1MM4A

Solution nmr structure of the outer membrane enzyme pagp in dpc micelles
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
170
structure length
170
Chain Sequence
MNADEWMTTFRENIAQTWQQPEHYDLYIPAITWHARFAYDKEKTDRYNERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLADENFHLGLGFTAGVTARDNWNYIPLPVLLPLASVGYGPVTFQMTYIPGTYNNGNVYFAWMRFQFLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure and Dynamics of the Outer Membrane Enzyme PagP by NMR
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords CrcA protein
total genus 19
structure length 170
sequence length 170
ec nomenclature ec 2.3.1.251: Lipid IV(A) palmitoyltransferase.
pdb deposition date 2002-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07017 PagP Antimicrobial peptide resistance and lipid A acylation protein PagP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1mm4A00
1MM5A 2M06A 2M07A 1Q9GA 1QJ8A 2X27X 1MM4A 2LHFA 4RLCA 2K0LA 3G7GA 1P4TA 1BXWA 1QJ9A 4PUXA 2F1TA 2MHLA 2JMMA 2N2MA 3QRAA 2N2LA 2F1VA 2ERVA 2GE4A 3QRCA 1G90A 1QJPA 1THQA 2MNHA 3GP6A 3C5OA 1Q9FA 1ORMA
chains in the Genus database with same CATH superfamily
3KZIO 3T20A 3PQUA 3LK3B 3RBHA 1GFNA 2M07A 2XE1A 4AFKA 2XE3A 1BT9A 1QJ8A 1MM4A 2LHFA 3POUA 4O3XB 3AA7A 4RLCA 3T24A 3HW9A 3AAAA 2OMFA 1ZHXA 3PRNA 1OPFA 3HOLA 4O3WA 1MPFA 3VZWX 4XNKA 3POQA 1S5LO 2F1CX 4RJXA 5E79O 5KAFO 5KAIO 2MHLA 4G75A 4UB6O 4D65A 1PRNA 4AYEC 3HWBA 2ERVA 4FQEA 2R8AA 4RLBA 5T5FA 4GCSA 3AA1A 1QJPA 5H2FO 3A0HO 2Y7SA 2WJQA 3PGUA 2YNKA 4FRTA 4AUIA 2ZLDA 4N75A 4FMSA 5G26A 5ADXK 2MNHA 4GF4A 3WU2O 2XG6A 2Y0KA 1IZNB 3EMNX 2N2MA 1ORMA 2XTQA 1GFOA 1H6S1 1GFPA 1MM5A 1T1LA 1GFMA 2KC0A 2M06A 5TISO 3LK3A 3VE2A 3A2SX 3DA4A 3WI5A 3DWNA 4BUMX 3AA0A 3BRYA 2J4UP 3PF1A 4N58A 4C00A 1HXXA 1PHOA 1ZHTA 3AAEB 4AYMC 5ADXL 2W80C 1P4TA 3HOEA 3FYXA 2ODJA 2IWWA 2KZ7A 3WI4A 3QRAA 4O4XA 4Z3TA 1T16A 4G76A 2GE4A 2R4OA 3DA3A 3BS0A 5GV0A 2W81C 1G90A 1YS5A 5G38A 1GFQA 4RJWA 2KZ7B 3SY7A 2JQYA 2R89A 5B5EO 2R4PA 3T0SA 3GP6A 2WJRA 4FUVA 4D5UA 3JCUO 5GTIO 3SZVA 3C5OA 4PJ0O 2LFUA 