1MM4A

Solution nmr structure of the outer membrane enzyme pagp in dpc micelles
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
170
structure length
170
Chain Sequence
b'MNADEWMTTFRENIAQTWQQPEHYDLYIPAITWHARFAYDKEKTDRYNERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLADENFHLGLGFTAGVTARDNWNYIPLPVLLPLASVGYGPVTFQMTYIPGTYNNGNVYFAWMRFQFLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CrcA protein
publication title Solution Structure and Dynamics of the Outer Membrane Enzyme PagP by NMR
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 19
structure length 170
sequence length 170
ec nomenclature ec 2.3.1.251: Lipid IV(A) palmitoyltransferase.
pdb deposition date 2002-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07017 PagP Antimicrobial peptide resistance and lipid A acylation protein PagP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1mm4A00
4RLCA 2F1TA 3C5OA 1MM4A 1G90A 2GE4A 2K0LA 4PUXA 2M07A 3G7GA 2F1VA 1QJPA 2MHLA 1Q9GA 1MM5A 2ERVA 2N2MA 1THQA 1BXWA 1P4TA 2N2LA 2MNHA 2X27X 3GP6A 2M06A 1ORMA 1QJ8A 1Q9FA 1QJ9A 2LHFA 3QRAA 2JMMA 3QRCA
chains in the Genus database with same CATH superfamily
2XE5A 3KVDD 1IZNB 2F1TA 1GFPA 4RLBA 5GTHO 1E54A 2GE4A 2K0LA 2R8AA 5T5FA 4D65A 4RJXA 2XE1A 1IZNA 4FOZA 3WI4A 2F1VA 2OMFA 3PF1A 4UB8O 2MHLA 5G38A 1MM5A 5G39A 4C00A 1THQA 5B5EO 3DA3A 2R4NA 1BH3A 4AYNA 1T1LA 2Y2XA 5AFUL 2MNHA 2KZ7A 4LSFA 2R4LA 2XE3A 3KZIO 4U9CA 4AYMC 1YS5A 4K3BA 2Y0HA 3A2SX 3V8UA 2KC0A 3VY8X 2IWVA 3VZTX 4BUMX 4O4XA 3PGRA 5GV0A 2ODJA 3AA7B 2Y0KA 3QRAA 1OPFA 1ZHXA 2R88A 3A0BO 4GHBA 4LSEA 2ZFGA 3AA6B 5KAFO 3HWBA 3TZGA 3AAAB 2W80C 3C5OA 4JCHA 4D5UA 1OSMA 3LK3B 2W81C 3PGSA 2Y0LA 3AAEB 1PHOA 3PRNA 1G90A 2FGQX 4KR8A 4FUVA 4N58A 4O3YA 4O3ZA 4UB6O 3VZUX 3AA0B 4PUXA 4D64A 4Z3TA 3AA6A 4RJWA 3AA1B 3AAAA 3G7GA 2J4UP 3PQSA 5E79O 1QJPA 3SY7A 3LK3A 2XG6A 3HW9A 3HOEA 5JDPA 2QTKA 1BXWA 3AAEA 4FZNA 4KRAA 3DWNA 3PORA 1GFNA 3LK41 4FESA 4AYEC 2LFUA 3QRCA 4N75A 7PRNA 3UAQA 4XNKA 4GCPA 4LSHA 3FYXA 3T24A 8PRNA 2O4VA 2PORA 5H2FO 2JQYA 4XNLA 2M06A 1ORMA 