1MM4A

Solution nmr structure of the outer membrane enzyme pagp in dpc micelles
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
170
structure length
170
Chain Sequence
MNADEWMTTFRENIAQTWQQPEHYDLYIPAITWHARFAYDKEKTDRYNERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLADENFHLGLGFTAGVTARDNWNYIPLPVLLPLASVGYGPVTFQMTYIPGTYNNGNVYFAWMRFQFLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CrcA protein
publication title Solution Structure and Dynamics of the Outer Membrane Enzyme PagP by NMR
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 19
structure length 170
sequence length 170
ec nomenclature ec 2.3.1.251: Lipid IV(A) palmitoyltransferase.
pdb deposition date 2002-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07017 PagP Antimicrobial peptide resistance and lipid A acylation protein PagP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1mm4A00
3C5OA 2JMMA 1ORMA 3GP6A 2ERVA 2M06A 2N2LA 1QJ9A 1G90A 3G7GA 3QRCA 1Q9GA 2K0LA 1MM5A 2F1TA 2GE4A 2M07A 2N2MA 1Q9FA 2LHFA 2MHLA 1BXWA 3QRAA 1P4TA 4PUXA 1QJPA 4RLCA 1THQA 2MNHA 1QJ8A 2F1VA 2X27X 1MM4A
chains in the Genus database with same CATH superfamily
2WVPA 2IWWA 5ADXL 4AYMC 3HOLA 2JMMA 2YPVA 1ORMA 3AA7B 2ODJA 2N2LA 3DZMA 5T5FA 2O4VA 4LSFA 3SZVA 3WU2O 4UB6O 4AYID 3QRCA 1PRNA 4XNKA 4N59A 4B61A 2K0LA 4AKMA 7PRNA 1T1LA 2M07A 2N2MA 4D64A 1Q9FA 3AAEA 3RBHA 3AA7A 4FOZA 3QRAA 2Y7SA 2R8AA 3AAAA 4K3BA 4PUXA 5IYUA 2PRNA 5KAFO 5FVNA 2ZFGA 2JQYA 3POUA 2Y0LA 3HW9A 5AFUL 4O4XA 4FUVA 4KRAA 2XMXA 4O3ZA 5E79O 3SY9A 3PGSA 3TZGA 4AFKA 2KZ7A 1MPFA 3DA3A 4G75A 4FSOA 1GFNA 2FGRA 2MNHA 4JFBA 3WI5A 1BT9A 3A0HO 1QJ8A 3K19A 2Y2XA 3NJTA 3POQA 5G26A 2WJQA 5PRNA 4XNLA 3T24A 4AKRB 1S5LO 1GFMA 1H6S1 4K3CA 4AYNA 2AXTO 3DWOX 2XG6A 2J1NA 2XE3A 3PGUA 1T16A 3UU2A 1IZNA 3GP6A 3PQSA 4PJ0O 2M06A 3HOEA 4LSIA 1QJ9A 4FZNA 2QTKA 2XTRA 4FMSA 3A2SX 3G7GA 4FT6A 2WJRA 4O3YA 1E54A 5GTIO 1Q9GA 1GFPA 4GCSA 3VY8X 3POXA 4AYDC 3PORA 4JCHA 3LK2A 4N74A 4F4BA 3AA1B 5TISO 4O3WA 2LHFA 3O0EA 2K4TA 3VZWX 4KR8A 1P4TA 4O3XB 4N58A 4D65A 1ZHTA 4BUMX 