2KDYA

Nmr structure of lp2086-b01
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
261
structure length
261
Chain Sequence
MGSSGGGGSGGGGVTADIGTGLADALTAPLDHKDKGLKSLTLEDSISQNGTLTLSAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTALQTEQEQDPEHSEKMVAKRRFRIGDIAGEHTSFDKLPKDVMATYRGTAFGSDDAGGKLTYTIDFAAKQGHGKIEHLKSPELNVDLAVAYIKPDEKHHAVISGSVLYNQDEKGSYSLGIFGEKAQEVAGSAEVETANGIHHIGLAAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Factor H binding protein variant B01_001
publication title Structural Basis for the Immunogenic Properties of the Meningococcal Vaccine Candidate LP2086.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Immune system
total genus 32
structure length 261
sequence length 261
ec nomenclature
pdb deposition date 2009-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2kdyA02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2kdyA01
4U9CA 4O3XB 4O3YA 2KDYA 1YS5A 2W80C 4AYID 3UAQA 5T5FA 3VE2A 4O49A 2Y7SA 4AYMC 4O4UA 4O4XA 4O3WA 3PQUA 4AYNA 2W81C 4AYEC 4AYDC 3PQSA 3HOLA 2KC0A 2LFUA 2YPVA 4Z3TA 3V8UA 4O3ZA 3VE1A 3KVDD 3HOEA 4QQ1A 5EE2A
chains in the Genus database with same CATH superfamily
5D55A 5A2JH 4HQQL 1UCBH 1YY8A 2LU4A 1REIA 5E4EC 1BOYA 4WUUD 4J4PC 4KMTH 2BSRB 2G2RB 2WIMA 3POCA 4NNYB 3S5LB 1I9IL 4WI3A 5F7HA 5I28A 2IPKB 4MNHA 2M07A 2W92A 4K3JH 5B8CC 3TEYA 4UQ3A 1WFTA 1K4CA 2OPCA 5K59E 1G7MA 1AQDA 4DKEH 4CSSA 4XTRD 3RNKA 5HYQB 3PWUA 5LBSA 2V5MA 3CFNA 3QZWB 5MP6L 4AW4A 1UKSA 4KFZC 4P99A 4MB3A 1BAWA 3WFDH 2B3IA 4HMCA 3QUHA 1BV8A 3IJYA 3MAWA 4TSCH 2GEQA 4TQ8A 1OANA 3CK0H 3L7FB 1T7ZA 3HZKA 4ABWA 1CFSB 3DBSA 4S0TD 3TWCH 1WAAA 4CBZA 1DL7H 1HXMA 3CN4A 3ERXA 4A67A 1WZLA 1MCPL 5DI8B 1ANUA 3C8KB 5H94B 3S37H 4MA3B 4Q89A 3BP4B 3FO0L 1EJOL 1WA2X 1N18A 4U1MB 4EXPX 1J0HA 5EEYA 2IDCA 4Y0GA 2PPEA 5ICXB 1ETZB 5T1LA 3WN5C 2DZEA 2W60B 1ZHNB 3VXMB 2J72A 3JQOB 2YHGA 12E8H 3WOVA 1KPUA 3JWNC 3KXFE 1SBSH 2R0KL 4YPJA 4DTGH 5CZRA 5AFAA 4G42B 3CMOH 4Y1AA 2OSLA 4MA7H 2CDGB 1AGFA 4PJ8B 4Y2NA 5HHMB 5LGHL 5LXGL 3C5JA 1Q0XL 4UBDD 1U93A 4G9FA 4ZUSA 4K71C 3G9VA 4QKXB 3KLQA 4I48A 3F6LA 3B34A 4HKXA 1KC5H 5IVZA 1YY8B 5AZEL 2NYYD 1UZ6E 2AJYL 4AEIH 4KUZL 3LQMA 4HLJA 4R83A 2P42B 4JFQB 4MNHB 4KTEL 4UQ3B 4OF8A 1K4CB 4AZLA 3FQ1A 2AQ2A 3MROA 5TGBA 1N10A 2D2OA 2A4CA 1G7MB 4LP5A 4Z3FA 4BQBA 3RNKB 3PWUB 2E27H 4I3RL 5H35A 5DF0A 1E5UI 5SX4H 5HYJA 2IFFL 4YDVA 3IJYB 1Q4NX 2VDLH 2ISDA 5DK2A 3PHQA 3G5VA 1UG9A 1KB5L 2Z31A 3L5XH 3HZKB 2ZJSL 1YA5A 4KKBD 4WHDA 4P5SA 1GSKA 5CJXC 5FW6A 3KGRA 4IHBA 3VXTA 1U8IA 3EUUA 1HXMB 2DJUA 2Q6WA 1GJIA 1BW8A 1QG3A 4GG6E 2KLTA 4OGZA 4HJTA 2NT0A 5FGSA 4IRJD 4E0RA 5J6GA 1F42A 4Y4HC 4PJXF 1T7VA 1XCXA 3N2JA 2BO0A 1AE6H 5T1LB 5MEQA 3FUFA 4N1HB 1AP2A 1I31A 2WKOF 1A6UH 4RIRA 2PO6C 3BHBA 2PYFA 1KPUB 3TASA 3WTVA 1HXUA 3FC8A 4JRXE 1F4HA 4QLWA 1YJDL 1MCIA 4Y1AB 2ADJA 2OSLB 4Z7QE 3QWRD 5HSFA 2QQQA 5JW5A 3C5JB 3V0JA 2QFPA 4YHLH 2NDGA 4MQSB 1U93B 3DUSB 1A4JA 4G9FB 4P06A 4ZUSB 4I48B 1HSBA 2JI1A 4HKXB 4HIEA 1DQQA 3DX9A 1C1EL 2CMRL 4FFYL 2YSSA 5FFGA 3PV6A 2ZD0A 3MROB 1XAUA 5TGBB 2CM5A 3BX7C 1NCTA 2AW2A 1HJBC 5EO1A 5TH2A 5C0CA 2R1XA 4OJFL 2ADYA 5H35B 1HL8A 5E5LA 2IPUK 2A6IA 2PXYB 5HYJB 3B3IA 4QJ3B 4Q2ZA 2EDFA 3VG9C 4YDVB 5D1QE 4G5ZH 1DZ0A 4KDVA 4IRSA 3ARDA 3PF2A 5DK2B 3PHQB 5HVGB 1QWNA 3ENEA 3G5VB 2V3FA 3STBA 2Z31B 4OLYL 1GCFA 4CN6A 4L9DA 4BEIA 4H8UA 1B6DA 4PHXA 3C5XA 3VXTB 4A55A 4D3CL 3VFSB 2CD0A 1U8IB 4KJQD 3VTAA 2Q6WB 4POUB 4RX4D 1N6QL 1T3FA 5C0BA 5TQ0H 4IIQA 1OY3B 1QFHA 4GBXA 4E0RB 1CFMA 2R2EA 5J6GB 4JHWL 4R26L 2Z7WA 4PCTA 4WSJA 1PZ3A 4ZW5A 5CBAA 3JYCA 5MEQB 4RRPM 5JOFA 4EF3A 1AP2B 2AZAA 2NY6C 3UTSE 3BHBB 1MWAL 2PYFB 5AZ2H 4EVNA 4I88A 3V4PA 3P2DA 1R3JB 4F8TA 5DUML 5JW5B 2IMNA 4O4YL 4LHUA 4I1RA 4KY1L 1A4JB 3X1GA 4AX3A 1HSBB 3P02A 4HIEB 2LOEA 1DQQB 3DX9B 3HMXL 1E3ZA 1YUHA 2Q3ZA 3FU3A 4PBDA 1W0VB 5EPMA 5F9JA 5AYQA 4G8EA 3WNIA 4AVKA 2YSSB 3BN3B 1F58L 2FEJA 3KXFD 3PV6B 4UYQA 3CVCA 3MPCA 4XNMA 5JPNA 2CO2A 4U1GC 1FNAA 4GKLA 5EO1B 5TH2B 3A6BL 2R1XB 5C0CB 4EUPH 2A6IB 3GC3A 3B3IB 3UPCA 2XYBA 4LSVH 5L4FA 3AGWA 3HAEG 3V4LA 1WA0X 2JI2A 3ARDB 4IRSB 2C9PA 3FO9A 4TYUA 1FYHB 5DC4B 3I75A 4HGMA 1BYOA 1EHKB 5FUZH 2D7QA 3DVIA 2WLZA 4J3BA 3ZTCC 3ZT5A 1I8LC 1NCBH 2VJ8A 1U33A 4EKJA 4J3SA 3LPPA 1WGVA 1PY9A 1T3FB 3WMSA 3WD5L 3FOLA 3QDJA 4IIQB 1L6XA 2DBLH 3INUL 4GBXB 4JB9L 4L1BA 3ECBA 3S4SA 4BCYA 2R2EB 5CBAB 1AKJD 2BVYA 5JOFB 3WNJA 4UQ9A 4PI2A 3WJJC 4WFFE 3RRQA 2J6EA 4YXLL 1B0WA 3CXFA 3GSNB 1RUPL 3PWJA 5ESQA 3L3OC 4MHHI 4LHUB 4YGVA 2BS9A 3IU3A 5GRXG 5GS0L 1WAAF 3QEGL 4HJ1A 2ZYIA 4LBEA 4YSPA 2WNWA 2VDQB 2MIZA 1INEL 1YUHB 4E9TA 1P4IL 1N4XL 4W9CC 5EPMB 1NCHA 5F9JB 1M9WA 4L1LA 1FNLA 2CCWA 3CHQA 4UQCA 4RDBA 3JVGA 3HR6A 1GIGH 4XNMB 4A7QA 5JPNB 1H6TA 1WIOA 4O51A 2GVYA 4TL5A 1JGUL 3S3BB 3SDXA 4DP4X 1M7IA 1VACA 5D7IA 5IMOB 3MBXH 3EH3B 5DMGC 1LD9A 1ZWIA 2K45A 3BE1L 5JORA 4HUMB 1NGPH 4LSPL 2W38A 2Q0ZX 4JFHE 1XAKA 5E99H 4GPVA 1GY1A 4FQCL 5DJ6A 1JGLH 2APBA 4D8PA 3C60A 5FDYA 2XWXA 1IGCL 3FO9B 4RRPG 1OV8A 4WU7A 4Z0BL 5DJYB 3AM8A 4B5EA 3I75B 3K0YA 5EFIA 4FQIH 4RAVA 4FHJA 4YH6A 4LPCA 3KGSA 2AV7A 3S3CB 3O3UN 1QVOB 4TQEH 