2KDYA

Nmr structure of lp2086-b01
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
261
structure length
261
Chain Sequence
MGSSGGGGSGGGGVTADIGTGLADALTAPLDHKDKGLKSLTLEDSISQNGTLTLSAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTALQTEQEQDPEHSEKMVAKRRFRIGDIAGEHTSFDKLPKDVMATYRGTAFGSDDAGGKLTYTIDFAAKQGHGKIEHLKSPELNVDLAVAYIKPDEKHHAVISGSVLYNQDEKGSYSLGIFGEKAQEVAGSAEVETANGIHHIGLAAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Immunogenic Properties of the Meningococcal Vaccine Candidate LP2086.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Immune system
molecule keywords Factor H binding protein variant B01_001
total genus 32
structure length 261
sequence length 261
ec nomenclature
pdb deposition date 2009-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2kdyA02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2kdyA01
3V8UA 4AYMC 3VE2A 4O49A 4O4UA 3PQUA 4O3YA 4AYID 4AYNA 3PQSA 3VE1A 4AYDC 4Z3TA 2W80C 3KVDD 4QQ1A 4AYEC 3HOLA 2W81C 3HOEA 2LFUA 4O3XB 5EE2A 1YS5A 4O3ZA 4O3WA 2KC0A 2YPVA 2Y7SA 4U9CA 5T5FA 3UAQA 4O4XA 2KDYA
chains in the Genus database with same CATH superfamily
4DP4X 2GJRA 3BAXA 3DLQR 1S9VA 2R4RL 5KVDL 1MCFA 1HILB 2IDTA 3VNYA 2YS4A 2ENYA 2WTPA 3F84A 4ZS6C 2PCFB 2PR4L 3I9GH 4M43H 2R29A 2ARJB 3OKDA 4MFHA 1SVZA 4KKRA 4EI5B 4R4ND 5IVXE 5PRNA 2CU9A 5D1QB 5I8CB 2R0ZH 3DX4A 5AOMA 4XMKH 2C9SA 1A1MB 1P5VB 5IWLA 3G5VB 1DVQA 4P2CG 5LBGA 4JQIA 4LVHB 1A3QA 3U0WL 4OUUA 2K4TA 2XE2A 1NGYB 1Y1UA 4R96A 4IBZA 4WHTB 3LZLA 1FYHB 5HGAB 3KH3A 4KITB 2HTLD 4RDQG 1MCWW 5AZ2H 1WT5C 1G9HA 5SV3A 1QI3A 5JPMA 2IAMC 3SQBA 3LNGA 3JVFC 3PDOB 4K9EH 2JQYA 3P3SA 2WNKA 2H47C 4TS6A 2V2WA 5TJWK 4QHUA 2BS9A 2OULB 4KXBA 1GC1C 1HSAA 2YD7A 1V3LA 3L4UA 5LBSH 3HZMB 1KBVA 2BP0A 4GRMA 3EHBB 3SE9L 4M8RA 4KVCH 4OJAA 3TBSB 5CLWA 1YDPB 4FQ2L 1IKFL 3QQ9C 4GSUA 5L2KA 4FQ1L 3ULSA 1D5MA 1HXKA 1SOXA 1XH0A 5EWIH 3P3YA 5C8JA 4IGBB 4OBRA 1SNRA 1ZT7A 1NGYA 5T3XD 2A6JB 4Z0XA 5IT2L 3VXME 5ETUA 1M6UA 2FK9A 3ULUE 2C9QA 1CLCA 4DH2A 4D94A 1PX8A 2YQGA 4WTQA 3V0WL 4E9VA 1HK6A 3MI6A 4PRHA 2VLKB 3GUTA 2BSRB 4OFYA 4DO4A 1BZ7A 4GSXA 4WJ5A 2QHLA 2F1CX 3TYFB 5K93A 1NFAA 4EKJA 2CR0A 3IAPA 5ICYB 2PP7A 3T77A 3GZOA 2CK2A 2BNQB 5GHWL 1UB6B 1UQSA 5IR1A 4JY4B 1IAIL 3HZMA 3OHXC 1H8SA 3RNQB 3MRMA 4HULB 5LNDA 2JF1A 4KI5E 1AO7B 1QVOA 3WBDA 4XE5B 1IM9B 3ARSA 3CZFB 3HNTL 2XBZA 3DURA 3B5TA 5IB3B 3D3VD 4HEPG 2QSTA 5I0WA 2DICA 3GRBA 2CAKA 5D93B 5F6IB 2FLBT 1AY1L 1HHGB 4S0SD 4KKCD 5D4QA 2XKNA 1NKGA 3RWGB 5I73C 3MGOA 3M8OH 25C8H 4YSQA 1CO1A 3HZVB 3PGSA 4XP4L 2DYPB 2X3BA 1JXGA 4PJCA 1HVXA 3MLSH 2NX5D 3QORB 4EOWL 3C5ZC 3CDZA 5K9JH 1B4TA 2AEPH 3KPMA 4LEOA 2AK1L 4TNWF 3VGFA 1MRFH 4KO5A 1R3HB 2Z4QA 1KCBA 4LASL 3K2UH 1RK7A 5EZIL 2QKIA 5EU7E 1R9FA 1YYLH 4NJAH 4F2MB 3C2AH 3Q1SH 4TSCL 5DS8A 5MP6H 2NQ3A 2R2CA 2R7EA 5JUEH 4HXAH 5IIEB 5I1DB 5JOPE 3LQAH 1ZLVH 5A2CA 3U7AA 5IVZB 2ORBL 4HWBA 2X3CA 1F1GA 5DK0A 3S2CA 3L7FA 2XKUA 4ISVA 3WELA 3WJJC 3AG4B 3TZVB 3F85A 1K5WA 2Z8VC 2Z7WA 3ZTCC 2ZJSL 4KRMB 4KUCD 5FKPA 2APBA 2CO2A 4UIKH 3KBFA 2B14A 3W2DL 1IGCH 4HX1A 3S7GA 4YSAA 4TN9A 4RGOH 5CU5A 2VM3A 1KGCE 3FN9A 3HMXH 2UY7B 4ZTOL 3IPBA 4YUEH 1IIKA 4L3FA 2GTZB 3S2AA 3TNNB 2LW3A 2DWEB 4FP8L 2X3AA 4P06A 2ZG1A 5HHVL 1QKZH 5I30L 1M7UA 3U1SH 1IQWL 1IFHH 4NFBA 3STZA 1MI5E 2XY1A 1IC7H 4S1QH 3MJ8B 1ZHXA 3FQUB 1GZQA 4PJ9C 3DXAE 1R47A 2XN2A 3E3QC 3UTQA 5D71L 1AGFA 2XTJD 3ZTEA 1JPGB 3L5WA 5IJKA 4XPGL 1LNUA 2PTUA 3VI4A 4QXVA 3KPSA 4ZXBC 4WZ9A 4N1EA 3OQ3B 2VDOB 2Y1AA 2W94A 1I8UA 3SE6A 5IVNA 4O49A 4FN0A 1P2CB 4QRPB 4UM8B 1QFWM 4V1DA 1ILUA 2WVVA 3KGTA 3B3IA 4Y2DB 4HLEA 1F02I 1BG1A 1L9SA 2N7SA 6FABH 1L0PA 5JXEA 4BUQA 2YD6A 4BH8B 5EC1B 3IDUA 4ZMAT 4C56E 4FLHA 3LB6D 1TTAA 3M1CA 2XG4A 1U3ZA 2FX7H 2YMXL 1V54B 4BA8A 1B3JA 1XGUB 4S1DC 3JV4B 2IANA 5IK3A 5DL7A 1FAIL 1SZNA 1ZE3C 2HKHH 4LCWB 1E9PB 1I9JL 4ES8A 4W9JC 3FSZA 4U4IA 5T5FL 4XXDA 2A7BA 2C3GA 1PZ2A 4GRLB 3V4PB 1U58A 1HIMH 3HS9A 2FX7L 3ARWA 3IN2A 4R6UA 1QPXA 3WNMA 2FWOB 2WANA 3DDGA 3OMIB 4NWTL 5CJBA 3IRPX 1LD9B 3AY4C 3POCA 1HXMA 1UZ8A 2KQNA 4QHUB 2VZ3A 5E79O 3OF6A 4JDEA 1Z9SB 2GPZA 1N10A 5C0IA 4OIBA 3IKCB 4N2AA 4NZTH 4JFEB 2CD0A 4BCXA 1INQB 4M7LH 4NT6B 3EJZD 1T6WA 1UG9A 2X1PA 2QPFA 3U36A 2EXSA 2JSFA 4N22A 3MUHL 1OK0A 2ZXQA 3JV0A 3OHXB 3QDJD 2QSCL 2EVFA 1IGYA 4GYBA 3SE8L 4K15A 3MBED 4PJHE 1XMEB 4PRAB 1T5XA 4QCIB 1B0RB 1V05A 3COOA 3CZKA 5KYUB 1IJ9A 5GQBA 1ZLSL 4ONHB 1K8IB 1A7NL 2A6JA 3LVTA 4LLUA 3C8DA 5FM8A 3DWNA 1IV8A 2YD2A 2WPGA 2ZT9C 1ECYA 3JBG7 3GKWL 4G71B 3UBXB 3VQ1C 1IU1A 3RDTD 3WIIH 4KZ0A 4GKZB 1OQOA 4UOW0 4I5BA 3T65B 3PHOA 4NQSB 4FQIL 3ETSA 4EN2A 2P5WE 3G7GA 2VXSL 3FOLA 4FABL 2VT0A 1AACA 3PV6B 2EH8H 3GBEA 4AJVA 1QA9B 4NUJB 5HHXL 4P59H 2V37A 4PWHA 1SYSB 3EBIA 5D2LB 5KYWB 5GJSH 4B9KC 4FMFA 1UFGA 5ES4B 3LXBA 3PWPB 4K71C 3WNKA 2DYPD 1ZV2A 1KLUB 3GMMB 4V2CB 5IW6B 4JFPB 5CEZL 5E56A 5IHBA 4JN1H 1OAUH 2OYKA 4YSEA 4XNMA 4I0PC 3O45A 2D31A 3BUBA 2A6KA 2RBLA 1YAZA 4NP4L 3WTUA 3NSXA 3ARFA 3TA3B 5FX3A 4AQ8C 4JB9H 2AMUA 4KZCA 2AABL 2O6EA 2VDKL 1AS8A 2OTWA 4KDTA 4OLUL 3ZTNL 3H7LA 3M1BB 3N40F 3S4SA 5D1XE 3VI3B 4BK5A 1MAJA 4CVUA 