2KDYA

Nmr structure of lp2086-b01
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
261
structure length
261
Chain Sequence
MGSSGGGGSGGGGVTADIGTGLADALTAPLDHKDKGLKSLTLEDSISQNGTLTLSAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTALQTEQEQDPEHSEKMVAKRRFRIGDIAGEHTSFDKLPKDVMATYRGTAFGSDDAGGKLTYTIDFAAKQGHGKIEHLKSPELNVDLAVAYIKPDEKHHAVISGSVLYNQDEKGSYSLGIFGEKAQEVAGSAEVETANGIHHIGLAAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Immunogenic Properties of the Meningococcal Vaccine Candidate LP2086.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Immune system
molecule keywords Factor H binding protein variant B01_001
total genus 32
structure length 261
sequence length 261
ec nomenclature
pdb deposition date 2009-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2kdyA02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2kdyA01
3PQSA 2YPVA 4O49A 3V8UA 4O3YA 4O3ZA 4AYEC 4O3XB 3VE2A 2W81C 4AYDC 3KVDD 1YS5A 4Z3TA 3VE1A 3UAQA 4O4XA 4AYID 2KC0A 4AYMC 4O3WA 5EE2A 4O4UA 4QQ1A 2W80C 3PQUA 2Y7SA 4U9CA 4AYNA 5T5FA 3HOLA 2KDYA 3HOEA 2LFUA
chains in the Genus database with same CATH superfamily
4UV4L 2X28A 3A5VA 4K9EH 4Y1AB 5HVGB 3TX4A 4N2EA 4J2XA 2QQLL 2ZNWA 3BFOA 4HEPA 1G9NC 2JK5A 3MV9B 4PLNC 2UWEA 1DQLH 2Y2TA 3P73A 5C0AD 1E4XL 2R9HD 5F44A 1MXGA 1ECZA 1WUZA 2EJ1A 4L29B 2G75A 2ZYSA 1NMBH 2CLVA 2JK5B 4K3JH 4XP9L 1D2PA 3VWKC 1AKPA 1QPPA 5IHHA 2M83A 3NG5A 1Q0XH 4Y16A 2XACC 5CP7A 2ICWJ 1W72A 4FA7B 4WFFD 4X9GA 4KXDA 4CVXB 3NJNA 3GSWA 1EO8H 2C1PB 3PJLA 3MRJA 5GTIO 3BUDA 2O93L 3QCTH 1G90A 3PWLA 3R0MA 3QW9A 4NP9A 4Z3HA 2VDPL 4Z7WE 1GC1L 5HJDA 2WXOA 3WNJA 1O7DE 5I1KH 4GXVL 5EF1A 4P2OD 1AKJA 5B38A 1ZRUA 2VUKA 3PYCA 2C3HA 4PYHA 3IGUA 3CTTA 3D39E 5K9KA 3OGCA 2XICA 4KKAC 3OTTA 4JBSA 4OZFH 4L9DA 5C08D 4YXHL 3G5VA 4IMLB 2D7OA 4I87A 4MAZA 3VXUB 1L3NA 1N70A 3VI3A 2VSKB 3QA3B 1IC7L 2CM5A 2PN5A 4P23B 1GW0A 4OCMC 3PWPE 1LO5A 4HAKA 2EDNA 3D06A 3KXFD 3WO4C 4NCC1 1EO7A 1SN2A 2ED9A 3MLYH 1RI8A 4N8CL 4Z7QE 4LEBA 2R39A 1Q9KA 5TF0A 3SE4C 1JWMB 1QNZL 3V6FA 2QVTA 3C87A 3RWCA 3DOSA 1JWUB 3NIDF 4GKNB 1OP9A 4QYOA 2DQHL 5I1GH 5IVNA 1PL3A 3EJQA 4APQD 5E8OB 4KKBD 3ESNA 1C5BL 4ABWA 1WVZA 4TQEH 5K69A 2BVPA 3ZJAA 1ACYL 5E8OA 4J5VA 4PWIA 2W9DL 4OFIA 3A24A 2ADYA 1HTYA 1EHXA 2Y06L 3GHBH 2V33A 1R46A 5EN3A 5E56A 4QRRA 1GHFH 5T3ZD 1FIGH 3RVTC 3WG7B 1A7NH 1QFHA 2WWMC 1K6QH 4W9DC 3VFOA 1B0IA 4N2CA 2BNUB 4BFIB 3DX1A 4TVSa 5I6KA 4N3TA 2ALWA 2Z92A 3FRUA 1NDMA 3DX4A 3JV4A 4MX7B 3TN0B 5I2IA 4YHNB 1KTKE 1IBYA 1JZEA 1KY7A 3N1PC 2DBLH 5LDUA 1GY2A 3T0VA 3Q9PA 2EECA 3PCYA 5B39B 2ADFH 5BRZD 2BNQD 1GCFA 4WHDA 2F7QA 4GSDH 1QKZH 4AK1A 2HFGL 5MHSE 3F3HA 2Z8WC 3LZNA 1G1KA 5GRUH 1DZ0A 3DMMA 3QZOA 1AMXA 4OLXL 4FG6D 4NQCD 2NTFB 2XX0A 4MDRA 2NQCA 2WZ6A 1WZ1L 4U4IA 3O45B 2EC9U 1NKRA 3D0AA 4MA1B 2VC2L 3KCPA 4P2QA 1KTLB 4OFQA 1JGEB 4C4BA 4ANVA 4RNRA 3B7YA 3IN0A 3GSUB 3I9AA 4WIQA 1X5GA 4L5FL 4JPWH 1IQWH 4OZGF 4UU9A 4EQ2A 1P1ZB 5KW9L 2Y36L 1WGVA 1X6NA 3DKHA 3Q43A 2WM0A 4YK4B 1OAZL 2Q1EA 3FQTA 3ESUF 4DWHA 4PR7A 2CCWA 2YPVA 2G3ZA 4JM2D 3WKPA 4NPYB 3WTVA 4QHNB 3CFUA 2B1HH 5IR1A 4UDUA 3QEGL 3T3ME 3B8YA 3LRSB 3VFSB 3WEAA 1B3JA 4WW1B 2EDXA 3FO2A 3BAYA 2H32A 1XF3A 4KZ0A 1OOAA 3QZPA 2YFNA 2H45A 3VZUX 4CN4A 3WLWC 3SGKA 2V4LA 1FZJA 1SRDA 1YY8A 4MHHG 4YC2C 5AB0A 1ACZA 2LW3A 4JL1A 2OQJA 3ZKMD 3OR6A 5FB8A 3MV9A 3FOMB 3B9DA 4I0KA 2FATH 3B9EA 3MLZH 4NRZA 3JZ7A 4QHPA 2R1XB 5E8EA 1REIA 2EO1A 2WQVA 1WAAF 2DMBA 2HCZX 1BAWA 2PP9A 3BN9C 4KK9D 2A3TA 5JHDD 1LO0H 3HE7C 2ITCB 3I6GB 3POCA 4GOSA 4Q74A 3S2AA 4CVUA 3SPIA 1F6LL 3SDCD 1T6BX 3SBWA 2QSCH 1LE9B 4JGNA 1WS8A 2VAAA 4N8VG 1ZLUH 5KVFL 5EOTB 3X11B 4LKXB 1GGIL 4J3WA 4KJQD 3B7RL 2XWTA 1EFXB 4YDJA 4LKXA 1ACXA 1DVFC 1AO7E 1E0OB 1T04A 3X3GH 2IVFC 3CQQA 3K2UH 4LSVL 1RJLA 3BQUC 4ZXBB 4PRID 3T8XB 1CXIA 3RDTA 3II2A 4KI1A 1AQKL 5J5EA 4HS8H 1KV7A 2QDVA 4PY8J 4HBCL 5BQ7A 3OQ3B 3EOTL 3GB7A 3CZEA 4FTVD 1NIFA 4B9GA 5DLML 3BZFA 4J1UA 2APXA 5FKPA 3KZ8A 5TE6L 2DQDL 1AHWB 3QUKA 3SE8H 1BVOA 3DURB 3QCVH 4IRSA 4QJ5B 4MASA 4G8EB 3QVAA 4AIXA 1IM3D 2Z35A 1PZ2A 3DETC 4K7PY 5E4IA 1OSZB 3N44F 4X7CC 3H56A 3RA7L 4UTAL 4P04A 4XMUA 4OQTL 4FQHB 1UASA 1BJMA 4JRFA 3S5ZA 3ZE2B 1V3MA 5ALCH 5AEAA 4AIZA 2ROXA 3UBXG 2UZYB 3QUXA 4WEBH 2OA9A 1BXUA 1X5JA 2O6EA 1G9HA 3PHOB 3MO1B 1QSEE 4PB0L 1JPTL 1BD2B 5FLVA 4NO5B 2WQ8A 2PLTA 4FG0A 2DIEA 3W9DA 1SZNA 3O6KH 5F0MB 3IS1X 4M9OA 1ZGLP 1XF4B 4J3BA 2GAZB 1HCVA 1I3VA 1UB6B 2X4PA 3V0WL 4AGNA 1FL6B 4LSQL 4G7VH 5M95B 1HU8A 2A9ML 2VXVH 4JKKA 1NFDF 2HLFD 4Z7AA 1VZIA 1E54A 1IGTB 1SXZA 2O6FA 4FOMA 3HOEA 5I1DB 4NN6B 4AL8H 2B1AH 4TOYL 3ARWA 4ZUVB 1NC2A 3UGUA 5CD3B 2VW4A 4MLSA 4I0CC 4HJTA 4BE5A 1HSBA 1OGAA 4MJ4A 1BXWA 2IH8A 4F57L 1KGWA 2IH9A 4L1LA 4XNLA 3CD4A 4A6YH 3HNVH 4N90D 2VDQL 3BO8B 4XO8A 1W0WB 1KACB 4I48A 3SSGA 4GLRI 4UTCA 2WIMA 1H3UA 1E2VA 3HAEA 4Q2ZA 4J3OC 2CU9A 4LPCA 4OD1H 4QNPE 3BH4A 2ENYA 3V7AG 4DZBA 4BDVA 3O2VL 4TTGA 4F7TB 1JZ4A 5GRZA 4JHVA 4YLBA 3VFPA 4QO1A 3EFOA 4P46B 3MRGA 4S1DC 4HC1L 3D0VA 5DHYB 5JW4N 3EJYC 2BW4A 4JCHA 4QHMB 3RVXC 4ZAKD 4BA8A 2VC2H 4Q14A 2LABA 2WKOA 4L5FE 1QATA 2FB4H 3PJSA 2ZYIA 5AKSA 