3FOLB 3P77A 3S4SB 3ECBB 2BSEA 4ONGH 5D1QD 4EOWH 1NFKA 3L5HA 2H47C 1Z0NA 3EJRA 3I74A 1PJWA 5DQDH 2VDMB 5E1IA 3V0DA 1GFMA 1HTYA 4DUVA 2OTPA 1MHPH 4IDJL 3V4VL 3SCMD 1HHIA 3VD1A 4A7SA 1L9PA 3PWJB 1A3ZA 5ESQB 4DK3A 1EZVX 3WU2O 4YQXH 4YSTA 5KW9L 5L4MA 2O5XL 5CINL 5D7KE 4LVNC 3CFCH 1CXFA 2X09A 3UTSD 2ENPA 5KVGH 2DWYA 2JKNA 4XP9L 5AL0A 3V9EA 5L8KB 1ZTXL 4OLVL 5KAIO 1F13A 1EH9A 1GMIA 4O51B 4Z95H 5GRVL 4J3OG 3UACA 4C56E 1XF2A 1ZHBA 4K15A 2GEEA 1M7IB 1I7TA 1VACB 5D7IB 3Q6FA 3K81A 1LD9B 1ZWIB 1KTLB 3VJ6A 5I1JH 4NPYA 3NQKA 5JORB 2ZG3A 4FD0A 4OD3L 4NZRL 5JW4R 2CHNA 1MJJA 3PAYA 3TL5A 5M94B 3D33A 5D2NE 3CX5K 3OAWA 5DJ6B 4D8PB 4W4OC 4YSSA 5D7JC 2WBJA 4WU7B 3U36A 5EFIB 2W59A 4RAVB 4Q9RH 2AV7B 5JXEA 4QOKE 4FFYA 5GISH 4ELDA 2KC0A 2HB0A 3L4TA 3P77B 4QWWD 3OTTA 2MOVA 1A7OL 4P2OC 2Y3AA 5B1BB 1AYRA 1GW0A 3HOEA 1UGKA 4OCMC 3PG2A 4H8VA 4KPHH 3AU1A 3DX0A 5F1OB 3TV3L 3W1ZA 5KBMA 1DP0A 5GGTA 1HYSC 3ARGC 1GGUA 4W9LC 1AHMA 3GIVB 1FL6A 1WZKA 1HHIB 4AYMC 2YRPA 3U6RA 2VKWA 3L13A 4LPYA 4UF7C 4JFDE 4KDTC 3DOIA 2BHFA 4OFVA 2GI7A 3MBEC 2XG4A 3QJZA 1IBZA 4QXUL 2IGLA 4DKFL 1B88A 4JPKL 1MW0A 3H56A 1ZDQA 5AYUH 4IBVA 4NC1E 3VFPA 1BQHA 5IBUB 3BS0A 4WFFD 3HRZC 2HTLC 1QI4A 5ECJE 3P54A 5IVNA 2DL9A 5F8RC 3DRQB 3NZ8A 4BDVA 3UJTH 1ZHBB 2NY7L 3PFQA 1XF2B 4YHOL 1I7TB 2NR6D 3Q2VA 3Q6FB 2DEWX 4QTFA 1K5NA 4NPYB 1HINH 2MWCA 1HXTA 1DQDL 3R8QA 5ACMA 1MJJB 3L54A 3BGAA 4PJAA 3KVPA 2WBJB 3RA7H 3U36B 4S2SA 4BELD 1ZHYA 1YMME 5MHSE 4XTRC 2YJLA 3HMXA 3AG3B 3BKCH 4IOFD 4XNZC 1LWJA 4UINL 1HHKA 2LAAA 1AFVL 3WI4A 3BP7A 3VD2A 1I1RA 1KY6A 3F6IA 4JFHD 3KYKH 5DHVA 1HE7A 2BHYA 3GDBA 1J5HA 3QFDA 2VDRB 2AI0L 3AU1B 3LCYA 5E2VL 1AGEA 5HDOA 3U1QA 4ANVA 5GGSY 2C9QA 1SF5A 4F8NA 4KK8D 3FJTA 4KUCF 1U58A 1FL6B 3U6RB 4AV5A 4M1GH 4N59A 1L0QA 4P2RA 1Z3GH 4KHXL 2F7QA 3A4AA 4ES8A 2XG4B 1WBYA 5B3NA 2VLKA 3MUZ1 5DHXB 3VFPB 1BQHB 4F80A 2RACA 1ZA6A 1SMDA 2OZ4H 2CA3A 3B7UX 3A6OA 1KEGL 4XNBA 4F8PA 4XXCA 3GHEH 4DEPC 2VR3A 1MKFA 1U6AL 2EICA 4UBDC 5C7XL 3NZ8B 3MV7E 4BDVB 4PJCF 2XU9A 5KYXA 5CXPA 3L3KA 1K5NB 2NYYC 5D7KD 2TRYA 4B5ZA 4HHAA 5I15L 1FL5A 2I5YL 2FT7A 4KNTA 3UYRH 1BVZA 3APDA 2FGWL 4PJAB 5AVVB 1YEKH 4S2SB 1U8PA 4JY5L 1IKFL 2V9TA 4NO0D 4U33A 4FRXA 3UBFA 4L4JA 1CE1L 3AADB 4C56D 2DMHA 1UM4H 3FUHA 1S7XA 4O3YA 2DD8H 2GIYA 4V11A 4NLHA 1EJ6A 5I1EH 4OJEH 1UATA 3PQYA 1FGNH 1HHKB 4X6BB 1P7KA 2Y0LA 3BP7B 4J3WA 2YS4A 1JZ8A 1Q0YL 4JZJC 5DHVB 4HWNA 1YHPA 2A77L 3QFDB 4ELME 1G9ML 4KKBC 4U1JA 4IOIA 2A9DA 3OLGA 1AGEB 4P2QE 4ZMAT 2C9VA 2Q7NA 3KLDA 2HWZL 2ICWI 4QOKD 2FHFA 1U58B 4AFKA 1CI5A 4IRJC 2UX7A 4P2RB 1CYXA 2XIIA 4YPGA 4ZI8A 1GZHC 1UA6H 2ADFH 1WBYB 4DGVL 2VLKB 3PGCA 1EMTL 4JJHA 4JKKA 4LZKA 5DCCA 4OM1H 4P2CG 1X5ZA 4RBPK 1EPFA 4MJIB 1ZA6B 3MUJA 1ACYL 3SGEH 3MRPA 3MNWA 5E8NA 5J11B 1BZ9A 4U6HA 3GEWB 1MRDL 2GCYA 5HPMA 4TVPH 1TITA 5EWIH 5KYXB 3AXIA 4ZFGH 6PCYA 5J13B 3L3KB 5BZDA 3MLUL 3W0WA 1FL5B 4XO5A 3LNDA 1VEMA 2P5WA 3R4RA 1UHVA 1ZDSA 2C3HA 2Q20A 4FOMA 4FNPA 5E2UH 3MCLL 1N68A 4O02L 1TJIL 4IBUA 1U8PB 5LG1A 4JFUA 1I1AD 1GGYA 3IWUA 5D7LA 2RQ8A 5TD4A 1S7XB 2WGXA 1QW9A 5KWYC 2PW2A 4CDHA 1FLRL 3PQYB 4HH9A 1P7KB 2AFNA 1TZHA 1OSYA 1Z5LB 3LRKA 4NM4L 4D9RE 1I7RB 5FYKE 4U1JB 4IOIB 2AJXH 1YMMD 2BRQA 2DQEH 3ZRFC 5D8JL 5HHME 4KJQC 2JQMA 1R75A 4QD2E 1OWWA 2DEYX 1FBIH 1BF8A 4X5XA 1YYLL 3MACL 2TRHA 3UBXG 1KCLA 5FW8A 4YPGB 5L0QC 1A7QH 4O4UA 2LLLA 3DGGA 5MEPA 1SMOA 1OSZB 3PGCB 3AVEA 3TX4A 2O6FA 3V52H 1F6LL 1CLVA 4H4NA 4M93B 1KGWA 3MRMA 3CDCA 2VQ1A 3T24A 3RIKA 3ESVF 3MRPB 3MNWB 4GAGL 4PTTA 5E8NB 1ZOXA 2B4CH 2ITFA 3G3LA 2IWVA 1Y1UA 1BZ9B 4OZHA 2DYPB 4X6FB 2GCYB 2OMTA 2Z93A 5HPMB 2MHAB 5DMKB 3ISYA 3V79C 1TVHA 1U8NA 1DVTA 3QARA 2VOTA 3NAAL 4LCWA 4N2DA 3W0WB 1MFNA 1OZUA 2P5WB 2AAVA 3DVGA 1YG9A 3KPOA 1IJ9A 4HJSA 5BVPH 2L04A 2N01B 3GLAA 1U3JA 3GBEA 2XNAA 1K8DA 3DBXA 5D7LB 3MV7D 1A6TA 2CKBL 4KI5E 2DQFA 3JWDH 3VXPA 2PW2B 1KELL 5IK3A 2YD4A 4HH9B 2ADGA 3A5VA 2PLTA 5TK4A 3AAAA 1TZHB 2GE4A 5B4MD 2BSTA 3M7OA 4P23D 2IDFA 3H42H 3S5ZA 5L4JA 2QBWA 5F0MB 3FT0A 1SYSA 2IF7A 2KZKA 2R0LH 2X05A 4NGHH 4Y1AE 2C8NA 3HFFA 4U3HA 4W6YB 3PGFL 3ZL2A 4A1RA 4PJAF 3MJGX 1DBBH 3V6ZA 4ENED 4X5XB 5F72S 5IB3A 4G9FE 5IKCA 4ANWA 4I8DA 3SQOH 4HU8A 1QNZL 4MXWH 1G84A 2F7OA 3QUZD 3BDXA 2YGPA 3DGGB 5MEPB 3VFWA 5EU4A 5TDNA 3SDAD 1R3KA 1UXWA 2FNWA 3N1GC 1R3IH 2IJ0C 5ID0A 4F20A 5FO7A 3MRMB 2VQ1B 1XMEB 4JCWA 4PTTB 2VXSH 2LE9A 4OZHB 4G80A 1J8SA 4F8QA 2OMTB 2Z93B 2VMJA 3PXHA 5HYJE 5IW1A 1MZYA 1CDHA 4JM2A 5JQ6L 1DTUA 1TVHB 4NN7C 1HHGA 1H3UA 5LN4A 1U8NB 3ZHKA 5E2WH 2Y69B 4LCWB 1J9TA 2EDHA 1E7UA 3MODL 4HYTB 1DN2A 3KPOB 1GXEA 1P1VA 3ZTNH 4EDWH 2XNAB 1K8DB 1H15A 3ESPA 4EIZC 2DQFB 3VXPB 1SXAA 1YDPB 3CH1A 5FGBA 5IK3B 3DECA 2ADGB 3HAEA 4AM0Q 2H8PA 3CBKB 3K5RA 2P5EA 3NZUA 4GO6B 2YQ3A 2FWUA 2NY0B 5BV7H 2JKSA 5T1KA 3TA4D 1BZQK 1P5UA 1CN4A 1QUNA 1SYSB 2YAFA 4NQTA 5DSCA 1A64A 2B77A 5E08H 2X2UA 1M3JA 3JV4A 3V6ZB 4JFBA 1DQKA 5IB3B 5IKCB 3EJSA 4P4RA 2B16A 2Y07L 4EN3A 1TOXA 4S0HA 3KJ4C 5D1QC 1LK3H 4Z3GA 2MJWA 3VXMD 1GJWA 2RTTA 4XNYH 3HI1A 3VFWB 5EU4B 5TDNB 1JZHA 2H1XA 1R3KB 3CSGA 1L9SA 1UXWB 4LE8A 2DQGL 3QHZH 1QKZH 1X5AA 5ID0B 4PJ8D 5FO7B 5HHMD 3SCMC 1R0AL 