5JHAA 2EIZB 1AQKL 2FTAA 3EO9H 1B0GB 12E8H 1LDPH 2EYSB 2DD8H 3I50H 1EJFA 4JZNA 3MPCA 2YAOA 5DR5H 2GTZA 2KZWA 2NW2A 2QR0B 3QEQE 3QJXA 1F56A 4GKNA 4LLMA 4Z7VA 3TL5A 1K5NB 4A38A 1OGAB 2IXQB 3WAJA 3EDKA 3GDCA 3NDZE 3POXA 1EGJA 4R7DA 3DYOA 3APDA 1KLFB 2ZCKL 1QEWB 1JZIA 1OGPA 4OM1H 2EYTA 2WN3A 2BOCA 1P1VA 5HYJE 1I9RH 5JLZB 2ORBH 3UTSE 3KS0H 3CFJB 4FG6C 1WE5A 1HEHC 2EC8A 4OF8A 1HCVA 3CCHB 1OM3H 5GZOA 3PRNA 1S46A 2K8MA 1PDKA 3GXDA 4QO1A 4QYAA 4XN1A 5IF0A 1K4CB 2BY3A 2VMDA 1T1YA 4E9TA 2CCWA 1KN4L 1A6TB 4RNRA 5BMFL 4P2OA 2CO4A 1BSIA 3EKCA 1YYLL 1IGJB 2XSKA 5D5MA 4JAMA 3C8HA 1F3DH 4PRNB 4CC0A 3Q1SL 1J0IA 3AA6B 3QJOA 4JZOB 4L4TE 2QVFB 2AK1H 3H9YA 1AS7A 4FG4A 4PBWD 1J0KA 3CPLA 2NY4B 2QPDB 4LASH 5GSVB 3N6YA 5F7BA 4WI9A 4MNGB 2AQ1A 2I7OA 3S4SG 1GFPA 3R8QA 1BREA 1CZ8H 2NYKA 3F58H 5CSGA 5ERWB 3K8MA 3AUVA 4AH2B 1ADQL 3L3KB 1XIWB 1D5XB 3HBPA 3KEDA 1DLHA 4GXUN 4PJ6A 5HHOD 5TDOB 4IRSA 5D7LD 5AVZB 4YPJA 3ZDYB 2QGCA 3D8MA 5F1IB 3L6FA 5C0DB 4FDWA 1N64L 1SY6L 3TNMA 5JMOC 1D5RA 1NCHA 1YJDL 3FSVA 2EE0A 1CDIA 2Q8AH 3EHBC 3ZO0A 1CL7H 2Y7NA 2FT6A 1NCBL 1UQSB 1YZZA 4LEXL 1O7DE 3MCG1 4ZFGH 2E9JA 5IHZA 1SMAA 2ZOUA 1W0VB 2HSIA 5F7YC 5GGRB 4L23A 3QRAA 1JHLL 2NY5H 1NGQH 1MY5A 3GSRB 2BIHA 1C5BH 4NKIL 4JZJB 4QRRD 3CH1A 3KXFE 1YYMH 1E4WH 2EINB 4AKQA 2Y5QA 3T0SA 1IC5H 3QDMA 4F1SA 3AU0A 2WQRA 2XPZA 3BPNC 2K7PA 4S10A 1INEH 4L4TD 4PIBA 4MMZA 1KTDA 4ZX4A 4WW1A 5C0CB 3B5HA 3HB3C 3DIFA 4LLWB 5E2TH 2EC9T 3EAKA 1UVQB 3N40P 3LSOA 4AMWA 1TO5A 3PL6B 3LZFH 3U9WA 1BFTA 1T2QL 5HDBB 1AGDB 4P2QA 5CLZA 3WEOA 4OF3A 3LIZH 2WXGA 4MZ2A 3H2QA 1U8OB 1T5XB 1OCWL 3DSNB 1I7UB 1TU2B 3JCUO 4O02A 3QEUB 4XI5C 4XO8A 3ZKMD 1N19A 2NUTB 1NWOA 3AM8C 2QQLH 5GRWA 5IHWA 3MLRL 3CZSA 3ZYOA 2BRRH 4M4RB 4M7JL 2K3TA 1BCIA 3CH1B 1FNFA 3TZVA 4KTYA 4IOIB 5ABDE 4MQTB 5FFGA 2BW4A 5EIVA 43CAA 5L4MA 4MXVE 4JX0A 4NSKB 3IGUA 4Q2ZA 4ES9A 4Y5YC 3BXNA 1X5MA 4QWWC 3PV7A 1JVLA 2APSA 3EW3B 3B7SA 3Q9QA 3VXSD 4XNXH 3QK0A 3DA4A 3FF8A 5BW7C 4IL6O 2H6PA 3UL4A 2D8KA 4M43L 4UNVA 1IBGL 2E8YA 1B9KA 3D4CA 4UTAA 4ZSOA 5IQ9A 2ISDA 1RH8A 4QXGL 2X6AA 1E27A 4HWNA 4A7QA 1F11A 4KV5E 3VJ6B 1A1NA 5DVMA 2ZCZA 3MOBL 4L9LB 5F9AC 5HGAA 1OAXL 2L8AA 2FATL 2RALA 2K6ZA 1VACB 3SE4A 1S9VB 1X5AA 4JG5A 4OGQC 3SQBB 1WVZA 1WWCA 4JGJA 1MM4A 2F18A 4M1CC 1LK2B 2OSLB 2Y6SD 3QI9B 5CSBA 1Z9PA 2L0DA 3CMGA 3D2TA 3RX9A 3TFBA 4IJ3C 4OLXH 3OKDB 3PQYE 1EDYA 3EGSA 3S3CB 3FFDB 1A1MA 4YXHL 3ZHFA 5B38G 3U6XA 3IBEA 1GAFH 3CHXA 4J27A 4HKZA 4KR4A 3FO0H 3MJ8A 4W9FC 4OCRH 3DMMC 3W81A 3BAIA 2YKLH 1SJXA 4GH7B 3SZ6A 1KPVA 2NY5L 2XWCA 1F1AA 5DWPA 2WYHA 3VXRE 1MFEH 2Z0UA 3LPFA 3KMDA 5E4OA 4FKHA 3RX8A 5HYJB 3UG3A 1VACA 3S36L 2WZ5A 3HNVL 2DQDH 5EF2A 2ZZUT 2HLFD 4PRHB 3QIUB 4ZOEA 5TQ0H 4CBZA 5T3ZE 3W82A 3KYNB 3ZT5A 2DQFB 2QVTA 4DQOH 4LNRB 4EZKA 1YJDH 5EOTB 5I1AB 3SPJA 1VLXA 4JREB 3KYAA 5I6XB 1EFXD 1KXTA 4K3DL 5C0AE 5CHNB 4X4XB 3O81A 1LE9A 2WQXA 2Y7QA 5LGKA 4PI0A 4GRWE 4LLYA 2LOEA 3K2MC 5AAMA 3GSVA 3U7WL 4PHZA 2X09A 4HKZB 1F3DJ 1U2HA 2KBGA 4WWNA 2JCCE 1AFVL 5I6KA 2E9GA 2EICA 1XF4B 1RP8A 1IE5A 2F5AH 3LQZB 3TA3C 1C7SA 4OCXH 1KPVB 3F65A 1NJ9B 3NUKA 3RY6C 2ITDB 1OAKL 1RFDL 4XI5D 1Y1DA 3JUZA 3W57A 3WUWG 2VLKA 4LVOB 3GUTB 4YBHA 3TT1H 3T0XA 2O4EA 1A02N 1UWXK 4YAQA 1BHGA 5JO5A 1YN7A 4MD4A 1INEL 3D39B 1WFIA 4LFHG 5F70A 1NQBA 4U1NA 1THCA 3LD8C 3KL5A 3L2MA 4N2GA 5KBPA 2WSDA 3BCFA 3ULVE 5D6DC 1LEGA 4MMZB 1WAEA 1K3ZA 2FRGP 1JWSA 1D7FA 4XPTL 3UC0L 3VFRA 3LX9A 1I8LA 2UXGA 1OIOA 1HXXA 3IXAA 5D2LE 1G9NL 4LCIL 1YUKB 4FTVB 3KBHE 1OANA 5ENWA 3KGRA 4XMPH 3ZBMA 3CC5A 2EADA 4AJ0A 3FHEA 4ZPTA 1XF5A 3SZKC 3DGDA 1IB5A 2P5WB 3LVEA 1CGSL 4XB8A 4QTHB 5FB8B 4BUHA 3ZTDC 3UBXA 4Z7UF 4U49A 1J11A 1R33A 3KCPB 1KZQA 2H26A 3EBHA 2A6KB 2PPAA 4JR9L 3FUHA 4L1HA 1W6LA 4HJEA 5GRYA 1ADQH 4FHJA 2ENPA 3QYNA 2PWDA 3EHBD 1N7ML 1PD0A 5BUGA 4B60A 4TULL 4MVBC 1CE1H 4YDKL 4HG4K 1DBKL 2TRYA 4ZX6A 4AYFB 5CKAA 2V2TB 3SPCA 3V6OE 1NC2D 1VFAA 1X5XA 1U95B 4JZNB 2ZOKA 4KNTA 1Q94A 2KZBA 4HHWA 1KGCD 2WXOA 2QJDA 3MUY1 5CGBA 2NNAB 1NMCB 2DLFH 1H3PL 3MN8A 4FL4B 5BV7H 5CKGA 5HGDA 2YSSA 4P2QE 6PRNA 1TLKA 1I7RB 4Y7MA 5CIPA 1EIBA 1NGQL 2FNBA 4NKIH 3O9WB 2V9UA 4PBDA 4TM9A 3VYOA 4E0RA 2R69L 2VO5A 4OZFH 1A6WL 4GRLC 5DQDL 3TN0C 2CUIA 5C0FA 3IDYC 1TZGL 2WAHA 3QJTB 3QO1B 5AALA 2X1XR 1QFOA 4ANWA 3T3MF 4YJZL 5EPMB 1Y7VA 2MPAL 5MEQB 2DZEA 4KPHL 3L9RA 4PGDA 3RIAK 5CZVH 2WLNA 3NDYE 1RZKC 1CD9B 1G7JA 3FU3A 4P23B 3UJJH 1OT4A 2YXWA 4HWEH 4OZGB 3JWDH 3S35X 4S0HA 1WAAE 2FBRA 2AHIA 1TNMA 1R34A 2X4UA 5AVUB 3Q5TA 4IS6A 3AMKA 1CDGA 4C00A 1B2WH 4KJWC 4WRLA 1IGIL 4HJJH 2BIPA 4JPQA 3V0JA 2IBGA 2GUOA 3RVUC 4KQ3L 3GLEA 1PFOA 3PNWB 4JB9L 4Z0BL 4JJ5B 3RNKA 2OFQA 2WKGA 4KXDA 4OAWB 3O11B 1BZOA 2BCKB 3JV6A 5IYUA 12E8L 3BLKA 2WXIA 4IGBD 5DQJB 4LQFH 1KV7A 1YVLA 1A7RL 1L0YA 3X3FH 1ET8A 3VDBA 3QO1A 1OCOB 2CRZA 5IF0B 4N0RA 3RIFF 2XVKA 1UTDA 3U9PL 4DGYL 4XNQB 2ZOLB 1E3ZA 3HI1B 2XTQA 3ZSSA 5EE2A 3RUGE 4G8GB 3S96A 1MHCB 5F1OB 3ATDA 1FF5A 4P2RB 1S7SB 3MV01 2R8SL 1T3FA 5IB1B 2R9HC 2Y7LA 3SBPA 4Q74A 4QTIL 4N0FA 1J5OL 3EH1A 4GAYB 2F53B 1PJ9A 3BD3A 3HC3H 4NQVA 1NEZG 4KX7A 2Z31D 4YSOA 3MCLL 3C2SA 4EUPG 1E2WA 1MW2A 5IMLB 1X44A 3A6CH 4XGZB 