3BS0A 2ZLDA 1Q9FA 4O4UA 1QJ9A 4G75A 1GFMA 4FMSA 5DL6A 3PGUA 2JMMA 2XMXA 4FSPA 4QQ1A 4RLCA 5FVNA 3SYSA 5ADXL 2WJQA 1MM4A 4FSOA 4AYID 2IWWA 1GFQA 3SZDA 3WU2O 4AFKA 4N59A 3SYBA 3JTYA 4FT6A 2F1CX 2WJRA 3AA7A 4PR7A 3VE1A 3EMNX 5DL5A 5DL8A 4C4VB 4GF4A 5IYUA 2YNKA 1Q9GA 2Y7SA 2ERVA 1HXUA 3POXA 3RBHA 5G3AA 5GTIO 2K4TA 4C69X 3VY9X 3LK2B 3HOLA 4KR4A 3AA0A 2XE2A 1HXXA 2J1NA 3AA1A 1PRNA 3BRZA 2YPVA 3K19A 4FRXA 4FZMA 5G26A 1MPFA 4FQEA 1ZHTA 2WVPA 3LK2A 3POUA 4RL9A 4PJ0O 2KDYA 2R4OA 3T0SA 3LK42 6PRNA 1T16A 2R4PA 4IL6O 2R89A 5PRNA 4AKMA 3DWOX 4O3XB 2KXPB 3DA4A 4O3WA 3JCUO 3DZMA 3SZVA 3T20A 4GCQA 4GCSA 4LSIA 4AKRB 5KAIO 1BT9A 2KZ7B 4O49A 3SY9A 2XTRA 2M07A 2XTQA 4N74A 5AFUK 4AUIA 3BRYA 2KXPA 2PRNA 5EE2A 3A0HO 3PQUA 2N2MA 3UPGA 5D5DA 1ZHWA 4K3CA 3VE2A 1P4TA 2N2LA 3O0EA 4FRTA 1HXTA 4JFBA 4AKRA 4AZLA 4F4BA 2FGRA 2X9KA 4E1TA 2X27X 5DL7A 3UU2A 4C4VA 5B66O 5ADXK 4FZLA 1S5LO 3NSGA 4G76A 4CTDA 3GP6A 4B61A 1QJ8A 1ZHZA 1ZHYA 3NJTA 5TISO 3VZWX 4E1SA 2LHFA 3WI5A 4AYDC 1H6S1 2AXTO 3POQA 1GFOA
chains in the Genus database with same CATH topology
2XE5A 3KVDD 1IZNB 2F1TA 1GFPA 4RLBA 1E54A 2GE4A 2K0LA 5T5FA 4D65A 4RJXA 2XE1A 1IZNA 4FOZA 3WI4A 2F1VA 2OMFA 2MHLA 1MM5A 1THQA 3DA3A 1BH3A 4AYNA 2Y2XA 5AFUL 2MNHA 2KZ7A 4LSFA 2XE3A 4U9CA 4AYMC 1YS5A 2Y0HA 3A2SX 3V8UA 2KC0A 3VZTX 4BUMX 4O4XA 5GV0A 2ODJA 3AA7B 2Y0KA 3QRAA 1OPFA 1ZHXA 4GHBA 4LSEA 2ZFGA 3AA6B 3TZGA 3HWBA 3AAAB 2W80C 3C5OA 4JCHA 4D5UA 1OSMA 3LK3B 2W81C 2Y0LA 3AAEB 1PHOA 3PRNA 1G90A 2FGQX 4KR8A 4FUVA 4N58A 4O3YA 4O3ZA 3VZUX 4D64A 3AA0B 4PUXA 4Z3TA 3AA6A 4RJWA 3AA1B 3AAAA 3G7GA 2J4UP 3PQSA 5JDPA 1QJPA 3SY7A 3LK3A 2XG6A 3HW9A 3HOEA 2QTKA 1BXWA 3AAEA 4FZNA 4KRAA 3PORA 1GFNA 3LK41 4FESA 4AYEC 2LFUA 3QRCA 7PRNA 3UAQA 4XNKA 4GCPA 4LSHA 3FYXA 3T24A 8PRNA 2O4VA 2PORA 4XNLA 2M06A 1ORMA 2ZLDA 1Q9FA 4O4UA 1QJ9A 4G75A 1GFMA 4FMSA 5DL6A 5FVNA 2JMMA 2XMXA 4FSPA 4QQ1A 4RLCA 3SYSA 5ADXL 1MM4A 4FSOA 4AYID 1GFQA 3SZDA 4AFKA 4N59A 3SYBA 3JTYA 4FT6A 3AA7A 3VE1A 3EMNX 5DL5A 5DL8A 4GF4A 5IYUA 2YNKA 1Q9GA 2Y7SA 2ERVA 1HXUA 3POXA 3RBHA 4C69X 2K4TA 3VY9X 