1YS5A 4RJXA 2XTQA 4FZMA 3LK42 4FESA 4Z3TA 3AA1A 5KAIO 5GTHO 4O4UA 3JTYA 4CTDA 3PQUA 3VZUX 4D5UA 3EMNX 3BRYA 3T0SA 2R4PA 4AUIA 3C5OA 3NSGA 2KC0A 8PRNA 2IWVA 1OSMA 2KXPB 5DL7A 4GF4A 2OMFA 2ERVA 4C4VB 1GFOA 2R4LA 3FYXA 4FSPA 1ZHXA 2YNKA 4GHBA 4AKRA 3VZTX 4IL6O 3PRNA 1MM5A 1GFQA 2F1TA 2GE4A 5GV0A 2F1CX 1ZHYA 3LK41 1OPFA 5H2FO 3AA0B 2Y0HA 3SYBA 2XE2A 4GCQA 2J4UP 3WI4A 4FRXA 4AZLA 1QJPA 2Y0KA 5ADXK 4UB8O 2LFUA 4E1TA 5B66O 4RLCA 5EE2A 2W80C 3SZDA 4U9CA 4N75A 1PHOA 4RLBA 5DL8A 2F1VA 3UAQA 5B5EO 5G3AA 4PR7A 3AAEB 4LSHA 5D5DA 2R89A 3SY7A 3VY9X 2PORA 3AAAB 4C69X 1HXUA 3UPGA 3JCUO 4FZLA 3KVDD 1ZHWA 2W81C 1G90A 5G38A 5AFUK 2FGQX 1ZHZA 3PGRA 5JDPA 4RL9A 3HWBA 4AYEC 2X9KA 6PRNA 5DL5A 3V8UA 2KZ7B 2R88A 3VE2A 3AA6B 3KZIO 2R4OA 1BH3A 3VE1A 4QQ1A 4KR4A 4FQEA 1HXTA 2KXPA 2XE5A 2MHLA 1BXWA 4G76A 3SYSA 3DA4A 5G39A 2KDYA 4C4VA 3BS0A 4O49A 4RJWA 3BRZA 3LK3B 3A0BO 4GCPA 2ZLDA 1IZNB 5DL6A 3T20A 2XE1A 3AA6A 4C00A 1THQA 4LSEA 4E1SA 2X27X 3DWNA 3AA0A 1MM4A 1HXXA 3PF1A 2R4NA 4FRTA 3LK2B 3LK3A
chains in the Genus database with same CATH topology
5ADXL 4AYMC 3HOLA 2JMMA 2YPVA 1ORMA 3AA7B 2ODJA 2N2LA 5T5FA 2O4VA 4LSFA 3SZVA 4AYID 3QRCA 1PRNA 4XNKA 4N59A 2K0LA 4AKMA 7PRNA 2M07A 2N2MA 4D64A 1Q9FA 3AAEA 3RBHA 3AA7A 4FOZA 3QRAA 2Y7SA 3AAAA 4PUXA 5IYUA 2PRNA 5FVNA 2ZFGA 3POUA 5AFUL 2Y0LA 3HW9A 4O4XA 4FUVA 4KRAA 2XMXA 4O3ZA 3SY9A 3TZGA 4B61A 4D5UA 4AFKA 2KZ7A 1MPFA 3DA3A 4G75A 4FSOA 1GFNA 2FGRA 2MNHA 4JFBA 3WI5A 1BT9A 3K19A 1QJ8A 3POQA 2Y2XA 3T24A 5PRNA 5G26A 4AKRB 4XNLA 1GFMA 1H6S1 4AYNA 2XG6A 2J1NA 2XE3A 3UU2A 1IZNA 3GP6A 3PQSA 2M06A 3HOEA 4LSIA 1QJ9A 4FZNA 2QTKA 2XTRA 4FMSA 3A2SX 3G7GA 4FT6A 4O3YA 4AKRA 1E54A 4D65A 1Q9GA 1GFPA 4GCSA 3POXA 4AYDC 3PORA 4JCHA 3LK2A 4F4BA 3AA1B 4O3WA 2LHFA 3O0EA 2K4TA 3VZWX 4KR8A 1P4TA 4O3XB 4N58A 1ZHTA 4BUMX 1YS5A 4RJXA 2XTQA 4FZMA 3LK42 4FESA 4Z3TA 3AA1A 4O4UA 3JTYA 3PQUA 3VZUX 3EMNX 3T0SA 4AUIA 3C5OA 3NSGA 2KC0A 8PRNA 2KXPB 1OSMA 5DL7A 4GF4A 2OMFA 2ERVA 1GFOA 3FYXA 4FSPA 1ZHXA 2YNKA 4GHBA 3VZTX 3PRNA 1MM5A 1GFQA 2F1TA 2GE4A 5GV0A 1ZHYA 3LK41 1OPFA 3AA0B 