4BHUI 4FSPA 4LSFA 3VXUD 5CLTA 2IGFH 1G4RA 5DZLA 3O2WH 4B9IA 5AB0A 1BZDA 4GRWB 4FJZA 4AVHA 1FFOA 2QTEA 3EJYC 3TVMC 1EZLA 3LZNA 3NZHL 2GJZB 1FV1B 5C0AB 2C4FT 3WMPA 1PL3A 1KUMA 3IU4H 5IFHH 1XWVA 4HIJB 1HL9A 5J8OA 4LCWE 3V4UH 3UPAA 3RG1C 3VTAA 2EDBA 4LLQB 3E8UL 3WFEL 1E7VA 4EIBA 1XSOA 4PRAA 5HHNA 4OD3L 2V3FA 1PGRB 3KVPA 3VWKC 1QSFA 1UYWH 3O0LA 2W8CA 1Q0EA 1NAMB 4P3CL 1E30A 2VQUA 3TJHD 1PLAA 1FGVL 3V4UL 1CFSA 5A16A 1JPST 1UD6A 2JKSA 3ESUF 4YK4B 1FBIL 5GGUB 5IMLA 2P8MB 2LVEA 43C9B 4AK2A 3E8UH 4G6KL 1H3UA 5KBDA 2ALWA 2JCCA 2OSXA 5BRQA 3TO4A 2PABA 5BRZD 3QQXA 1FRGH 3U2JA 5SWSD 3CHSA 3PV6A 4M8QA 4DVRL 3B2UD 3L16A 1JCVA 1DBBH 3SDYH 4M61A 5D96C 3RWHA 2GSMB 3MBXL 2HWZH 4JLRA 5FYLH 4FERA 4J2XA 4JKPH 3HMXL 4Y9EA 2H5UA 2BP8B 1UB6A 2FEDC 4IKJA 3F05A 1JE6A 4FQLH 4LSRH 3DO4A 3KXFB 5L8KB 4O4XA 4UIKL 2VERA 1E43A 1A9EB 4D64A 3HW9A 3EJYD 3TVMD 4MAYA 1A7OL 4WI5A 3UAFA 1LK3L 1AC6A 1S7VB 1V10A 3NSCA 1JWMA 5D7HA 5G39A 3OLDA 4WDIA 5A16B 5C0ND 3FCTA 4P5SA 3BFWA 2JCCB 2I32A 2DYPA 5FA4A 4H8WH 3AADB 3ARED 2NNXA 4I1PA 1HZLA 2GIYA 1UH2A 2Q2LA 3HC0B 2W1NA 4M7KL 4JHWH 4YDZA 4QHMA 2VNCA 3WUZA 2E7LC 4ZMNA 5KS9A 3WIFA 4QRUA 4Y5VA 3VCLA 5E7FA 3RTQC 2DTMH 1PJWA 3QCVL 3TA4D 3MFFA 15C8H 4PW4A 1MREL 4AMKH 4KQ3H 4P0DA 4V2BA 3UDWA 4LLVA 4H40A 3ZE2F 3D9AH 1XR9A 4U6XA 2FB4L 2BOCB 2XJKA 4FQQA 4IMLA 3TZVC 5JLZA 3QJFB 1LO0H 1RPQA 1AANA 3QWNA 5EORL 2JK5A 4N2EA 1T1XA 2I7SA 3QUGA 1RUKL 3OHMB 3CBKB 1J8RA 5DMGC 3SCMC 4Y9FA 2COQA 3ETBF 3CU7A 3FTVA 1OGTB 1CFBA 3H3KA 1E28B 3EYSH 3L4ZA 4BEIA 5JPMB 1RJLA 2V6HA 2XWRA 3DK2A 4QRFA 1RUQH 3EF7A 4PREA 4TSCH 1CTNA 3QC6X 1SOSA 3QUXC 1TQBB 5KANG 3TM6A 2IDUA 4NYLA 1E67A 4LKXB 1T1LA 4G3YH 4TNVF 5F44A 4ZBJA 2YOAA 3S3PA 2V5TA 1N0XL 1KZYA 1LP9E 5G3AA 5A2BA 2DQGL 3FRUB 4LF3A 5EU3B 1NGZA 3NJJA 2OP4H 2GY5A 3X3GH 2ODIA 2ZX9A 2E4FA 5C0BD 1M1SA 3STZB 3HZKA 3R8BB 3MLSL 1KYOJ 3GXMA 3L3IB 3E6HA 4TULH 3QVAA 4OAWA 3V8OA 5AVWB 3ARBA 2O72A 1BMWA 1A7RH 4A55A 1GHFH 1R5IB 4QI3A 1SF3A 4YOKA 4Q4IA 1LO3L 5DUJA 4OFPA 3ZZSA 1DBMH 4Z0BH 1I1AD 1Y6MR 1AGCB 4NGHL 5IM7B 2X1OA 4DPAX 5ACZA 5K9JL 3CN0A 4LPCA 5HYQB 5F1NB 3KR3H 1VHPA 2B39A 4BFJA 5HD8D 5KOVC 4HAKA 1JI1A 1T4KA 5EA0L 3VA2C 5F3HB 3QCTL 4DETA 4BSVA 3MLUL 1IAIH 4KO6A 4AGMA 1KPRB 2W65A 5T1KD 3QORC 2BVQA 4A2GA 3UACA 3I6KB 1D5MB 1AKJD 1RZQA 3G08B 4UI2A 1GGIL 3HFMH 4KJYB 4XPTH 2E47A 1P5UC 5HHOE 2Y07L 5ICZA 4ZQKB 3AMLA 3GSWA 1C8QA 3QJQB 4EUPA 2BOBB 3B2DC 2AQRA 2R15A 1J9TA 1PG7H 4Y2DD 3QJZA 1EAPB 5FWRA 4PTUA 5DMJB 2ZYSA 4N87A 2HFGL 5GRVK 3MCKB 3OR6B 4DGVL 1SEQH 3BESR 1QSEB 3D69A 3CDZB 4FC3E 4P2OC 1EZVX 4GQQA 3NZHH 4ZRGA 2R23B 1JGUL 2WUBL 1U8MB 2IAAC 1RZ7L 4PLOB 1QVOB 4AKPA 1U95A 2ZWSA 4PJIA 1I85A 4F7MB 3FONB 4IDJL 5I1CH 4XNBA 1BVKA 2H3NA 4HBCH 1CE1L 5TDPB 1G6RA 5IB3A 4JJHA 1NM9A 2Z31A 1AQHA 1BGXH 4K8RH 2Y3NA 3EYQD 1WUZA 3LH9A 5LBSL 5ESAA 2WHVA 4LDLB 1EAOA 1XFPA 4C4BA 4E5XG 4UILH 2I07A 3FO9A 4FA6A 4Y4FD 1YEDA 3D0LB 3D1MC 2IOIA 5B3SB 1NEPA 4WWPA 1J0ZA 3U0WH 4TSAH 5C7XL 2N2LA 1QACA 1UD5A 4Y8AA 2VL4A 2W9EH 1DQML 3BD4A 5AKTA 5MERB 5E9NA 1R3HA 3O4OB 5AZ2L 4L48A 2WWKT 2XQBL 2WZPA 2AV7A 3OJVC 2I9LA 3QEQD 3SDCB 1LP9F 4HGWA 2XETA 5AENA 1E4KA 2X4RA 4ODSL 3DX9B 5DSCA 1SF5A 4HEME 3FRPA 2BOLA 2OZ4A 3SKJL 5F1KC 4DP5X 3ALXA 4WI0A 3OMZA 3BUPA 1GZHC 2GQHA 4Z77A 1DANT 5I0YA 1UCBL 4PJBF 5IJCC 1KB9J 2D7MA 1JZHA 3H4FA 3OJMB 2VLRD 3QAZB 5E8EA 3RGVB 1I4FA 5A2IH 3GXUB 3OBAA 1RPUA 1ZS2A 2MQCA 1N0LB 3HIZA 2WYTA 3H6AA 3AAAB 2TRHA 1BW8A 3PFQA 5GZNA 4XBEL 2WIIA 5FGCB 1CFVL 3KH4A 2BNRB 4MS8D 4XOEA 4GG6F 4PCSA 4HUVA 3VG9C 3ZMNA 3C6SA 3WNNA 4GW4B 3IMVA 4POZC 1DQLL 1RZGA 3N85L 3L5JA 3RU8H 1Z32X 1ETJA 4K7PX 1G7HA 4PJAA 4YDNA 1KGWA 2FH6A 4J1UA 5DK2A 3CXHK 4ALAH 3AVEA 2MPVA 3RKPA 4DGIL 1MJ8L 3U9UA 1WBYA 3T09A 2F5BL 5DUPL 3UBXG 1A7QH 5JHDA 3LQZA 1AGFB 2FDBP 3SKOA 3TIDA 1KEGL 2KLSA 3SKMB 5I18L 3RWCB 4Z77B 1WZKA 4JFZH 3MA9H 1FCCA 1FIEA 3ZZ1A 2EABA 5IHHA 5L2KD 4EI5D 2V2WB 3MJWA 1I8IB 1RJYB 3CXHJ 1U8CB 4N9GB 5BS0E 4OTXL 2EUVA 2W0FB 1LXMA 2OTUB 3DXAA 4PY7B 4BV1A 1ADWA 5JORA 4NYLB 2O61A 4KVPA 3D34A 1TF4A 4IHBA 3UX9B 4UTAL 1AZNA 1JYXA 5E8NB 4FESA 5IUCA 1TT6A 4N20A 2IBZX 4XAKD 1IVLA 1SXNA 1FNGB 3DV6B 4Z3EA 2B1AH 3JWNG 3VO0A 1A4JA 2YJLA 2EDNA 3K80A 4EQ3A 3II2A 1RZJL 1Z2KA 2HT2D 2OK0L 4MS8C 4L3ED 5ALCL 1XAUA 1E8ZA 3L7EA 4LE8A 3K72A 2E4TA 3OZLA 1P5UB 1RSYA 2JV6A 3Q3GB 4BKLB 5GGVH 3TYFA 2X6CA 1N59A 5DI8B 5AQ0A 1ZK5A 1L6XA 4HPOL 1IC0A 2FZ3B 5IESH 3ROLA 2VXQL 5HHOB 5KAIO 2RAMA 1ZVHA 4IRJD 4WTZA 3L6FB 5DRZB 5C0DA 5I71B 2C34A 1D5IH 5IR1B 1OOWA 3QDAA 4PFEA 1EEQA 1P4LB 1NDMB 2O5ZH 3FQWA 4JHVA 4JUSA 5ENWB 5JXEC 1G0XA 3VMNA 2YAFA 3MVSA 4MMXC 3JTBA 4HT1H 4ZTPH 2CLRB 4TUJA 2BNUA 4PYHA 5CUSH 4AI7A 1WS8A 2DL2A 1BM3H 1O6SB 4J7RA 4L5FE 4ZT1A 2W9DL 2ZAHA 4FQJH 5B1AB 4MS6A 3BGFC 3CZEA 1QZNA 4P3WA 3SCMA 4AUIA 3KLLA 3D0VA 4JNXA 1MIMH 2H26B 4UBDD 5C86A 5HYSG 4ZNEA 5MENE 1AZVA 3K71B 5ILTH 4JHAL 2D7TH 4A67A 4Z7WB 1FCGA 2P8LA 4RMTA 4H8UA 4DP7X 3GZPA 5AZUA 4BKLA 1BA9A 1FFQA 3K4AA 2WLHA 3LNFA 4OKDA 1KEML 2KUTA 5GGRY 3P73B 2XWJA 1M7DB 4MQ7B 4LAQL 1S4IA 5KSBB 4QD2E 4B0MB 3ZL4L 4PVBA 2X41A 3K3QA 5IBLC 3T0DA 1MAML 4PLKC 2EH7H 3TF4A 2HT4C 