3IK2A 1M6OA 6FABL 5FOJA 4F58L 2BY1A 3MRBB 5I16A 2ZF8A 2D3VA 1Q0YH 1YPZB 4K5MA 1I3RB 4OKVB 2MH4A 1F56A 1NUFA 4HDIB 3RUGA 2GHWB 4K8RC 3VYOA 4C55A 2VZSA 3M17B 2DMCA 5D5DA 2JI1A 2ZX8A 3QRBA 5DEFA 4EI6B 1A1NA 4HMEA 1EAPB 3HRZC 3QUXC 5GZND 2ATPA 4LESA 5L0QC 4P23A 3L6FA 1YUKB 2NR6A 4N2LA 2NX5E 1QP1A 5KVGE 4Y5VB 1ID2A 3U30B 1QBMH 3QI9C 5AWNH 4HETA 3ME0A 2Z9TA 2ZKYA 3PGFH 3GSRB 3FO0L 1NIEA 2RFXA 3U9PL 4Z3FA 2E8YA 3QZBA 1AR1D 2ZWYA 4PW4A 1RV6X 3PL6D 3F5WA 3Q8EA 4HIJA 1N6QH 4UINH 3GINA 1DVZA 4JPVL 3TO2B 1T2QH 3ZRSA 3WI5A 1GGBH 4NQSA 3ZL2A 2ZXAA 5CZRA 1G9MH 3ARGB 5BQDA 2AQQA 4XBGA 4GT7A 3KYKL 3AQXA 4PRHE 2ZUVA 1HSAA 3PY9A 5GS1B 2EIDA 1NFIB 1IGCL 3S0PA 4BFKA 1RPUA 2IFFL 4POZD 5J6GA 1MAJA 5C0BE 1JYXA 5J11C 1PFOA 1ZLDA 2Y2WA 5F7BA 4O00A 2PRNA 3T8VA 3VFWA 4Y5YA 5E9DA 2QPUA 3CHPA 3VH8A 3VJ6A 1N10A 3AU1B 3ZTJG 3SDCB 1DVYA 3N91A 5E2UL 4XB3A 3GSNA 3MMEB 3U48A 3SYQA 3SD5A 4NJ9L 1DDTA 2B16A 3EDFA 2E27H 2G0KA 3T04D 1GIGH 2D7TH 4ANWA 1NBZA 5DHEA 4X6EA 5F2FA 2DLIA 1JN6A 1IAIL 2J43A 3EGDB 3U1SL 1OAYL 3COOA 3BSHA 1T03L 2X87A 5E6IB 7FABH 1WFNA 4NRYB 3QR1A 2ARWA 2EC9T 4W4NA 3RTQB 1Q8MA 4AJYV 1CR9H 3GQFA 5A2KH 4G6KL 5MEND 5LG6A 3D25B 5DGRA 4ZZFA 1AQKH 3RTQA 1FIEA 1FFOA 1G9MC 4HZLA 4Z77A 3TO4B 1CLVA 2LU4A 1A6VL 4JPIA 3WFHB 3SKJL 4LCIL 2VDNH 3DV4B 1B88A 3MROB 4N6QA 3WN5C 1OXYA 4Z77B 4KZEH 1MAMH 4JZOB 1BIIA 4MQTB 5DCCA 4WO4A 3S5LB 4E41B 1V7NH 4KKCD 3X1GA 1VSCA 3WFCL 4P0DA 1KLUA 5KTEL 5L2KB 1MWAB 1NAMB 4NJAH 3D4CA 1C1EH 4K0OA 3ATEA 3CLEL 4DZ8A 4YSQA 3RWGA 5E70A 5HJ3A 2F1EA 2JB6B 3VRIB 2KKQA 1WFIA 5FM5O 4HPHA 4YAQA 4IRZH 4P2RB 4DP8X 4NPYA 1WT5A 3LPFA 1M71A 3GMLA 3KPOB 5DZVA 3LHPL 2DKSA 4IRSD 3LD8B 2H32H 4FHBD 4O49A 3KG5A 1QLRA 4YDIH 1R5VA 5IQNA 1MRCH 4YR6A 3MRCB 3STZB 5JPMA 2X1OA 1C16A 1RP9A 2P7TB 3QULA 2OL3H 4YE4H 1BF5A 1A25A 2LHAA 3WD5L 4LOEA 4TVUA 1JPFA 1TIUA 1SYVA 3HW7A 4ZO6A 2C7FA 3WO4B 5IFHL 1MY7A 2B4CC 1EX0A 2H41A 3MJGX 4KKNA 3Q0HA 1THQA 4HJGA 4NB7A 4S1RH 2APVA 3CUPB 1LP9F 3VGAC 4XX5A 1SN5A 3R1GL 2IWKA 1QFWM 1J1OH 4PMFA 5F9OL 4BGLA 2ADFL 2VAAB 3RX7A 3PRZA 3UAEA 5TF1H 2H26B 4D0BA 2B9AA 2DD8L 4PWHA 1AZCA 2WVVA 5DQ9A 5E23A 4ZFGH 1NJ9A 3KD4A 1YVLA 4O2EB 4MJ5A 3VXQB 1ID5I 1GA2A 1RUKH 2IOMA 5GGQH 3WEMA 1NBVH 1BLNA 1O6VA 1OM3L 1BECA 5D1ZI 5AW1B 1LEGB 4LOVA 2VXTH 1C5DB 3EBAA 1BQHA 3CDGA 4X7SH 5EO1B 1FV1B 2AK4E 4AMWA 3RQ3A 4EOWH 4KK6D 4M7JL 3IDYC 2J8OA 5IVZA 4LIQE 2DMGA 3B56A 4I5BA 1RIUL 3OZ9L 4X5LA 4ZUUB 3S34L 3VQ1C 1B9ZA 2AI0H 4KI5E 1EXUB 2XWRA 2NYYC 4JKMA 4UILH 4NZJA 2GB2A 2AJUH 3ARYA 3I85A 1J86A 2X9XA 5D55A 1L9QA 4EUPH 5F1SA 2PCXA 1WP6A 4N1EA 3O6FD 4I2XE 2Q76A 2WLLB 3HVNA 2NY5L 2PO6C 1DBAL 1S5HB 1TYJA 2FYYA 2QL1A 4CSZA 2FEEI 4Z5RB 5HDOA 3SQOH 4H5SA 5C6WH 4NYLB 3VXRE 5CP3H 5AW7B 1GJWA 4R7DB 1T1ZB 3CHXA 2MHAB 4Q9RL 2K6WA 3E2HC 4ADGA 1IL1B 4LF3B 2QLVB 4Z7OF 1A0QH 1PCXA 2NNAB 2WQWA 1E5UI 1YMMD 4DAGH 4TSCL 5KJ7E 2QV4A 3JWDC 4JDEA 4ONOA 5C0DB 3KL0A 3E6FA 3EFDH 5H4ZA 4IOFD 4NCC2 5F7YC 3K6NA 3RHWF 4OVVA 5EV7A 4AFKA 1DANT 2EZ0C 5C0DA 4UNIA 2V17L 3VNYA 5DFTA 1HSBB 4XOAA 4AVHA 1UZ8B 4YN3A 3SE9H 1T16A 2A73B 2J88H 4KTEL 4UTBA 3NGBB 4OF6A 3AG4B 3JV4B 4MX7A 4PY8I 3LKRB 5I2IB 4W9FC 1MPFA 4JFQA 1HL8A 4KY1H 4BV1A 1IC5H 2M07A 5AVTB 3W2DL 2CR0A 9CGTA 4GQ9H 2EXYD 1Q1JL 2F08A 3T0EB 4NXKA 2CGRL 2AERT 2QELA 3HG4A 3QXDA 2EYTB 4LVHB 4TUOA 2PWEA 4KUCD 3BPNC 5C08B 5LAPA 3T71A 4A38A 2NW2A 2NY2D 4QYAA 2XKNB 3HE6C 3QNXA 5CR8A 3UG3A 4M03A 3ZKSD 2VN3A 2PWDA 4AEIH 3B83A 3IDIA 3AS3A 2XTJC 1JF6A 4QO1B 4YHMH 4DGVL 5T3XE 4UB8O 2H2PC 3EOBB 4YHYC 5K9OB 2AJXH 4H88L 4RFNC 2AP2A 4R3SA 2BSSB 3BVWA 1QZ1A 5FA4B 5BOJA 1XQ4A 2VQTA 5M94B 3X3FH 2J88L 4URTB 4GRWB 4RA3A 4FD0A 1GC1C 3SOBL 4FUVA 1Q72L 4XNQA 1JNJA 4G6MH 3D3VD 3BVNA 3LZLA 4M7LT 4CADB 4UM8B 1G7MA 1S5IL 2WCGA 3KYAA 3FT1A 3MRKB 2EUXA 5F7WC 2K9FB 2WIIB 2MRYA 3CVBA 4OV6F 3LK42 4HCRH 3OKEB 1ZGLM 3TT3H 4JM2F 4XNXL 1UXWB 2X4OB 4A6YB 4J39A 3QNFA 1UFGA 5JQIB 1KJMB 2OSYA 4M43L 1Q0EA 1X9RA 5D7LD 1ZHBB 3QNZA 4GXUM 5DJXB 2ATPB 1RZ7L 2FGZA 3AWFA 4GRWE 3VFGL 4DKEL 3VQLA 4KBPA 2BP3A 2Z31D 4XPBH 3VFTA 1Z6JT 1JGLH 3I3BA 3PV6A 4K55A 1SM3L 5CJQL 4HJGB 4FRXA 2A9NL 2EKSB 1FG2B 1X9QA 2OW6A 2R15A 3A6BH 3WS3B 3ZDYF 4Y4KD 2O6PA 1HJBC 1BBDH 2GJ6D 3GXIA 1MWAH 3BAEL 4XVJH 3WEOA 4ZNEE 4G8AC 4R4ND 1PKOA 5C09D 1IBGH 4FESA 4FABL 1KOAA 3V6BR 3TBBA 1JBJA 2P5WB 2PO6A 5MEPB 5D1ZB 1YNTF 2X9YA 3P69A 4LCYB 2QKSA 4RGNB 2F1BA 2Y1YA 4XOEA 5MEPA 1MRDH 3KPNB 4NLHA 1IT9H 4HU8A 2E7LC 5DTFB 1NLBH 2WNWA 5F1IA 3VFWB 5IB1A 3HR5B 4AXWA 1DQIA 1HEZA 3HWBA 2ZXWB 3QHZL 4N0RA 1G7IA 2NUPA 3FPYA 2L4OA 2QGEA 1KEMH 2P5WD 4IU3A 3IMSA 4MDIA 3SKMA 3GIVA 1BBJA 1IC4L 2JSFA 2FTAA 3U9WA 2ZXDA 2OZNA 2RTTA 1INQA 1U8QB 4U1SB 5KYUA 2RCSH 1Q9OB 1KN4L 3OZKA 4B9PA 5I74B 3VFMA 3SDAB 4K3BA 3TT1L 1YPZE 2VRKA 5DK0A 5FHAH 4I4WA 3RPKA 3PWVB 4NIKB 1SUHA 3RVVD 3RWJB 5EOQH 4C4VA 1TEFA 1DN0A 4EI0A 3MBXH 3TO4A 2BK8A 2OYLA 4PG2A 2EUWA 1X6LA 1JPEA 5IP4A 5L9DL 3P54A 4PJHE 3RIFF 3FQWA 4LLWB 4E36A 1RFDL 3MRQB 4D0DB 2DQEL 3MRDB 2C9PA 1MFDH 2QGCA 2VDLL 4UT9L 1OF2A 5LBVA 2YUXA 4P59L 2DYSB 5A2AA 2W95A 3JT0A 4CVXA 3I6GA 1RPKA 4XMKH 1N12A 4IGBB 4KNTA 3SDXA 3UIZA 2J4WH 3LX9A 4PMEA 4NT6B 