1MM4A

Solution nmr structure of the outer membrane enzyme pagp in dpc micelles
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
170
structure length
170
Chain Sequence
MNADEWMTTFRENIAQTWQQPEHYDLYIPAITWHARFAYDKEKTDRYNERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLADENFHLGLGFTAGVTARDNWNYIPLPVLLPLASVGYGPVTFQMTYIPGTYNNGNVYFAWMRFQFLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CrcA protein
publication title Solution Structure and Dynamics of the Outer Membrane Enzyme PagP by NMR
pubmed doi rcsb
source organism Escherichia coli
total genus 19
structure length 170
sequence length 170
ec nomenclature ec 2.3.1.251: Lipid IV(A) palmitoyltransferase.
pdb deposition date 2002-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07017 PagP Antimicrobial peptide resistance and lipid A acylation protein PagP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1mm4A00
2M07A 2GE4A 3G7GA 3GP6A 4PUXA 1QJ8A 2JMMA 2ERVA 1P4TA 2N2MA 1BXWA 1QJPA 2F1TA 3QRCA 1THQA 3QRAA 1Q9FA 2MHLA 2N2LA 1MM4A 1ORMA 2F1VA 2K0LA 3C5OA 1MM5A 2MNHA 1G90A 1QJ9A 2X27X 4RLCA 2LHFA 1Q9GA 2M06A
chains in the Genus database with same CATH superfamily
1GFPA 2XTQA 2LFUA 3WI4A 2GE4A 2Y0HA 4O4XA 3SYBA 3T24A 4D64A 2QTKA 3POXA 4AYMC 4PUXA 4N75A 3UPGA 2K4TA 2KDYA 1P4TA 2YNKA 4IL6O 4O49A 4O3ZA 4B61A 4O3WA 1MPFA 4N59A 3K19A 3PRNA 1QJPA 4UB6O 1YS5A 2XE3A 2R4LA 2O4VA 3AAAA 4Z3TA 1Q9FA 2KXPA 4AYEC 1T16A 5ADXL 5T5FA 1OPFA 8PRNA 3AA1B 2K0LA 3SYSA 3UU2A 2XMXA 5IYUA 5E79O 5DL5A 2MNHA 3VY8X 4O4UA 2XTRA 3LK42 4KR8A 3A2SX 4F4BA 1BH3A 2Y0KA 1H6S1 2LHFA 4FRTA 1Q9GA 2IWVA 4FZLA 2F1CX 3A0BO 5DL8A 1PRNA 2XE2A 5DL6A 5EE2A 3BRYA 2FGRA 5KAIO 1GFNA 2ZLDA 3AA1A 3VY9X 3AAAB 2J1NA 3PQUA 2KXPB 2KZ7B 7PRNA 1ZHYA 4CTDA 3HW9A 1QJ8A 5G38A 4AKRB 2J4UP 2JMMA 3NSGA 3PGUA 4FT6A 3TZGA 3LK41 4XNKA 4RLBA 3VZWX 4C00A 4JCHA 5G3AA 3HOLA 3JCUO 4AFKA 2WJRA 3QRAA 4GCPA 2R8AA 2MHLA 2N2LA 4QQ1A 3VE1A 5G26A 2KZ7A 4G75A 4AYNA 1ORMA 3A0HO 3LK2B 4FMSA 2F1VA 1PHOA 1IZNB 3POUA 4K3CA 2OMFA 2XE1A 3C5OA 4N58A 4AKRA 5GTHO 3POQA 5JDPA 5G39A 3DWOX 3PGRA 4GCQA 5GTIO 1GFMA 4RJWA 3HOEA 2PORA 4GHBA 2M06A 2W81C 3KZIO 4GF4A 3V8UA 2JQYA 3SZDA 4E1SA 4AZLA 1T1LA 3LK2A 3AA7A 3LK3A 3G7GA 3SZVA 4AYID 1IZNA 3O0EA 5AFUK 1GFQA 2ODJA 3GP6A 4KRAA 5B66O 2KC0A 2XE5A 3AAEA 3SY9A 6PRNA 2ERVA 4FZMA 4FSPA 5D5DA 2XG6A 3PF1A 3KVDD 2N2MA 1E54A 3DA3A 4GCSA 4D65A 2R4NA 4LSIA 2F1TA 2R4PA 3JTYA 1THQA 3QRCA 4D5UA 4LSFA 5ADXK 3T20A 1HXTA 2WJQA 1MM4A 5B5EO 4PJ0O 4AKMA 4FRXA 1ZHWA 3AA7B 2R4OA 3LK3B 3PGSA 2AXTO 4FUVA 4RL9A 5GV0A 3PQSA 1GFOA 1MM5A 5DL7A 4XNLA 5FVNA 2PRNA 3AAEB 3EMNX 4N74A 4U9CA 2Y0LA 4UB8O 3UAQA 1HXXA 2X27X 4BUMX 5KAFO 1G90A 5H2FO 4E1TA 4C4VA 4LSEA 2R89A 3VZTX 4RJXA 4PR7A 2M07A 2Y7SA 3WU2O 1ZHXA 3AA0B 2W80C 3AA6B 4FSOA 3PORA 5AFUL 1BT9A 4G76A 4FESA 4FQEA 4AYDC 1BXWA 2YPVA 2IWWA 4LSHA 2ZFGA 3DZMA 5PRNA 2R88A 1OSMA 2Y2XA 3HWBA 3WI5A 3T0SA 1ZHTA 2WVPA 3FYXA 4AUIA 4C4VB 3AA0A 5TISO 3RBHA 3VE2A 3AA6A 4O3XB 1HXUA 3BRZA 4KR4A 3NJTA 3DA4A 4FOZA 4K3BA 3DWNA 3BS0A 1QJ9A 4FZNA 4RLCA 4O3YA 3SY7A 4C69X 2FGQX 2X9KA 1ZHZA 4JFBA 3VZUX 1S5LO