3LK2B 3HOLA 4KR4A 3AA0A 2XE2A 1HXXA 2J1NA 3AA1A 1PRNA 4FZMA 2YPVA 3K19A 4FRXA 5G26A 3VY8X 1MPFA 1ZHTA 3LK2A 3POUA 4RL9A 2KDYA 3T0SA 3LK42 6PRNA 5PRNA 4AKMA 4O3XB 2KXPB 3DA4A 4O3WA 3SZVA 3T20A 4GCQA 4GCSA 4LSIA 4AKRB 1BT9A 2KZ7B 4O49A 3SY9A 2XTRA 2M07A 2XTQA 5AFUK 4AUIA 2KXPA 2PRNA 5EE2A 3PQUA 2N2MA 3UPGA 5D5DA 1ZHWA 3VE2A 1P4TA 2N2LA 3O0EA 4FRTA 1HXTA 4JFBA 4AKRA 4AZLA 4F4BA 2FGRA 4E1TA 2X27X 5DL7A 3UU2A 5ADXK 4FZLA 3NSGA 4G76A 3GP6A 4B61A 1QJ8A 1ZHZA 1ZHYA 4E1SA 3VZWX 2LHFA 3WI5A 4AYDC 1H6S1 3POQA 1GFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RLC A;  2F1T A;  3C5O A;  1MM4 A;  1G90 A;  2GE4 A;  2K0L A;  4PUX A;  2M07 A;  3G7G A;  2F1V A;  1QJP A;  2MHL A;  1Q9G A;  1MM5 A;  2ERV A;  2N2M A;  1THQ A;  1BXW A;  1P4T A;  2N2L A;  2MNH A;  2X27 X;  3GP6 A;  2M06 A;  1ORM A;  1QJ8 A;  1Q9F A;  1QJ9 A;  2LHF A;  3QRA A;  2JMM A;  3QRC A; 
#chains in the Genus database with same CATH topology
 2XE5 A;  3KVD D;  1IZN B;  2F1T A;  1GFP A;  4RLB A;  5GTH O;  1E54 A;  2GE4 A;  2K0L A;  2R8A A;  5T5F A;  4D65 A;  4RJX A;  2XE1 A;  1IZN A;  4FOZ A;  3WI4 A;  2F1V A;  2OMF A;  3PF1 A;  4UB8 O;  2MHL A;  5G38 A;  1MM5 A;  5G39 A;  4C00 A;  1THQ A;  5B5E O;  3DA3 A;  2R4N A;  1BH3 A;  4AYN A;  1T1L A;  2Y2X A;  5AFU L;  2MNH A;  2KZ7 A;  4LSF A;  2R4L A;  2XE3 A;  3KZI O;  4U9C A;  4AYM C;  1YS5 A;  4K3B A;  2Y0H A;  3A2S X;  3V8U A;  2KC0 A;  3VY8 X;  2IWV A;  3VZT X;  4BUM X;  4O4X A;  3PGR A;  5GV0 A;  2ODJ A;  3AA7 B;  2Y0K A;  3QRA A;  1OPF A;  1ZHX A;  2R88 A;  3A0B O;  4GHB A;  4LSE A;  2ZFG A;  3AA6 B;  5KAF O;  3HWB A;  3TZG A;  3AAA B;  2W80 C;  3C5O A;  4JCH A;  4D5U A;  1OSM A;  3LK3 B;  2W81 C;  3PGS A;  2Y0L A;  3AAE B;  1PHO A;  3PRN A;  1G90 A;  2FGQ X;  4KR8 A;  4FUV A;  4N58 A;  4O3Y A;  4O3Z A;  4UB6 O;  3VZU X;  3AA0 B;  4PUX A;  4D64 A;  4Z3T A;  3AA6 A;  4RJW A;  3AA1 B;  3AAA A;  3G7G A;  2J4U P;  3PQS A;  5E79 O;  1QJP A;  3SY7 A;  3LK3 A;  2XG6 A;  3HW9 A;  3HOE A;  5JDP A;  2QTK A;  1BXW A;  3AAE A;  4FZN A;  4KRA A;  3DWN A;  3POR