EC 4ATTA 3JZ7A 1AJ7H 4XPHL 2V5YA 1ZA6A 1O9WA 1OGAD 3U9WA 3EGDB 2Y06L 3SB3A 2X09A 3WXWL 4F1SA 5DRXB 4KZEL 1VFMA 2R0KH 2AXGB 1V05A 4H0IA 3K4DA 4W4NA 3MRPA 4RSYA 2NY3B 5C08A 3ZQ9A 5EWIL 5MEPA 4ZTEA 5D55A 5E2UH 1JGDA 2GAZB 1FGNH 2NY5H 5HHOA 1QPPA 4HWZA 3IDUA 3TBBA 3JTYA 5IG7B 5IW1B 4ODHH 4BQCA 2R56L 3KGUA 3B43A 3K71A 2EYTA 1ZVNA 2VMDA 4TKWA 4IEFB 1F2QA 5GS0C 3LKPA 3B9KD 1J1OH 2VCOA 4YSOA 1TNMA 1UM4L 3FQXB 3KD4A 5ES4B 2W9EL 3IGAA 3LKOA 3WEXA 4N90E 3ETSA 1FFPB 2B2XL 2LFEA 3GRBA 1KJVA 1I1AC 5L8KB 3EUDA 2ARJA 1T5KA 3CV5A 5T5FL 3HNSH 3D85D 5F6IC 1P7BA 1BVLB 2IFFL 3L48A 1PQZB 1JI2A 3ESPA 5AVVB 5B21A 3D9AL 4ALAL 1GTNA 3PFUA 4A7GA 2ITCA 2NXYD 4QYOB 2W5PA 4YDJB 5JIMA 1SBSL 3L4XA 5DD5L 2EXSA 3GXMA 1GGTA 5MENA 2XUWA 3IXAB 3L8QA 4JHZA 4OUUA 4UTBH 5CU5A 4QTFA 2C26A 3D25B 3R7RA 3CDCA 3CMOL 3EFDH 1QSFD 4MS8D 3SKMB 2YQGA 2HG5A 4N2BA 2CUAA 4MXVF 1QVOA 3CVCA 1FN4B 1UASA 4I5BB 3SGJC 4WKZA 3A67L 4GMTH 4RWYH 3JV4B 1OP4A 4M1CC 5DEGB 5LBSL 1RK1B 3RIFK 3KBFA 3NK3A 5K39A 1CTNA 3ZRSA 1YEHH 2UXVA 5T1DH 3WJMB 4Z78A 3CXDL 5A6MA 3DSNA 1A7BA 4L18A 2EUWA 3VZUX 1S6NA 3KVPA 2V9TA 1WGOA 4CA4A 5IMMA 4HYTB 3VACA 5KVEL 1KPVA 5GGTH 1HKLL 3T71A 1WAEA 4N68A 2DPKA 1QR4A 2HLAA 3T4AB 2JTYA 1F18A 3SCMA 4IJ3B 1SOKA 1DEEB 3VG0H 3NFNB 4Z7VB 3MUUA 1S5IH 5BRPA 4LB8A 4C56E 4Z7WA 1CF8L 4J4PC 1KEGH 3K5RA 1G7HB 5CJQL 4M5ZH 3QW9A 5DJZA 4ZT1A 1OCRB 5T1LA 2OZ4L 1WC7A 4FXTA 4G8GA 4UB0H 5DHEA 5EZOH 4S1SL 3CHQA 3NRQA 2YUZA 1XGQA 4ENED 3QUKA 2P48B 3BUIA 1MVFA 1RJZA 15C8H 1SQ2N 3SZ6A 3WL9B 3O8XC 4J3UA 4UQBA 1PAZA 3MBEA 4F7CA 1SEQL 4IMLA 4X7DC 2JJTC 4MXVE 2AK4A 3WJLA 1NCAL 2AP2A 3GBNH 3FTUA 5EN3A 4OZHF 2QKIB 4P59H 2VC2H 3BPCA 5C2BH 4RGNC 3ARDD 2D7TH 5JQ6H 3IJHA 2WGNB 3KWWB 3B2DC 4NHCL 3DIFB 4Y19E 5F71A 1DVFC 4YK4C 4X8JB 2RH0A 4G42B 4JFOA 4U6TA 1U3NA 1GOFA 