3O0EA 4C69X 4KR4A 4K3CA 5IYUA 3KVDD 4KRAA 2N2LA 5EE2A 4AYID 3PQSA 4JCHA 4LSHA 4B61A 5FVNA 5G39A 3DZMA 2PRNA 4FESA 2X27X 2X9KA 1OSMA 3AA0B 3LK2B 5D5DA 4E1SA 5AFUK 3G7GA 2ZFGA 1ZHZA 2XMXA 3SYBA 3AA6A 1BXWA 4FZNA 1QJ9A 4FOZA 4PUXA 3UAQA 4AKRA 2F1TA 2FGRA 2F1VA 2WVPA 4RL9A 3VY9X 6PRNA 3QRCA 4N74A 2J1NA 3JTYA 4FZMA 4LSFA 1THQA 2R88A 4FT6A 4KR8A 4LSEA 1ZHYA 3AA6B 2XE2A 2KXPA 2Y0HA 3BRZA 3K19A 4O49A 4CTDA 4FZLA 7PRNA 4FSPA 4K3BA 3NJTA 3TZGA 3POXA 1HXTA 2YPVA 1Q9FA 5DL6A 3LK2A 4AKMA 4O4UA 4AYDC 4QQ1A 4AYNA 4C4VA 5DL7A 2O4VA 2Y0LA 5B66O 1BH3A 4GCPA 3DWOX 4U9CA 5G3AA 3VY8X 3A0BO 1Q9GA 4F4BA 2IWVA 2PORA 4FSOA 2R4NA 2K0LA 4O3ZA 4LSIA 4GCQA 3SYSA 5DL5A 5JDPA 3SY9A 3V8UA 2R4LA 4C4VB 3UU2A 4PR7A 4UB8O 3AA7B 2JMMA 3AAAB 5DL8A 2QTKA 3PORA 4FRXA 3AAEA 4IL6O 3VZTX 4XNLA 3VE1A 2AXTO 3LK42 3AA1B 4E1TA 3UPGA 4O3YA 1IZNA 3LK41 2XTRA 8PRNA 4JFBA 5PRNA 2KDYA 2K4TA 4AZLA 5GTHO 5AFUL 1ZHWA 4D64A 3PGRA 2Y2XA 1HXUA 2KXPB 2XE5A 3NSGA 3PGSA 3SZDA 3VZUX 4AKRB 4GHBA 1E54A 2FGQX 4N59A
chains in the Genus database with same CATH topology
3T20A 3PQUA 3LK3B 3RBHA 1GFNA 2M07A 2XE1A 4AFKA 2XE3A 1BT9A 1QJ8A 1MM4A 2LHFA 3POUA 4O3XB 3AA7A 4RLCA 3T24A 3HW9A 3AAAA 2OMFA 1ZHXA 3PRNA 1OPFA 3HOLA 4O3WA 1MPFA 3VZWX 4XNKA 3POQA 4RJXA 2MHLA 4G75A 4D65A 1PRNA 4AYEC 3HWBA 2ERVA 4RLBA 5T5FA 4GCSA 3AA1A 1QJPA 2Y7SA 2YNKA 4FRTA 4AUIA 2ZLDA 4FMSA 5G26A 5ADXK 2MNHA 4GF4A 2XG6A 2Y0KA 1IZNB 3EMNX 2N2MA 1ORMA 2XTQA 1GFOA 1H6S1 1GFPA 1MM5A 2KC0A 1GFMA 2M06A 3LK3A 3VE2A 3A2SX 3DA4A 3WI5A 4BUMX 2J4UP 3AA0A 4N58A 5ADXL 1HXXA 1PHOA 1ZHTA 3AAEB 4AYMC 2W80C 1P4TA 3HOEA 3FYXA 2ODJA 2KZ7A 3WI4A 3QRAA 4O4XA 4Z3TA 4G76A 2GE4A 3DA3A 5GV0A 2W81C 1G90A 1YS5A 1GFQA 4RJWA 2KZ7B 3SY7A 3T0SA 3GP6A 4FUVA 4D5UA 3SZVA 3C5OA 2LFUA 3O0EA 4C69X 4KR4A 5IYUA 3KVDD 4KRAA 2N2LA 5EE2A 4AYID 3PQSA 4JCHA 4LSHA 4B61A 5FVNA 2PRNA 4FESA 2X27X 1OSMA 3AA0B 3LK2B 5D5DA 4E1SA 5AFUK 3G7GA 2ZFGA 1ZHZA 2XMXA 3SYBA 3AA6A 1BXWA 4FZNA 1QJ9A 4FOZA 4PUXA 3UAQA 4AKRA 2F1TA 2FGRA 2F1VA 4RL9A 3VY9X 6PRNA 3QRCA 2J1NA 3JTYA 4FZMA 4LSFA 1THQA 4FT6A 4KR8A 4LSEA 