2Y0HA 3SYBA 2XE2A 4GCQA 2J4UP 3WI4A 4FRXA 4AZLA 1QJPA 2Y0KA 5ADXK 2LFUA 4E1TA 4RLCA 5EE2A 2W80C 3SZDA 4U9CA 1PHOA 4RLBA 5DL8A 2F1VA 3UAQA 3AAEB 4LSHA 5D5DA 3SY7A 3VY9X 2PORA 3AAAB 4C69X 1HXUA 3UPGA 4FZLA 3KVDD 1ZHWA 2W81C 1G90A 5AFUK 2FGQX 1ZHZA 5JDPA 4RL9A 3HWBA 4AYEC 6PRNA 5DL5A 3V8UA 2KZ7B 3VE2A 3AA6B 1BH3A 3VE1A 4QQ1A 4KR4A 3VY8X 1HXTA 2KXPA 2XE5A 2MHLA 1BXWA 4G76A 3SYSA 3DA4A 2KDYA 4O49A 4RJWA 3LK3B 4GCPA 2ZLDA 1IZNB 5DL6A 3T20A 2XE1A 3AA6A 1THQA 4LSEA 4E1SA 2X27X 3AA0A 1MM4A 1HXXA 4FRTA 3LK2B 3LK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C5O A;  2JMM A;  1ORM A;  3GP6 A;  2ERV A;  2M06 A;  2N2L A;  1QJ9 A;  1G90 A;  3G7G A;  3QRC A;  1Q9G A;  2K0L A;  1MM5 A;  2F1T A;  2GE4 A;  2M07 A;  2N2M A;  1Q9F A;  2LHF A;  2MHL A;  1BXW A;  3QRA A;  1P4T A;  4PUX A;  1QJP A;  4RLC A;  1THQ A;  2MNH A;  1QJ8 A;  2F1V A;  2X27 X;  1MM4 A; 
#chains in the Genus database with same CATH topology
 2WVP A;  2IWW A;  5ADX L;  4AYM C;  3HOL A;  2JMM A;  2YPV A;  1ORM A;  3AA7 B;  2ODJ A;  2N2L A;  3DZM A;  5T5F A;  2O4V A;  4LSF A;  3SZV A;  3WU2 O;  4UB6 O;  4AYI D;  3QRC A;  1PRN A;  4XNK A;  4N59 A;  4B61 A;  2K0L A;  4AKM A;  7PRN A;  1T1L A;  2M07 A;  2N2M A;  4D64 A;  1Q9F A;  3AAE A;  3RBH A;  3AA7 A;  4FOZ A;  3QRA A;  2Y7S A;  2R8A A;  3AAA A;  4K3B A;  4PUX A;  5IYU A;  2PRN A;  5KAF O;  5FVN A;  2ZFG A;  2JQY A;  3POU A;  2Y0L A;  3HW9 A;  5AFU L;  4O4X A;  4FUV A;  4KRA A;  2XMX A;  4O3Z A;  5E79 O;  3SY9 A;  3PGS A;  3TZG A;  4AFK A;  2KZ7 A;  1MPF A;  3DA3 A;  4G75 A;  4FSO A;  1GFN A;  2FGR A;  2MNH A;  4JFB A;  3WI5 A;  1BT9 A;  3A0H O;  1QJ8 A;  3K19 A;  2Y2X A;  3NJT A;  3POQ A;  5G26 A;  2WJQ A;  5PRN A;  4XNL A;  3T24 A;  4AKR B;  1S5L O;  1GFM A;  1H6S 1;  4K3C A;  4AYN A;  2AXT O;  3DWO X;  2XG6 A;  2J1N A;  2XE3 A;  3PGU A;  1T16 A;  3UU2 A;  1IZN A;  3GP6 A;  3PQS A;  4PJ0 O;  2M06 A;  3HOE A;  4LSI A;  1QJ9 A;  4FZN A;  2QTK A;  2XTR A;  4FMS A;  3A2S X;  3G7G A;  4FT6 A;  2WJR A;  4O3Y A;  1E54 A;  5GTI O;  1Q9G A;  1GFP A;  4GCS