1DO6A 2WXLA 1UT2A 1BVKB 1QO3B 2BS71 1E3FA 2H3NB 4GO6B 4X83A 5TK4A 4WU7B 5DSCB 2HVBA 3M17A 4GUPB 1CGUA 1A7QL 2YEQA 5G2NA 2EIDA 1AD9A 2R2BB 3AG1B 2CBTA 3HB3D 5TQ2L 1L9MA 1DL7H 3G9AB 2OQJB 3P54A 2MWCA 1CD1B 2DI9A 3KD4A 3CN3A 4LP4A 4ZDHB 3PXHA 4E5XA 4QAWA 4X7DC 4PRHD 5I6OA 3US0A 1OT1A 3SKUD 4JHBA 1P7QD 2R4OA 1NPUA 1GZPB 2EIZA 2FSDA 1DCEA 3FYXA 2G3XA 2GJ6D 4CMMA 2A9NL 1F90L 1KCUH 3IJEB 3T3PF 3QRCA 4HKXA 5D6CB 3WEMA 3I6GB 4KAQH 2KDYA 1A6VH 3UXFA 3V95A 1RV6X 3GMRB 1FL5A 4HIXL 5CR1A 1CI5A 2AF2A 3I85A 1ZLWH 2ADYA 3RGVD 2F8XC 1WHPA 4AKOA 3QCTH 2IDQA 2CDFA 1QTPA 4M8VA 2Y5EA 4M93C 3RWJA 2FO4A 3LS4L 1GKOA 3DJZA 1N6UA 3HRZA 3LN4B 2ADFL 4KK6D 3QP3A 1T0MA 2WLLA 4N2MA 1KCRL 1E28A 3DI3B 2P43B 2OMXA 1BFVL 1K2DB 5DEGA 1QFUL 4G8EA 3VD9A 3MOAL 3RVVC 4M1DH 3OWEA 3D3VE 2YXMA 5F7KC 3QJHA 2VN4A 1HDMA 3APNA 2DQGH 5I5JA 2O5XH 3WKMH 3BDXA 3P4OA 5AYQA 4GG6E 5LLIC 4DIXA 5K9KA 1DVZA 2ENJA 4RDBA 1H8NA 5C0RH 4BWTA 4I3GA 1FYTA 2E75C 4OQTH 1ZHYA 3FOMB 4J5VA 5E4EB 4PJEE 3QG6A 5AUMA 2KS0A 1TVBB 2B0SH 5DK2B 1U3HB 4JFOB 1OB1B 4QRTA 4WTXA 4PR5A 2NT1A 1JZJA 2N4IA 5FYJD 4NZJA 4AYBA 5M94B 3AGVA 3ECUA 3ZKNC 5FYKH 4JCWA 1RUQL 2XPGB 4P99A 1JK9A 1MIEH 1CF1A 1D6VL 4DWHA 1BAFH 1NEUA 3GXTA 4XO5A 3RY6A 4LARH 2R0WH 1N68A 2FQDA 3RVUD 5HYQA 3VWJC 1RULH 5F1NA 1R17A 4YNYA 3MRGB 3DJSA 3NJNA 2Q9OA 4B9GA 4UANA 1EZVY 1L3NA 3IKCA 1YEWA 1NCDL 2OMWA 1R5WB 3QJVB 4ONFH 4XMTA 2LU5A 1PSKL 3KWTA 4YSUA 3ZY7A 4BFNA 4EIZC 1PCSA 1NC4B 1NFIA 3LKQA 2DB8A 3G5YB 4LSQL 4RVBA 4WJG3 4NO0D 1DJSA 1JV5B 4TUOB 1URIA 2X2UA 2W91A 5FYJU 5EU4A 1C5BL 3BUTA 1K8IA 3WJLA 2PYFA 4ELME 1Q9WA 4RJXA 3KYKL 1LM8V 3U1PA 3ETTA 3ZKND 1HAUA 1TZIA 3O3EB 4HJGA 3TBVA 3OLIA 3OC5A 5DRNB 4WU5B 3QDMB 5IMOA 3OAWA 3RTLA 4LP8A 3QQDA 1G9NC 2H32H 4OCYH 1IAOA 1T16A 2I9TA 3MCKA 2OZNA 1EFXB 4JM2F 4O02L 5FOBA 1L0QA 4IRSD 5D7LA 4ZO8A 4RFEB 2JE8A 1QRNB 2EXWC 3SGKA 2VL5A 5B38B 5F1SA 2VXTH 1SYVB 1LO5A 4WW2F 1UXLA 4WY7L 1C5CH 3ARQA 2LHAA 3WFHB 4AEEA 4F57H 2X4SB 2J4UP 3KXFA 3CVDA 5SX4H 3I6LE 5TK2A 2DWYA 4PN6A 2A77L 4C4KO 4ZMYA 5E6YA 3WMSA 1G1KA 3NFSL 4E41E 3D09A 3A3YB 4K94L 1MPAL 2ZKHH 2IEPA 5BVJB 2O6PA 1C5CL 1AQMA 5ANME 1AHWB 2PO6C 1KIUA 4HUUA 3SE4C 1A21A 2OSYA 2VDMH 2XZZA 3A4FA 4G6KH 4KZEH 3SDDC 3AG2B 3QQ3B 4TKWA 4GMTH 3FQNA 1TTCA 2QADB 43CAB 2VC2L 1FGVH 3OKLB 5G38A 1ZT1B 4G3YL 1MELA 2G3NA 3C5SB 5MERA 4Y5YB 4E5XB 3QT2A 3UTTE 1A7PH 1KJ2B 1OTSD 3IFOB 2DEYX 3JT0A 3MLTA 4U6VH 7PAZA 3LJ3A 3MO1B 2VL5B 1S5LO 3ML9A 3BVUA 2AMGA 2GFBB 1K4DA 1PAZA 5FF6B 2QSCH 4TNWK 4N2BA 4WGKA 1BQKA 2C9RA 4RAHA 4CSZA 5C1MB 1MCIA 2R2EA 3ULUH 1TSRA 4A7SA 4DP0X 1EPFA 2EEBA 4UAOC 1FI8C 3W9DB 1G6RL 5A2KH 2UZYB 1KTJA 3ZHKA 4R84A 4NIKB 1SJEA 4OUOA 3CMOL 5LXGL 4F9PA 1YPZB 3WIHH 1S9XB 4HK0B 1F4HA 1UD2A 3AS1A 2J88L 4JFDE 3BQUA 1AGCA 4OV6F 2QL1A 4G11A 4HIQA 3UZEA 4DHLA 3OQRA 2ZX7A 3H0TB 3LY6A 5I1IH 1MQ8A 1FNAA 2V5RA 3C5SA 1GZPA 4WTZG 2A77H 3NABL 4AE1A 2IDFA 2VDLB 3LYRA 3QBTB 1JXDA 4P2RD 1TIUA 1F4XH 2DF3A 3CFCL 3D85B 3MO1A 4X6DE 1SEBA 7FABL 1G5AA 1WUNT 3QPKA 3UPRA 1M9WA 2DEWX 4TQHA 4NP4H 4YIQB 5I16A 1BQHA 1J1PH 1DBJL 3PORA 1RVFL 4AVIA 5FR3A 5KZCD 4X6BB 4AXWB 1Q0YH 2NUPA 2J20A 3BSHA 4MCYA 5FGBC 4MRCA 1SDDA 2VJ8A 4F7KA 5E9DE 5CEZH 3QG6B 1BPVA 4E9LA 2UXVA 4XVSL 3QWRA 4WHYG 4NJAL 1SJEB 3RUGB 4NUQA 1TLMA 2Z0BA 3FCSB 3GDBA 5DYOB 3S3DB 2XN9D 2IWVA 1D5XA 5DFWH 5DZVA 1QPPA 2J5WA 4Z95L 2JCWA 1T4KB 2BY2A 4HD5A 2ZXBA 3WE6B 4IGBC 2Y2XA 4GAJL 1A4KA 1B2WL 1B9ZA 4YNYB 4YHYB 4WFEE 1ODAA 4X4MA 1JF5A 4HS3B 3PWNA 4P4KD 1CLVA 1EANA 1KBGL 1KCSH 1CG9A 1B0IA 2Y7QB 5JW4M 4ZPVA 4G42A 3QCUH 3GB7B 3C12A 4JM2B 2WNGA 3R19A 4QHNB 4TUJB 2B5IC 3TTSA 1YECL 4FNLL 3OB8A 5CBEA 1FYTE 4ZQKA 4EIGB 4OZGE 2YPLA 3GMOA 1ZT7B 1DQDL 3BAWA 1VZHA 4HA1A 3GRWA 4KK6C 5C6TL 1P4IL 1QSFD 4KPHH 4LPVA 1DJXA 1PMYA 5I19L 4HOMA 3S48A 1RZFH 4PVNA 1Q9WB 3VFPB 4QNPE 2P5WA 3ZMEA 2GTWB 2J2ZA 2VSCA 2WSKA 3B2MA 5CJXA 3R18A 4HCRH 3LPOA 3WIAA 1YY9D 1WD8A 4APXB 1AQ8A 1P69B 1AVAA 1MHEB 2QGBA 5DRXB 5MP6L 2NZIA 1AHWC 2XFXA 1S3KH 5D9SB 5GRZA 3DX8B 3QPXH 1NC2B 3VH8B 5FECB 2EYRB 2H2PC 4BQCA 1UOWA 1WV7T 3GEWB 5FO9A 1A14H 2ZWNA 1OM9A 3UJIH 4AEIL 5D1XB 4PJ5E 1AXIB 1WHOA 1OSEA 3S88H 4JFHE 1CG9B 3F2LA 5J57B 1RIUH 1S8DA 4FTVA 2A1WL 5DDHB 4D8PA 3FFCA 2X4NB 4PJ5D 1OLLA 2E46A 2RFXA 1QFUH 4ZYKB 3SQRA 4PGJA 1WGVA 2BS8A 3CZFA 4MHHI 4O5LH 4XP5L 3GF8A 4L3CB 4OCSH 4QMEA 2IO5A 2NW3A 1L9PA 4NRYA 1HHGA 4KXZH 2BHUA 4KO7A 2CUAA 4Y19B 4GJTB 1DVFB 1GGBH 1KIUB 2QVIA 2VMJA 3KCPA 5CIPB 5ESVA 3OZ9H 1H5BC 4ELMA 2L7UA 1CGSH 1LE5A 3J2PA 2DW5A 4UZSA 2XJLA 4V1DD 2FIRT 4RBPK 1D7BA 3BSZH 1XCXA 2X4QB 3RWHB 1EXUB 4RZCA 4V1DE 5HTSA 1A2YA 4ZNCD 4P07A 3HR5A 3HZ3A 4PS7A 5JPNA 3MRIB 5HGGS 4WHYH 3TH3T 5ELIA 4ODVH 1W16A 1XGYL 4EEEA 4FG6D 3EOTL 1ID2A 1CDHA 3G5XA 1RJZB 4QQ1A 2BP3A 3DTXA 2X4UB 3S36X 4BK5C 2LLNA 3PRZA 1GTNA 3FTGB 3HMXA 1VZGA 2F8VA 2AP2A 4OCLC 2WQ8A 5CLYA 4KJQC 1GY2A 1FNSL 4Y9BA 1CD8A 1T0PB 3MRDB 4XO4A 4RETB 4Z7UB 1GAFL 2Z92B 3O3AA 4W4NA 4ISVB 1QKZL 4GW5A 1BDYA 1G7IB 4U1GC 1ZHWA 1N0LA 3F01A 1R3JB 2KXPB 1CGVA 3HG1D 1A8JH 2VR4A 4FYRA 4WEEA 1BF8A 2YD8A 3ROOB 2VUOA 3AB0C 3TWCH 1VKXA 4GI8A 3PHSA 4YUEL 2JKXA 3RB5A 5L9DH 1DP0A 5IHLB 