1ZHYA 3AA6B 2XE2A 2KXPA 2Y0HA 3K19A 7PRNA 4O49A 4FZLA 4FSPA 3TZGA 3POXA 1HXTA 2YPVA 1Q9FA 5DL6A 3LK2A 4AKMA 4O4UA 4AYDC 4QQ1A 4AYNA 5DL7A 2O4VA 2Y0LA 1BH3A 4GCPA 3VY8X 4U9CA 4F4BA 1Q9GA 2PORA 4FSOA 4O3ZA 2K0LA 3SYSA 4LSIA 4GCQA 5JDPA 5DL5A 3SY9A 3V8UA 3UU2A 3AA7B 2JMMA 3AAAB 5DL8A 2QTKA 3PORA 4FRXA 3AAEA 3VZTX 4XNLA 3VE1A 3LK42 3AA1B 4E1TA 3UPGA 4O3YA 1IZNA 3LK41 2XTRA 8PRNA 4JFBA 5PRNA 2KDYA 2K4TA 4AZLA 5AFUL 1ZHWA 4D64A 2Y2XA 1HXUA 2KXPB 2XE5A 3NSGA 3SZDA 3VZUX 4AKRB 4GHBA 1E54A 2FGQX 4N59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MM5 A;  2M06 A;  2M07 A;  1Q9G A;  1QJ8 A;  2X27 X;  1MM4 A;  2LHF A;  4RLC A;  2K0L A;  3G7G A;  1P4T A;  1BXW A;  1QJ9 A;  4PUX A;  2F1T A;  2MHL A;  2JMM A;  2N2M A;  3QRA A;  2N2L A;  2F1V A;  2ERV A;  2GE4 A;  3QRC A;  1G90 A;  1QJP A;  1THQ A;  2MNH A;  3GP6 A;  3C5O A;  1Q9F A;  1ORM A; 
#chains in the Genus database with same CATH topology
 3KZI O;  3T20 A;  3PQU A;  3LK3 B;  3RBH A;  1GFN A;  2M07 A;  2XE1 A;  4AFK A;  2XE3 A;  1BT9 A;  1QJ8 A;  1MM4 A;  2LHF A;  3POU A;  4O3X B;  3AA7 A;  4RLC A;  3T24 A;  3HW9 A;  3AAA A;  2OMF A;  1ZHX A;  3PRN A;  1OPF A;  3HOL A;  4O3W A;  1MPF A;  3VZW X;  4XNK A;  3POQ A;  1S5L O;  2F1C X;  4RJX A;  5E79 O;  5KAF O;  5KAI O;  2MHL A;  4G75 A;  4UB6 O;  4D65 A;  1PRN A;  4AYE C;  3HWB A;  2ERV A;  4FQE A;  2R8A A;  4RLB A;  5T5F A;  4GCS A;  3AA1 A;  1QJP A;  5H2F O;  3A0H O;  2Y7S A;  2WJQ A;  3PGU A;  2YNK A;  4FRT A;  4AUI A;  2ZLD A;  4N75 A;  4FMS A;  5G26 A;  5ADX K;  2MNH A;  4GF4 A;  3WU2 O;  2XG6 A;  2Y0K A;  1IZN B;  3EMN X;  2N2M A;  1ORM A;  2XTQ A;  1GFO A;  1H6S 1;  1GFP A;  1MM5 A;  1T1L A;  1GFM A;  2KC0 A;  2M06 A;  5TIS O;  3LK3 A;  3VE2 A;  3A2S X;  3DA4 A;  3WI5 A;  3DWN A;  4BUM X;  3AA0 A;  3BRY A;  2J4U P;  3PF1 A;  4N58 A;  4C00 A;  1HXX A;  1PHO A;  1ZHT A;  3AAE B;  4AYM C;  5ADX L;  2W80 C;  1P4T A;  3HOE A;  3FYX A;  2ODJ A;  2IWW A;  2KZ7 A;  3WI4 A;  3QRA A;  4O4X A;  4Z3T A;  1T16 A;  4G76 A;  2GE4 A;  2R4O A;  3DA3 A;  3BS0 A;  