4D64A 4CJ1A 3P4OB 1M71B 3KPOA 3BWUF 4YHIB 4A7GA 1HILB 3SKNA 4FG6C 4OZGA 3I02A 4PRHA 2NT1A 4W9HC 5GZOD 2OTUB 2WLMA 1XT5A 4M1DH 1MFCH 4P2AA 3TBTB 5FR3A 4PRHB 2Z7UA 4P3DA 4PV8A 4OJFH 5J0BA 4R7NB 3DTUB 1N7ML 5DS8B 2ZUUA 1DSFL 3NOIA 5INDA 1MLBA 4HFUL 3DVIA 2E27L 3AGVA 5ILTH 2CJ3A 3W2DH 3KPRA 2DV6A 4PJ7F 5D4IA 3CZJA 3FQYA 4XHJC 4YX2L 3MRIB 3W5NA 4YEEA 2QEJA 2IALA 3BX7C 4ZYKB 4JPKL 4ZS6C 3RLSA 4BCXA 2ZOUA 3H9SB 4BE6A 3WLWD 2UXTA 2F1TA 1JPGB 4BFNA 4Z0BL 2FNBA 3SE9L 1OTSC 1Q9KB 3MNDA 5I75B 3VXUE 4MB5A 3GJFH 2ZSWB 1P4BH 4R8WH 3UTSE 4JLRB 1UD4A 3PJNA 2CKBB 3RWIA 1WBXA 3QJHB 4LSSL 1HVXA 1KFGA 3IGKA 2GITA 1Q1JH 2EEDA 3HJ0A 1WBXB 1JXFA 1YMMB 1FCCA 1OT4A 1AOHA 4ABUA 5HHMB 5IFJA 1WEJH 3ARBB 4JJ5B 4BZ2L 4O3WA 1MG3C 3PP4L 3QWRA 1GS6X 1KG0B 3KVQA 4P2OC 2A4EA 3PHSA 2A6IA 3DVFA 2VIRA 3LS4L 4K5OA 1HL5A 1WZMA 2IDFA 2OK0L 2PXYD 1TJMA 5IV2A 1XF5A 3CSFA 5C0AE 1M4KA 2GI0A 3E9TA 3FPXA 1KCWA 2KLRA 4ES9A 2A74A 5DVOA 1IZNA 3G08A 3OPZH 1CICD 5FYJD 1KN2H 1S7SB 3CFNA 4HUVA 5MENB 1QSFB 2KZ7A 1IZNB 3G08B 3JWDL 3C60B 5HI3D 1EHAA 3WFEH 2GJ6A 4Z95L 1ZD6A 1RLBA 4A2LA 3VXSB 3QIBB 4MXVF 2C7UB 4YHYB 5D1ZA 1XGTB 2WY3B 4XN9A 2NY4B 1M1SA 5D72H 3NT0A 3ULUD 4R83A 1XWVA 2R0ZL 5E99H 5HI4C 3U2SA 1BZEA 5EOCH 2MPAL 3IGAA 4ZMXA 4M56A 2UWEF 4N0UA 1OZUA 3GMNA 4JDTH 3K0YA 4MLIA 4OH2A 3TBVA 3ILEA 1DJWA 2NY6B 5SWSB 1F4YL 3D09A 1A7QL 4DAGL 4MD0A 4W68A 3K6SA 4MNHA 1CFVH 4WU7B 4KGJA 3TBVB 4QTHA 3RY6A 4R90H 4HBQA 4F7CB 1LL1A 4GLRH 1KPRA 3V6OC 3WUWG 4WI4A 3DZMA 5DL6A 1I1RA 2XZQH 4XO5A 5DUML 2XFGB 3V9CA 3PJSB 4UDTA 5FM5M 5BVJA 3FRPA 1G6RL 3EGDA 1U3HD 5CILH 1E2ZA 1IKOP 4CC4C 1ET7A 4V1DA 5FCSH 2VUOA 2YRLA 2MNJB 4O3XB 2BY0A 1KV3A 4I3SH 5HVFB 2BWQA 1MLCB 2B9BA 2BSTA 4F27A 2NY5H 5C0GB 4PJ5E 4HOZA 3EDJA 2XQ0A 1S8DA 4FZNA 5EBLB 1TYEB 1L0PA 3BP4B 1E6OL 2HTLD 2L7JA 1NGWB 4OFKA 2F54A 4KRMB 1F4YH 2CK0L 2R59A 1M7DA 2A6DA 2DMHA 4UTBL 2FSEA 4J6RH 4L5FH 3CWGA 4R3SB 1SJEA 1O9ZA 4DGIH 4FFWD 4PJBE 2C3VA 2DQEH 4V1DD 4AENB 4UIMA 1UM6L 1ZXQA 1Z5HA 5TE7H 5LBSH 1X5YA 2L7EA 1HSAB 3SYOA 4ZFFA 1WICA 4HF5L 5GHWH 1GMEA 3ZHFA 4HSQA 2ZXGA 1U8PA 4NRXB 2EDWA 1ZWIB 5JW5B 2XWTB 1N3NB 5BCAA 4PJ8D 2EEXA 3LNDA 1TTRA 2R7EA 4MNGE 3UZQB 4YUEH 4KKLD 2ESVB 3LN5B 4RZCB 2WCPA 4NP4L 3TV8A 1S9XB 1TQTA 3QBTB 2DLFH 3BC9A 4D2NA 5JIMA 4IRJD 3CFCH 2CRYA 5D1XB 4QAWA 1DQQB 5I8KL 1K5WA 2VDOH 4XPAL 1VZGA 3H9SA 3AY4A 5DO2C 4Z8FH 1OPGL 2BIPA 3UO1H 4AKOA 1PG7X 1JGVH 4IK7A 3RZWA 3WMQA 3RTQD 5JPNB 3QHFH 4ANKA 4LSPL 25C8L 4NSKA 2BCMA 3HNSH 1NCJA 5FYJU 2MHLA 3TF7C 5DMKB 5GGRY 3N0PB 4WCYH 3WXWH 3MREA 4NUGH 4TMPA 5E5RB 5JMRA 1BQHG 4AGMA 1HXMB 1OE1A 1OV8A 3EHBC 1H6EA 2A99A 3KPNA 4ZXBD 3MREB 4X98B 1DLFH 1SHWA 3AQZA 4JRYE 4AYGA 4H2AA 2Q7AA 4LDEB 3MTXA 3K1DA 2VERA 2BVOA 5KVEE 2EIZB 1A7OL 1CDHA 2BNRE 4X6BB 2NY5C 3EJPA 4LE8A 3DX7A 4CAGA 1FO0A 2DQUH 3NFPB 2RGSA 1YNTB 2EIZA 5CUSH 3P2TA 3QB7C 5DK2B 1OSPL 4I77L 2WBWB 4RNRB 4P2QE 4OGYL 3ZK0A 4G80A 1JGVL 3LD8C 1OCRB 1HN1A 5FW8A 2W9EH 4HK0B 3HFMH 5CKAA 4ZTPL 3PGCA 1W2KT 3CXHK 3JSSA 4FFZL 5E2WH 3VXMD 2J4UP 4XPHL 3QH3B 2DQ6A 4Y4FA 4YFDB 1W0WA 3CBKB 5AW4B 1DN0B 1KGXA 4JFPA 4YIQA 4V33A 2DYRB 5D96B 4Z1PA 1QFWI 4Q9QH 1HC1A 4X9BA 4QQ1A 1C12B 4LNRA 4W9IC 1RHHB 1WBZA 4OT1H 3MRPA 4GFTB 1WWBX 5DZOA 2AEOA 4DEPB 2EXWD 2KDGA 1GGCL 2IXQA 1IBBA 4DQOH 5D6CB 3QFGA 3NESA 5A2LH 4FSPA 3CUPA 3DXAA 4MJ6A 2CO6A 3KJ6L 3D0VB 1ZLSL 5JO5A 3LV3B 5IMLB 4MD0B 4P9MH 3BP5A 3DARA 4JHAH 4QRPE 2PPEA 4HS3B 2VERN 4QF1B 1PEWA 5HVWA 3VSUA 3MNZA 1Q9LA 4GSUA 3MRBA 1YEDA 2Q3ZA 5EBMB 3U79A 4Z3EA 3T0BA 2A9AA 2DI9A 3K2MC 5I9QB 1N2RA 5HYJD 5T5FA 1H5BB 3E0GA 3GI9H 3H1ZA 4X80L 2EZ0D 5TDPA 4LVNB 1U8OA 4NUJB 1XAKA 3S3CB 3ARFC 1BVZA 4HSAC 3WD5H 3FO2B 1JS4A 1OTTD 5EEYA 4OV5B 3JVFC 4JN2A 4OJDH 2O26U 1N19A 4FA8A 2VABB 5CEZE 2YGVA 1IQWL 1AHWA 3PV7A 3QUKB 4FQXB 4HUCA 3POQA 1SVCP 4L3EB 2NXZC 2MFNA 3SGEH 3R4RA 2AQ2A 1IQDB 4HIJB 4CILA 5IESL 3MJ7B 1D5ZB 1M3IA 4JGUA 3MJ7A 4MKTA 1AXSA 5I66B 4FZLA 2WWKT 3A4DA 1QSZA 3QJSB 2ZXQA 4DGIL 4HALA 5T1JA 2EYSB 5IUSA 2GTQA 2YRZA 5DR5H 5DWPA 5K9QG 4CADA 5C0CA 3BUYA 3S35H 1CGUA 4U1MB 3MCLL 2XTLA 3BJ91 2UXGA 4WDIA 5HVHC 3ARVA 1UVQA 3QDGA 4OLUL 1BW8A 2APBA 3HG1A 5SX4H 1MCPH 4KRPC 1K5NB 3BKYH 5CR1A 3TCLB 2AEPL 4K73A 4I9WE 4IEFB 3SO5A 4K7FA 5F3BA 1IE5A 1P2CB 4B7LA 2QLYA 1P4IH 4P07A 3U25A 4G8IA 1U93B 5DI8A 3L3JB 3L4VA 3NABH 2BSCA 4ODXA 3A22A 3BFWA 3MOAL 1CLYL 5FO7B 2ZUQB 2DI8A 2IJ0C 3MYJA 3L4ZA 5CN1A 3P9LB 5SWQA 4RISL 3L3JA 3EOAB 2G9HB 3LQAC 3WUWA 3T6QC 3QCVL 2BS71 3QEUB 3ZDZE 4PJIB 3TTSA 1Q72H 5T3XH 4JFHD 5BS0D 4UBDD 1WQVT 1ZHNB 1TJGH 3QZNA 2OMBA 2LVCA 3F58H 3H9ZA 4GRMB 2IF7A 1PGRB 4IBTA 5JQ6H 4Z0XB 2GY7B 4L8SB 4ALAL 1NGYA 1IAMA 3V10A 2WYZA 4U7SA 1LNUB 1T1YA 5BS0B 4TSCH 4JZNA 4BK4A 1YYLH 3A2SX 5LLIC 4Q9BA 1BXXA 3HZMB 3FHAA 2OYKA 4GRLD 1DFXA 3A67H 4KY2A 3IKKA 3PF1A 3ZHLA 4ZO8A 3O6FC 2WW8A 3ML8A 1OP3H 3WTXA 3C2AH 3STLA 2XG5B 4JKWA 5TGBA 5FF6A 4LMQI 5ETUA 3V0JA 2VMJA 3BVNB 4YSDA 2MCAA 3UJIL 4KK5D 2Z4QB 3BXNA 3OPZL 1MQKL 5T1KD 2FJFB 2GSGA 2YAPA 2ZX9A 3D30A 4L9LC 3D4YA 4YHOH 1MCWM 2Y0LA 4FRTA 4S1SL 2J57A 5ENWA 4UQ3A 2CGRH 3BT2L 3V5KA 5HDLA 3BRGC 5JPMB 2W59A 2CALA 1HE7A 4QRTA 1F6FB 2XRAL 