3SYSA 5C0BE 4B6ZA 4JFEE 1TMCB 5HDQL 2VH5H 2RD0A 1WFMA 2V7HB 1I1CA 2NQCA 4GQ9H 4OZFB 3GJEB 2B1AL 5AW0B 3BWUF 2MJWA 1HHHB 4HG4J 2PTTB 2BJML 4GBXC 4Z7QB 1SHXA 2PUQT 2GSIB 5JW3L 1I8MB 3FRPG 2Y7SA 1KTRL 3D25B 4N0FB 4RA0C 3GSVB 2VRQA 4GKOA 1SLUA 1ZIBA 1GKEA 3O41B 4A6YL 2XBTA 3E9UA 4Z78B 1AXSB 3G9VA 4L5FL 3UROR 1NM4A 1E42A 1CURA 3WFDL 3L5IA 5LQBH 4YSTA 5DHDA 1FP5A 3D7PA 2EH7L 1CGXA 3ARDD 1KELL 1P5UA 2DYRB 5GRXG 3TJEL 2EDTA 4X0KA 1YN7B 4MD4B 3T8XB 4F7CB 3CWGA 2Y25A 4S11A 3VFWA 3HS0C 3WTYA 3HVNA 3NCFB 5C3LD 4GSDL 4IIQB 5CJ5A 1HNYA 1MM5A 1ZIAA 4L1DA 4EAEA 5JR1H 2N1KA 1AAJA 1HOCB 3K0YA 2MH4A 3DV6A 4DVBA 2ZNXA 4HPHA 2QQLL 3NZUA 2H3KA 3A2SX 4GBXD 1A0QH 1E90A 3D6GA 4KNUA 4WSGA 5AOJA 1FIGH 2LABA 4MAZA 1UB5A 1EERB 5C0CE 5HYFA 3O41A 1S9WA 4UQDA 5H2BA 3DO7B 1CQKA 3N42B 2B4CC 2NYYD 5ETUB 4FQJL 3FT1A 2HTLC 3MMEB 3QUXD 5KUMA 1KIQA 1FFPB 2DKUA 5A7EA 1CF8H 1WAPA 4P9HH 4X6EB 1QBLL 2J57A 3MA7B 1Z5LB 1YEIH 2VQ4A 3MRRA 5FCSH 4KC3B 4BM7A 1TETL 3P0GB 5IB2A 5TISO 4ZMTA 3T2PA 4N3TA 3DWTA 5HVHC 2JMMA 4KRLB 3RZCB 2NTFA 1LLAA 3CU1A 4X0NA 2FEEL 1TEGA 3KS0J 4HSCX 2HJKB 3UIYA 1JD9A 1F58H 3UJTH 4D2NA 1IGTB 1IT9H 1AD0A 4TLSA 3CUPB 3VH8A 1QSVA 5HD8C 4B9YA 4PJDA 4DP8X 4G43A 3UFIA 1BVNT 4X8CA 1MCWM 1Q94B 1SOKA 4AL8L 2Y36L 4QPEA 1MAMH 3HHSB 2CRIA 5C3IA 2OBGA 1KELH 3DBXB 3N44B 4GF4A 2XA8L 4HUNB 3GBML 5SWSE 1MOEA 4JHUA 4KZDL 4L8SA 1DVFD 1ZA6A 3BJLA 2IALB 4Z8FH 1TQVA 4L37B 3TBTA 2F7RA 4TPRL 4APQB 1KIQB 3NCYS 4GMSL 3Q48A 3G6JA 1KV3A 2YPLE 3IGAB 3ES6B 1EEYA 5FKPB 3D2UD 4QXWA 3NBNA 3EXLA 1CDBA 1F2XK 3LPPA 3U82B 2Q2EB 3PWPE 4HOXA 2X5PA 4PG2A 4PP2B 4KVNL 4UMSA 3QS2A 2HJKA 4LMQI 4NQEA 3NQIA 4EXPX 1BVNP 3S8WA 3Q8AA 4I9WD 5FS5A 3AACA 4D3CL 3WDHA 2J56A 5E24E 3HG5A 3I3EA 3MFFB 3V6OC 3HHMA 3RDTC 3S88L 2NX5B 3SDCC 2P5ED 4FFZL 2UZYA 4M4PA 1Z7JA 4G70B 4FTVE 3QEGH 4HMDA 3P9WB 2ICCA 3RNKB 2JJWA 3WN5B 5AVSB 4P48A 2VDPL 1T0MB 2WXHA 5DVLA 4D7BA 2K9UA 3GEFA 4G7YH 3D0LA 1NDGA 1G7IA 5DUMH 4HCRL 3OD3A 3BHBA 3RVWD 4Y1AE 4NCC1 2I5YL 1TUPA 1CLZH 3ARZA 5FHAH 5CMAA 1OAZH 3K6DA 4J6IA 3S3SA 4F2FA 4O2CB 3HUJA 4XVUD 3MUZ1 1OGAE 3MRIA 1Z9OA 2WM0A 1GGIH 3HFML 1X4ZA 2NR6C 2AV7B 2WXPA 2XC8A 1AGEB 5HVWA 4QLWA 2R29L 2JQZA 4NQEB 3QR0A 3LKSA 4OZFA 4GRWF 3GJEA 3QQ4B 2CLZB 2AQQA 2NT0A 3LOWA 4XH2B 3VRLF 1KJ2L 3WN6A 5GS0C 1FIGL 3BH8A 5DHEA 4NB7A 4JJOA 4XCNA 2NXYB 1RJCA 2AJVH 2GSIA 3D5OF 3FRUA 4MLSA 1YRKA 4PJBB 4IOSD 4EO5A 1GYUA 4JCLA 1HYSD 4CU8A 3IT8D 3T5WA 4GXUM 5FW7A 3PP3H 3BWSA 5F9JA 2XACC 4ZW6A 2XDHA 1LO2H 2HLEB 1S7QA 4U0QB 4ZXBB 1HZHL 3UABA 3EMNX 5I1GH 5HGHA 5DJCA 4OU3A 2CDGA 4I18B 1FORL 4LIQE 3TFKC 3CFMA 3WY1A 3A23A 1ZLDA 2BPBA 5D7JD 4HXBH 2OP4L 3MJ7A 4QGTA 2MFNA 1E6OH 1WFUA 1INQA 2QFRA 2R0LH 4LBEB 2AAVA 3IYLW 4IMKC 3V5KA 2I69A 4P3DB 4ZW7A 5HVHB 1KBPA 3MRJA 3UAEA 1QSFB 2ICWJ 3VY8X 2E9BA 2H1PH 5DA4A 5GGQL 3L3IA 1SQMA 1LD9A 1W8OA 5DJ6B 3ARUA 3NZSA 5HHQA 1D7DA 2R1YA 4Q9BA 3P2DA 4MA3A 4H5SA 3RWCA 5F6HJ 3MLXL 4JL1A 3BO8B 4WV1C 5B1KA 3MODH 3RGVC 4ENZA 2YQBA 4Z7QF 3IM1A 3FTUA 3V6FA 2J12B 5ERWA 2Z6FA 4L3AA 4YXLL 2ENSA 2P5PA 5CILL 2JI1A 4A63A 2R83A 2D0HA 1J7VR 4KHXH 1B3IA 4UQBA 1KY6A 5L88H 1A6UH 4N86A 5CEXA 1MLBA 5E9DB 2H1XA 1JGEA 1PAMA 5JORB 3WFHA 1MRDH 3KWXA 2LLLA 2JVUA 1F97A 1IGFL 3PIQB 1X7TA 1EDHA 3THML 3LEVH 1BV8A 1A7NH 3V7AG 2NY1C 4OD1H 3PHOB 3HFFA 4NQSA 3CVIH 3RKDC 4MJID 3CQQA 3MV7D 4FNTA 4QRQB 1W0VA 1ZTMA 1NA8A 2C8NA 4XXCA 1DJIA 4UT6L 1JRHH 4X8XA 4PJ8A 1IKNC 1XGYH 3T6ZA 5JYMA 2Z31B 5JHBA 2CNZA 2X6UA 1OTSC 2A9BA 4LU5H 4ZUWB 3O9WD 5GV0A 5AB1A 3RPKA 1OALA 1WG3A 5GISH 4DKEH 4FQXD 5H8DA 4TSAL 5FGSA 5FM4A 3BEWA 3QCUL 3QISA 4GMTL 3DJRA 1B90A 3MRBA 2X4SA 4K8RC 3IFOA 1NFKA 4NZFA 4QHMB 4MNGE 4E42A 2VO8A 2PRNA 4JCHA 1TZHB 1BJ1J 4M9PA 4AKMA 3FBKA 1TPXB 2EYSA 4MSWB 2OLDA 1QFPA 2EH8L 4MAUH 4BRJA 1NCWH 2XXFA 1MEXL 2NW2B 2V8LA 4FF9A 4LLMB 1J87A 4HUUB 3HHSA 4G6MH 1JWMB 1KYDA 4WDIB 4DVRH 3QEUA 4YHLH 3DX6B 3Q8BA 5LKNA 5JHLL 1B0GA 2DQCL 3IF1B 1O6VA 1JI2A 1FN4A 3ZSTA 1VFOA 1TEYA 4B7LA 3D9AL 1SXAA 3OV6A 2CO1A 1AOZA 2X42A 2PXYA 1M9SA 4IHOA 3CJJA 3TESA 1Y18A 3ZRFC 2M06A 15C8L 3V5DB 2BFVH 3QFDA 1FBIH 5I1KL 3VGHA 3EF4A 3HS0A 1FGNL 4L4VE 4MKMA 2K0LA 3N0AA 5ACLA 1O5DT 3JWOC 5AW1B 4LVNC 4O2CA 3C09B 4FZNA 1QEWA 3KWVA 3WHE1 4AKRB 4FXKB 2NY6B 3ZKXB 4E9QA 2OTPA 5DC4B 4KKAD 1VCBC 1VGEH 1DQDH 4F3FA 4PB9L 3KAAA 1BBJB 4OGYL 3NP3A 4GUPA 3HZKB 2HAZA 4N2KA 1S7RA 4P5KA 2VDML 1D5BB 1T7WA 1T1YB 5SWZD 1YN6B 1KCWA 3KJ4C 1R5IA 4FP8H 4P04A 1MFBH 1FN4B 4NQTA 2P7TA 3WOVA 1TXKA 3DYPA 3D4ZA 3F6IA 3NCCB 4LVHC 3GSQB 1CL7I 1MXGA 2D7PA 3D18B 3V5HA 4WI6A 2HPTA 3RDTB 2A9DA 4N1HB 4XNKA 1IUZA 4X50A 3TC9A 4CN6A 4JM4H 4QHKJ 2DQJH 4HJ0D 3K6SB 5JNYB 2DLTA 5D5MB 3SN6N 1LWJA 2ZOOA 3HUJE 3NMEA 2VN7A 4HYTB 1U8HA 3LNEA 3TCXA 3ZYIA 5J9PA 3N04A 2V7NA 1RMFL 3RFZA 4XAKE 3DMMD 1NMAL 4XPFH 5E4EC 3ARPA 3KWWB 4M1CD 4ODBD 4F58H 3H8NA 5E2WL 2WXFA 5I75C 3VFGH 4NOFA 5EUOB 3GLAA 4PJ8D 4UNTA 3QXAB 4M1DL 4MAYD 2JTYA 4J3SA 2WGNB 4AENB 3GSNB 4MJHA 5DMIH 5BVPL 2WBJC 1YEGL 4WI4A 1H6UA 1MHEA 1VEMA 1IBBA 2KT6A 1ZHLA 4KWUA 4HPYH 3DHMA 4S1DD 1JNHA 5EO1A 1DBBL 1KGJA 3B9KA 5EF1A 3U1SL 3VXSE 1ETA1 4G59C 5EG6C 4NHUB 1QRND 4N2IA 3GKWH 3G6JF 2Y0SA 