5GV0 A;  2W81 C;  1G90 A;  1YS5 A;  5G38 A;  1GFQ A;  4RJW A;  2KZ7 B;  3SY7 A;  2JQY A;  2R89 A;  5B5E O;  2R4P A;  3T0S A;  3GP6 A;  2WJR A;  4FUV A;  4D5U A;  3JCU O;  5GTI O;  3SZV A;  3C5O A;  4PJ0 O;  2LFU A;  3O0E A;  4C69 X;  4KR4 A;  4K3C A;  5IYU A;  3KVD D;  4KRA A;  2N2L A;  5EE2 A;  4AYI D;  3PQS A;  4JCH A;  4LSH A;  4B61 A;  5FVN A;  5G39 A;  3DZM A;  2PRN A;  4FES A;  2X27 X;  2X9K A;  1OSM A;  3AA0 B;  3LK2 B;  5D5D A;  4E1S A;  5AFU K;  3G7G A;  2ZFG A;  1ZHZ A;  2XMX A;  3SYB A;  3AA6 A;  1BXW A;  4FZN A;  1QJ9 A;  4FOZ A;  4PUX A;  3UAQ A;  4AKR A;  2F1T A;  2FGR A;  2F1V A;  2WVP A;  4RL9 A;  3VY9 X;  6PRN A;  3QRC A;  4N74 A;  2J1N A;  3JTY A;  4FZM A;  4LSF A;  1THQ A;  2R88 A;  4FT6 A;  4KR8 A;  4LSE A;  1ZHY A;  3AA6 B;  2XE2 A;  2KXP A;  2Y0H A;  3BRZ A;  3K19 A;  4O49 A;  4CTD A;  4FZL A;  7PRN A;  4FSP A;  4K3B A;  3NJT A;  3TZG A;  3POX A;  1HXT A;  2YPV A;  1Q9F A;  5DL6 A;  3LK2 A;  4AKM A;  4O4U A;  4AYD C;  4QQ1 A;  4AYN A;  4C4V A;  5DL7 A;  2O4V A;  2Y0L A;  5B66 O;  1BH3 A;  4GCP A;  3DWO X;  4U9C A;  5G3A A;  3VY8 X;  3A0B O;  1Q9G A;  4F4B A;  2IWV A;  2POR A;  4FSO A;  2R4N A;  2K0L A;  4O3Z A;  4LSI A;  4GCQ A;  3SYS A;  5DL5 A;  5JDP A;  3SY9 A;  3V8U A;  2R4L A;  4C4V B;  3UU2 A;  4PR7 A;  4UB8 O;  3AA7 B;  2JMM A;  3AAA B;  5DL8 A;  2QTK A;  3POR A;  4FRX A;  3AAE A;  4IL6 O;  3VZT X;  4XNL A;  3VE1 A;  2AXT O;  3LK4 2;  3AA1 B;  4E1T A;  3UPG A;  4O3Y A;  1IZN A;  3LK4 1;  2XTR A;  8PRN A;  4JFB A;  5PRN A;  2KDY A;  2K4T A;  4AZL A;  5GTH O;  5AFU L;  1ZHW A;  4D64 A;  3PGR A;  2Y2X A;  1HXU A;  2KXP B;  2XE5 A;  3NSG A;  3PGS A;  3SZD A;  3VZU X;  4AKR B;  4GHB A;  1E54 A;  2FGQ X;  4N59 A; 
#chains in the Genus database with same CATH homology