3LS4L 1KULA 1KN2L 1OAKL 1XZ0A 2AMUA 3ZDZB 4NIYE 4OLXL 3IKCA 1U8JA 1NFDA 4PWEA 5C0CE 4NT6A 3U7WL 4X4YA 3I50L 3MYZA 2ZX8A 3KS0H 4OCXH 5IW1B 5C6TL 2Y22A 4OUOA 3TN0C 4F2EA 4JM2B 1KGCD 1D7BA 2I85A 3LIZL 1HHGB 3DMMA 3QEUA 3SYOA 1U8LA 2J5LC 5D5DA 4TNWK 3FKUS 3ULUF 5JO5A 1HKLH 4E9LA 4HS8H 4MFHA 4NJ9L 4XMLL 1BEYL 4WCYH 4YSOA 1H15B 3O2VH 2AJVH 5C0BE 5K1VA 4M6ML 5B3JF 3V0FA 3PGDB 2FECL 1OW0A 1WBZA 3CH1B 4KOCA 3HAEB 3AAEA 2H8PB 3K46A 4GLRI 4X99A 2P5EB 4XPBH 1IZKA 1FNSL 3OGCA 2ERVA 1E6OL 4RRPA 1M2OA 2E7CA 5L9DH 2P3YA 3Q5YA 2CJ3A 4FN0A 4X5WA 4Y4KA 4CKQA 5IFAH 1JMXA 1P5UB 3QRAA 1QUNB 1Y6MR 2JNZA 3BUYA 5DSCB 1ZLSL 4U3CA 3A47A 3UZEC 1QASA 2PW1A 4DQOH 5C0RL 4JO8A 3UO1L 3VMNA 4DGYH 3JV4B 4X7SL 3IU4L 3W57A 4QWWC 1IB5A 2XPGA 4P4RB 1NAMH 1U0QA 3TPUA 2CRIA 5T1LD 1EBAA 1KEML 3GHBH 1VPOH 4XRCA 1YO4A 5DS2A 1S7SA 3HI1B 4P46A 3VQMA 5HYSA 2BVOA 5C09B 3TZVD 4Y1AD 2XQBL 4ACPA 1KGUA 4I18A 1EFXA 2IH3A 4KVNL 4RVBA 3IKCB 1U8JB 1NFDB 4G9FD 2DJMA 4NT6B 2H2PD 3GM0A 4X4YB 4KH9A 2ZXGA 4C55A 3HRPA 3BP6A 1L6ZA 4X83A 2BOLA 3DMMB 2G75A 3IPFA 3UPGA 3QEUB 1KZYA 1I9EA 3QT2A 2ZXCA 4CVXA 1U8LB 2YUXA 1UOVA 2XLLA 4JE4B 1DEEA 2R83A 3IFOB 3KW7A 5JO5B 4J23A 1NPJA 1DJSA 1MEXL 3NESA 2YJQA 1II4E 3CZGA 3PWPA 1FVCA 4GS7B 3FO1A 2NR6C 4N2AA 2BMKA 2PXYD 4ZTEA 5HYJD 2HMID 1Q1JL 3QDJE 2FD6H 2F19L 1GY2A 5C6WH 2X0VA 3GMRA 5LGYA 2DLFH 1WBZB 1G7PA 5I8CA 3AAEB 1B9ZA 4X99B 2Z31D 2HFTA 3OGCB 3LXBA 4IBYA 5EZLA 4X5WB 3VE1A 4Y4KB 5DO2D 5CJOL 2H6PA 3BUYB 1RZFL 4M5YH 1HILA 2UWEA 4IOFC 2PW1B 4AJWA 3T1FA 2VZOA 2XPGB 5I5IA 4PWFA 3TPUB 1PCXA 4I13B 4A6YH 4OZ4A 1UYWL 2Z9TA 4IJTA 4NBYB 4XRCB 4YHMH 4XWOD 1S7SB 3ETSA 2V3EA 1A6ZA 3CHXA 3CZJA 5HYSB 2XACC 3NSJA 4KK8C 4M7ZB 3GINA 1JZIA 1SNRA 3K6OA 3LEXA 3G04A 5T5NF 4I18B 3SDXE 1EFXB 2IH3B 15C8H 5D7IE 3PJNA 1J0KA 3BT2H 5FECA 4KZDL 3EJPA 1S5IH 4HWBH 2WNGA 4YC2C 3BP6B 3EZ8A 4YLCA 3ETBJ 2G75B 1UA3A 5BMFL 4CVXB 1IAIL 2HKFH 4KMTL 1DEEB 4MDJA 4KXZH 4W9FC 4HT1L 4PW3A 4FT6A 5C0CD 5IG7B 3UJJL 3PWPB 1FVCB 3FO1B 5G26A 2VMDA 1E4WL 2BMKB 4NKIL 4LPUA 3GMRB 3ZDZF 9PCYA 4DFIA 3O11A 1G7PB 3ARDD 3WE6A 5I8CB 5EEVA 2BP8A 1F8TH 3VVVA 5HHNA 1JFQL 3D69A 3DHPA 4JM2F 2XTRA 4AMKH 3HS8A 1OTUD 4P04A 4BH8A 1KJVA 4TSCL 4HWEH 3CK0L 1DJIA 3BH4A 4FFZA 2H6PB 3O6FA 5C8JA 3A6CL 1HILB 2UWEB 2XA8H 3HBZA 2GJ6A 3BPLC 3T1FB 1FHGA 3D4YA 1DL7L 2XE2A 2BP0B 4F3FA 5D2NC 4OZ4B 1SOSA 1UOKA 1YN7A 2LFEA 3BZ4A 4MS8D 4XOEA 3S37L 3TBSA 5L6YL 5DRXA 4PBWD 4LOVA 3RWJA 1QFUL 5GHWH 1AOZA 1A6ZB 2PWDA 2QKSA 3SYQA 2K9UA 2DKMA 3LEXB 4O3XB 1THCA 3G04B 1QABA 12E8L 4LHUD 1I9RL 3U7AA 3FT3A 1T5WA 1SBSL 4N2IA 4NWTL 1R5WA 3A21A 2WOBA 3QJTB 5GRVK 5FECB 2WCGA 3CMOL 3MJ9H 4HU2A 1WD9A 1VSCA 4UQEA 3QBTB 5B3SB 5LKNA 3ZZSA 3EXLA 2VR8A 3OSKA 1MFUA 5F6HJ 3R18A 5SV3A 3NA4A 4EO5A 5EEWA 4AEIL 1GTNA 4MDJB 1N8OE 5AVYB 1OSEA 1KSRA 1AZVA 1NM9A 4BYHA 4JMNA 5TTRA 1MCFA 1UENA 5I19H 1Z5YD 3G08A 1OZTG 3PREA 2E7DA 4FOZA 3ZIYA 2K9FB 4XVJL 1MDAA 2EINB 3AA1A 3O11B 1NFDF 3WE6B 2BP8B 2F6AA 3KR3H 2H3XC 4KUCD 3MOAL 4XNDA 5HDRA 5J7CC 4RJXA 5HHNB 4LSQH 2ICEC 3D69B 3QIUA 5E9NA 5GS1C 2APSA 4BH8B 1I1AC 1KJVB 1DVFA 3HLAA 3O6FB 3SBPA 4JQXC 1KCUH 3N1PC 2GJ6B 5CKGA 1N5YH 2ZP9A 2DEXX 4LVOC 2BIOA 3NJTA 1RZIA 2YKKA 4P4KA 4NDMA 1XGUA 4F15C 4WI6A 5SV4A 6TAAA 4F3FB 3DHUA 3Q5TA 3UTTD 3VG0L 1CK0L 1YN7B 3BZ4B 4PGZA 1T03H 3TBSB 1MW3A 3FYEB 2C9UA 5DRXB 1N9PA 3RWJB 1P53A 5CCKH 5J3HD 3R4DA 2XC8A 2M83A 3RPKA 1L7IH 2YXVA 3QUKA 4PJ5B 3BUBA 1ZSHA 1U9KA 4UV7H 3FT3B 1T5WB 1R5WB 1NC2A 4ZFZA 2PCPA 1VGEH 1QHPA 4B9JA 4GT7A 5GS3A 1YNTA 5KSAA 5EF0A 1QJPA 3EJZC 4AGNA 3WSQL 3KBFA 4F7KA 4PJAE 4JQIA 4Z3TA 4PWIA 2Z7YA 3ULSA 1QYGH 2P49B 5F7MC 3HC2A 2JLLA 2PABA 2JWYA 1EANA 1MPAL 3Q2LA 2P47B 4OM0H 4XP5H 2FWOA 3G08B 3PXJA 4R6UA 4Z7WF 4K8RL 3RP1A 3LS5L 3LY6A 2EDOA 2ZX6A 5D5MA 3A22A 3AA1B 1W72L 3SE4C 4YS4A 2ZOKA 2JTYA 5GGVL 4LSDA 4NCC1 4U7MA 4HUUA 3QIUB 1UXSA 2M1KA 3OJMB 1UEMA 4HUNB 3HVDA 4Z7VB 1DVFB 3HLAB 1AZCA 3FFOA 4L3EA 2KZBA 4QHUA 4EKXA 1E8WA 4AQ1A 1ORQA 4P2RE 5EF2A 3RIAK 2CDEA 1D5IH 5EOCH 3UPRB 4P4KB 2BSED 1RZIB 1JGIA 4BZ2H 4NDMB 1XGUB 1N5AA 1SMAA 2CXKA 2VLKE 5B4MC 4GUQA 4P23C 2CUAA 3GJFA 3EDKA 1PFOA 3WAJA 1M1SA 1SEBA 4OCYH 2F1EA 2YAHA 5DMJB 2XG6A 3T3MB 4WW2A 3QHTC 4ENEC 1KFGA 2UV3A 3QUKB 2YRLA 5DA4A 3PS6A 3KAAA 2LTQB 5AZ2L 2GQHA 4K3CA 5A2KH 1NC2B 4ZFZB 2DQTH 2PCPB 3DJSA 3QUZC 5C3TA 5KSAB 4EBQL 1T16A 3O6LH 3NJLA 3SDAC 1LE5A 2B7DT 2DBJA 2GK2A 3GIZL 3ARQA 2XWZA 2AGJL 1KT2A 1ITCA 4G70B 4U0QB 3ULSB 3BZDA 4FX5A 3AWFA 4DESA 3MJ7A 5I0YA 2JB6A 1CDIA 1EO5A 2FWOB 1DBAH 3PQYE 5TPWL 2GYSA 1HXYA 1HWGB 2PP8A 2HPOA 4PS4L 4FDWA 5D5MB 4YJZL 1URIA 2WBJD 4ZX5A 1LEKA 2ZOKB 1FPTH 2RALA 5FIEA 2ODJA 4HUUB 4KVCH 3ASOB 1UXSB 3EGXA 4YSQA 4ZMWA 5JXED 4L3EB 1UD6A 1UUNA 2HRPH 2UX6A 4QHUB 1QPPA 3SYPA 4AQ1B 1ORQB 4RISL 2CDEB 2EH8H 2NY3B 2C3VA 3CFQA 3D07A 4AITA 1EGJH 3TEWA 1N5AB 1JCVA 4HKJA 1GHFH 1NPUA 1BX2A 1HAUA 2DBLL 3GJFB 3IRCA 1IQDA 3WMPA 3S36H 3U48A 2G3ZA 2BOBA 2D7MA 1AS6A 1FG9C 3GBLA 3ZYZA 1SEBB 5CIPH 1BFVH 2C1PA 2ZKMX 2O4VA 4WW2B 1KTJA 5M95B 3L4YA 4JO3L 1RJZA 1IZNA 3P4NA 4NCC2 2M06A 4FGMA 4JREB 1DLFL 2HLFD 3W0WE 2R9HD 3Q44A 4K3EL 2P5WE 2JVUA 4A7UA 3THMH 1LE5B 3QJUB 