2ZZUT 3G08B 1SUJA 4WJKB 4GW4B 3HMWL 5H37A 2L0DA 4U9CA 5KVFH 4PGCB 2J1ZA 3FOMB 3OKYA 2J2ZB 4FQJL 4IOFD 4UBDD 3OKMB 4YSPA 3CAFA 3RUGE 3ZTJG 1GJIA 5ITBL 4A67A 5CN3A 4PLJD 5FW6A 3FSZA 1TQSA 3T1FA 3TBCA 4ZQKB 3VDCA 3X13B 1X9RA 4OGZA 1PD6A 5JTWA 2Z92A 4P46B 3DBXA 4F20A 1Z7JA 3IB4A 1U8KA 5KVEE 2F7OA 1JVOA 2YGVA 1WF5A 4OF3A 4QLWA 1DQLL 4OGYH 5LCVH 1ACYL 2BVTA 4H88H 1P7QD 4OCRH 1UACL 4ZUWA 2R59A 2XPZA 2GIMA 1AZRA 4WI4A 4QHPA 4P5MB 4TS6A 1TEYA 1ZVSB 1WUZA 4KI5D 4OF8A 1M42A 4QUOA 1E90A 1OF0A 1OP3K 3SOTA 4DCQA 3TASA 3L9RB 1E7UA 3RB5A 2NY4D 3O3AB 3T3ME 3KYOB 4GS7B 2X41A 5D96C 3UBXI 3EDJA 1FO0H 3U6RB 1TETL 3VGHA 5DEFB 5F9OH 3BQUC 1QW9A 4WUUA 4CSSA 3PWPD 5GGSA 4XOCA 3L1FA 4QDGA 5BNXD 1T03L 4JFTA 1JZGA 1IGTB 4ZUVB 5E2WH 4KROC 3FQNB 4XNYL 2H8PA 2I07A 3UGXA 1JIBA 3WGUB 3VD4A 3FBQA 4D64A 1SMAA 1WZ1H 1F41A 5GRXG 1M05A 3GXNA 1MXDA 5GGUB 4DKDC 4IIZA 3DC0A 2X4QA 1TNNA 5IK3B 1HQ4B 3W0WB 3QEQB 5D1QB 5HHMD 1NJ9A 1YNTB 1U3YA 3A4FA 2DQIH 3OHXB 1IVLA 3U1PA 2X4OA 3D34A 4MNHB 2BP0B 1EX0A 5MEOB 4HXBH 4ZXBD 1KULA 2BSDA 1DFBH 2HFGL 2NLJA 2CDGA 1A1NB 3QDHA 1Q94B 3OSVA 2P44B 1CU4H 3AA0A 2OMWB 1Q0YH 3B56A 4IIQC 4LLQB 4Q74A 5DMIH 3WNLA 6PRNA 4MB1A 4YSAA 4AIZB 1N8ZB 4F93B 3M8OH 4HLJA 4HK3J 2FHCA 2IOMA 4KJQD 4HU2A 1XF5B 4X7CC 3ETBJ 2Y2WA 5D4HA 2ADIB 3TZGA 4B9JA 3FKUS 4O58H 4IKIA 1I1AA 1E2VA 2ERVA 3OWEA 4NM8H 3R0MA 4OF0A 4UV4L 3VFVB 4WW2B 3V52H 1VGEL 1ZTMA 1MH5A 3VYPA 3AFLA 4TOYL 1NFDE 2QV2A 5HJBA 5IEKB 1AQHA 4AUUA 4JO2H 3AZUA 4JKKA 4LFHD 4OR1A 4EI6A 4A39A 2OSLB 4OLVL 3STLB 4DKFH 4G7VH 3LQZB 4H1LG 3HFFA 4LXFA 4BD4A 3D6GA 3MV8D 3VXRD 1AHKA 1WBZB 5EIIG 4LMQI 2AQNA 1ODAA 2DICA 5ICUA 4LLVB 2IC2A 1BZ7B 1PD1A 2F61A 3EBIA 3LRSB 3OKOB 4N2LA 1CPUA 1CFSB 5DLMH 4JJOA 1PZCA 2E8ZA 2A99A 1I9JL 4PW9A 1PLGL 4L3EA 5I2IA 1FJ1A 3X1FA 3U83A 1G9MH 1JV2