3VWJD 4URKA 3OR6B 5FB8B 2GTZB 2FSEB 5E6SB 4HFWA 3VB9A 4ODHL 1XH3A 1MCSA 4NJAL 3T8MA 5I15L 1V7ML 4NZRL 2SODB 4BDVB 4JQIA 4OLVL 2J8UB 3MRLB 1O9WA 2X3AA 3ULAB 1WWAX 3QJQB 3GUFA 3T3PE 2AF2A 1KB5L 3PWJB 3RGVA 3BAXA 1MCOL 4BBWA 4E9LA 1PNCA 4K15A 1SDAB 3LHAA 3SO3B 4EI5B 1ZE3C 2J7LA 5DRWA 5T1MB 1E4WL 4AYID 1YAIA 2OKMA 3D2UB 3EJTA 4MJ5B 1C9SA 1EXGA 4GJTB 5J9PB 4K2UL 4TUKH 3BIKB 3G5YA 4YLCA 3LH2L 4AGPA 5FDWA 1NCCH 3MBXL 1WS7A 2YIHA 4GIPD 5FYKE 2OTWB 2P8LA 5ICUA 3CK0H 3ZYJA 1AZVA 5C07E 2EDYA 1HYSD 3KLKA 2LTQC 1I8KB 4D7BA 4O3YA 4ES8A 3UBXB 4WGWB 3KDMB 3QEQE 1RIVH 3K80A 4YMPA 4HWZB 3G5VB 4JGJA 3P0YH 1NFAA 4RMUA 4U6HB 4AJVA 1EBAA 2EE9A 2H8PB 3ESOA 2JIXD 4ZFGL 5GS3A 3NJXA 4Y9EA 1L7TL 4JE0A 5D1QC 3L1GA 4QRUB 5HHPA 5DDHA 5T5FH 4WGVB 2MEJB 4HAGA 4IDJL 4U2ZA 4PJCA 5D7IE 1CK0H 1SBSL 3AITA 2Q3XA 4NO5A 5KVDH 4WVRA 2VDLH 4GO8A 5GS0D 4JPVH 2XE2A 1J11A 3GDBA 4Y1AA 1JNNL 2W38A 5SWSD 5CZKA 4W9LC 2YXFA 1AI1H 1K5NA 3PUUA 3MNVA 3CDZA 4XBMA 3W11C 3OJVC 5CN2A 1HL4A 3HC4H 1MWAA 1A6TA 4TNVK 5EU4A 2VDMB 4G8IB 3BPCA 4A37A 3H3PH 1UD6A 3RWEB 2IPTH 2ZT9C 1ZLVK 2XJLA 1R1CA 1TUPA 3IRZA 4OAWA 4F24A 1VFBA 5CD3A 1S5LO 1EMTH 1PNDA 3DECA 4YVNA 1RZFL 1G1YA 1DUZA 1EJ6A 5F96H 4X5WA 3B8SA 2Y5EA 1OL0A 1B4JH 4UNUA 1ZDQA 4C56D 5LGYA 3MROA 3LSOA 4UV7H 5I6PA 4J23A 2VGLM 3PAYA 5E5MA 5E2JA 4ZYKA 5DO8A 3KPSA 3U2SB 1NSNH 5JA9A 2HVJB 1M53A 4QOKD 3KWWA 1XGUB 2XFXB 1B4LA 5D1XE 5DHYA 4O4YL 1E6JH 1KSRA 2B5IC 1U6AL 2OP4L 4PREB 4BZ1H 3DV6B 4P57B 1BMGA 2LR4A 1LK3L 3ES6A 2F8XC 4FA6A 5D4HA 1DVTA 4ZW7A 4GXVH 5DJ6B 4UB0L 3QT2A 5KZCB 2YNKA 2HJFB 2WINB 2X6UA 3HLAA 1E9OB 3ZE2E 4YR6B 2C9SA 4Y2LA 3V4UL 4ZMNA 3CDGB 3BGMB 1CBVL 4RX4D 2VH5H 4KMQA 3BUPA 1NGQL 2XSKA 4DGVH 1Q0XL 1KF9B 3FQ4A 3VH8G 2F5BH 1UJ3B 3TNNA 1Z9NA 1HX0A 4DESA 1BFSA 4EMZA 1TTCA 1DLHA 2EKSA 4N9OB 4F37F 3GSOA 3K46A 1PZ3A 3FO1A 4JAMB 3S36L 5E6ID 2G2RB 2VDRH 5HHXH 5LGHH 5KVDE 1JG9A 4AKRA 2ATKA 1YNKL 2I5YH 5AUMB 3UPGA 3WE6B 1WGOA 4X5RA 5I5MA 2FO8A 4NQEB 3FUIA 4Z3JA 3LYRA 4XMVA 3KPMA 5CEXA 3FYIB 2IFFH 4PSRA 5K93A 3U4EB 5E9DB 3HHMA 1HQ4B 4OVUA 4QXGH 5AW3B 1TT6A 5D2LE 3SDCA 4ANXA 4R0LC 1RK7A 2X2IA 2GQHA 1S7UB 3L17A 5E94A 4NQDD 3ULSB 4AUIA 4Y88A 3J07A 4U1JB 3FDWA 1G7IB 2VL4A 1WITA 3FUHA 5I76A 2HG0A 1ZA3B 1NDGA 2GCYA 2BZCA 2FB4L 3FO9A 1RZQA 1UOVA 4FLOA 4QXUH 3KR3L 4HKBB 3SY6A 1TQVA 3VD1A 1QBML 1E4HA 2ZXEB 3F7QA 2J2ZA 3VNZA 4GUPA 2PR4H 3AXLA 4NO3A 4Z3IA 3UAAA 5HHPB 2J72A 3P0YL 1BH3A 4HKBA 2FVNA 3T20A 4WEEA 3PGRA 1IILE 2A4CA 3ZUCA 3FNKA 5HPMA 3UERA 1FSKB 2KL6A 3APCA 3M07A 3T5WA 5IVXB 3F62A 3JV5A 3L95B 5B3SB 4PEEA 1PY0A 1HXMA 3FU0A 4WI7A 3GI8L 4HWUA 3ULVL 1FFOB 1C08A 1UCBL 1H3XA 1WA0X 3UTSA 4ALAH 4F7EB 4X6CE 5A2BA 4ZX6A 1KLUB 1NLDH 2LFEA 2VO5A 2ERJC 1AQHA 5B8CA 3NRPA 5E0QA 1NAMA 2Y5TB 1ZTXL 1YEWA 3UTSB 3L9EA 1U8HB 2AXWA 5FF6B 4Z7UF 3STLB 1IX2A 1N64H 1VCAA 2B2XL 3HC3H 3WS6A 3NACL 4JFFB 1I7ZB 5ACZA 3L13A 1BOYA 3L3HA 1LEIB 3Q2NA 4F15B 2WQXA 4J28A 5TISO 2PR4L 3DO7A 4Y0GA 2IQAB 4GMSH 5CILL 4Y4HA 2DLEA 3IFLH 3JV6B 5C0ND 5ESAB 3ECBA 4ZFZA 3MLTB 3KLHD 4OD3H 5TDOB 2RIKA 4YDZA 5ABAA 3ZE0E 1RH8A 3FT3B 2MIZA 2F7IA 5HGGS 2Z8VC 3JTSA 4P3WA 4PRNB 4HCRL 3TTYA 3OAZK 5C0AA 1SNRA 3CMOL 4OFVA 1RHFA 2A6JB 3QFDB 4TSBH 1KFAL 2GJZA 3TLRA 1XH3B 1AFVL 2XA3A 3C5ZC 2OR9L 2EVIA 1NCDH 4G8FA 4LO9A 1JPFB 4E9RA 2AITA 5FYKH 4G6FD 4C47A 3FTSA 3HC3L 2FLRT 4J3OD 2DH3A 2HLEB 3O2DL 5J12C 1L7IL 4HK3J 1P6FA 1UGKA 5GJSL 4F7TA 2IBZY 4R96B 5HHOD 5KTEH 2G3NA 5E03A 1A7RH 3LKPB 5IBLD 1YMMA 3TZVA 1HT6A 3ES6B 4AZLA 3TEUA 1K4DB 1JWMA 4HJSA 4C56B 3DGDA 3GJFK 3L8QA 4Y1AE 1KB5B 1AG6A 3AAZB 2BVQB 4ZAKC 3VU2A 5D1QE 4G9DB 2DQGH 4AOFA 4JFHE 1SXCA 4JVUA 4LB8A 5EO1A 3EOYG 5JW3L 3AAZA 1CTMA 4NLAA 1BLNB 4RAVB 4Q0XH 4XN2A 1YPZA 1JL8A 3ARBA 4JJ5A 4FN0A 2B7DT 3FTWA 3FCUB 1DDHB 3FB5A 5DT1L 4ZTPH 1QEXA 4RX4A 1GGYA 4ATWA 1EAPA 3H0TA 4FADA 4L1DA 2NY0C 4HYTB 5AW9B 1J9TA 4JE4B 4ONHB 2QT6A 1A6ZB 2QFRA 4BD4A 3VE1A 1T0PB 5DJ0B 3GMPB 4ZOEA 3CVIL 4R2GD 1JNLH 5EUOF 2P8PB 4XO4A 2OMWB 4XMLH 4X6CA 4ZX4A 2CRMA 1S7VA 4MMXB 2WHVA 1J0KA 4QWWD 3L9RB 4HWEL 4E5XB 1QOKA 2ZPKL 3B7SA 4PG9A 4YO0B 1KNOA 3U6XS 2E6JA 3RZCD 1QI5A 3PU7A 2OV0A 2QFPA 4MCZB 3P9MA 2AS5M 1E3XA 3P4NB 3HCVA 1BQLL 1OKEA 1Z9SB 3HAEB 1FAKT 2XNAA 5JDJA 2C7UA 1BOGA 3FN0H 4JFXA 4L4TE 4PSPA 4JR9H 2D0FA 3LEYL 2PMZA 2OMXB 2WTRB 1HNYA 3GNMH 2CO3A 3MBEC 3ISWA 2E7HA 3QEHA 2UWEB 4JFDD 1XH2A 2BVYA 4XB8A 1AS8A 3X17A 5A6IA 3VFPB 1S9WB 2PCPB 3TCLA 5A2CA 1SJHA 4L4VD 5E7FA 4TSAL 4W4OC 4FP8L 1Y7VA 4E9TA 2FEJA 5E7BA 1I1FA 4QLWA 5HYJB 2P24A 1CFQA 2I32A 3BQUD 1HQRB 2G5BB 1DCLA 3VI4F 1QKZL 1HH9A 4EDWL 5CSZA 4I4WB 4UDTB 2IWVA 1LYQA 3O3EB 5I5JA 3SGKC 5EU3B 2ZX6A 3F83A 1RZ8B 5EZIH 2M2DA 1UKQA 4E0RA 1M7IA 2F74B 2ZCKH 1HCYA 3ZKXB 5FHAL 1OTSD 2NXYD 1JHKH 5K9KB 2GJ6E 4FQJH 1XR8A 2AJYL 1U92A 3QPQC 4ZFOL 4FQXA 3DVGB 1HWWA 5HD8D 5AYUL 5KANG 1SOXA 3F01A 5AOLA 1BEYL 1PW3A 2CDGA 4D8PA 5IQ9B 1I9JL 4NHUB 3SY0A 1WE5A 4HC1H 1IGIL 5IM7A 3EBHA 4Z7OE 4H8HA 5CEZL 3UCQA 1O5DT 2X4TA 1H19A 5GGTA 3GZOA 4QAMB 4G6AD 3RJDA 2C3VB 4AM0B 1I1AB 3D2UD 1W8EA 3RJQB 4AENA 2X4TB 4IQHA 4HGWB 1H8LA 5AAPA 4HEPG 2IGFH 4LSRH 3HLAB 4ZO9A 3WEXA 1QFUL 4KQ3L 3W0WE 3FZUD 