2A6DA 5AW6B 1S3RA 4AKQA 2A9CA 1KT2B 4PJ8C 1OPGL 1LILA 3WS6A 1QR1A 5FCUH 5D7LE 3QJXA 4F37F 3MJ7B 2XX0A 2JB6B 1J05A 5AW9B 1SPDA 4OGYH 2N7AA 1E9OA 3MOQA 4LCIL 2XV2A 1CFVL 1HXYB 3BSZH 4N9OB 3KVDD 3REWA 1T20A 2CK0H 3PJSA 4YE4H 1Q72L 1G0XA 3DJZA 1LEKB 5B1KA 4XPFH 2XQYG 3PP3K 1NGPL 3F83A 1OAUH 5KTEH 5E99L 2A0LD 2Y3NA 4BUMX 1M05B 3EGXB 5J0BA 2FEDC 3N55A 1HWWA 2FLMA 4AY0A 3L1OH 5FM5O 3L9BA 3KYAA 4K7PL 5D72H 2YOCA 2C3VB 1X9LA 4XN4A 2O5NA 4HKJB 2ENYA 4S11A 1BX2B 1FZOA 4LEEA 5CEZH 4LIQH 4HDIA 4MLSA 4L1TA 3B4NA 3KYMA 1IQDB 5AKRA 2PWGA 3MFFA 4WWOA 5LXVA 4EOWL 2BOBB 4FLSA 4NI3A 5KVDH 2BFVH 2C1PB 4BKTC 1JGDA 3I6LE 5IW3A 3IJ9A 3BIAX 4OZHE 4P2RD 2UUDK 3BEWA 1RJZB 2GITA 1CXLA 3P4NB 4N3UA 5GRJL 4Z7VF 5CS7A 1XR8A 2E7MA 4A37A 2XIDA 3EFDL 2B3RA 4M29A 2AJZA 5LHDA 4LCWE 2X4SA 5AENA 4FESA 4BUQA 4MJID 3VA6A 5D2LA 2A6DB 2HCZX 5I5JA 4B6ZA 5JNYA 3TZVC 5BO0D 4L37A 3X3FL 4BK5A 3D8MA 1INQA 2EAEA 3NSCA 4QT5A 1QR1B 5GV0A 1KCSL 3D7PA 4M02A 2H2PC 1J05B 1EBPA 4B60A 1E9OB 3SZ6A 4K94H 3T3MF 3LZOA 2CO1A 4Z95L 1UA7A 2FX8L 4XBPB 1JYWA 1T20B 3PJSB 5JIHA 4M8UA 3VFOA 1RV6X 3QXTA 1OARH 1H6FA 1CL7L 3T08A 2PXYC 2QPSA 2HMIC 1HK6A 2EDRA 3ZRSA 3PQYD 2WQWA 1FA4A 1MY7A 1A25A 2EKSA 1AQ8A 2NZ1A 2G60L 2Z31C 3I6SA 1CD9B 3OR6A 1NJ9A 4MAYD 1FZOB 2EXTA 5B1JA 1V54B 4BRJA 1TYJA 4HDIB 4K3BA 3KYMB 3CDGB 5DO2C 3EO9H 3MFFB 4MNQA 3MLWL 5F7AA 3RI5K 3HZ3A 1TZIA 2YK1H 2BNUA 3CLEH 5J1TC 4NN6C 4EZJA 1JGDB 2ZX5A 3F7KA 3ZE0B 3BEWB 1IAMA 2YMOA 2GITB 3VRLF 1OAZH 3DSNA 3MLRL 3AREA 3ULUD 1XR8B 5EORH 2VDLB 2XY1A 1TQVA 2X4SB 3WEMA 1WFJA 1TSHA 5D2LB 1T1XA 5JNYB 2GG1A 3BUQA 1IM3D 5IVXB 1INQB 4QT5B 4JKWA 2DYPD 1EK3A 4NJAH 3A4DA 3MLXL 4N6QA 3NABL 3AT8A 1WSST 4JHZA 5INCA 2NXYB 4WW2F 1WCBA 1RZKL 2P5EE 4UQ2A 3DV4A 3HKFA 4CW1A 5EEXA 3VFOB 1HINL 1G0DA 3D0AA 5D7LD 5F93C 4B7IA 4UAOB 2ZZUT 2AANA 4I4WA 4Y2LA 3RA7L 4LFHG 4JFEA 3TIDA 2YPVL 4PS7A 2K6WA 1YEFH 3QR1A 4FKKA 4JO4H 4RDQF 4XCCH 4HZ1A 3ARDC 4UWQB 2EKSB 3F04A 1KBGH 2ITCA 3OR6B 3KGUA 4L05A 5IHHA 1NJ9B 4X8JA 1BQLH 2JXMA 3O4LA 3BP5A 3IFPA 5KS9B 1JGEA 1TZIB 2W0PA 5ISZA 4CAGA 2BNUB 3U0WL 2F0CA 3ULVF 4IIQC 2IQAA 3EYSL 4EUPA 2NZIA 2XYCA 5DWUL 2ZWNA 4XMUA 3WGUB 5HHQA 3EJJX 1VADB 2XN2A 3DSNB 3BCFA 3AREB 3H3PL 3VX0A 1CDJA 3KNBA 4MS8C 5EV7A 3WUZA 1MCBA 2E76C 5T1JA 1J12A 3WNPA 1AG0A 1P2CB 2K3TA 2AVGA 1T1XB 3EJYC 2AERT 4LGRB 4ZZFA 3RPIB 4G7SB 1VLXA 4GO9A 1IC7H 2YA2A 3I6LD 4G6ML 4KXDA 4Y5VC 2APFA 1W0YT 1XQ4A 3V0WH 5F7NC 1OVZA 3RY4A 3KHQA 4FTDA 4JGMA 5F7LB 3GHEL 5TJWK 5INCB 1WCBB 2XUWA 4LCWD 3FSVA 4UQ2B 5T3ZH 3U4BH 4FQXA 2CHDA 4CW1B 4PWHA 3BRZA 4UV4H 3EDJA 5HGBA 2RH0A 4RWHA 1YMHA 4XNAA 3ZHNA 1XF5A 4I4WB 4P9HC 3S5YA 4OGXH 3SE9H 4JFEB 3AJ7A 3TIDB 2XQ0A 3V55A 1NZRA 4XMXA 2WXFA 4FQQA 2H0FA 1BM7A 3WTYA 2NY0D 5KYYA 2ITCB 5I1EL 3CU7A 4X8JB 3GXPA 3DV6A 4FKEA 4HSCX 2JXMB 5DU7A 3O4LB 1OP9A 1WZMA 3BP5B 4GSUA 3IFPB 1JGEB 1KNOA 3MJWA 5ISZB 5BZXA 2IQAB 4EUPB 1LMIA 4RFNC 1XDTT 3Q1EA 4KROB 5HHQB 5FYJU 5E94A 1FV1A 4XZ4A 5DHEA 1R9FA 3KNBB 3FCSA 1LLAA 1W15A 4YBHA 2IG2H 3WEOA 4YX2H 5J3HC 4CUCA 3PIQA 3FBKA 3CXHK 3U4KA 4FNLH 3GD1C 3WKYA 4OTXL 3CZKA 4OLZH 5D93B 5F9OL 1EVTC 3PWPE 2OCJA 1UZGA 3VXSA 5HHOA 3GJFK 3TESA 2EIDA 4S1DD 4J27A 2WLJA 4JM2D 3EJCA 4A2EA 3S88H 3H85A 2DYSB 1WH0A 3D09A 4L48A 2HPTA 1E5BA 4TVPL 5AG8A 4FQXB 3JVGC 4FSOA 1D6VL 4ADJA 6FABH 2CGZA 3QP3A 1AANA 3QZBA 5HGBB 2UWEE 3EHBD 3GTTA 1YMHB 3ILPA 5E2UL 1XF5B 2DDQL 5D2LF 4D0CA 3EYUL 4R2GB 3QZPA 4PU2A 3TO4A 5IVXF 1KYOK 2F8OA 4G6KH 4FQQB 2DM2A 2P5ED 1SLWA 5IHUH 3T8XB 1O9ZA 4N58A 2D7PA 2WVTA 5KYYB 1GC1C 5IQ7L 5JTWA 3AM8C 3DV6B 3B5GA 2A5UA 2IDQA 2D73A 1SRDA 4P0DA 2H2SD 4JGUA 1EHAA 1KNOB 2K0RA 2X87A 2K4TA 4FS0A 2OJ1A 3SYBA 5EA0L 3ZE2B 3JV6A 5E94B 3N0AA 5AVWB 3JTTA 1FV1B 1G1YA 4OCRH 2G3MA 1WV7T 4O4XA 4PWKA 1IO4C 2RAMA 2VSCA 1WE5A 2V17H 3CPLA 5EN3A 2PMZA 2Y1AA 3FCSB 1MJUH 5C09D 1S6NA 5KANI 2ODIA 1H6UA 2JJVA 4FL4C 1CD1A 3L17A 4OJAA 5HGGS 1PEWA 1CT8A 2OAAA 3MSPA 3V52L 3MRDA 3PY9A 2BLFA 4PYGA 3SDCA 1F2XK 2OA9A 2CR3A 3TCLA 3ABMB 3VXSB 5KS9F 1E42A 5HHOB 1IIIA 3DMMD 2VN6A 4KZCA 1OAQH 1K2DA 3ORJA 2Y23A 5IBTH 3X1FA 4OJYA 1NFAA 2IWFA 4L2YA 2AVFA 4U0RB 3PPSA 1MIML 4S1SL 3DWNA 1ZSDA 3UTPE 4DJMA 3DVNB 3L7EA 1YC7A 3TT3L 4D0CB 1MG3C 4N3TA 3S48A 2GJ6E 4WHTA 4IRZH 2BP3A 4JPWH 3TO4B 3BMVA 4TSAH 1G9NL 4AEFA 5AAPA 3CVIH 2WBJC 3JWDL 4H8WH 4JFZH 5IZ7A 4NKOA 4Y4KD 2DQUL 5FKAA 2CBPA 2APWA 1MFAH 3UTZA 2GTZA 2LGNA 3G9AB 1BG1A 5JXEC 3UJIH 3ZHFA 3H42L 1Y6NR 3IB4A 1QLEL 2YN5A 3VI4E 2G5RA 2XTQA 1GGIH 2O30A 3J2PA 3JV6B 1KOAA 2LQRA 5BUPA 3JTTB 3AAZA 2FX9L 4H7VA 3CPLB 5K9QG 1QPXA 4JY4A 1ZS2A 4TQPA 4N26A 2QDWA 3R8BB 1CD1B 5DC0A 1EFXD 1CT8B 1GS7A 1RLWA 3MRDB 1SF3A 4A2FA 2M26A 3SDCB 3TCLB 3NJNA 3WKPA 4KY2A 1J1PL 3LB6D 3RG1C 3D1MC 2HLFC 2R9HC 1M56B 4ZNCD 1AHWA 1GYWA 1K2DB 1F3DH 4HX1B 4XP6H 2LHFA 4HPYH 4FP8L 1GYAA 4M1DH 2N0MA 3EDFA 1TTRA 4LU5H 2O72A 3EG9A 1FORL 4FFWD 1ZSDB 3NFNA 3PWPD 1EDYA 3L7EB 5G3AA 1KLGA 3H6JA 4YSRA 3P9MA 5ABZA 4F57H 4WHTB 1NKOA 2NRDA 1X5YA 4EE2A 3DO7A 2HTKD 4XVTL 4ZW6A 3OM3B 4KITB 3QQNA 2J1KA 4NKOB 3ZDXF 2OZ4A 2A0LC 4WEMB 3NK4A 2VLME 3T3ME 2GTZB 3UTZB 1KGXA 1L9RA 3K2IA 5T3XE 3EAKA 2XWCA 5DHDA 2WSDA 3WG7B 