A;  1GFN A;  3LK4 1;  4FES A;  4AYE C;  2LFU A;  3QRC A;  4N75 A;  7PRN A;  3UAQ A;  4XNK A;  4GCP A;  4LSH A;  3FYX A;  3T24 A;  8PRN A;  2O4V A;  2POR A;  5H2F O;  2JQY A;  4XNL A;  2M06 A;  1ORM A;  3BS0 A;  2ZLD A;  1Q9F A;  4O4U A;  1QJ9 A;  4G75 A;  1GFM A;  4FMS A;  5DL6 A;  3PGU A;  2JMM A;  2XMX A;  4FSP A;  4QQ1 A;  4RLC A;  5FVN A;  3SYS A;  5ADX L;  2WJQ A;  1MM4 A;  4FSO A;  4AYI D;  2IWW A;  1GFQ A;  3SZD A;  3WU2 O;  4AFK A;  4N59 A;  3SYB A;  3JTY A;  4FT6 A;  2F1C X;  2WJR A;  3AA7 A;  4PR7 A;  3VE1 A;  3EMN X;  5DL5 A;  5DL8 A;  4C4V B;  4GF4 A;  5IYU A;  2YNK A;  1Q9G A;  2Y7S A;  2ERV A;  1HXU A;  3POX A;  3RBH A;  5G3A A;  5GTI O;  2K4T A;  4C69 X;  3VY9 X;  3LK2 B;  3HOL A;  4KR4 A;  3AA0 A;  2XE2 A;  1HXX A;  2J1N A;  3AA1 A;  1PRN A;  3BRZ A;  2YPV A;  3K19 A;  4FRX A;  4FZM A;  5G26 A;  1MPF A;  4FQE A;  1ZHT A;  2WVP A;  3LK2 A;  3POU A;  4RL9 A;  4PJ0 O;  2KDY A;  2R4O A;  3T0S A;  3LK4 2;  6PRN A;  1T16 A;  2R4P A;  4IL6 O;  2R89 A;  5PRN A;  4AKM A;  3DWO X;  4O3X B;  2KXP B;  3DA4 A;  4O3W A;  3JCU O;  3DZM A;  3SZV A;  3T20 A;  4GCQ A;  4GCS A;  4LSI A;  4AKR B;  5KAI O;  1BT9 A;  2KZ7 B;  4O49 A;  3SY9 A;  2XTR A;  2M07 A;  2XTQ A;  4N74 A;  5AFU K;  4AUI A;  3BRY A;  2KXP A;  2PRN A;  5EE2 A;  3A0H O;  3PQU A;  2N2M A;  3UPG A;  5D5D A;  1ZHW A;  4K3C A;  3VE2 A;  1P4T A;  2N2L A;  3O0E A;  4FRT A;  1HXT A;  4JFB A;  4AKR A;  4AZL A;  4F4B A;  2FGR A;  2X9K A;  4E1T A;  2X27 X;  5DL7 A;  3UU2 A;  4C4V A;  5B66 O;  5ADX K;  4FZL A;  1S5L O;  3NSG A;  4G76 A;  4CTD A;  3GP6 A;  4B61 A;  1QJ8 A;  1ZHZ A;  1ZHY A;  3NJT A;  5TIS O;  3VZW X;  4E1S A;  2LHF A;  3WI5 A;  4AYD C;  1H6S 1;  2AXT O;  3POQ A;  1GFO A; 
#chains in the Genus database with same CATH homology