4L4VA 2FX9H 4N90E 3TJPA 4YGVA 3TBTA 4N9GA 1OOWA 3TV3H 1SFHA 4B9CA 1J1PH 4R4FH 5PCYA 4XC1L 3VE0B 1FJ1B 4KDVA 1V3LA 1CGTA 2VLLA 3TNMB 4EXPX 4GUOA 4NQTA 1AC6A 2ID5A 3UZEC 1MIEH 1KEGL 1IGYB 4OB5L 3K8LA 5SWZE 4WUUB 1QTSA 2O6DA 3SE3A 5D1XA 5IK3A 4UQ2B 4JFEB 4BH7A 1EK3A 1Z5LA 4Q6KA 1OM9A 5TK2A 4XBPA 1IEBB 4H1LA 2E46A 4HJIA 4FNRA 4TUJA 5I1CL 4AKRB 1DYZA 4XC3L 4XNAA 4TNVF 2YOCA 3DPBA 3TESA 1W6WA 3EYSL 4N5ED 3RGVB 3T0WA 3W39B 2P8MB 1OGTB 3EXLA 1B4TA 2WLKA 3LS5L 3ARDC 3OQRA 4N8CH 3E1F1 4FMFA 1U91B 3MV8D 2CIIA 3NCYS 5EORL 1NKOA 2Y3NA 2ESVD 3QIUC 3T2QA 2APSA 1JUFB 2EDTA 1G84A 4G1MA 2GBUA 2NUPB 2PTUA 3D39D 5DK2A 3WFBH 3ASWA 4XVSL 5D93C 1MRFL 3V8OA 4GIOA 4LRIA 4FYQA 3O3AB 4JDTL 4PI0A 5DTFA 5F1IB 3HUJA 4IKJA 3SDXE 4EBQH 3QQ3B 4HCGA 4H1LH 1A8ZA 5D7JA 2KDYA 3ROOA 3WTTA 1K8DA 1KJ2H 2WVTA 5IVXF 1MW2A 4L9LB 3B5TA 1EXUA 2R1YB 4O02L 1P5UC 4DCQB 4YAQB 2AV7B 4A7VA 4MDIB 3QRAA 1ZLWK 3GSVA 2R9HC 4MS8D 1N8ZB 5T33L 1S7SA 4HUVB 4QTIL 1G1OA 2AV7A 2KUTA 4UQDA 1Z0MA 4MMXA 2UV3A 3FCGA 4E5XA 1LP9B 1MCJA 3IJEA 5ICXB 2V2TA 2IV8A 1ZT4B 5IR1B 5CIPB 4WKZA 2KZ1B 1KN2L 3KPPA 4OIIH 4X83A 4BFFA 2BCKA 1V27A 2RA1A 4XCEB 2IXQB 1D6EB 1HXKA 1ONQB 3TXAA 2UYLB 2GUYA 3ASNB 2ICWA 3FQRA 3KH4A 3X14B 1HYSC 1JERA 2AXGA 5T5NG 1RU9L 3MLWH 4U1IB 4LARL 4LMQE 4YSEA 1LVEA 2WKOF 1MVUB 3IFOA 2Y7LA 4JFZH 2AXFA 2XZZA 3G7GA 1P7KA 4E9SA 4IBSA 3OKYA 3RTLA 2NSMA 4AUUA 1EPFA 2FUTA 4CC1A 4F7CA 1UOLA 4ODUA 3BEVA 4OZHF 5I8EB 1MFEL 4DTGH 3SDDA 5FOBB 2GI7A 4FQCH 5F72S 4OZIA 4P2RE 4N3UA 2PR9A 1RURL 1TCMA 3V0EA 1VB9A 4JDVB 3JWNC 3WYRA 4KVPA 3RILA 3LKNB 3DWNA 1O9VA 4H0LC 2XY2A 4XAWH 1MREH 3CHQA 1PD6A 4PP2B 5AVXB 1E28A 1TJXA 3SCMC 1H3TA 4EN3D 5L6YL 3TBWB 5DURB 2QHLA 5SWZB 4QTFA 3QDMD 4XX1G 4P2YA 3ULUH 3MLXH 4M02A 4HH9A 1ANUA 4PJFE 2BOCB 1I1YA 1OB1A 4TUOB 2YPVH 4R7NA 1QHQA 3U0TA 1LEKB 4BFGA 4H2CA 2BOCA 3QR0A 3V4PH 4DVRL 4JQXC 2Z35B 4BRVA 2V5RA 1LDPL 3NZHL 3QUYC 3PGDB 1RVFL 1Y0LA 5DSCA 4D8PB 5I30H 4GSXA 1EIBA 1SJMA 1NCWL 2ZG2A 3UP6A 5I17A 1D3CA 4YSRA 1CFNB 1IKNA 3D48R 3V7AE 3SDXF 1L0YA 1E7UA 1NOAA 4F1ZA 1CICB 2OMYA 1R5WA 3DTXB 4LRNH 5EUOA 4HA1A 3ZL1A 3VW3H 4QYOB 4PD4J 4FHKA 3C5ZA 2RMNA 3DSFH 4YBQD 3AS0A 1HHKA 2WWOA 3ZZ1A 3CN4A 4Y19D 2QSCL 3T3MB 3ZLQC 4JRXD 4ZTEA 5SX5K 3QZLA 1UCBH 2M8XA 4HGKC 1E7VA 3ML9A 1WFOA 1BGXH 1IJNA 5EB9A 1MIMH 4QHKI 4CL7A 4U1MA 2QGDA 2ZX7A 4GXUN 4C4KO 3LQAL 2AKRA 3QIUB 1BLIA 1MEXH 3P3UA 4EF3A 5DC2A 3BUTA 3R7RA 2V9QA 2C9AA 3EYVA 3NACH 2E4TA 3LIUA 2WKLA 3R1GH 1FJ1A 3UP1A 3QNZB 5DEJA 5DJXA 2X53A 1BF2A 4PWKA 4XN7A 5JDSA 4RAUA 4HUXA 1J1PL 2GEEA 2Z6FA 4K9EC 2IANB 4X6FB 3WHXB 4PS4L 4WV1B 2I27N 3L1EA 5I9QC 3MRNA 1RUKL 3L7EA 2AGJH 4M9PA 5CJOL 5GGQL 1JYNA 4YBLC 3EH5B 5BO1L 3Q05A 2ZUYA 5K1VA 4BSWB 1JZFA 1NDMB 5ITBL 4M5ZL 1L0XA 1KJ3H 3VVWA 1MVYA 3V5HA 5CBAB 1JPST 3DXAD 1BQUA 3P4NA 3DC0A 3VDAA 1J5IA 3WIAA 1TTBA 2TSBA 5D2LF 1I9IL 1KJ2B 4XC1H 3PHQB 2CMRL 4TKWA 1KULA 1OO2A 5IROD 4G7YL 4R7XA 1G7JB 1XGRB 4WK0B 3SCMD 1HWGB 1AQDB 4U1NB 3DXAB 1QFWH 3UTQB 1P0SE 4AGQA 1GZPB 2HH0H 1ACCA 3L3OB 3GJFA 5EE2A 1S7RB 2GG1A 3MGAA 2FWSA 3P0VL 5I1IH 4JFOA 4MCYB 2N1TE 3QXWA 5BVJB 1RUPL 5KVEH 2QQKH 4G6KH 5I1JH 1HH9B 4G3YL 4PJGE 1JFQH 2XQBL 3H42H 3MBEA 1OTUC 5KJRL 3FOLA 4MD4B 3PP4H 5T1KB 1JXDA 3N04A 5LO7A 5GRXG 4OZFA 5BZZA 3QUYA 3SDDC 5JR1L 3KJ4C 3KH3A 2GW5A 1NGQH 2E56A 3FBKA 4MXQD 2VDQB 3ATFA 3FOLB 4MD4A 2VNCA 3VUAA 3A0BO 1OE2A 2FNWA 4Y1AD 3X3GL 2F9BT 2Y72A 4NNPH 4HLEA 2B59A 3GLDA 2AQ3A 4E2OA 5ABDE 1O5PA 3MOBL 5DMIH 3GSNH 4I2XA 3X14A 2H0JA 3D4GA 3DRQB 4GW5A 2BFVL 2NX5D 3H9HA 2ATAA 3LNGA 3GWJA 2AJSL 2R69H 2F8IA 1M7DB 1RUPH 3NCBB 3IU4L 1IZKA 3V52L 1QBBA 2H3KA 1YLBB 4UQBA 5IHWA 4XNMA 4IJ3B 4FS0A 3LVEA 3QQXA 3BUQA 1MI5D 1BD2D 1F3JB 2BH0A 4QF1A 2WXHA 5IQ7H 2EDOA 4JM4L 4JRXE 3FN0L 1MZZA 1TF4A 2OM5A 3SKNB 2O5YL 3WV0A 1NTDA 3N42F 4NNPL 3MV9D 4ZUTB 4OLZL 4LCCA 4YLQT 5EO0B 2Y7NA 2W60B 4HKXB 4CSTA 1IGCH 4NOBA 2DTMH 1PG7L 3HS0C 1T1WB 2OTPA 1PKQE 5TDNB 2FD6H 3BGAA 3OPUA 5F3BB 2P48B 5I76B 4XP5L 4XAWL 3PGUA 3IDGB 1KTRL 5CLTA 5IVZB 1I8KA 3BWAA 4RVBA 1BZ7B 5KG9A 2XU9A 3IDGA 1CD9B 4YJZL 1VRSA 2OR7A 5AENA 3QDME 1G7LB 5JXED 3H3KA 1HHIA 4D9QD 2NY3B 1BMWA 1NMAL 5EIVA 1JZGA 3QXAB 4WFHE 3FHEA 3BP7A 3F04A 4A55A 1H8OA 1FHNA 5HYQA 2JWYA 3S96A 3LKPA 4KPHH 2MNUA 2WXNA 2IMNA 1HHKB 1E40A 5DGQA 4Q6IA 5F89A 5LQBL 4JB9H 1PQZB 4BWUA 2BVQA 1C08B 2ZOLA 3U2JA 1IL1A 1MW1A 2Z91B 2B2XH 1J0JA 3D33A 1CVRA 3IT8D 4NZUL 3QZWA 4K94L 4X4ME 4PRDA 4XCCL 3TJEL 3QIBD 3LKOA 2I07A 1TZ8A 1MCLA 2NY0D 4KKRA 4OD1L 3RNKA 8CGTA 3E8VA 4QRRB 2VDRB 4G6JH 3N1MC 2VRAA 2BNRD 4PTUB 1TKWA 5LXGL 2DOCA 5G55A 3MYJB 3GXNA 3PQYB 4JRYD 4PLKC 1AY1H 1UM4H 4LSUL 4FZMA 1IGJA 3GMLB 4WW2F 3BIBX 1PG7W 3CMOH 1GGTA 1IEAA 3JXAA 5KS9F 3C60D 5D7JC 3E8UL 1MCWW 4PG9B 1GY1A 4BGDA 5CCJA 2Y0HA 1QRND 1ORQB 3VXME 3INOA 4XH2A 2Y7SA 4OZGE 3H2QA 3MRHA 3T08A 3B9KA 3ZOAA 1R3HB 2HX8A 5CJXA 1G1CA 2AXFB 3G6JF 4GKOA 2BOBA 1MY5A 1NANH 4JQXA 5CSGA 1YDPA 2EUZA 3QUZA 3B3IB 4D3CL 1TSHA 4JZJC 4M6ML 3QQNA 2VMCA 3IN2A 3SBQA 4X4YA 1YUHB 2I7OA 1YDPB 3ZMRA 3T3MF 1I4FA 4YZFE 3BAWA 3DA0A 1F2XK 2B1OA 3GJFB 3VX0A 4OR1A 4PB9H 4S1QL 3CFJB 5LJYH 3RIKA 1LGVA 3ABKB 3BH9B 4L0ZA 5F7KC 