4LMQE 3FSZA 3TTSA 4LSIA 3FN0L 3J7HA 5DT1L 5AW1B 4G71B 5FYJH 4Y2DA 5J12B 1LK3L 3DNKA 2YBRA 4IBSA 4JY4B 1X5LA 4XZUA 1F4YH 2OLDA 3W38A 1XGRA 2CHWA 2B9BA 4XNYL 3HG1A 3WHE1 2DS4A 2XZZA 1RZ8A 2LFGA 1FH5H 3QHZL 5B7MA 1K85A 4BRVA 1VFOA 1TKWA 3X1NA 2FRGP 3VXNA 2VDKH 4NUGL 4WW1A 1V7MH 1NQBA 1F1AA 1HL9A 5D5ME 3GRWL 5F7EL 3ZIMA 1AHWB 4GKOA 3LHPL 3FDWA 4ECNA 4F5CA 3ZE2F 1OB1A 2YLHA 2IQ9H 1YC8A 4XXCC 4ZAKA 3VRLE 3EG9B 4D8OA 3QA3B 5J11C 3NFNB 1A7RL 5AWNL 2AJUH 4L3EE 4IK6A 1KLGB 3P9MB 4PG9B 1MRCL 5AB2A 4HS8L 2IAMA 2VLJA 1B4JH 4QXVA 1OPOA 3AXHA 2EIZA 3D2UA 3N1MC 1BZ7A 3DO7B 1HVXA 1IAII 5DDHA 3VXUD 2XQYA 2Y0SA 2ZYHA 1TIUA 3I9AA 3D85A 4KGLA 2JKXA 3O6FD 3UTPD 4RMBA 3ECQA 3ROLA 4KHTH 5DJCB 2DI8A 2GJ6D 2ZE0A 1JRHL 3RU8H 2VKXA 2F68X 2QLVB 2CGRL 3AQDA 4W9DC 1OALA 2DN7A 4MAYC 1S78D 4DGYL 4BK4A 1LEGB 2FUTA 3GPSA 3D9AH 2HKHH 1T21A 4Y2DB 2E8YA 4HSAC 4XZUB 4HIXL 2YBRB 4RCAA 1VPOL 4GG8A 1OP5H 4FNTA 4PJ5D 1XGRB 2F54B 3C08H 5GGSB 3HG1B 1A14L 2ZXAA 5AOJA 3TEZA 1RZ8B 3JUYA 2AQ3A 2M2DA 3LDBB 2R4SH 5CGBA 1TKWB 4ZDHA 1XH2A 3ULUC 4M48H 3VXNB 2J7LA 5I0XA 4WW1B 5K1NA 5J6SA 5AW0B 1PG7L 3MRCA 3BWUF 3HTLX 4M93C 4PB0H 4DW2L 4TPRH 1OB1B 4RSVA 3T9WA 3CUPA 1PZSA 3D3VA 5IROD 3QZOA 4ZAKB 1MH5A 3FB6A 2ZOLA 3P4MA 4GP8B 3TJHD 5DJXA 5K93A 1C8QA 2AKRA 2ZWZA 1XSKA 3DYPA 4OB5H 4W93A 1RPKA 1CBJA 1L7TH 1QQDA 4WZ9A 1KYUA 1H8LA 2VLJB 4Q6YA 3D2UB 1BZ7B 4HCIA 5I0ZA 4IBWA 5DDHB 4BQ9A 4G75A 2NNFA 2QQLL 3KL5A 3V6FA 8CGTA 2DLFL 5EBLA 1YQ2A 4JDTH 1DVFD 1UT1A 2WY3B 1AGBA 3CXDL 1RK7A 3D85B 3SJVE 3CC1A 3H8NA 3ROLB 3RGHA 1ND0A 3RIFF 1AQHA 3A2SX 1TTAA 4U1IA 4LSUL 1EUTA 4NNPH 3DX1A 5IQMA 3NA9L 5INDA 5LN8A 4JPVH 1KACB 3DWOX 1T21B 2K7PA 3KL3A 4FABH 4IKKA 2VLMD 1X5GA 4GG8B 3TONA 4DP0X 4R0LA 5T3XD 1DFBH 4XO9A 2QHLA 5EE2A 5KSAD 4ZDHB 3J8F7 2AS5M 3WJLA 1FE8H 15C8L 1LO2L 2EIMB 1B2YA 2WN2A 2P52A 3U2IA 3MRCB 1JPFA 2F8VA 3ZKSD 5SWQA 1B2WL 1L3NA 1Z1WA 1I82A 1NBYA 1TNNA 1OGTA 3CUPB 3M1OA 3D3VB 3SPHA 2C1OA 1J8HA 1MH5B 3FB6B 2ZOLB 3P4MB 5SX5H 4HFWB 1IIKA 4BZ1H 5DJXB 5D96B 1RZJC 3PNRB 1X44A 2AKRB 3T0EA 2B39A 4H20H 5DD6A 3RHWK 3KPNA 1QQDB 3L9RA 1DN0A 4GMTL 1TZAA 3OAYH 2IIJA 2HVKA 3UERA 5LBGA 3ZZ1A 3KYNB 2WUCH 1E43A 4TUJA 2R56H 3V6FB 4OCLC 2D0FA 1N26A 5EBLB 1XXDC 1IVLA 2D3NA 2XOTA 3CQPA 3TU6A 1AGBB 1PZBA 2VXUH 4PVMA 5FYKU 3ZE0E 2BCMA 1ND0B 4AMKL 2X4NB 1PL3A 2NY3D 2YD6A 1MFBH 4KO9A 4KX9A 4OFPA 4PS3A 3SKJH 4A2HA 4U1IB 1TYRA 3NZHH 4OD2A 3I3BA 2ZQKA 2NY0C 3LTVA 5INDB 5KZCB 4M7JH 5B38G 1KCKA 2GJJA 1Z9LA 2VLLA 2ZLDA 3ELAT 1XL4A 2CO3A 1PZCA 3Q5OA 4HCGA 2O5ZL 4RAHA 1PZDA 5D2LE 3UMTA 3N1QC 1BVKA 1WQVT 2YD9A 3LD8B 4HAKA 1NAKH 3NIDE 4R0LB 1TVBA 3ZRCC 2DIJA 4KKZA 3QEHA 3QRGL 4L18A 3CSTA 3HS9A 2XV3A 1TDQA 2ICES 4E41A 2BVEA 4XHQA 4TOYL 2PTTA 3H2QA 2XTSA 3SPVA 1A1MA 4NUQA 1OF2A 1XCTA 1OCZB 3IDNA 3P0VH 4L8DA 1JPFB 1CU4L 4L5FL 5SWQB 2X2HA 5IT2H 1KJ2L 5DR5H 4NN5C 2OTUA 1ETB1 1NBYB 2RHEA 1IGTA 1OGTB 1XSIA 1RKRA 2MQ3A 3HNSH 1YEEL 2C1OB 1J8HB 3LN9A 2B20A 2EP6A 2EACA 3T0EB 2ZUQB 4S1DC 1MFEH 3QO1A 4JM2C 4FZLA 5DD6B 5HDQH 5FV2A 5DMYA 3KPNB 1BHGA 1AO7D 1DN0B 3I02A 3C6SA 3L9RB 1SN0A 3NRFA 4HOZA 3TURA 1IE5A 2HVKB 5JDPA 4HP5A 3ULVD 1I9JH 1ZEAL 3VZTX 2DW5A 4TUJB 1ROWA 4MNQE 4UDUA 4X0NA 2XVBA 3EHBC 4UQIM 4WFGD 2QZQA 4LSQL 1NLDH 1QX1A 1OTTD 2MRYA 1KCRH 3OLDA 5I6PA 3BAEL 4QRUA 4QRAA 5FGBC 3KZIO 1E54A 3IJSB 3IS0X 3LQAC 4FG2A 4J1UA 4ZPVA 4OD2B 3OMZA 5E6SB 4WWKA 3L1EA 1PY4A 1GYVA 3JT2A 2VLLB 1CXHA 3CDZA 4I1NB 3MV8A 2H2SC 2FT8A 1BVKB 2ORBH 4QJ5B 2WP3T 4G8GA 1TVBB 4HEPG 3QEHB 3KEDA 3S35L 1L7IL 1A7BA 1MQ8A 4E41B 4Q4IA 3SPVB 2PTTB 1JZFA 2LVCA 1A1MB 1OF2B 1XCTB 5BV7B 1T2QH 3OBAA 3VQ2C 4B95C 4Z7NB 5KAQG 5AOLA 3MV11 2W9DL 4FSPA 3HN5A 2OTUB 2BSCA 4MRBA 1O7VA 2FIRT 5I1LA 43CAA 1G9MC 4JFEE 1A0QL 1QYGL 4J7RA 5JW4Q 1BXVA 2R59A 1EO8H 3QO1B 1NAMA 2EXYD 2X88A 4MA8L 1IBFA 3DMMC 1NEUA 1MUJA 3I02B 2GUYA 2IANA 3C6SB 5TF1L 1SQMA 1FG2A 4Y5XA 3U83A 2O26U 2VDOL 3Q06A 2BIIA 3O4LE 4LKXA 3Q6GL 4KO5A 2JH2A 3OZ9H 4ZO9A 4UDUB 5ISZE 4XB3A 3MMEB 1THQA 1NBQA 1A9EA 3GMNA 1OK0A 3SYCA 4AL8H 4A2GA 1OW0C 1LP9E 4QRUB 5DVMA 4J1UB 4ZPVB 1WS8A 3D4CA 4WWKB 3CZSA 3WXWH 4OLUH 1F97A 2OMXA 1YEGH 4Y4KC 4O49A 1FL3A 3CDZB 2Z4QA 4APXA 2VMCA 3MV8B 3E9UA 1RUKH 1CVSC 1JG9A 1V7NH 1ZS8A 1MAML 1MWOA 2GBVA 3RKPA 2HJLA 3WFZA 3GMOA 3OX8A 4G8GB 2OXHA 4I9WE 1UWYA 1D9KA 2Q87A 2J1WA 3HOLA 5LVEA 3MNZA 1SHMA 4G7QB 2CUIA 3FOMA 1M7DA 3R0MA 5TFSL 1KBKA 2FX7H 3P4OA 3BPNB 4LOEA 5A6MA 2W65B 3OF6D 4I7ZC 3VB9A 4M7ZC 5CJ5A 1NL0H 4PLKD 3O6LL 1HAWA 4I18C 3GS0A 4HCFA 4Z7IA 2YFOA 5AB9A 4O58H 4Z7AA 2FHBA 3QUYD 4G7YL 5I1LB 43CAB 2Y1YA 3LB6C 2JJWA 3J27A 4DUXA 2NXYD 3NJJA 1NAMB 4A6YA 5EU3A 5F8QC 1QFWH 3NTCH 5L88H 2YAQA 1MUJB 3T3PB 2IANB 2NSQA 3BQUD 4QKTA 2QL1A 1R3HA 2VN4A 1ZVSB 35C8H 3KCWA 4TNVF 1FG2B 4Y5XB 3WTTA 3WU1A 4DZ8A 4LKXB 3LPOA 4FFWC 1MCKA 5BW7C 3G5XA 2IPTH 1OAYL 3NH7H 5D1XA 3GMNB 4KVCL 2BSBA 3VZUX 1I8AA 2X27X 3EADA 4HWBA 3LK3A 2ZUWA 3E6HA 5I18L 3GHPA 2HTKC 2XKNA 3RZWA 3V95A 4NQXA 3MC0A 4KXBA 2DICA 4F7MA 3CSFA 3QYCA 1EGJL 1FL3B 5J6HB 5I1CH 2Z4QB 4APXB 5C0ND 2WQRA 3DGDA 4OF6A 5K9KA 1ZS8B 2P9RA 4NP4L 3F8UB 2HJLB 4YUEH 3GMOB 3QI9A 3S36L 2OXHB 3VXSE 5ETUA 5CN3A 3QAQA 