 3T20 A;  3PQU A;  3LK3 B;  3RBH A;  1GFN A;  2M07 A;  2XE1 A;  4AFK A;  2XE3 A;  1BT9 A;  1QJ8 A;  1MM4 A;  2LHF A;  3POU A;  4O3X B;  3AA7 A;  4RLC A;  3T24 A;  3HW9 A;  3AAA A;  2OMF A;  1ZHX A;  3PRN A;  1OPF A;  3HOL A;  4O3W A;  1MPF A;  3VZW X;  4XNK A;  3POQ A;  4RJX A;  2MHL A;  4G75 A;  4D65 A;  1PRN A;  4AYE C;  3HWB A;  2ERV A;  4RLB A;  5T5F A;  4GCS A;  3AA1 A;  1QJP A;  2Y7S A;  2YNK A;  4FRT A;  4AUI A;  2ZLD A;  4FMS A;  5G26 A;  5ADX K;  2MNH A;  4GF4 A;  2XG6 A;  2Y0K A;  1IZN B;  3EMN X;  2N2M A;  1ORM A;  2XTQ A;  1GFO A;  1H6S 1;  1GFP A;  1MM5 A;  2KC0 A;  1GFM A;  2M06 A;  3LK3 A;  3VE2 A;  3A2S X;  3DA4 A;  3WI5 A;  4BUM X;  2J4U P;  3AA0 A;  4N58 A;  5ADX L;  1HXX A;  1PHO A;  1ZHT A;  3AAE B;  4AYM C;  2W80 C;  1P4T A;  3HOE A;  3FYX A;  2ODJ A;  2KZ7 A;  3WI4 A;  3QRA A;  4O4X A;  4Z3T A;  4G76 A;  2GE4 A;  3DA3 A;  5GV0 A;  2W81 C;  1G90 A;  1YS5 A;  1GFQ A;  4RJW A;  2KZ7 B;  3SY7 A;  3T0S A;  3GP6 A;  4FUV A;  4D5U A;  3SZV A;  3C5O A;  2LFU A;  3O0E A;  4C69 X;  4KR4 A;  5IYU A;  3KVD D;  4KRA A;  2N2L A;  5EE2 A;  4AYI D;  3PQS A;  4JCH A;  4LSH A;  4B61 A;  5FVN A;  2PRN A;  4FES A;  2X27 X;  1OSM A;  3AA0 B;  3LK2 B;  5D5D A;  4E1S A;  5AFU K;  3G7G A;  2ZFG A;  1ZHZ A;  2XMX A;  3SYB A;  3AA6 A;  1BXW A;  4FZN A;  1QJ9 A;  4FOZ A;  4PUX A;  3UAQ A;  4AKR A;  2F1T A;  2FGR A;  2F1V A;  4RL9 A;  3VY9 X;  6PRN A;  3QRC A;  2J1N A;  3JTY A;  4FZM A;  4LSF A;  1THQ A;  4FT6 A;  4KR8 A;  4LSE A;  1ZHY A;  3AA6 B;  2XE2 A;  2KXP A;  2Y0H A;  3K19 A;  7PRN A;  4O49 A;  4FZL A;  4FSP A;  3TZG A;  3POX A;  1HXT A;  2YPV A;  1Q9F A;  5DL6 A;  3LK2 A;  4AKM A;  4O4U A;  4AYD C;  4QQ1 A;  4AYN A;  5DL7 A;  2O4V A;  2Y0L A;  1BH3 A;  4GCP A;  3VY8 X;  4U9C A;  4F4B A;  1Q9G A;  2POR A;  4FSO A;  4O3Z A;  2K0L A;  3SYS A;  4LSI A;  4GCQ A;  5JDP A;  5DL5 A;  3SY9 A;  3V8U A;  3UU2 A;  3AA7 B;  2JMM A;  3AAA B;  5DL8 A;  2QTK A;  3POR A;  4FRX A;  3AAE A;  3VZT X;  4XNL A;  3VE1 A;  3LK4 2;  3AA1 B;  4E1T A;  3UPG A;  4O3Y A;  1IZN A;  3LK4 1;  2XTR A;  8PRN A;  4JFB A;  5PRN A;  2KDY A;  2K4T A;  4AZL A;  5AFU L;  1ZHW A;  4D64 A;  2Y2X A;  1HXU A;  2KXP B;  2XE5 A;  3NSG A;  3SZD A;  3VZU X;  4AKR B;  4GHB A;  1E54 A;  2FGQ X;  4N59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...