2BOLA 1EERB 2MOVA 1AQ8A 1KB5A 4UT6L 4QJ4B 3KLAA 4ERSH 5CFHA 5DZ9A 3L48A 3RUGB 3GC3A 1CFTA 2EDKA 4OV5A 1MW0A 3G6AB 4PWFA 1M6OB 3LPGA 2NMSA 1AGBA 3FFCD 3BE1L 3VFSA 2DQFB 4JGMA 5DJ8B 2Z93B 2WXQA 3WFDH 3LB6D 3RB5A 4HG4J 2YC1A 1ICTA 4ZTOL 2W0FA 4L05A 4JO5A 4PJ8B 3F84A 3ZHKA 2DIBA 2IAMD 4AW4A 2A6DB 1CURA 3CZGA 1FG9C 3UJIH 3F7LA 4G8GE 4FXGB 1PY4A 2CDGB 1UB5A 5I1EH 2GKIA 5HD8C 1C5CH 2ATKB 5D7JD 3OAYK 5IB4B 5ALCL 1HINL 2VDMH 4ZQTA 4PJ7E 5EIIB 5I75C 5E8NA 1EHKB 3UFIA 3HG0A 3FTUA 3Q6GH 4UNVA 2X89D 5MEOA 4PJAE 5I66A 3ELQA 3ZDWA 5J9PA 2RR3A 3WE6A 2XWJA 2YXVA 5CEYB 3AUVA 2HKAA 4V1DE 3VRLF 1JHKL 5BPPA 5JHDE 3QFJD 1MHEB 2ZJSH 1JPSL 2ZOTA 4QTHB 4DW2H 4CBZA 1S9XA 2DEYX 4F8OA 1P4BL 3QQ4A 4R8WL 4KV5E 2D7TL 2GFBA 4ZQKB 4IU3B 5I0WA 5L8KB 1BWWA 3BD3A 4KRPD 2Z0BA 3U36A 2FD6L 5EMYA 3B6SB 4XPFH 4DO6A 4OKDA 4M3KB 7PCYA 4G7RB 4KRNA 3CX2A 1EUUA 4ZUSB 1NBZB 2AK4D 3QFJB 4FMVA 1NAKH 4RFOH 1WZAA 5LGJB 1GXEA 4Q7DA 3VXOB 2DQCH 1X3DA 4HHAA 4Z7WF 3O0EA 5SWQB 2Z31B 2J1YA 2RACA 1FYTD 1I1CA 1I75A 4OGXL 4XMXA 4NENA 5TTRA 1Y1DA 3SDYL 5CSBA 4ZD3H 3HMXA 4PJ9C 3GGWA 3Q7JA 3LVTA 3MR9A 1MM5A 2WXGA 4HIIA 2V8MA 5GIRA 4WFHD 4AV0A 3AAEA 1ZHZA 3IAGC 5EC2B 3WXVL 1PD1A 3GSXA 4PBXA 1DHKA 3VXPA 1EJOH 3QZWB 2WNKA 4AYSA 1BXAA 2Z7WA 5DUBB 2AQSA 2V5YA 3OAYH 3RWGB 4A2MA 1ZS8B 1CYXA 1ZA6B 1I3GH 5IUCA 2ARJA 3UJTH 3QEQD 3JV6A 1DO5A 3IAPA 4JO1H 4NHCL 1PY9A 4JQIH 4N2GA 3L4YA 4GSDL 4CMMA 2HJLB 3L3HB 4U6TA 3VXRB 1XGYH 4CMMB 1MCRA 2X4QA 1GKOA 4PLJC 4D9LL 4PPTA 3FC8A 3MJ6A 4B96A 5G38A 2N7AA 2F1AA 1UXWA 2X4OA 5DHXB 1JK9B 5CIPA 4BUGA 3BGMA 3Q1SH 3VE0A 5I1LA 4FX5A 5AVSB 1S46A 3QDMA 4NKOA 4ZMAT 1MI5E 4IHOB 4YGAB 3TS8A 3FSAA 2CA4A 3RIAK 1IVTA 3IMWA 1X4XA 2EVJA 1JXGA 1SYVB 4NEHB 4AVKA 1THAA 2FEDC 1K6QL 2D4FA 5FS5A 3TEXA 1TENA 3Q3GA 4PAZA 4AUYA 1VHPA 4GRWH 3O3DA 2X6AA 5I8OH 2J6WA 4FQ2L 3EG9A 3PS6A 4PREA 5AKRA 1EJ8A 1OY3B 2D7QA 3HVDA 1NUGA 1RK1B 1N9PA 1X4ZA 3CXFA 3I6LE 3NCJL 4RIRA 4UINL 5LBSL 4Y2DC 4ZMQA 5BRZB 4HZ1A 3MRRA 2ZSVB 1UHVA 4OZIB 5IZ7A 3HMWH 3OHMB 2D0GA 2E0PA 3K74B 1GYCA 1E42A 1OAXH 1U8IA 2H0EA 4A6YL 1Q38A 5AD0A 5DWUL 2D2OA 3DBXB 3DIFA 4LBEB 2C3WA 2QPEB 2AAVA 2YXMA 1LEGA 1GS8A 4JY5H 4LZKA 4ZMVA 3DK0A 3EJZC 4GG6B 3FB7B 3L54A 3PWPD 1JZ2A 3FFOA 2HA1A 4KXZH 1JWSA 4AWJC 4WTZG 1XO8A 1T21B 2C9UA 3QCUL 4KJPD 1CLZL 2X0UA 3L6FB 1JNHA 2XZAL 4WI8A 3FCTA 5IMOA 1RP8A 2CO4A 5EZJA 4XXCC 1JGLL 1T1LA 4ZS7L 1LO5B 1ADQL 3HOGA 2V2TB 1O7SA 1J9RA 4C00A 1YN7B 1ZVSB 4S0SD 3UTOA 4PJGB 2MHAA 1GSMA 4NO0D 2OJ1A 5EULV 3RL2B 2XTJB 3T2NH 4Y1TA 4ODHH 4UCFA 2VDKB 3VFGH 1I7RB 1WWWX 4LEOA 4I3RH 1TJIH 4FFVC 4KHTH 1J05B 3BEWA 4RBPK 1JSYA 4AYDC 3GI8H 1DFBH 3N43B 1ZVYA 2XXFA 1UWXH 3CN3A 4LVHC 4LP4A 2QQLH 2ICEC 1YYLL 5EUOE 3FYXA 3VJ6B 4DF9A 3GT6A 4PTUA 2MPVA 4ZFOB 25C8H 4FJ6A 3SO3C 5E2TH 3HMXH 2OI9B 3MNZB 1P4LB 4Q8BA 2W0LA 5JHLH 2BNUA 4PJ0O 4ZFOA 2FT6A 1Y1UA 5FOBA 3WFEL 1A14H 1DBJH 2ZYRA 3CSGA 3LKRA 2YGPA 1EO8L 3QJOA 1TOXA 2O4VA 4GO9A 4A2EA 4KROC 4WU5B 5E9AA 4BUQA 3LZRA 3UPCA 5C0EB 3MACL 1EQWA 2VITA 1VGEH 4AC2A 1E28B 4U2YA 3AADB 3THMH 3NPSB 1U30A 4L3FA 4OJEH 5DC9B 5FYJH 1B0GA 1VCBC 1MDTA 1U0QA 4XVTH 2ZTBA 2VR3A 3KPSB 4HPYL 4NQED 2B8OT 4WI9A 5I26A 1RU9H 1MM4A 1R4XA 3MLWL 1BV8A 3OXSB 4F33A 1FGVL 3GKWH 4FQLH 3B3IA 1N5YH 3AREA 3E2HB 2YOAA 1U92B 1ORSA 3IJYA 4K3DL 3VXSD 2Z0UA 4YSUA 1XV8A 2O5XL 2VN7A 1R3JA 4NZDA 5EWIH 3FMGL 2JB5L 2ZCLL 2R8SH 5DUPH 3V0AC 3BSZH 4NWUL 2DM3A 3RYMA 3DYOA 4HKZA 3ECWA 1D6VL 4MCYA 4N2MA 2PYFA 3PXLA 3RDTC 2V2WB 1FF5A 4M1CC 5DZJA 4DN3L 5HY9B 3UYRL 3ZE1E 4JREB 4N1HB 5EO9B 4WI0A 4OF7A 5I6XC 5K33A 3QJRB 5DHVB 4RA0C 5E6UB 2DM2A 3EYUL 4HU2A 2VMDA 2BSRB 3AG3B 3RNQB 3WI9A 3SODB 3IF1A 1R5VB 4NN7C 4UT6A 5E9NA 5C9KA 4XN8A 4D8OA 4AQOA 3QJTB 2QTVA 3GS4A 2H32B 3CC5B 4JFVA 4XMKL 4F9LA 1CFSA 4R5XA 1F13A 1V10A 3WDJA 4UQ9A 4YDKL 3QORA 4FSOA 3NRFA 1MFAL 3IE4A 5D1ZD 2C26A 3APFA 4N74A 1G9NL 5DHVH 4PUXA 4M7KH 3L5JA 4HUNB 3WO3B 5J3HD 4M7LL 4RGND 3MTRA 2DY2A 3WU1A 3LK3B 5B22A 1OTTC 3M45A 3BOVA 2IGFL 3SKOB 1AYOA 3GIZH 3GXMA 4PRPD 3JWNG 4UQIM 5C0BA 3AA1B 4B95C 4G3YH 4HH8A 4UT9A 2YEZA 5DMKA 2WBJB 2IOOA 1I8LA 4FC3E 2HFGH 3BMVA 1WK0A 2AVFA 4Z0XA 4ENED 5IFAL 2CDFB 1MCPL 1ZDSA 4NNYB 4G83A 2W65A 5D72L 3JUYA 4KJWD 4N2FA 2AC0A 4OZFG 2IAAC 4PRPB 5HVHB 5GZOA 4TLTA 1KIUB 3KHOA 5F7EL 3HZKA 4OTXL 4U1LA 5D8JH 1TFHA 4GXFA 3FQ1A 5ANMA 2AJUL 1N0LB 3BWSA 4YDNA 2JJTA 4FXKC 4YEFA 4PW9A 1INQB 1T21A 1D5RA 1BZ8A 2QR0B 4L18A 3BVDB 4PHZA 3F65A 3GIVB 1OCWL 3AXLB 4R6UA 3MAWA 1F1AA 4M8QB 3QUYD 5DVKA 5LHDA 2YLKA 1KXHA 2N1KA 1L6PA 2BMKA 2ESVE 3IJHB 1CCZA 5CBEA 3VGGA 9PCYA 1QWHA 4NYLA 1L9NA 4YFLI 3UU2A 2UX6A 1RD6A 2XV3A 3T6ZA 2CD0A 2MCPH 5H2BB 2XNAB 3SY7A 1CU4L 2DQTH 2NNFA 5F7EH 3DRQA 3BEWB 2AJYH 3EJZD 2X1QA 3ETBF 5LBSA 4Y9FA 3CE1A 2WK2A 5IQ7L 3HUJE 5KSVA 5ACZB 4XNUH 2YR3A 3LEYH 3U83A 1H5BC 3DWOX 1ZS2A 2EDQA 5I73C 3LV3A 4A7SA 2Y5TA 3RY5A 2FL5B 4GQQA 2HJLA 3WJJA 5D9SA 5DC4B 4PUBH 4ETQB 4GQRA 1XF1A 2OZ4H 5D9SB 4EUPB 1EFXA 3ARGD 2EVGA 3FQNB 5TH2B 5KSAC 5HTSA 3VRLE 5ISZA 5IT2L 5JUEL 1YMHA 1DQDH 5EU3A 1NIAA 1INDH 4CUCA 2QVFB 3SDCC 1ZIBA 1IGMH 3X1FA 2VZTA 2G2PA 1H6FA 1AIFA 3N40F 4F91B 1VJSA 2BP5M 2X4SB 1CI3M 3UTTE 