5HHOE 4BH7A 2WWOA 1P4TA 3T0BA 2XQYK 3MNZB 4R7LA 3ARED 5AAMA 3N6YA 3FOMB 2DQIH 1M7DB 3HW7A 3IFNH 3P4OB 5AUMA 4YSAA 3W5MA 3GK8L 4HUWA 2YD3A 1CTNA 1I3GH 4GCQA 2FO4A 4OCSL 1OT2A 5CAYB 3IGUA 3K8KA 3ML9A 3BRYA 5I8EA 5DD1H 1TETH 2X4QA 3THML 1LDPH 4G5AA 5IHZA 2MEJB 3VRIA 3CX5J 1F3RB 5I6MA 4YDJA 1MRFH 3R19A 4KZEH 4KKQA 5KG9A 2R23A 4A6YB 2A1WL 5EU3B 4GRWH 5T33H 2GBTA 3MXVH 7PAZA 4JRYE 5KVGE 3I6GA 3TH4T 3ZGHA 2E75C 3L48A 3LIUA 4DZ8B 1W0WA 3NPZB 4HFUH 4QGYA 5IB4A 5TK2A 2B2XL 5TE4H 4XMKH 3G5XB 1NMCB 1G1CA 1G7HA 1KDIA 4HGWA 4BZYA 4XPFL 2ZF9A 1AIZA 1SDYA 4Z7NF 4XOCA 5D1XB 3KVQA 5KTEL 1V3LA 1IEAA 3MJ9A 5HYIA 3I2CL 2JKWA 3LK3B 1AR1D 3H0TA 3E6HB 1JTPA 4DGWC 2XKNB 5JHDA 5KVEL 3L1OL 4TUKH 3S96A 3A67H 4NQXB 4Z5RA 4TTGA 3O4LD 1JVOA 4F7MB 1P9MA 4ZYKA 4NM8H 2C9SA 2RJMA 3O6FC 2KH2B 5B22A 1MM4A 5K9KB 4I3SH 3WXVH 4EQ3A 5CEZL 3QXAA 3FF8A 5H4ZA 3HI5H 4FQ1H 2DRUA 3QI9B 3L5IA 3AC0A 2NX5B 1BCIA 1I3VA 4KROD 5ETUB 2O5YL 3AWGA 4CN4A 5CSBA 4BH7B 2XZAH 3GMQA 2BFVL 1E4HA 3POHA 3HKZA 4UNUA 1F90L 4FQJL 1QWUA 5E00A 1S78C 1YYML 1XH1A 3SSGA 3UC0H 2XN9A 5AUMB 2V2WA 4XPTL 1YECL 4HUWB 3MUGA 5F9WB 3UMNA 5EIIG 2FO4B 1KN4L 3QPXH 3VU2A 5I8EB 1VCBC 2OCFD 2X4QB 1LMKA 4PVNA 5IHZB 3VRIB 4YDJB 3ROOB 2V7HA 3UBGA 5KG9B 2WNXA 2K70A 2XHNA 4Q0XH 1UT9A 4X5RA 2R23B 1URZA 2C3GA 5CUSH 1FFQA 3L4ZA 4FQXD 4TXVB 4LKCA 1QEXA 3RBHA 5IROC 1W0WB 3QNFA 5IB4B 3OGOE 1SOXA 2D9CA 3TJHC 2P24A 2EC9U 1G7HB 4HGWB 4DH2A 1KIPA 4R2GD 2FUQA 3QJSB 3GQFA 1UWEH 3CFTA 3O6MH 3K6SA 4C58B 2C4XA 1IEAB 4NRYA 3H0TB 3A23A 3H53A 4KV5F 5I6OA 4M00A 1YEJH 5JHDB 2DL2A 4R4BB 3S96B 3QIUC 4BKLA 1LM8V 4Z5RB 1KLFA 1JZ6A 2EDQA 2MCG1 4K2UH 1UWGH 4LCUA 2XG5A 1BMGA 1DVFC 3G7TA 3P0YL 4ZYKB 1B90A 3WO3B 1FFNA 5DD5L 3QXAB 1U41A 3D12B 4Q9QL 4L9LA 4B9YA 4UM8A 3WFCL 5DURB 1O9VA 4PRBA 3GMQB 1MG2C 4NLAA 3LKQA 2ED7A 4E9WA 2XN9B 2V2WB 3C8DA 4D9LL 3DOSA 3MUGB 4LSSL 3REVA 1B4LA 2XE3A 1P69B 2V5SA 3TYFA 4B61A 1M7UA 3MRHA 2LTQC 4P9ML 3VXSD 2XTLA 5IJKA 2KPNA 3HG0A 5HHOD 5LUMA 3BISA 1NBVH 2V7HB 2ZWYA 4I5BA 4WK2B 4D2NA 2CALA 5KSAC 4BZ2A 2BRRH 2BFGA 4R5XA 3JCUO 4NJAL 1XH0A 4LRNH 2CJUL 4WHYH 3JUZA 4U6XA 1IBGL 4LKCB 1ED3A 4A39A 1XIWA 5DZPA 4GOSA 1CFNA 4ZNEA 5I71B 4N2KA 2P24B 2QZ5A 1KIPB 1DVUA 2OYKA 1RFDH 3OWRA 2V3DA 3TO4D 3K6SB 3SY9A 3RKDD 3DIDA 4FTVA 3UG4A 2AQ1A 1KENH 1MCQA 3ETBF 4U3XA 3WY1A 1JFHA 4JN1H 4JDZA 4JO4L 1QBML 1AACA 1KLFB 2XVLA 1IGFL 3Q2WA 2CE6A 1N2RB 4LCUB 1PTZA 1IBYA 2FJUB 2XG5B 4JN2A 1KBGL 3LKPA 3HG1E 1PLGH 2NT1A 1OM9A 1ZPUA 4YVNA 1FFNB 4AQ1C 1SJMA 2NY3C 2WZ6A 4L9LB 1IQWL 1DVZA 2JQZA 4UM8B 3MRNA 4GJTB 5LCVH 4QJ4B 4PRBB 2RA1A 3HB3B 4B50A 5CFAA 1HYRC 3RUGA 5JIQA 2LAGB 3LKQB 4F5CE 3M07A 5IUSA 1DCEA 3DOSB 1A02N 1KFAL 3QHFH 1IILE 3DI3B 2KDYA 1XF3A 3REVB 4WW2C 4GMSH 4N1EA 3TYFB 1RJCA 2Q10A 3SDCD 3MRHB 3WY4A 4QNPF 4HMEA 5CGMA 1B4RA 4JREC 2NSXA 3ARWA 4I5BB 3F2LA 3ATDA 1EGJA 1IC7L 2VLJE 3C6LA 5JUEL 3RL1A 3V0WL 3FB7A 1FUNA 2AEQL 3PDGA 4UT6H 1HIML 4HQQH 4U6XB 2ZP8A 1ED3B 1G9HA 4NKQB 2NUTA 4HGKC 4X5QA 5CIPA 1I9IH 1CFNB 3KLAA 5T3ZL 3PWVA 2F1CX 3U4BL 4GLRH 4YZWA 4YHPA 3IWVA 5F3FA 3EBAA 4AW7A 4TVPE 5E2JA 4N8PA 1X3DA 3UAQA 4R3SA 4PY8I 1ZLUH 5MP6H 4FTVB 3ULVC 2VL5A 5EDXA 1DEDA 5JR1H 1TFPA 4JDZB 1BXUA 4ETYA 1YNLL 4JN2B 5I0VA 2GHWB 3LKPB 5IJCC 4M4PA 3DURA 4O2EB 4F58H 1OTTC 1MOEA 1EXHA 4U1HB 3MZTA 3MRNB 5KBPA 3QIWA 3BSZA 2EVJA 4MXVF 4WEBL 4J8RA 3EF4A 3RUGB 3GXTA 5B38A 3WELA 1UACL 1EJOH 1FVDA 3FO0H 5F89A 3D3VE 1XF3B 2F53B 4BA8A 4GIPD 5E8PA 3CX2A 5DWPA 3FXIC 2J25A 4NUJA 4P07A 1AZUA 1JHKL 3ZKXB 5LXGH 3O4OB 5LAXA 3DIVA 5LGHH 3C6LB 4OLZL 3NRPA 3RL1B 1IEBA 3D18A 3FB7B 1QZ1A 3U4AA 4BBWA 2D3VA 1I3UA 3LEVH 3BUPA 3WS6C 2AJYH 2NUTB 3HE7A 4KUZH 4J3UA 5CIPB 1ZGLM 3KLAB 3PWVB 1EEYA 4AQ8A 4KTEH 4UNIA 4HIPA 1NFIA 3H4FA 3EYVA 3TS8A 4YHPB 2EXYC 4GCPA 6FABL 4R3SB 2P45B 2NNRA 4EJ1C 4OUUA 1C7TA 2FDBP 2E4TA 2VL5B 4A38A 5C92A 1A6AA 4D65A 1SJXA 2WXQA 4YBLB 3SQBB 4BHUI 4CVUA 4AGPA 1ODAA 1KB5H 4FERA 2DV6A 1JUFA 3DURB 4NB7A 2LR4A 2ZJSH 1MCRA 3UU2A 4O5LL 1IL1A 1K5WA 1N0LA 2X4RA 4B9IA 4WI5A 3S3PA 1HCVA 4JK0D 5DK0A 4GP5B 3MJ8A 5E79O 1SXBA 4M1CD 3VD7A 1I8UA 2C5DC 2W9EL 3GXMA 4PGCB 4IU3A 4J8RB 5EULV 1SM3L 3LKRA 5B38B 1OGSA 2GJZA 4HPOL 1BPLB 1FVDB 4FI6A 3MCYA 2VXVH 3NEOA 4AWJC 5F7YC 5F89B 1P5VB 2OMWA 2F54D 3IDIA 5ABDE 3HG1D 3E8VA 1J8HE 1T1YA 2V17L 3U30B 5BXFA 4ZS6D 1Z5HA 1UJTA 4MS6A 3IDYB 5E8PB 1AXTL 2YUWA 1YJDH 4M61B 4NUJB 1IBDA 5LAXB 3QPQD 1IEBB 4AK2A 1E4KA 1T4KB 4OQTL 4M5ZL 1QO3A 4MHHG 1QJ9A 3GYRA 5H8DA 4GFXA 1C1EH 4PLKC 4ZAKD 2CMRH 4BK5C 1OAQL 3EKCA 4W6WB 4N24A 4LSHA 2Y7LA 4RGNB 1BAFL 1G5GA 2NOYA 5HDBB 3SDYH 1NFIB 3EYVB 4LQFH 2Y5EA 3FPXA 3OQRA 3RVUD 4PP2A 2NXYC 3G7GA 3CNKA 4PLJD 2UZIL 3D2UD 5IOPA 1WAPA 4OJFH 1T0PB 5HY9B 1XWVA 4OUUB 1JYVA 1J86A 4DETA 1A6AB 2BH0A 1L9OA 1CYWA 4UAOC 4UM9A 3CVIL 5F9DC 3FUNA 5CZVH 4JFZL 3PU7A 4OLYH 3C5OA 1JUFB 3E2HB 5CN1A 3V7AG 3VE0A 3OAUH 4C4BA 4Z18A 2XV6B 1IL1B 2P8LA 4U7SA 1N0LB 2X4RB 4UT7L 3QXWA 1MFAL 3K72A 4D3CH 1E4XI 4PVLA 3KPSA 5DK0B 5DRWA 3MA7A 3MJ8B 1Q9LA 3OPZH 4HC1H 4E41E 4PRAA 1HT6A 8FABA 1N6QH 1ZT1A 2ZFGA 5B1JC 4IU3B 1QSFE 5F0LB 5FX3A 4DO5A 3LKRB 5E7FA 2GJZB 5D4HA 4JHWH 1GGIL 4Z7NE 4R26H 3ESNA 