3VYNA 4YH6A 1MVFA 3FQXA 2P9RA 1RZJC 3GS0A 3SDXF 4YEFA 4MJ6B 3KG5A 3VU2A 2OX5B 3FNKA 4BH7B 1TZAA 4JFFE 4GFXA 1JPEA 2PPFA 5LAPA 1K9TA 4MB4A 5GGTA 1T21B 5B7MA 4RFOL 4ONOA 4ILDA 2AXGB 1OARL 3DRQA 5H37H 4MDRA 3VTTA 5C9JA 1OWRM 4L8CB 2GVYA 4YAQB 1HH9A 5FK9B 2PP8A 2ZJSH 3CBJB 3FQ4A 3DARA 4EMZA 1EEZA 2AQ2A 3QORD 4CILA 5T5FA 2B0SL 5LBVA 2AV1B 2E0PA 2BIOA 1QLEL 2VZVA 4PV1C 3WUWA 2PXYD 1P4LA 3FQWB 5CZXD 3AQYA 5K39B 2R88A 1D9KC 1EV2E 1WAAA 1YG9A 3HG1E 3LKQB 1XMWA 4RIRA 4IIZA 2K45A 2BVOA 4LBAA 2F1TA 3VE0B 2JXMA 5HJ3B 2R0KH 5T5FH 4YFLI 2CJUL 2FQGA 4NZRL 1BFVH 1F3RB 1WBZB 2MTPA 4PJ8B 3F7LA 4C8XA 2XRAL 4ZFZB 2MKWA 5J6HA 3NCWA 2ADFH 25C8L 1KG0A 4EZLA 2IAND 4NBYB 4XVTH 4XNZB 4G80A 2E9IA 3KXFD 4G8AC 1OHQA 2VE6B 1N8OE 4X99B 1IAOB 4QKXB 4UAOB 2VQ1A 1DQQB 2EQDA 4NNXB 3OKOA 4R0LC 3B9KC 5IFAL 2FSEB 3O9WC 3OSVA 5I8EB 4E9YA 4Z7OE 5DMKB 4DUWA 1UH4A 4NN5B 5AB9A 3ARYA 3RLSA 3KL3A 3AWEA 2O5NA 4Z3IA 2XE3A 2OJZH 3QFDB 5AVRB 3P2TA 1YQVL 3SPIA 2RMNA 2NY1B 1PKQB 5BQ7A 4N58A 4A2DA 4HU8A 1TCMA 4BD4A 4RMRA 4O51B 3UTOA 2ZXAA 4JQXC 3KZ8A 5E0QA 3BH8B 2NZ1A 4OD1L 5GS3A 4M29A 1C5DA 2W07A 4YL4A 3C60C 3MV7A 1AR1C 2R69H 3KPLA 5DRWA 4ADIA 3DX6A 1OZUA 1UKTA 2N59A 1CR9H 3NCJL 3SBWA 4LNVA 3M46A 3BZ4B 3D52A 3QQ3A 3O6LH 4HK3J 4MZ3A 4JO3H 1LP9B 1XCWA 3FQ1A 3FN0H 1X6NA 1ZANL 3JWDL 2D3VA 1LMKA 4PWGA 2OK0H 4Y89A 5KAFO 2O5YL 1E5YA 1N2RA 4P4KC 4TOYL 5T5NG 3SOBL 4GW4A 4PWFA 1UCTA 3H9SE 1WYJA 1PX4A 2AITA 2XX1A 5FEBA 4YXLH 4KUZL 1DFBL 4DKFH 5K9KB 1CFNB 3U7WH 2ZKYA 4FFWD 1FL6B 5H94A 4MJ2A 3I2CH 1QSFE 3FOMA 3BT0A 2L7QA 4WUUE 2RIKA 2WWMD 1FVEA 4KGLA 3UERA 3SKMA 1I82A 5T33H 4KKLD 1L9NA 3W3BA 4AIZB 3OKEA 3UTSD 3ZYZA 1XBRA 3HOEA 2CR3A 2FECI 2K6WA 1E5UI 2CIIB 5CJOL 4PRPD 3VVWA 1H9DA 3JQOB 3PAVA 4FCHA 1HOEA 2E7HA 5DEGB 3QIBC 2Q86B 1FH5H 2V9TA 1FLRH 2IFFL 4H0LC 3HN5A 4LVOC 4WFED 1TJXA 2KH2B 4DN3H 3CSTA 4RWHA 1NGXA 5I1AA 1J8HE 5HI5D 3LMJL 3NGBC 2FQEA 3AY2A 4NN7C 1A47A 2CO6B 3F64A 3BZEB 1I1YB 4FE9A 3WNIA 2GK0A 3BAEH 2GSGA 2PXYC 1MCCA 4JO1L 1QNZH 4JRXE 4XCFL 4LLYB 4OBSA 5E4IA 2G4EA 5K1NA 4U3SA 4WWKC 4Z7NB 1BQ5A 3NRPA 2YPVA 2HRPH 3STLB 1CLYH 4AGQA 3MFGB 3IGLA 5BS0B 2X88A 1XVSA 1SBSH 3FN3A 1ETZA 3GT6A 1DDHA 3K74B 3TN0B 4I9XA 1Z66A 4XMWA 4K7FA 4UQ2A 4Z7WE 3ES6A 3NPZB 5I8OL 4P2RE 5CGTA 2C3WA 3BT2L 3AA0A 2HRPL 1BZ7B 7CGTA 4C4KT 3UGEA 3ULVF 1AHMA 3ZE1E 2XWBA 5GSRB 4PJIE 2ZIDA 3BPLC 3U4KA 2B4CL 3IDNA 2AQTA 3HE7C 4OLWL 4PRID 2EDYA 3MRFA 2FJFA 2C7UA 4U0RC 4KDWA 4BFGA 2AS5M 2BNUB 3SDCD 4C54A 5BZWB 1J48A 1LQBC 4IU3B 4A6YA 3QRLA 4U1MA 5EOQL 1D9KB 2MCMA 4XCCL 2E7MA 2H0FA 2E8ZA 2ARWA 5IBLD 1ZJBA 3CXDL 3O8XC 4L8SB 3GHBH 1MCPH 4Q9QL 5BJTA 1JGIA 3ATFA 1ZA3A 1BWWA 4PP1C 4ATTA 4PJ8C 3WO4B 5H37G 2EO7A 2QADD 4FFVD 4R5VA 1WFJA 1EQWA 3CX5K 1HZHH 5C07A 2NRDA 2Q8BH 1BXWA 2GTWA 2J2ZB 3AA7B 2ZUXA 3BDYH 5KW9H 1CD1A 1SLXA 2EE2A 4KVCL 4L5FH 4KK5D 5F96H 5DZPA 1KYFA 1K6QH 3DETD 5J12B 3SB3A 1NGWA 1PIFA 1TZHA 2NY0B 3I2CL 2MQGA 4ZFOL 4ZFQA 2HFFA 1P6WA 3N50A 4B97A 1P53A 1XL4A 2QPSA 3OJDB 2A38A 3GLZA 2A6IB 2C7UB 2FUTA 1GYCA 1NCTA 2WBJA 2OCCB 3HE7D 4KUZH 4AWJC 4DKFL 5D1ZC 1I9EA 1E4HA 5F96L 3V7MA 1OHZA 1GFQA 1PY0A 3MAWA 2KZ7A 2AJ3A 3NFPB 2EDDA 1NOAA 2XA8H 5CJQH 5D4JA 1JERA 4I3RH 2F7QA 3NN8A 4IBSA 5K33A 1Q0XL 2L7JA 2WOYA 2IGLA 3IJHA 1PW3A 3HZYB 1UJ3C 3NIFB 3CHQA 4YVNA 1MQKH 1M57B 4Q4EA 3RHWK 4NO2B 5C6WH 2JLLA 4RDQF 2EXWD 4FZEH 5IESL 4W4OA 4W93A 3CSFA 5I1HH 1X5IA 2ZUQB 2UZIL 3VXUE 2JJTA 3R0NA 2W60A 1M71B 1OD9A 1PF3A 4I3RL 3ALPA 4PJAE 4OQ1A 1ZSDA 2ZCLL 3EFFB 4ODWA 4YO0A 1BPLB 3OAZK 2LTQB 2UXFA 3PWVA 4ZOAA 1TR7A 2A74B 3T1FB 3ABGA 5MI0C 2EILB 2PYEE 4QT5B 1A3RH 3OTTA 4C56D 4MQXC 5KG9B 2VAAA 1D2PA 3O6FD 4C4VA 1OB0A 4ODUB 5J3HD 3HBQA 1RZJH 2I25N 4O51A 4WKZA 1QEXA 2Q76B 2VR6A 4A7GF 3MNZB 1RUPL 1EZSA 1A0QL 3O3BB 4N26A 3KPLB 2WBWB 2GI0A 4OGXH 1UOKA 3WTTA 1N4XH 3VACA 1YAIA 4NKMB 1ZHKA 5B7EA 3SKJH 3BKJH 5EBWA 3ULUF 3TBSA 1BGXL 3VUAA 4Z7NF 1X5GA 3I75A 3LTVA 3V4PH 4TL5A 2YK1H 5ISZD 1AS6A 3QUXB 3QQNA 2YC1B 4MZIA 2VMEA 2CJUH 2G75B 4HUKB 4JCMA 2NYZA 3RWFB 2Q86A 3GTTA 4HWZA 1XXDC 4F4BA 1A9BB 1MZZA 4OGAC 4AM0A 1MVYA 2A4CA 4AQAA 4RFNB 3TJEH 1OW0A 4EPSA 4TNGA 1SHSA 4KJWD 3KLAB 4PHXA 4H2CA 2D3LA 5EEYA 3S34L 4ZPVB 3CXDH 4X5QA 1U8NB 1I1RA 2AZAA 2OXGB 5D7EA 2HFGH 3B3IB 3FQXB 3ET9F 2ZAGA 3C75A 4F8PA 4TLTA 5GIRB 1NAMH 5ESQA 3ATEA 4KROB 1U6AL 3L9YA 5F2FA 4M8UA 3M7OA 4KTGA 5C0IB 1NBZA 2B8OT 3ZQWA 2XZCL 2QSVA 3GSUB 5HDQH 4QNPF 1C1EL 5EDSA 3DECA 3S8GB 2HT3D 1UD4A 4OJEH 1TQBC 3IU3A 4JY5H 4OB5H 3BT2H 3VXQA 1ZHLB 4P2QD 2WWNA 3RYMA 1NFDB 3GZKA 4FLSA 5JOPD 5EZLB 2R2HB 5AKSA 2X4OA 3UBFA 1TYRA 4F5CE 1NCCL 4XXDB 2O5YH 3DVIA 1EHLH 2OA9A 1KCVL 2GK0B 3NT0A 4QXGH 5JOFB 4JM2A 3IDNB 4MCMA 2J1YA 2CE6A 4WSJA 2BWDA 1DVSA 3ORJA 1MREH 1BM7A 3QPQC 4Y5XA 1YMMA 2P24A 4AMKL 5IJVB 3UYPB 2JJUA 3MLYL 3B2XA 3WS3B 5CZKA 4YGVB 1XX9C 3VWJD 1FO0A 4HUMB 4NQXB 3FPXA 4L8SC 1JHLH 1LMIA 2NX5E 3KPOB 1AQKH 2FD6H 3L3OA 2PW2A 5IQ7H 3OVUB 2DLGA 2J21A 2DM4A 4R4BA 1MFVA 1MHPL 1OLZA 2H7WA 2J8UA 2NQDA 2FLRT 3A4EA 2WZPD 5CJOH 2LR4A 4LRIC 5C07B 5KVEL 3Q2LA 3TPKA 1YQ2A 3RL1A 1XGZA 4ZUVB 5ID1B 4NNXA 4PJIF 3EO0B 3MRFB 5KSAA 1REIA 2HVKA 3QIWA 3VG9B 2VW6A 