A;  3VY8 X;  3POX A;  4AYD C;  3POR A;  4JCH A;  3LK2 A;  4N74 A;  4F4B A;  3AA1 B;  5TIS O;  4O3W A;  2LHF A;  3O0E A;  2K4T A;  3VZW X;  4KR8 A;  1P4T A;  4O3X B;  4N58 A;  4D65 A;  1ZHT A;  4BUM X;  1YS5 A;  4RJX A;  2XTQ A;  4FZM A;  3LK4 2;  4FES A;  4Z3T A;  3AA1 A;  5KAI O;  5GTH O;  4O4U A;  3JTY A;  4CTD A;  3PQU A;  3VZU X;  4D5U A;  3EMN X;  3BRY A;  3T0S A;  2R4P A;  4AUI A;  3C5O A;  3NSG A;  2KC0 A;  8PRN A;  2IWV A;  1OSM A;  2KXP B;  5DL7 A;  4GF4 A;  2OMF A;  2ERV A;  4C4V B;  1GFO A;  2R4L A;  3FYX A;  4FSP A;  1ZHX A;  2YNK A;  4GHB A;  4AKR A;  3VZT X;  4IL6 O;  3PRN A;  1MM5 A;  1GFQ A;  2F1T A;  2GE4 A;  5GV0 A;  2F1C X;  1ZHY A;  3LK4 1;  1OPF A;  5H2F O;  3AA0 B;  2Y0H A;  3SYB A;  2XE2 A;  4GCQ A;  2J4U P;  3WI4 A;  4FRX A;  4AZL A;  1QJP A;  2Y0K A;  5ADX K;  4UB8 O;  2LFU A;  4E1T A;  5B66 O;  4RLC A;  5EE2 A;  2W80 C;  3SZD A;  4U9C A;  4N75 A;  1PHO A;  4RLB A;  5DL8 A;  2F1V A;  3UAQ A;  5B5E O;  5G3A A;  4PR7 A;  3AAE B;  4LSH A;  5D5D A;  2R89 A;  3SY7 A;  3VY9 X;  2POR A;  3AAA B;  4C69 X;  1HXU A;  3UPG A;  3JCU O;  4FZL A;  3KVD D;  1ZHW A;  2W81 C;  1G90 A;  5G38 A;  5AFU K;  2FGQ X;  1ZHZ A;  3PGR A;  5JDP A;  4RL9 A;  3HWB A;  4AYE C;  2X9K A;  6PRN A;  5DL5 A;  3V8U A;  2KZ7 B;  2R88 A;  3VE2 A;  3AA6 B;  3KZI O;  2R4O A;  1BH3 A;  3VE1 A;  4QQ1 A;  4KR4 A;  4FQE A;  1HXT A;  2KXP A;  2XE5 A;  2MHL A;  1BXW A;  4G76 A;  3SYS A;  3DA4 A;  5G39 A;  2KDY A;  4C4V A;  3BS0 A;  4O49 A;  4RJW A;  3BRZ A;  3LK3 B;  3A0B O;  4GCP A;  2ZLD A;  1IZN B;  5DL6 A;  3T20 A;  2XE1 A;  3AA6 A;  4C00 A;  1THQ A;  4LSE A;  4E1S A;  2X27 X;  3DWN A;  3AA0 A;  1MM4 A;  1HXX A;  3PF1 A;  2R4N A;  4FRT A;  3LK2 B;  3LK3 A; 
#chains in the Genus database with same CATH homology