1Q94B 2AXHA 5C0NC 1JXFA 5DYOA 2N4IA 2YD0A 1VAHA 5DUPL 3TBVA 2OMWB 5J4MA 3IDIB 1ZVNA 3BCDA 4DN3L 3VFUA 1T1YB 1NEZA 5BXFB 5KJ7E 1QFPA 1MWAH 1XFPA 4J6IA 3BRGC 1I7ZA 3AREC 1ZIAA 2MNUA 1X5JA 4O4YH 4KY1H 4IYKA 4O3WA 3GZOA 2AQRA 2DKUA 1QO3B 2D0GA 3GLZA 1BWMA 5AOZA 3D3VD 2OCCB 2XA3A 3PWNA 2E6QA 3T4AA 2OKMA 4XP6L 1F58H 1XD0A 1PLCA 2CHXA 3QZNA 3VNZA 2JJUA 1Z6JT 4LU5L 1CYGA 4LAQH 3K3QA 3F12A 4PP2B 3RBSA 5LNGA 4Q6IA 1KV7A 2NY5L 4EI0A 5IOPB 5HBBA 4JKMA 4NUPA 1VFMA 5I9QB 1JAEA 2APXA 4E36A 4F9PA 3MV8E 2HRLA 4UM9B 2GPZA 4G8GE 3VE0B 4PIBA 4AE1A 2P8LB 1AGDA 4YDIL 5IGXH 5C2BH 1AR1C 3K72B 5DRWB 2W1NA 3KPSB 3MV9E 5KZCD 3MA7B 1Q9LB 8FABB 3BLBA 4ODHH 1ZT1B 1NUDA 1QZNA 1S7QA 3INUH 3ZL1A 3OJVC 3AXLA 3UTQA 4G83A 3TBVB 4U2ZA 1WYJA 1HDMA 1EVUA 3VFUB 4FXTA 1NEZB 4KV5E 4JFOA 4KROC 3TEXA 2ZCHH 3CZFA 3AB0B 3NCJL 2J88H 4Z6AT 1I7ZB 5FB8B 3BQVA 2WC7A 3ASWA 1QFWM 1RUPH 3T3PE 2IANE 1MCSA 2LFUA 3SZVA 3QEGH 4H88L 2YXFA 5CSZA 2A99A 5AKSA 4H8PA 1HX0A 2VDKL 4PPTA 4DP2X 1INEH 1IT9H 1YEIH 2IDTA 1P4IH 1J8HD 3HUJB 3PWNB 3L45A 3T4AB 4MCNA 1IKNA 3T0ED 4PHZA 4Y88A 3F7YA 4YHZL 1YS5A 2G0LA 1V3KA 2BDNH 3F12B 4XMWA 3QSKB 1JGUH 4Q6IB 3RDJA 2PCYA 3UAAA 4PLOB 5T5FL 5GXBB 5KJRL 4FQXC 4DO4A 3H2PA 5MEOA 1Q38A 3BE1H 4D9QE 1FJ1A 1FDLL 1ACCA 1B4JL 2CGYA 3B7SA 5I23A 4MZIA 2EH7H 4WKZA 5CM1A 1IGCH 2X1OA 4Q6KA 2EIBA 2YPKA 4ZTPL 3HHMA 4R2GC 1CGSH 1J8RA 4IHOA 4NZUL 3V8UA 3PF1A 1P4UA 1XB8A 2XXFA 1AGDB 3B8YA 5KYWA 4WJKB 4KHTL 32C2A 4RMWA 5HDBF 4U05A 1QEWA 3DDGA 2EILB 1UT2A 4HXBL 4LRIC 3RU8L 1S7QB 2Z92B 2UZYA 5HXMA 2B1OA 2R7EA 4JE0A 4DKTA 3AXLB 2XN1A 4R4FL 1ES0A 3UTQB 1HDMB 3IGKA 2HKHL 4JFOB 4H0GA 5EUKA 3CZFB 4IDJH 5G55A 3V4VH 3ARRA 4GW4A 3SN6N 4YK4B 4QRRA 1N12A 3S6CA 2VN7A 4ALAL 2O5XH 5CINH 5CSZB 5EIIA 1JS4A 4PGBA 1RJLA 3IFLL 5A2IH 5L8JB 1F11A 4PB0L 1L5GA 4KQ0A 3CN3A 5H2FO 1X9UA 4TPRL 5D1XE 1LO3H 2X1QA 1ZTXH 1HI6A 3F7YB 2YWZA 2E74C 2X9XA 5HD8D 3SKMA 5ADPL 5JIDA 4FA6A 5FF6A 4G2AA 2DWSA 3TF7C 5MEOB 1L7TL 4U0RC 3C2SA 5AL8A 4EZMA 1FJ1B 3F62A 4JPIA 5E95B 1JZGA 1MVYA 1UM5L 4NZRH 4OD3H 2P43B 1WITA 2MQCA 1JN6A 1JXGA 1O6SA 2YPKB 4L8SA 2PORA 4IHOB 3TO4C 1ACXA 4ATWA 1JV2A 3RKDC 2ZXWB 5KYWB 1YZZA 3UOAB 4WWKD 32C2B 1QEWB 4EI6A 2WLIA 1G0YR 3MV8D 4L4TA 2RBLA 1JIBA 2LHAA 4ZSOA 2F18A 4XVOA 4Z9KB 1ITBB 3Q48A 1ES0B 4JDEA 4P3CL 2WB7A 2MSPA 3TV3H 4IBZA 3RNQA 3BWUC 4IRZA 4O2FA 2R88A 1Y18A 2I24N 3BDYL 4N2EA 4NX0A 1C16A 1EHLH 2X4OA 2IVFC 2P4AB 4GW4B 3FQ2A 3PUCA 4CU6A 4QRRB 5ES4B 5EIIB 5TDOA 1HOCA 1VGKB 4QXUH 4PGBB 1A4CA 4DKFH 1RJLB 4HEMA 4JPKH 1GR7A 1QBLL 3AA6A 4Q56A 2E9BA 3S37X 5F3HA 3ZX1A 4DSYA 1F11B 3V6OA 3SDCC 3L4CA 4LLUA 3ZO9A 1L5GB 3FHAA 2EDWA 4F4BA 1Z2KA 3VDAA 1HI6B 4L5FE 3SKMB 3B2VH 2E9WA 3ZDYF 2WVUA 4YHOH 5LDUA 4HS3A 5JHDE 1PW3A 4P59L 4H20L 5FF6B 3S2AA 2ID5A 1I75A 3NSYA 3QAZB 4JPIB 5DVNA 5T1DL 4CSTA 4QRQA 1A22B 2BNQD 3C12A 4FLOA 2Z34A 1O6SB 2V9QA 2R56L 3T2QA 3P1VA 2GFBA 4L8SB 5JOEA 1TZGH 3QC6X 2OX5A 4LLWA 2H32H 3HUJF 1JV2B 5IJVA 4NBXB 2KT6A 3DRTA 1PVHA 2XN9E 3B2XA 4HW6A 4UINH 4D9QD 4N8CL 4EI6B 2KUTA 1AFVH 4ZX3A 2WLIB 3NZHL 2WVVA 4L4TB 4BFRA 4NUMA 1DQTA 4OZGE 4M7JL 2FJGA 4IKNA 5DGRA 5H2BA 4JDEB 3RAJL 3SB3A 2AI0H 3N41F 3BAKA 3RNQB 2MH4A 3OXRA 4O2FB 1SLUA 1Y18B 2CJTA 3LSOB 1MXDA 1DSFL 2HA1A 3QDGE 3P2BA 1C16B 2X4OB 1X5MA 3NACH 5EO0A 5J12C 4MJHA 5I30L 1QLRA 1A1NA 1KGJA 1ZY9A 5TDOB 1JSYA 1HOCB 3IK2A 2OSWA 1BXWA 3WY3A 4E9QA 4NZDA 4KQ3L 2WUBH 5EO9A 5F3HB 4APQA 3SBRA 3P0VL 2JKLA 4IOSA 4LLUB 5DFWH 2GBAA 1JCKA 1KEGH 4OY9A 5CJBA 1EO7A 4XAKD 1U6AH 1SEQL 1X7QA 2IH1A 4Y16A 2ATPA 3UAEA 1AHWC 5C7XH 1CMOA 3ZZLA 5EMYA 5L7XL 4HS3B 5HDQL 3EFFB 2XWBA 3JZ7A 4L8CA 1PRNA 2FJHB 3SHSA 1IM9A 5AB0A 1K9TA 3M46A 2I5YH 2BWIA 1KBPA 4QRQB 5A1AA 3DKHA 4DK6A 2FGWH 4NQUA 3DTXA 4HG4K 5D1XD 3JTBA 2N1KA 3MNDA 5FGCB 1W16A 2QADB 1IKFH 4JY5H 3ZXAC 2GFBB 4F7EA 3JSSA 2OX5B 4LLWB 1CE1H 5IJVB 1GJUA 4W6XB 3DRTB 1KCRL 1GOFA 1MCDA 2ZPKL 3AY4A 1IC4H 2WVVB 5KYUA 1OCOB 5GZND 4DAGH 2FJGB 5H2BB 3QI9D 2NX5D 1DYZA 2CAKA 1PZAA 1ZIBA 1LVEA 4TLSA 1PQZA 3PABB 1MJ8L 3OXRB 2MQ0A 4M1CC 4R96A 4XCYA 3LKSA 2HWZH 1HL4A 2L7JA 4GXVH 4LLDA 4Y2DC 4UTAH 1QLRB 1A1NB 1ORSA 2OMZA 4DGVH 4DQAA 5IJBC 1SVZA 1EMTH 2WM0A 2YPLA 1A7NL 4JG5A 4YO0A 4UB0L 4ZS6C 5EO9B 1T2QL 3LDBC 5G38A 2B1AL 5DC9B 5EOTB 3HBGA 3OLEA 1RZQA 4LVEA 3RX5A 4KQ4L 4F2FA 5JW3L 1X7QB 2IH1B 4FTVE 4Y16B 3UTOA 2ATPB 1EA9C 3QPQC 1ZV9A 2Y06L 4ZMZA 3WTSA 1EO8L 2J55A 4N8UA 2XWBB 3WIHL 4L8CB 4ZAKC 1IM9B 4HD9A 5AKTA 4M3HA 5FCSH 2J21A 3GSVA 4O02H 3DTXB 3RURA 4FQEA 5E03A 2DI7A 3RVUC 5A7EA 3AGVA 4H2AA 3N5AA 4F7EB 4PLJC 3CVBA 2EDEA 2VDKB 1VF5C 1F00I 1ADWA 2YD7A 5JHDD 3BMWA 4KRLB 4FLQA 3RUGE 1YN6A 4QY8A 1FLRH 4DPBX 3UAJA 4NM4H 4NQCE 5A2CA 5KYUB 2X70A 2HZHA 3LX9A 3HBQA 4LP8A 1A3RL 3PQSA 4LSEA 1PQZB 2ILLA 4RMVA 1SHWA 4R96B 2FEEI 4XCYB 4Y9EA 3LK42 4Y4FA 2WCPA 1YYLH 3OD3A 5I26A 1N3NA 1K3ZA 2XN9D 3MACH 5CMAA 2DQDL 1P7HL 5AAWA 4LL4A 4LLDB 4C4KO 2FGQX 4XNXL 3GXDA 1ORSB 2OMZB 1S8DA 2XCMC 2FX7L 1RAMA 4BWUA 2YPLB 4KVPA 4YO0B 2VUOA 5H4YA 2D3JA 2ZUYA 4XPGL 1YLBB 4C69X 1NL0L 3BVNA 3L3GA 4LPVA 4GAGH 5LB1A 3L4UA 4O58L 1BVLA 4M56A 1OCWH 2AXFA 3U9UA 4GI6A 3N06B 2DWTA 4PSPA 3P3SA 1JNNL 4JVPA 2DQCL 