4YX2L 3L54A 4P8QA 3T08A 2GJPA 4OR1A 1GC1L 4KK8C 4Q0XH 3LH2L 2D31B 3FONA 1V8HA 2H32A 4PLJC 2X6MA 1WBZA 2VABB 3F7KA 3U30C 2W80C 4PWIA 1XAKA 3PDGA 1KBWA 2NY7H 4LPXA 1KG0B 4QYOA 3MV7B 5C0JB 3EFOB 3UYRH 3ULUD 2IV9A 5TE4L 4PS8A 3BZ4A 4WK4B 1IC4L 3FFCE 3C5ZD 2AZUA 5F93C 3TCTA 1JNNL 3EH5B 1CR9L 3NCJH 1IC5L 3DVNB 1PQZA 2J6WA 2JKIS 2IDSA 5JPNB 4ORGB 3CVHH 1HQ4A 4PREB 3AT8A 5BQ7B 4UM9B 1OARH 4TLUA 3PL6C 2Y07H 2Q3ZA 4HGWB 5AKRA 5MEND 2APFA 4XAWH 4K3EL 1VESA 4HUXB 1IBZA 2NUPB 2EDQA 4FD0A 4ZFGL 4KH2A 5E1IA 3TN0D 2FJSA 1RUKH 4PRIB 4HEPA 2AQPA 4NZDA 3B2PA 3H53A 2NNFA 4GAAA 1N67A 5E6ZA 3VRJA 1O7DC 4Z3JA 2F9BT 3CLFL 2PYED 4WO4C 2HLFC 4GG6A 1IBFA 2JIXA 3B4NA 1RJLB 4UOW1 1QATA 5CLXA 5IB5A 4HF5H 4K94H 3CSGA 4OD2A 4P9HC 5LO7A 3OWRA 1NGZB 5EA0H 4PJAF 4OCSL 1I3VA 3UMNA 4NP9A 2ESVD 4ZAKC 2YMXH 5AG9A 3K6SA 2XI9A 4JY6A 4LHJB 5GZNC 3A6CL 1HNFA 4NNYB 4FA7B 1A5FL 1H3VA 3WO4C 4F7TB 4LKCA 3LHAA 3ARRA 4OVVA 4PJGE 1J18A 3WFBL 3FZUC 2J5LC 4U1IB 3IJYA 3IJ7A 4K55A 3B1UA 4J6RL 1A3LL 1QQDA 3WL9B 4QO1B 3QWRD 4RWYL 5LVEA 5CP3H 1GS8A 1N0XH 2EIMB 4A7VA 5JQ6L 5EUOA 3LKPA 3PS6A 1JPSH 4MQXD 4HZAA 1Z9SA 4RSYA 1S9KC 2WLIA 1E5CA 1DVUA 5GSVA 2AEQH 2CO7A 4Y16B 1TTRA 3MNDA 2H1LM 1QYGH 1CXLA 3N44F 2BMKB 4PQXA 4BZ1L 3NJTA 3CZJA 1T7VA 5T5NF 4Z7NE 3BFOA 3IMBA 3CDYA 1RP9A 4H1LG 5AEAA 1QBBA 3AT0A 1A4KB 4K7FB 4UQ2B 4POZD 1IC7L 3VXTB 2WTOA 1LQSR 3NCEB 1Q9KA 1MCNA 5CP3A 1L4IA 2VXUL 2L3BA 4XN9A 4AM0B 3DROB 5AD0A 1BAWA 4QAMB 1TNNA 3WEAA 4DKAA 4DO5A 4CU6A 2Y2WA 1ZXQA 2UUDH 1CJYA 3F7YB 7PCYA 3NOIA 2R2HA 5L2KE 1U92B 3AAZB 4F9LC 2V9QA 1L0XA 2FX8H 1FG9C 1XIWA 2A5UA 4O58H 2YQ3A 1MDAA 1JWUA 4U3SB 5E5MA 1F4YH 1H5BA 2O30A 4ZTOH 3T65A 4PLNC 3ULUC 4OFVA 1LEIA 2GIXA 3Q05A 5FYLD 1U91B 3GMLA 3G5ZA 4XP9L 3APMA 2X70B 4HIIA 2DTML 2K4WA 2VISA 3ZQXA 4LK4A 1CLOL 3SGDI 4L8CA 5J6HB 1IQDB 4BZ1A 2VKXA 4DPCX 1YS5A 4PGCA 4WTWA 5CXPA 3T0EC 1E6JL 2CO7B 4O58L 1U3JA 4NPYA 4F33A 1VZIA 5ICXB 1G9MC 2VE6A 1SVCP 4G9DB 1J9RA 4KFMA 2AABH 5FYKL 1AQDA 3HJ0A 3MRCA 2DQMA 5SX5H 1OP3K 3L4XA 5F97E 5FECA 1KXVC 3EJSA 1J8KA 4ZODA 1B4RA 5GS2H 5IW6A 1B6DA 5T1MA 1QSZA 2Q87A 3SQOH 3V4VB 5KJ4A 4QTIH 1J1OL 1MN4A 3QZWA 1A2YB 3CN1A 3PQYB 1HKLH 4RWYH 1JPFA 1NMBH 3H3PH 1A64A 1Q0YL 1ZTXE 5I74C 5JOFA 4J3OH 1TQCB 1FFNB 3BIKB 2G60H 2AEQL 4PJXB 3DPDA 4MJJA 4Y4KC 4IW4C 5IEKB 3QA3A 2G3ZA 3NJLA 3D08A 1ZLWK 2P46B 4B50A 3FQ2A 4I89A 3GRWL 4PW9A 4HFWA 4LXFA 4IKNA 3Q6FA 4GI6A 4NRZB 4MTMA 1QLFA 5EIIG 4FOMA 3T3ME 4X9HA 3UP6A 2Q7NA 4PJDE 1GW0A 2JMRA 3WEXB 4CVWA 3CFKA 1VJSA 4X80L 1TO4A 5F3BB 1DHKA 2Y4SA 3T0BA 2C3HA 1YY9C 1J8HD 1JN6B 4LIQL 4IOSA 2XWTA 1DEEB 1AXTL 3SBRA 3DOSA 3TU6A 3HS8A 4OGYH 5SWSA 2A6IA 1V7MH 1WSST 4IEFA 2VQTA 3X14A 2H2PD 3JTTB 4O02H 5I0XA 2ZSWB 5INCB 1QBMH 4Q9CA 3Q13A 4NRXB 5DO2C 1HQ4B 1YNLH 3EOBB 3Q0HA 4YFLF 2IAMB 3MNWA 3X1NA 3ZO9A 5K9OA 3MTXA 1N8ZB 3LV3A 2R8AA 1IGCL 3Q1EA 4XC1H 3QQ4A 2LT9A 4MMYA 4WUUD 3KNBA 4K3HA 3FQRA 1WGOA 2LAGB 5ECJE 3QH3A 1KENH 1ED3B 1DJGA 2DDQL 3DK0A 2HCZX 1XB8A 2WQSA 3IRCA 3EXJA 5BV7L 4U6HA 5HHVH 3VWJB 4X6DA 5A40E 2PCYA 4XZUA 2KI6A 2HFTA 3ARDC 2ZKXA 3TEZA 2VLJA 2KL6A 2WAQA 4Z3GA 1T7ZA 2OV0A 4HWEL 2CDGB 1D6EB 5J9PB 2J44A 3EGSB 3C6LD 3E8VA 2X2JA 1J1XL 1G7HB 3MRNA 3UZEC 2WY3B 2WWKO 4WHTA 5F88B 1KB5B 3EJCA 4GOSA 4HUXA 4Q9RL 3JTYA 4KBPA 4AEHH 1MCEA 2KPNA 1SDYA 1Z5HA 4GQPH 1XEUA 4PJBA 3KPRA 5BQDA 3CLFH 2VTFA 1GJUA 4WO0A 2H2SC 3DMMB 1AE6L 1BOYA 4B9JA 1YEFL 4PJHB 4HKBA 4JFFB 2CRMA 5K1VA 5DJ6A 3WHE0 4PGBB 3UAJA 4ECNA 1S78C 1IM9D 1IMHC 4TTDC 2IH8A 3L08A 5AYUL 3GSUA 2B2XH 3WKML 1NCNA 5DD0L 5DLLA 3V4VH 3ATAA 4MRBA 1NEZB 5DMGD 3A24A 3QNZA 4I2XE 3SCMD 1HDMB 5D7LE 3TBCA 3PWUB 4RMVA 4JO4L 2KHAA 2CGRH 4KROD 4AG4L 1N7MH 1Q9KB 2OMTA 4UV7L 5DVPA 4YZWA 3X3FL 4HT1L 1KXTB 4ZTPL 5I8KL 3KLAA 1OTTD 5HYJA 1UXWA 1KBKA 2IANE 4U1MB 5F6HI 1P0SE 1HAWA 4DPBX 4ENED 2H0JA 4K3GA 4Y5XB 1FHNA 4JQVC 4PR5B 5JO5B 4I18C 1LWRA 4PS4H 1IIIA 2DJ4A 4LHUG 4NN6B 2W0KA 3ROLB 1G5GA 3DBXA 1OPOA 1NJ9A 2BW5A 4HJJL 3UAJC 4FAAB 1MSPA 4OZ4B 1V5JA 4FADA 3ZDZE 1NDMA 2BHYA 4XMPL 2IWFA 1FFRA 3NSYA 1FNEA 1PD1A 3RGHA 3MLXH 5EU6A 4O3ZA 3W2DH 2NXYC 4M6MH 4LSVH 3QNYB 1EUTA 3BP5A 2WW8A 3VZUX 2A9NH 5LCVA 4I4WB 5C0NC 1R5WA 2G3MA 1RCYA 4K5OA 3D4GA 5L8JB 4KRNA 1JUFA 2AERT 5EEUA 3SGKC 3GP6A 1KC5H 5FB8A 3OGOE 5J11B 4LCVA 3KDMB 5CM1A 2YN3A 3TO4C 1X5JA 2Y9RT 1B6UA 3TT1L 2YD1A 4N8VG 1HI6A 4OTXH 3TLRA 3K7UA 2DQDL 4OF5A 4BWWA 2DLEA 4JW3A 4OZHE 2OR9H 3ZIYA 2OW7A 5B1JA 3OKKA 3P73A 3TBTB 2P8PA 3F12B 5E0FA 1PZSA 4HFUH 3MRKA 4HCFA 1J0YA 3DSFL 3AITA 1QLRB 1GMEA 2YK1L 1PFCA 2D03L 3BP4B 3ASWA 4N25A 2R27A 3CK0L 4ZUVA 5ID1A 4ZPTB 1XF5B 5E6IB 4B3VA 1IM3B 2BWIA 2ROXA 1ZAGA 4IRJC 5ABZA 4XP4H 2RQEA 3BP5B 1U8LA 5JHMA 2OJEA 1H9VA 3MJ9H 2PW1A 1RUPH 5M7QA 5I15H 3MTRA 3MRHB 2V4LA 5L2JA 2JKJA 2YPVL 2ZOKB 4OGXL 1AGBB 2VABA 3C6LA 1CFVH 2ZSWA 5INCA 4ACTA 1AZCA 3HJEA 4XHJC 1A3RL 4XPAL 4GT7A 4PH8A 2VLJD 3HEIB 1QD0A 3O6MH 3QUYD 4LSHA 4FXKC 5C0GB 2R29H 2VRAA 5I76A 3PPSA 2NCMA 2FEDD 3BPCA 1OAQH 2K4AA 3VFVB 4P23A 4PJDF 2PCFA 1G4MA 4YHIA 3WEXA 4LSDA 5DC2A 5F3BA 4DSYA 2BSDA 3VSQA 5D2NA 1PHOA 4H4NA 4TQ8A 3WENA 5JW5B 4EXKA 5EO0B 4M03A 3V0WH 3I9GL 3OM3B 3V6ZA 2NDFA 