 5ADX L;  4AYM C;  3HOL A;  2JMM A;  2YPV A;  1ORM A;  3AA7 B;  2ODJ A;  2N2L A;  5T5F A;  2O4V A;  4LSF A;  3SZV A;  4AYI D;  3QRC A;  1PRN A;  4XNK A;  4N59 A;  2K0L A;  4AKM A;  7PRN A;  2M07 A;  2N2M A;  4D64 A;  1Q9F A;  3AAE A;  3RBH A;  3AA7 A;  4FOZ A;  3QRA A;  2Y7S A;  3AAA A;  4PUX A;  5IYU A;  2PRN A;  5FVN A;  2ZFG A;  3POU A;  5AFU L;  2Y0L A;  3HW9 A;  4O4X A;  4FUV A;  4KRA A;  2XMX A;  4O3Z A;  3SY9 A;  3TZG A;  4B61 A;  4D5U A;  4AFK A;  2KZ7 A;  1MPF A;  3DA3 A;  4G75 A;  4FSO A;  1GFN A;  2FGR A;  2MNH A;  4JFB A;  3WI5 A;  1BT9 A;  3K19 A;  1QJ8 A;  3POQ A;  2Y2X A;  3T24 A;  5PRN A;  5G26 A;  4AKR B;  4XNL A;  1GFM A;  1H6S 1;  4AYN A;  2XG6 A;  2J1N A;  2XE3 A;  3UU2 A;  1IZN A;  3GP6 A;  3PQS A;  2M06 A;  3HOE A;  4LSI A;  1QJ9 A;  4FZN A;  2QTK A;  2XTR A;  4FMS A;  3A2S X;  3G7G A;  4FT6 A;  4O3Y A;  4AKR A;  1E54 A;  4D65 A;  1Q9G A;  1GFP A;  4GCS A;  3POX A;  4AYD C;  3POR A;  4JCH A;  3LK2 A;  4F4B A;  3AA1 B;  4O3W A;  2LHF A;  3O0E A;  2K4T A;  3VZW X;  4KR8 A;  1P4T A;  4O3X B;  4N58 A;  1ZHT A;  4BUM X;  1YS5 A;  4RJX A;  2XTQ A;  4FZM A;  3LK4 2;  4FES A;  4Z3T A;  3AA1 A;  4O4U A;  3JTY A;  3PQU A;  3VZU X;  3EMN X;  3T0S A;  4AUI A;  3C5O A;  3NSG A;  2KC0 A;  8PRN A;  2KXP B;  1OSM A;  5DL7 A;  4GF4 A;  2OMF A;  2ERV A;  1GFO A;  3FYX A;  4FSP A;  1ZHX A;  2YNK A;  4GHB A;  3VZT X;  3PRN A;  1MM5 A;  1GFQ A;  2F1T A;  2GE4 A;  5GV0 A;  1ZHY A;  3LK4 1;  1OPF A;  3AA0 B;  2Y0H A;  3SYB A;  2XE2 A;  4GCQ A;  2J4U P;  3WI4 A;  4FRX A;  4AZL A;  1QJP A;  2Y0K A;  5ADX K;  2LFU A;  4E1T A;  4RLC A;  5EE2 A;  2W80 C;  3SZD A;  4U9C A;  1PHO A;  4RLB A;  5DL8 A;  2F1V A;  3UAQ A;  3AAE B;  4LSH A;  5D5D A;  3SY7 A;  3VY9 X;  2POR A;  3AAA B;  4C69 X;  1HXU A;  3UPG A;  4FZL A;  3KVD D;  1ZHW A;  2W81 C;  1G90 A;  5AFU K;  2FGQ X;  1ZHZ A;  5JDP A;  4RL9 A;  3HWB A;  4AYE C;  6PRN A;  5DL5 A;  3V8U A;  2KZ7 B;  3VE2 A;  3AA6 B;  1BH3 A;  3VE1 A;  4QQ1 A;  4KR4 A;  3VY8 X;  1HXT A;  2KXP A;  2XE5 A;  2MHL A;  1BXW A;  4G76 A;  3SYS A;  3DA4 A;  2KDY A;  4O49 A;  4RJW A;  3LK3 B;  4GCP A;  2ZLD A;  1IZN B;  5DL6 A;  3T20 A;  2XE1 A;  3AA6 A;  1THQ A;  4LSE A;  4E1S A;  2X27 X;  3AA0 A;  1MM4 A;  1HXX A;  4FRT A;  3LK2 B;  3LK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...