1IAOB 1F6AB 2Y06H 4YXHH 1FGNH 3MKGA 4EKXA 1PJWA 2QTEA 1QSFD 1GYUA 3AA7A 4OZIF 2EE0A 3VGBA 5HI5D 3SDDD 4XXCA 2RAMA 3CPUA 3ERXA 5B66O 1GIGL 5KSBF 3QDJE 2DDQL 2ADGA 2NNXA 1S5IH 2F5AL 3U7WL 3ZZLA 4JHZA 3WAJA 1OAYH 3CZSA 2DJ4A 5EU7E 2HLFC 1YEKL 3C6LB 4UZUA 2DQIL 4YZWA 1P6WA 3LEVL 3TASA 1DQDL 1U2YA 1PQZA 4N2BA 4X98A 1PS3A 4GKNA 1EFQA 2QBWA 1J8HD 2CLRB 3HRZB 5D7SH 1CGWA 1SVZA 4JM2A 1U21A 4BFOA 3MLSL 4QRSA 2E7LA 2AKRB 2EP6A 3QIUA 1IGFL 2B14A 5FCUH 3QIWD 4LIQH 2HZHA 2I9TA 3NFNB 2OMTA 1CTNA 2VIRB 2M06A 3U9PH 4UIKL 5L8JB 2EVHA 2UZXA 2JIXA 3MFFA 3PV6B 4Y2OB 1ASPA 1KYOK 4RAHA 3CFCL 5JNYB 3H0TB 1AIZA 4RMRA 4BH7B 2FCBA 3GMOA 1WZKA 5B8CC 3LK3A 35C8L 4L8DB 3VXSA 1OALA 2D31A 4GQPH 5GGRB 4B0MB 2FZ3A 3OLEA 1VKXA 1A1MB 3HBPA 5D1QD 1XGTA 1QWNA 4XWGL 1KPUA 3T4AA 2WUCH 1NA8A 5GJTH 1J8KA 2PWGA 1RPQA 4XNZC 1R3HA 3OAWA 5FYKL 4N0UB 4F2MA 5KYYA 3D50A 3B9VA 1WH0A 2QMJA 4NN7B 3QUZD 4PWJA 4C69X 3FFCE 3O2DH 4EO5A 4AGOA 1WIOA 2VDNB 3L3OA 2CK0H 2EDEA 4GCPA 3MXVL 1A7RL 2OX5B 4KHXL 3ULSA 1OIOA 4LEXH 2DM4A 1OB0A 4K3CA 1R24B 1K8DB 3PAUA 4FQPA 2YPLE 1F4XH 3PORA 2JJSC 3UX9B 2WO3B 3VMNA 3UROR 1KMGA 4IOIB 1X4YA 4MMZC 5GSRB 1Z3RA 4OUUA 2Z1PA 4G59C 2R29A 1OEZW 5ICZB 4N6RB 2P4AB 3PXJA 2CSPA 3GHPA 3V8UA 3HN8A 3QFJA 1PF3A 1VERA 3IJHA 3CPLB 4Y5XB 5DMJB 1OQXA 5FM8A 5EBLA 5MENE 3NQIA 1ODUA 3BP4A 4TL5A 4X0KB 4ZW8A 2VXQA 3MLVL 3KS0J 4TRPH 4U6YA 3TWCL 1ETJA 3RWDB 2R2HB 4M6AA 3T6VA 4GW5B 4F33B 1XCXA 3ZGHA 1V55B 3DI2B 2WUBL 1M7IB 3I6LD 4IW4C 3KAAA 1QHPA 2Y0KA 2AK1H 5TE4H 2YUZA 1KY6A 1U3HA 3MRDA 2F7RA 2ITCA 1LQSR 2OR8A 4DW2L 4BHUA 3LXAA 4H8UA 4DVRH 1JOIA 3GSOB 2NX5A 5AALA 1U8HA 5J6SA 1BX2B 1ZA6A 5DUPL 2ZKHH 1R5WB 3PWNB 2F1VA 1INEH 3PWJA 4YXKH 3ULVD 4IMKC 2VLME 3US1A 3VW3L 2Y9RT 1TTGA 2YRBA 1IO4C 3BLKA 3DA3A 1ET5A 3WNLA 2ICEB 5JYMA 1AKJD 2JQAA 5EF0A 1HEHC 4KU1A 4POUB 5ESVA 5JORB 2R56H 1DBML 4N8VA 5D70L 2PPAA 4NFBA 3AGWA 4XP6H 2C4XA 5HHME 3H53A 3EOTH 4XVUD 5ITFA 4D65A 3THML 3Q01A 1K4CA 1P2CA 2TSAA 5EPMB 2N4IA 4ZXBC 2IH1B 4X8XA 1HK6A 2DWXA 4HUXB 2YO3A 3GUTB 1D9KB 3RA7H 3WHXA 3BGFC 3OC5A 1AZZC 3C60C 1ZT7B 1Y18A 3ECVA 4NSKB 4NQXA 5HHVH 3VXTB 1ITCA 1SMOA 3LIZH 3NJFA 4UB0H 1PZAA 5IROA 1MNUL 1NCOA 4PJXE 4N0FB 3Q9QA 4G7QB 4Q6IB 5JPNA 3ALWA 4YHKL 2VE6A 4BZ2H 1I8UA 2HJKA 3S5YA 5HYQB 3HW9A 4JFYB 1HE8A 2BINA 1MNNA 2IG2L 1EHLL 3IJ8A 3CV5A 1UB6A 4L3CA 1FGNL 5E1HB 4MYWB 4AQ8C 5IHZB 5IFJB 3G6JB 1XBDA 4BFBD 3L9YA 4CN6A 2WXPA 3CFDA 5I18H 3S35L 1AYRA 1MAML 5DD0L 3ARBC 4M6OL 15C8H 2CKNA 2IBBA 2ADIB 4I18A 1IGTA 4K7PX 1N26A 2XBZA 2ARJB 3CDZB 1N67A 3ARUA 4XXDB 1FL6A 3ARDA 3L2LA 4LCUA 3BPOC 3G04A 2JELH 2V2XB 3T0AA 3CVHL 4NQDE 5MI0C 4FFZH 5JOEA 2AXTO 1IEAB 1OAZH 5CBEB 3KEDA 3VWJA 5KBLA 1P69B 4U6XA 2R1YA 4OY9A 4YHNA 1LK3H 3OSKA 5JOPD 4Q9RH 4JM0A 4PCKA 2LAGB 5E2VL 4GAYA 2Q76B 3KPRD 4ZFQA 2F0CA 3EBGA 3OF6D 1BPVA 1EZSA 1F90H 1KNOB 2KERA 4MA1C 3SBWC 1F4HA 2VR4A 1ZE3H 3RPBA 3P11L 4MCZA 3LS5H 5EZOH 1AD9B 4U0RB 1RFDH 2VR7A 4UNTA 2VXTL 4XAKD 3R06A 1XIWB 1CU4H 1MG2C 2DQTL 1AP2B 2QQNL 4MXWH 4YDVB 4F2MB 4PJ6A 1KENH 1BJ8A 1FO0H 5MERB 5KBPA 2FQDA 1P7KB 2P5ED 3QI9A 2XVKA 4JN1L 3FAWA 2CUIA 3OJMB 5BJTB 1PKQA 4FXKA 1IARB 4P48A 3AS2A 2AJZB 2WZPA 2WQUA 1CDGA 3VXQA 4CC0A 5GQBA 4EI5A 1AO7D 4U49A 2AJZA 2NCEA 1E5AA 1J7VR 1ETZA 3CFEB 3FS9A 4X8CA 2O4EA 1KCLA 1ZTMA 1IBGL 3S35X 4DEUA 3GPSA 3ZR6A 5JHBA 2V5MA 3MCYA 4EN3C 2YEQA 3M17A 5DEFB 1WAPA 5HSFA 2GC4C 2ZYHA 1UZGA 4X0KA 2X4UA 2EYRA 1CIDA 4M4PA 1TSRA 1XF3B 2APFA 1NLBL 2PYEE 2VW7A 4PGBB 4JX0A 4NN5B 5IEKA 2XDHA 4FXGA 1FH5H 2H9GB 3CSTA 3B37A 4G5ZL 1I85C 4MA7H 2OQJB 1XR9B 1JGDA 2XA8H 1YEGH 3T24A 2BP8A 1SJEB 1CDJA 1CL7I 5TE7L 4XMPH 2HKFH 2ZICA 5I74C 2MOQA 3T1FB 4KH2A 1FNEB 4ZW5A 5F1OB 4PJ9D 4JO4L 2V9TA 3A21A 5SWSE 2YKLL 1BVKB 1KXTA 2Y2YA 5GS1A 1PU0A 4A68A 3NCMA 4QRAA 4RL9A 4R0LA 4R5TA 2JKXA 1LO4L 4P23C 2LOEA 4WDIB 5AL8A 3U0PB 2WKGA 2EUVA 2WANA 3HG1B 3HI5H 3FT0A 1UD3A 4XBGB 3LQZA 4QRQA 1EAQA 5JZ7C 5C0CB 2BSRA 2Q8BL 3LQAH 1GVIA 5AAWC 2HPTA 4N87A 4PQXA 3NIDE 4KQ4H 1H3PL 3RFZA 5MP6L 4OD2B 1SF3A 1KGUA 5C0FB 1NCCL 4BXVA 2UZPA 3ESVF 2DJMA 2YFOA 2YZ1A 3EFFB 3DROB 3GEWB 4NC1E 3EYVB 4HUKB 1N5AA 1CFQB 1MWAL 4XCYB 4D5UA 2NY2C 4ZBJA 5AW8B 1U41A 2P42B 3V4PL 5I1AB 1ZJBA 4NQXB 3LXUX 4XCYA 1AZNA 4W4OA 2K70A 2Y22A 4WI2A 4RMQA 4XBPB 2JCCA 4XWOD 4LPUA 3WJMB 1JIBA 4GBXC 5K9JH 4LLYB 1D5XB 4Y4HD 5D5ME 3VWKB 4C83B 4HIIB 5KN5B 1FL3A 3QEUA 3GRWA 1F18A 4MNQD 4ZPVB 1W91A 1IM9D 5HPMB 3ZN6A 3SOBH 1BD2A 5CGMA 2NR6D 3BKJH 1MHPH 1QRNA 3BT2H 1QUNA 4DQAA 3UEZA 4IBZA 1MWOA 3QZMA 2EE3A 2UZIL 3P4MB 5J1AB 2AXJA 4FNLL 3PDOA 2E9GA 2OX5A 2VM3A 5IM7B 1SEQL 4NZRH 1IBDA 4HUUA 4H88H 4IKKA 5JIPA 3TL5A 4HJ0D 2IGTA 4DT2A 3G04B 4NQCE 2H1XA 5L2KA 2VDOL 1YJDL 3UC2A 3WLBA 3CX5K 2DLHA 3H6JA 5TQ2L 3TH4T 3KW7A 1VEPA 5K9JL 5EO9A 1MI5B 3C75A 4X6CF 3TPKA 2V9RA 3VWJB 3K2KA 5AKVA 1XMEB 2YHGA 4L0PB 5C8JB 2NOYA 3AU0A 4O9HH 5HYIA 4KDTC 2AEIT 1DBBL 3MOQA 4YHZL 5DVLA 1CXLA 3ABMB 3L1OH 4BFEA 3WKML 1D6EA 1Q1PA 5I1LB 1U8JA 4IBQA 1W15A 3OKMB 2AHIA 3IFPA 3IETA 1G0XA 3VFRA 4BEIA 4P3CL 2RH0A 4OCYL 1RIUH 3OZ9H 3P3TA 3OKMA 5DURD 1KDJA 4KC3B 3ZZSA 2AAAA 2ZKWA 4TUJB 5KSVB 2DRUA 2P26A 3K3QA 5FECA 3T09A 