4S0TD 5K69A 3SGJC 1E4WL 4CSSA 4KMTL 1IAKA 3LN5A 3VI3F 3WIHA 1S5HB 5FKAA 3SO5A 4XTRD 2CGYA 5TGBA 2WKOF 2R56H 4JJ5A 4FXTA 3FW6A 2V3EA 4F8NA 1T7YA 5DT1H 4WI8A 3KM1A 5ITFA 5G5DB 4OFDA 1NCAL 1AFVH 3RTQB 3VM7A 2ZKWA 2CM5A 2HTKC 3HI6H 3QIUA 2RR3A 3OKYA 3C09C 1KEMH 2XX0A 1R24A 1G7QB 4OZGA 3GYRA 3RJQB 5DHMC 5EOTA 3QDJE 1U8QA 1JXFA 2H8PB 4WGWB 2DY2A 4FNQA 4NUMA 4RRPA 1S7SA 3LHPH 3UEQA 2N7BA 3PXJA 4XBPB 3UTZA 1ETB1 3VI4F 2XTJE 5JIPA 3DXAD 3QO0A 5AAWC 2GC7C 2XN9A 4UYPA 5F7DA 3SPHA 1T0NB 1YLBB 2XLLA 2P47B 3BDYL 5KW9L 2VAJA 1YNTB 3HLAB 5KS9F 3GMNB 2FIKA 5DL8A 1T6BX 1CGYA 5DWUL 4LBEA 3WXWL 3FFCD 4PJ5A 2JQAA 4GP4B 3RURA 3CSYB 1FL6A 5FM5O 4YWGH 2Y24A 3F83A 3P3UA 2OMUA 2VR7A 3EGXA 3G7TA 2HG0A 3LRSA 2Q3AA 3RWIA 5AWNL 1EO5A 4ZUTA 3GHBL 4HV8B 3I9IA 3WJMB 1DSWA 1TQUA 1DBAH 1OPGH 5A3IC 2XU9A 5HYIA 3IDMB 3SPVA 3OAUH 1OT2A 5DRWB 4XBEH 3MYJA 3K8LA 4TNFA 1QFWL 5HDRA 3K46A 4KK8D 4R3SB 1VIWA 2D0GA 1AP2A 4Y1TA 1E50A 4YHOH 2FGWL 4I1RA 5F7DB 4YK4C 2PMZA 2E7DA 4JO5A 2YMOA 5EU6B 4OT1H 3LK41 5LXVA 2IOMA 5J1SC 4K8RD 2ILLA 5CINH 2VLME 1CYGA 5L9DL 1ZXKA 1J0JA 2OI9C 1JUFB 5J0BA 2OSWA 1CICB 3VD3A 4ZAKA 5EEVA 2N0MA 2NY3B 3CV5A 5IQNA 2IWKA 4FQHB 2IFGA 3QHZH 4W6XB 1S6NA 3CAFA 3HMWL 3KVDD 5E8DL 5IEKA 3R4DA 3D48R 1MAKA 4OIIL 4LCYA 4HV8A 1IBGH 4DN3L 4LSTH 2COVD 9PCYA 1JZ2A 2HX8A 2LHFA 2ZWZA 3GI9L 1T03H 1VFAB 4QWWD 2D03H 5C0EB 4H0HB 3BWZA 2F68X 2W0LA 3QULA 4AGOA 4G80B 5AL8A 3SODB 4BXVA 3DWOX 3IWUA 1C12A 4W6YB 4FXGC 2WMPA 4NN7B 1AE6H 4TVPH 1L6ZA 4QXTA 1HINL 5ALBH 3MLRH 1DBJH 3JWNE 2C1OA 4HJSA 3AA1A 3VD1A 2VLKE 5A7BA 1XO8A 2FECL 4ANXA 4I5BB 5AYUH 1WIOA 2JI3A 3OAYH 4YSSA 2ESVA 1BLIA 2G0KA 5JW3H 2ZP8A 5D2LF 1IZNB 4KKNA 3KZIO 2EDOA 3TA3A 3OLEA 4E9RA 2OMZB 4LCCB 5D70H 4NRYB 5CZXC 3VXOA 4CKVX 1SXBA 2PCPB 4I3SH 4OM1L 4HBCL 1QW8A 1T0OA 3MR9B 5D2LA 3T0AA 5CCKL 5HVFB 3UJIL 4AEIH 4ELMB 5KYWA 5D1QD 1GPOH 4APQD 3RWEB 2YGQA 2EDJA 5T3XE 3GNML 4QOKD 1EO8L 1GYWA 3H2WA 2NY0C 2G9KA 2QR0A 2NOYA 1LGVA 4GKNB 4QRSA 4Z7VB 3IETB 2ZYHA 5BXFB 2UZPA 2FGQX 2YOCA 4LLVB 4UTBA 1KB3A 3HPLA 3H56A 3WY2A 3T0EB 4W1TA 2PW1B 1FNHA 1YPZA 1H6EA 4OH2A 2JK5B 4FLQA 4U6YB 4M6OL 5E00B 3QAZC 2VIRA 3BQUB 2HYMA 3EJQA 4PJFE 2DDQH 1CFNA 1UWEL 4K3JH 5EOCL 3BVNB 3VXPA 1AI1H 4JE0A 4XCEB 5HHME 3VA6A 4BFIB 2KZ7B 2AJ3B 1RZKH 3NFPA 4FKEA 4H8WL 4K0OA 4M5ZH 1WP6A 2WXMA 4NWUH 4C47A 1ED3A 2PCXA 4W81A 3DMMA 1AR1B 4UT7L 4EE2A 4GW5B 3FF7A 3NCXA 3SZVA 3H9HB 4Z7QE 3AXLA 1BQHB 2H8PA 4JPKH 5CWSB 2Z93B 4AQZA 4GFTB 4JY6B 3WMQA 3EDJA 3ULVD 3KCWA 2K8QA 2J1XA 4PCYA 4O3WA 2KYIA 1F3JB 1RK1B 4UF7C 5JXAL 2PLTA 3L3DA 3X17A 5BXFA 2AI0L 3G3LA 5MHSD 4G7RB 3E6FA 1DBML 2LU4A 2ADIB 3FB6A 4MA8H 1HHJA 2FGRA 4HLJA 3TO2B 4F7EB 4M1GL 1RUMH 2XWEA 1U33A 4HKJB 4JG1L 5AOKA 1O9VA 4A2LA 4AVJA 5LN8A 2YRPA 1XB6A 2VXTL 3OSKA 1BYOA 3BPNB 2VDLH 4XNZC 4E9WA 5B8CB 4PJHA 2ICWB 1PZUB 3TEYA 3O6FC 5J3HC 4HIIB 1EUUA 4Z3HA 1GZHA 3L1GA 4KKCC 4OF7A 2F74A 3RIFK 3DHUA 3W1ZA 2X7LB 4JRXB 3NPSC 3GSNA 3QJRB 1PZ3A 4BSVB 3RNQA 1SJVA 3WFCH 1UACH 3U6RB 2BZ7A 5E94B 4AL8C 1OCRB 1J88A 3REVA 2W95A 5I2IA 3PXLA 4XC1L 4O2EA 3QDJA 3SY6A 5CD3B 3RGBA 1NANI 1JHKL 4PG2C 1C08A 3OXSA 5T3ZD 5FAAA 5HBBA 1WTGT 2QPUA 5F3HA 2X87A 4BSJA 3JYBA 3PPEA 8PAZA 2BC4B 1FA4A 1CICD 2J88H 3PABA 3LXCA 1KJVA 4FQIH 2HKFL 1LEIB 2FEJA 3B2VH 4X5WB 1IQWH 1IFHL 3V0DA 5ACZB 4YDIL 1YMHA 5D1ZD 2V8MA 4JN2B 1QNIA 2JB5H 5BOZG 4FQPA 2IPTH 5DRXA 3P4MB 4AITA 1HL8A 4JBSA 3MHZA 5B8CA 4NPYB 5AW5B 4F33B 2F8IA 2XQ0A 2APWA 3I50L 2JELL 3S5LB 2VDNL 5GS1A 1ES0B 4JRXA 3T4AC 1VDGA 3IDJA 4XNUL 2EZ0C 4ZW5A 2C9VA 1CTOA 4M3JA 3SY0A 4JHWL 1X5YA 3FFCB 3OG6B 1UADC 3VXQB 1WISA 5KN5B 1DQQA 35C8L 1G7LB 2D7NA 1BFSA 2WP3T 4NBXB 4JRFA 4MYPA 5D1XA 1NDTA 4FSOA 2QHRL 1HN1A 1E8XA 1NIFA 4MMZC 2OL3L 1HKLL 4HJ1A 2EP6A 2ODJA 1MFUA 5IOPB 1M56B 4Y2NA 2YA2A 1M1XA 5H37A 3KWUA 4ZUUB 2YBGA 1UD8A 3FOLB 4J8RB 5J6GB 4IBLT 2AAAA 35C8H 5IZ7A 4YHZL 2ZONA 3B3BA 3ECWA 4MMYB 4W4OC 1FO0B 1J1PL 1DSFL 1S3RA 4B7IA 3I3DA 3M1BA 3VI3A 5CS7A 3BGFB 1MRCH 3L2LA 4IIQC 4OVUA 1AC0A 4P23C 5F8QC 1BIIA 2J8UB 3OKOB 4P4RA 3QR2A 3VGEA 5I5RA 5KJ7E 3NA9L 2F58H 4M1GH 2GW5A 2AQNA 3RL1B 1G9MH 4IOFC 3A21A 3C6EA 3ABLB 3T4YA 1U41A 3QNFA 5FGCE 3WU1A 1T83C 5CSZA 1PCXA 2DI7A 2DQTL 4YQXL 4KRPD 1IAMA 3GWJA 4HMCA 4O4YL 1G0DA 2VDQB 3HPLB 5BNXD 2IF7A 3HA0A 6TAAA 3VH8G 4FGMA 3KYKH 3IFLL 4N2NA 1WA0X 2OMZA 3B5GA 4RMSA 1PZ5A 3RRQA 4W6WB 1DN0A 1FH2A 4KNSA 4H8PA 1FJ1A 4P49A 3M7FB 2IC2A 2A99A 1NFDE 1EGJL 1RZ8A 3ERXA 3INOA 3U46A 2R9HD 1BIIB 1QYGL 4HS8H 3BFQG 5CBAB 4WFFD 2X9XA 3H9SD 3O8XA 3X1EA 4FMKA 4RH4A 3JZYA 4EVNB 5I1KH 3FB5B 3QWOA 4NZUL 5IMMA 3QUXA 1H19A 5FYJH 2QKSA 1GA2A 2R69A 4KZEL 1EMTL 2XPYA 1OZTG 1A6UL 4IBQA 3TBWB 3WLBB 2CSPA 1A7BA 4FS0A 5EN2A 3HE7A 1XCQA 4ZMWA 4QRRE 2VDLL 1F00I 2FJGB 2K1MA 2XWDA 3SDXE 1KGXA 3MV9B 1YPZE 4ZW8A 4JKLA 4Y1SA 3BRYA 2UWEA 3RPBA 5D7IA 5E8OB 3WGUB 4K23L 4GXVL 4PY8J 1O7VA 3C6SB 4ZUTB 1PLGH 2AKRB 2DQEH 2XXMB 2ZD0A 4AM0Q 3IE9A 4LNRA 4HXAL 2R8SH 4PJGB 1V55B 3H9HA 4MNQD 4R2GD 4MJ5B 1RK0A 2AFNA 1E4KC 4AK1A 1B4LA 4EI5A 4AT6B 4HUWB 2VZ1A 2JJVA 4Q56A 4YZFF 4XODA 4XMVA 1B0RA 5JPNC 3WD5L 2FIKB 1XGRA 1XF3A 2ATPB 2ZXEB 3CDGB 3F00A 4P3CH 2UVFA 2OCJA