5L88L 5K1JA 4WFEE 1FFOA 3NAAH 3ZN6A 4HJJH 5D96C 1ID5I 1NWOA 3GSVB 4MAUH 1JYNA 1SUHA 2H41A 3EUDA 5GQBA 2EABA 3DOHA 4GG6F 2YKLL 3BWSA 2IPTL 3LAFA 4ZO8A 4KNQA 2Y7NA 2CKBH 3K1KC 3VD5A 2KMWA 1YN6B 3CIAA 4QY8B 1KELH 2KKQA 4HV8A 1NIDA 2CQVA 4M7KH 4R7DA 2IOMA 1OP3H 3TOPA 3D34A 2X4TA 3VTMA 2B4CC 2X70B 2VO5A 4BZ1A 4QIRA 4Z7QF 4XNQA 2VO8A 2DJ4A 5KVEE 1UUSA 4FCAA 3MLVH 3PHOA 4URKA 3AROA 4LDOB 3HB3D 1CGUA 3FULA 5I8KH 4YUEL 3UAFA 1WPCA 2DH2A 4M9OA 3DI2B 2V6HA 4Y4FB 1N3NB 5CMAB 2G9KA 5CEZE 4K7PX 5C0JA 1QNZH 3FUEA 2DQIL 4PWGA 4NO2A 3IFNL 3LD8C 4R84A 3RVXD 1S8DB 5KVDE 1E9QB 2IGTA 4R0LC 4N75A 4EI5A 2MPAL 5HDBE 3II1A 4CJ1A 2HH0H 2BVTA 2Z1KA 3LVTA 4G1MA 1JERA 3K2MC 4QRPE 4KJYA 2Y2XA 3BVNB 2QVKA 1LO4H 1TETL 2F58L 3L3GB 4OBSA 2LT9A 3WJLC 3ABLB 4ODXA 4Y7MA 3VFGH 1BVLB 4BD4A 5LGKA 2WQ8A 5IREA 2AXFB 1GFQA 3C5SA 3GMMA 4UUJA 3U9UB 5JQ6H 1ICTA 1TENA 3UL4A 1FFOB 2PNDA 4AYID 4JFDA 1AD0A 3QS3A 3WV0A 3BSGA 3T0EC 2ZUQC 2FSDA 2EIEA 4HFUL 4QF1A 2CSPA 1BQSA 4NAQA 4XMKL 3ZZQA 3NCCB 4FTVD 1MCOL 1G87A 3H7BB 2BM3A 1JZ4A 4BJLA 1IGIL 1G9EA 2DQ6A 4HV8B 2L0DA 4R7DB 4AG4H 4MCZA 5D9SA 3BKYL 2X4TB 3D50A 3ARZA 3LMJL 5EH1A 2NXZD 3A67L 3Q2NA 4UQBA 4XNQB 2EXSA 1PZ2A 2N7SA 3IPEA 1U8CA 3PHOB 2WN3A 2ALAA 4YNYB 4I3SL 2WBXA 4HK0A 4JR9L 2Y7SA 3OVUB 1WT5A 1KF9B 3CVHL 3IGAA 4MJ5A 4P3DA 5SX4I 2Y07H 4ES9A 2IBGA 1TEYA 3AWEA 5C0JB 1RULL 5E1AA 4NO2B 2F53D 2WQSA 4FLHA 4WTZA 2WLHA 5KYNA 1ZGLB 3KPRD 2WAQA 4HJUA 3VVWA 1TEFA 4EI5B 4KC3B 3PORA 2DQGH 4JL2A 4F8OA 3QPXL 3VYNA 1R0AH 3LS4H 1OAKH 4KJYB 2J57A 3C6LD 4JKPH 4NWUH 1A6WH 4KJPD 4OLXH 4ODXB 3SGJA 3U7WH 2WB1A 2YA1A 5BV7C 7FABH 1MCEA 3I50H 4IJ3B 3V9FA 1IE4A 3C5SB 3GMMB 4UUJB 4GI9A 5IEHA 4Q0XL 2YC1A 1OF0A 2W5PA 3LIZH 4YXHL 1LDSA 2IGFL 3NVQA 1AAJA 2N3JA 2UVEA 1AD0B 3E38A 4JFDB 3T09A 4Z3HA 5DQ9A 4R8WL 3VD9A 1ZVHA 1XVSA 4QF1B 1J9RA 3KPSE 5HD8C 4NJ9H 1IARB 1BEYH 1PLBA 3EW3B 4GKSA 4Z3EA 4M6MH 3RILA 3TBCA 3ECUA 3O6ML 3VRJA 4DP7X 2ARJA 4YXKL 4OD1L 3IBOA 2WJ5A 1YEDB 5L2JA 5FYLL 1UADC 2F2HA 2W8CA 1FNSH 3GPEA 2VR4A 1YEJL 1E6OH 3QNYA 4MCZB 5D9SB 4ZFOL 1SXNA 3RWEA 2XT1B 3Q2CA 4YHNA 2KERA 3T77A 1ZA3A 3W56A 1U8CB 3FTUA 1ZLSH 3O0RL 4WWKC 5IFHL 4HK0B 5C0RH 5F7DA 1N59A 3UO1H 3IGAB 5BJTA 1LO5A 3C6EA 3IU4H 3L6FA 1UH2A 4IEFA 1MCWM 4MJ5B 4P3DB 5FO9A 2WO2B 3ZSSA 4Z1PA 1NCOA 5E1AB 4AKPA 2XETA 1SGKA 4FE9A 1Y0LA 3UXFA 3LZRA 2CLZA 2LABA 4QTHA 5EU5A 1BA9A 5B1CA 2XQBH 3H4HA 1S9YA 4MZ2A 3BPNC 2EVGA 2RR3A 3T0WA 4KVNH 5E8DL 3RFZA 5CEZD 2H3NA 4V2CB 1Z0MA 3M8OH 3CDFA 4NQEA 5IEHB 4GQZA 3BGFB 1S7RB 2BRRL 2YC1B 3GTVA 2BVPA 3FRPA 5F1KC 4RGND 2J1ZA 1C5DA 3ARBA 3TJEL 4R97B 2WSPA 5I24A 3BYTA 4YL9A 5DQ9B 4JPSA 1DSYA 4AYGA 1MEXH 5IBLD 4GKSB 3IN2A 5F3BA 5T3ZE 1PHOA 3U9PL 1Q1JH 3LZPA 2F19H 4A2LA 5E0QA 3VRJB 5HHXL 3WLBA 3QRCA 2ARJB 1GRWA 5DFVD 4WIQA 3CZEA 5L2JB 3DX7B 3DROA 3FB8A 3L81A 4JGNA 3FH5A 3QNYB 4N90E 3SY7A 1EWHA 1M1XB 1S3KH 1BLIA 5BRQA 3T0SA 4TULH 5A2FA 2YUVA 1Y6KR 4NYLB 4U1KA 5CJOH 3T77B 1I8MA 4UOW1 1W80A 4FF9A 1RZFH 3PHAA 1ZA3B 1GL4B 1FI8C 3D6GA 1OD9A 4PJ9D 2VLRA 4WAFA 3CXHJ 3KJ6L 5F7DB 4OZIA 5BJTB 2YGNA 1LO5B 1T80A 1W8OA 3L6FB 3G6AA 4IEFB 3X14A 3RX7A 4YDLB 1UYWH 3VWKA 3VD4A 2J8UA 5HJ3A 4ZD3L 1RCYA 1Y0LB 4KR8A 3QHFL 2CLZB 3HZYA 4QTHB 5EU5B 1S9YB 1V5JA 1E5ZA 1UURA 1CF8L 3AS3A 3B9VA 3MLZH 5JOPD 4X5LA 4X8XA 3RFZB 2ICWA 3SPGA 2H3NB 4NS0A 4NQEB 3A0HO 1KYOJ 2XWJA 3RTQA 5GIRB 2BVPB 3FRPB 5BMFH 1C5DB 3ARBB 4QRTA 1IAIH 2E56A 3B7RL 5AYTA 2F15A 2EUWA 1ZXQA 4HT1H 2PR9A 4ZUTA 2BK8A 1MHEB 1SXSA 4OF0A 3UJJH 5F3BB 1E4WH 2COVD 2XZQL 2VABA 3AG4B 4NKIH 3UP6A 3P9WB 4NKMB 3WLBB 3U82B 2IDUA 2KL6A 4UM9D 1VFBA 4W70A 1NMCC 3DROB 3FB8B 2ZG1A 1MFCL 1BSIA 1NTDA 1JFQH 5D1XC 5C0AE 5JR1L 2Y24A 4U1KB 3FHEA 3QG6A 3X12A 1I8MB 3KPSD 5FC9A 3A6CH 3V0HA 3FN9A 2NYKA 4F58L 2NQCA 2NLJA 1OP5K 3IE4A 4QRRE 4OZIB 4GT0A 3S97C 3EBHA 3K8LA 3G6AB 4MX7A 3X14B 3SODB 1FZJA 4V2BA 2J56A 4MB5A 5GZNC 3VWKB 4MYPA 4N2MA 4NZTL 4FLRA 5L6YH 1GOGA 5HJ3B 3QI9C 2BP5M 5BUAA 3ESOA 1T4WA 1QFUH 4DN4H 3HZYB 4L1HA 3SPIA 2X9ZA 4H5SA 4HBQA 4HF5L 2R4PA 4K3GA 4BFGA 4YHYB 4XNKA 1I9RH 3ZUCA 4ODVH 4L23A 5F9WC 3IETA 4NWTH 2ICWB 4AYBA 3QUXA 1KG0A 1HU8A 3WNOA 1MCCA 4ZXBA 2J4UP 4YZFF 3L95A 2DY2A 2WYTA 2XWJB 3RTQB 3VI3A 5LWYL 3QNZA 5GGUA 3LEVL 3MOBL 1UQSA 4QRTB 1E67A 3VUAA 2R2BA 3RWGA 1VCAA 3ESUF 3PRNA 5CU9A 1PX3A 2VZTA 5HI5D 4RL9A 4RQQA 4ZUTB 3BPOB 2R29L 3QPKA 4J4PA 4DKDC 4H13C 2ED8A 5J5EA 2VABB 5ICUA 3U0TA 2WZAA 5B8CA 1AQDB 2A6JA 3MLYL 4FHKA 4L4TE 4XVJH 4BK8A 1CDCA 4ZSOE 3ARFA 1VFBB 3TFBA 1Z9SA 3DX8A 3MOAH 1XBDA 1OHQA 4PSRA 1HHHA 2XXGA 1O9WA 3QG6B 3X12B 1HKFA 5E1HB 2V5YA 4E5XG 1IC1A 4GRWB 2NLJB 2OMVA 4C59B 1RHHA 4G43A 3SBQA 4MX7B 1M4KA 3STLA 1FZJB 3MYJA 2YEVB 4HEME 3VG0H 1CK0H 2P80D 5GGVY 2CPUA 3V6OE 3EJTA 2VXVL 1NA8A 1I1CA 3ESMA 4MKMA 1UCTA 5C0IA 3LXAA 4JW3A 2CHZA 2FAUA 4C00A 3WN5A 2ATKA 3IETB 1NCDH 1PJ9A 2ZYSA 4M8QA 5SX5K 1WISA 3RVTD 4ZFOA 4OI7A 2R39A 3QUXB 5EZJA 3PV7A 1AGFB 1QTSA 1KG0B 4ZXBB 3MLTA 3L95B 1NCWH 4UZSA 5F1SA 2JMMA 3VI3B 3WSQH 1L9MA 1LWHA 3QNZB 4K23L 4NNXA 3OAYK 5GGUB 4F7TA 1EEUA 5FGCE 1UQSB 4MYWB 5IVZB 1CR9L 4M5SA 2WW8A 2R2BB 1PX8A 1NCAH 3BAYA 3RWGB 4BCZA 1F4XH 4M62L 4AIXA 1MPAH 4RQQB