1GGIH 1JVOA 3D7PA 4R96A 2ED8A 5IJDC 1FFQA 5FK9A 4AMXA 2Y6SC 5IKCB 4OM0H 4OF8A 1NBVL 3UMTA 3PFUA 1ZMYA 3FT4A 2P80A 4H25B 1YEHL 4ODVL 5JORA 4WAFA 4O58L 4OM1L 4O2CA 5ADXK 4U1KB 1LTXA 3LEXA 5GGSY 3JCUO 2K1MA 4EN3A 5JIDA 4M7JH 1HEZB 3FU9A 4FQ1L 3UZEA 2OXHB 1E4KA 5DD6A 1AOZA 2IH1A 2BVTA 4WK4B 5IBTL 3BMWA 2ZNXA 2SEBB 3DRTB 4H1LG 2W0KA 3HZVB 4WHYH 5AAWA 3RWFB 1YYML 4ALAC 5TPWH 3GB7B 4KZCA 2EADA 2ALAA 3OKDB 2NY3C 3NJIA 5DDHB 3AS1A 3G5XB 3GBLA 5DD1H 3QXAA 4JPQA 1PX4A 4HVBA 1TZGH 3PQYD 4PCYA 1D5ZA 2H8PA 1J1OL 1S7WA 2C1OB 2HT3D 4I0PD 5F9OH 6PCYA 3MCLH 4LPYA 2J8UF 2YN3A 3D12B 4JHWH 1J8SA 5FYKU 1CWVA 3F7KA 3ZX1A 3U4BL 1G6RA 2R0WL 3SQBA 4Y19B 3LPWA 5CEYA 1RIHL 1JMXA 3VXPB 2ENQA 4FG4A 4V11A 5DL8A 4JM2B 1J48A 1JAEA 3F12B 3ILDA 3BPCB 5KSUA 1MCNA 4UWQB 3W0WD 3Q8AA 2KZWA 1A3RH 4XPGL 3MRFA 4IOSD 4BKLB 4CC4A 2IFGA 3AMLA 3MMEA 5CINH 2A9BA 4KUZH 1SY6A 3PQYA 5HHXL 3S4SG 4A2DA 3KLLA 1FC1A 1SJVA 4IJ3C 1T22B 4Z3GA 3ZL4L 4G9FE 4PV9A 3TBSB 4DPBX 1MH5A 3IDXH 3QG7H 3ZO0A 4FNQA 1ZLWH 3WUWB 4PV9B 3VGAB 2VLJA 3N5AA 4AEHH 1XFPA 2AZUA 5E51A 4MMZA 3WGUB 3C2SA 2BZDA 2ZIDA 4RGMC 4M48L 3LEVH 3IPEA 3GEFA 1KPUB 5FO2A 2XKNA 3QNXB 1N7MH 1UCTA 4JZJA 4LHQB 1OPOA 4LAJH 3Q1SL 2DF3A 4ZS6D 5ADPL 2TRHA 1FDLL 1G0YR 4M29A 3KWWB 3QAQA 2XE1A 4JZOA 43CAB 3RZCA 3DJSA 2Q7NA 2HP4A 2Z4TA 5E5MB 1EWHA 4UM9D 4XPHH 2R69L 1L5GB 2F5BL 5IQ9A 1U6AH 2X70A 2OP4H 2BOBB 4N2KA 2VC2B 1T20B 2DQCL 3HS0A 4N2NA 3WMPA 1CF8L 1P4UA 2YD4A 3HFFA 3QDGE 1KIQB 3PABA 1HI6A 4UM9A 3WNPA 4PJCF 1T20A 3O8XA 5DVPA 3TH2T 4E9XA 2W0PA 3ASOB 3VXRA 4RRPM 4PJEE 1RZJH 2RD0A 4I1RA 1UOWA 2E5EA 1U9KA 5DD0H 2PORA 4FFYH 2G0LA 3L16A 4NGHH 1RZ7H 3GLAA 5ADPH 1JTTA 3QULB 5KBNC 1SMDA 3B2DC 4Q4EA 4X99B 1MCDA 4JCLA 1QLFB 1UJ3A 3GK8L 3CN2A 3MC0A 2FX8L 5CZVH 5HGAA 1MCCA 1NGWA 1UXSB 2OL3B 1MJ8L 5ICYB 4WEUD 2AQTA 5LAXB 1VIWA 4H8WL 1FORH 2VLKD 4HJJL 1UUSA 2G5RA 4S2SB 3KXFA 1RURH 3VU1A 4JPWL 5E6IC 5KW9H 4A7GF 4DVBA 1JNLL 1KCUH 4U0RC 4WV1C 2P5WA 2GJ6B 4X6DF 4OSUL 3TZVC 4X2UA 4XR8C 5IKCA 4A66A 2V3DA 1AHMA 4DJMA 4UQEA 2L8AA 1OGAE 2CM6A 1RQ5A 3IYLW 3VG0H 2BWDA 2VR9A 3D3VE 3RPIB 3SIKA 1RZJC 2Q0ZX 4OLXH 5INCB 4AQ1B 4M5SA 3EO9H 3UOAB 2K7QA 4HCFA 4LNVA 3PRNA 1BQHB 4JFTA 3V95A 2WNGA 2EDHA 5ERWA 5JQHC 2R7EB 5JW3H 2PUQT 3U4EA 2QKIB 4MNHB 5GS1C 1IJ9A 2WAHA 2D2CC 4B3EA 1W8OA 4PS4H 3ARGC 4JFOB 1BQKA 5ANMB 4RH4A 1HNGA 5DZLA 3ETSA 2XG4B 4IU2B 4LSDA 3PWVA 3NJGA 4K94C 5FV1L 2X44D 5T3ZH 5JDPA 2WQAA 3JWNH 3RU8L 1XCTA 2O6CA 4ZOAA 5I28A 4MAYC 3QUYB 1QABA 1ILUA 4WNSA 1A66A 5EOQL 1GZHA 1JV5B 4Y5VC 4WI6A 5D7LA 4EVNB 1AQMA 1YYCA 4N8PA 1TZOA 4AIZB 2QMKA 3QUXB 1I8AA 2XCMC 1X44A 4NUPA 5EH1A 3S7GA 4RJWA 1UQSA 2OXGB 4JO2H 2EKJA 3WIHA 3BRZA 3WY2A 2GBTA 1HZHH 5AVQB 5J1TC 3GGWB 1J5CA 1X5AA 1YSOA 5TPWL 3FOMA 3SJVD 5JXEC 4HP5A 5HDRA 1D9KC 3CBRA 4DN4H 5CD5D 3NP4A 2PYEB 4UOJA 5FO9B 1GL4B 3DX7B 5CAYB 4BIKA 3QHZH 3WUZA 5KBKA 1ZJAA 1ZKAA 3BZDA 2XI9A 2FWUA 1R0AH 4JQVC 5IQLA 1LO3L 4PVNA 2BO0A 2HFFA 4GMSL 5GRYA 2HLAB 1VPOH 4OCWL 3ATDA 3E80A 4DUVA 3T0SA 1AS6A 4ZODA 2OCCB 2YBGA 1RZKL 5AB1A 2A9CA 4LSIA 1MH5B 4BK5C 1Y6KR 1T04B 2HFTA 3TA3C 2WZ0A 1LD9B 3PG2A 1MJ7H 1L0QA 1VFBB 2AJ3A 2IADA 4ZFZB 2BIMA 4JO2L 4KO5A 5EC1B 2ZOWA 4PJ7A 1NFKA 2R4OA 1J0YA 1FBIL 4KKPA 4MMYB 3TNMA 1AIFB 4B53A 1LMKA 3GD1C 1M56B 2WN2A 1XVSA 3LS4H 5TE6H 3EHBD 2VJXA 4R2GB 4P3CH 3RHWK 1JE6A 5H8DA 3DOIA 1PBYA 5KWYC 2QADD 4OZ4B 3K71B 1Z32X 3DTDA 4QY8A 1CDBA 1NGXA 1UA6L 5GZNA 2GJPA 1HHIB 4DNLA 3RWIB 4FQLL 4F80A 1YNLH 4DP6X 4IBVA 3C6LA 3HPLA 1O0VA 3ATBA 3NCJH 4P46A 4C56A 5IG7A 4CDHA 2ZSVA 4OM0L 3UO8B 4N0UE 3BZEB 2LLNA 3C6LD 4M62L 2D4DA 4Y5XC 4XVTL 1JPTH 2JKRM 3I6SA 5KSAD 3QCTL 1X5IA 1SOKA 3CVCA 1SHSA 3DK2A 1U8OB 3JUZA 3ZIYA 4X9FA 2FT7A 2GYSA 5F7NC 4Z7NF 1VA9A 1PLCA 5JQ6L 1TVBB 2QDWA 3HZVA 2CLZA 3N06B 3BDXA 4ZUUA 2X2YA 4PGJA 2VSMB 4XN4A 1QR1A 3MSPA 3FULA 2A74B 3ARDB 3NJKA 4LCUB 2A4ZA 5HGAB 4AIOA 1RJYB 1IFHH 4Y89A 1S9KC 1UXSA 2OL3A 5ICYA 1T3FA 2P8PA 3MPCA 1QACA 1YEJH 2IOIA 4M5TA 3HHSA 2LU3A 5IV2B 2VN6A 3EYOA 1A1MA 3UYOD 2YUWA 3L7EB 1XCQA 4PVLA 7PRNA 3NN8A 5EZJB 4IRZA 3ZZQA 3ABGA 4S1DD 5C0BB 4J4PD 5L2KD 1AXSB 3CDYA 3NN8B 4XNDA 2IAMA 3DPDA 1C12A 1PZ5A 1TR7A 3CH8A 5AUMA 4OCNC 2DH2A 2UYLA 4QHUA 1T0OA 1T7VA 1CXHA 1N6VA 2J5LC 4N85A 4BJLA 3RZCC 2W88A 2F53E 3AREC 4MCMA 1MFDL 4WU7A 4FYRA 3ZE1F 1G7JA 3KXFE 4B5EA 3IGAB 3DSNA 3U46B 3HI6L 1JJUA 2OSLA 4ZPTB 4OD2A 5FXCH 4GMTL 2QVKA 1CB4A 1QW9A 3EZJB 5CP7B 4M8RA 3WIHH 3HPJB 1DQML 2J4WL 4GP4B 2VWEC 4MDJB 3PHAA 4L2LA 3ESMA 2XWDA 2VSCA 1CLZH 1ZHXA 3G6DH 5GGSB 3IU4H 4ODXB 3ZYIA 5IHBA 5JYLA 3LQMA 1N2RB 4HLJA 1OAXL 3RRQA 3MUGB 3IGFA 2LLLA 3AWEA 3GBNH 2YA0A 3QRGH 5DL5A 1GGBL 5DK3A 2EDJA 3QGVA 2Z31A 5JUEH 1J5OL 3ZPDA 2DQFA 5AKTA 5E8PA 1QFUH 3C6LC 4D9RE 3N43F 2IANE 2OULB 4Y2DA 4Z7NB 1VADA 3GXDA 3FQWB 3HBZA 4LLWA 1XB6A 3ZTNL 1HHHA 2KQMA 1QUNB 3SE3C 3QORC 4IBYA 1A7NL 2FECI 3AY4C 3EW3B 4DERA 4MYPA 5I1IL 4YPJA 3VD9A 3ME0B 4BH8A 4Z7IA 1N18A 1KTBA 4PG2C 1GZQA 4JZNB 1PVHA 5AZ2L 1U8KA 1P53A 4XBEH 3D3VA 4YK4C 5KBMA 4BH8B 5PRNA 3REVB 1NEPA 1YN6A 2YPKB 2VM4A 4XPGH 5E4EB 1YEIH 4PLJD 1DE4B 1D7CA 1JVKA 1ZLUK 3U0WL 3VI4A 1OWWA 1KN4H 3QJZA 5MEOB 1T7ZA 2DIAA 1HCZA