 2XE5 A;  3KVD D;  1IZN B;  2F1T A;  1GFP A;  4RLB A;  1E54 A;  2GE4 A;  2K0L A;  5T5F A;  4D65 A;  4RJX A;  2XE1 A;  1IZN A;  4FOZ A;  3WI4 A;  2F1V A;  2OMF A;  2MHL A;  1MM5 A;  1THQ A;  3DA3 A;  1BH3 A;  4AYN A;  2Y2X A;  5AFU L;  2MNH A;  2KZ7 A;  4LSF A;  2XE3 A;  4U9C A;  4AYM C;  1YS5 A;  2Y0H A;  3A2S X;  3V8U A;  2KC0 A;  3VZT X;  4BUM X;  4O4X A;  5GV0 A;  2ODJ A;  3AA7 B;  2Y0K A;  3QRA A;  1OPF A;  1ZHX A;  4GHB A;  4LSE A;  2ZFG A;  3AA6 B;  3TZG A;  3HWB A;  3AAA B;  2W80 C;  3C5O A;  4JCH A;  4D5U A;  1OSM A;  3LK3 B;  2W81 C;  2Y0L A;  3AAE B;  1PHO A;  3PRN A;  1G90 A;  2FGQ X;  4KR8 A;  4FUV A;  4N58 A;  4O3Y A;  4O3Z A;  3VZU X;  4D64 A;  3AA0 B;  4PUX A;  4Z3T A;  3AA6 A;  4RJW A;  3AA1 B;  3AAA A;  3G7G A;  2J4U P;  3PQS A;  5JDP A;  1QJP A;  3SY7 A;  3LK3 A;  2XG6 A;  3HW9 A;  3HOE A;  2QTK A;  1BXW A;  3AAE A;  4FZN A;  4KRA A;  3POR A;  1GFN A;  3LK4 1;  4FES A;  4AYE C;  2LFU A;  3QRC A;  7PRN A;  3UAQ A;  4XNK A;  4GCP A;  4LSH A;  3FYX A;  3T24 A;  8PRN A;  2O4V A;  2POR A;  4XNL A;  2M06 A;  1ORM A;  2ZLD A;  1Q9F A;  4O4U A;  1QJ9 A;  4G75 A;  1GFM A;  4FMS A;  5DL6 A;  5FVN A;  2JMM A;  2XMX A;  4FSP A;  4QQ1 A;  4RLC A;  3SYS A;  5ADX L;  1MM4 A;  4FSO A;  4AYI D;  1GFQ A;  3SZD A;  4AFK A;  4N59 A;  3SYB A;  3JTY A;  4FT6 A;  3AA7 A;  3VE1 A;  3EMN X;  5DL5 A;  5DL8 A;  4GF4 A;  5IYU A;  2YNK A;  1Q9G A;  2Y7S A;  2ERV A;  1HXU A;  3POX A;  3RBH A;  4C69 X;  2K4T A;  3VY9 X;  3LK2 B;  3HOL A;  4KR4 A;  3AA0 A;  2XE2 A;  1HXX A;  2J1N A;  3AA1 A;  1PRN A;  4FZM A;  2YPV A;  3K19 A;  4FRX A;  5G26 A;  3VY8 X;  1MPF A;  1ZHT A;  3LK2 A;  3POU A;  4RL9 A;  2KDY A;  3T0S A;  3LK4 2;  6PRN A;  5PRN A;  4AKM A;  4O3X B;  2KXP B;  3DA4 A;  4O3W A;  3SZV A;  3T20 A;  4GCQ A;  4GCS A;  4LSI A;  4AKR B;  1BT9 A;  2KZ7 B;  4O49 A;  3SY9 A;  2XTR A;  2M07 A;  2XTQ A;  5AFU K;  4AUI A;  2KXP A;  2PRN A;  5EE2 A;  3PQU A;  2N2M A;  3UPG A;  5D5D A;  1ZHW A;  3VE2 A;  1P4T A;  2N2L A;  3O0E A;  4FRT A;  1HXT A;  4JFB A;  4AKR A;  4AZL A;  4F4B A;  2FGR A;  4E1T A;  2X27 X;  5DL7 A;  3UU2 A;  5ADX K;  4FZL A;  3NSG A;  4G76 A;  3GP6 A;  4B61 A;  1QJ8 A;  1ZHZ A;  1ZHY A;  4E1S A;  3VZW X;  2LHF A;  3WI5 A;  4AYD C;  1H6S 1;  3POQ A;  1GFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...