chains in the Genus database with same CATH topology
1GFPA 2XTQA 2LFUA 3WI4A 2GE4A 2Y0HA 4O4XA 3SYBA 3T24A 4D64A 2QTKA 3POXA 4AYMC 4PUXA 3UPGA 2K4TA 2KDYA 1P4TA 2YNKA 4B61A 4O49A 4O3ZA 4O3WA 1MPFA 4N59A 3K19A 3PRNA 1QJPA 1YS5A 2XE3A 2O4VA 3AAAA 5ADXL 1Q9FA 2KXPA 4AYEC 5T5FA 1OPFA 8PRNA 3AA1B 2K0LA 3SYSA 3UU2A 2XMXA 5IYUA 5DL5A 2MNHA 3VY8X 4O4UA 2XTRA 3LK42 4KR8A 3A2SX 1BH3A 2Y0KA 1H6S1 2LHFA 4FRTA 1Q9GA 4FZLA 5EE2A 5DL8A 1PRNA 2XE2A 5DL6A 2FGRA 1GFNA 2ZLDA 3AA1A 3VY9X 3AAAB 2J1NA 3PQUA 2KXPB 2KZ7B 7PRNA 1ZHYA 3HW9A 1QJ8A 2J4UP 4AKRB 2JMMA 3NSGA 4FT6A 3TZGA 3LK41 4XNKA 4RLBA 3VZWX 4JCHA 4AFKA 3HOLA 3QRAA 4GCPA 2MHLA 2N2LA 4QQ1A 3VE1A 5G26A 2KZ7A 4G75A 4AYNA 1ORMA 3LK2B 4FMSA 5AFUK 2F1VA 1PHOA 1IZNB 3POUA 4N58A 2OMFA 2XE1A 3C5OA 4AKRA 5JDPA 3POQA 4GCQA 1GFMA 4RJWA 3HOEA 2PORA 4GHBA 2M06A 2W81C 3V8UA 4GF4A 4E1SA 3SZDA 4F4BA 4AZLA 3LK2A 3AA7A 3LK3A 3G7GA 3SZVA 4AYID 1IZNA 3O0EA 1GFQA 2ODJA 3GP6A 4KRAA 2KC0A 2XE5A 3AAEA 3SY9A 6PRNA 2ERVA 4FZMA 4FSPA 5D5DA 2XG6A 3KVDD 2N2MA 1E54A 3DA3A 4GCSA 4D65A 4LSIA 2F1TA 3JTYA 1THQA 3QRCA 4D5UA 4LSFA 5ADXK 3T20A 1HXTA 1MM4A 4AKMA 4FRXA 1ZHWA 3AA7B 3LK3B 5GV0A 4RL9A 4FUVA 3PQSA 1GFOA 1MM5A 5DL7A 4XNLA 5FVNA 2PRNA 3AAEB 3EMNX 3UAQA 4U9CA 2Y0LA 4Z3TA 4BUMX 1HXXA 2X27X 1G90A 4E1TA 4LSEA 3VZTX 4RJXA 2M07A 2Y7SA 1ZHXA 3AA0B 2W80C 3AA6B 4FSOA 3PORA 5AFUL 1BT9A 4G76A 4FESA 4AYDC 1BXWA 2YPVA 4LSHA 2ZFGA 5PRNA 2Y2XA 1OSMA 3HWBA 3WI5A 3T0SA 1ZHTA 4AUIA 3FYXA 3AA0A 3RBHA 3VE2A 3AA6A 4O3XB 1HXUA 4KR4A 3DA4A 4FOZA 1QJ9A 4FZNA 4RLCA 4O3YA 3SY7A 4C69X 2FGQX 1ZHZA 4JFBA 3VZUX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M07 A;  2GE4 A;  3G7G A;  3GP6 A;  4PUX A;  1QJ8 A;  2JMM A;  2ERV A;  1P4T A;  2N2M A;  1BXW A;  1QJP A;  2F1T A;  3QRC A;  1THQ A;  3QRA A;  1Q9F A;  2MHL A;  2N2L A;  1MM4 A;  1ORM A;  2F1V A;  2K0L A;  3C5O A;  1MM5 A;  2MNH A;  1G90 A;  1QJ9 A;  2X27 X;  4RLC A;  2LHF A;  1Q9G A;  2M06 A; 
#chains in the Genus database with same CATH topology
 1GFP A;  2XTQ A;  2LFU A;  3WI4 A;  2GE4 A;  2Y0H A;  4O4X A;  3SYB A;  3T24 A;  4D64 A;  2QTK A;  3POX A;  4AYM C;  4PUX A;  4N75 A;  3UPG A;  2K4T A;  2KDY A;  1P4T A;  2YNK A;  4IL6 O;  4O49 A;  4O3Z A;  4B61 A;  4O3W A;  1MPF A;  4N59 A;  3K19 A;  3PRN A;  1QJP A;  4UB6 O;  1YS5 A;  2XE3 A;  2R4L A;  2O4V A;  3AAA A;  4Z3T A;  1Q9F A;  2KXP A;  4AYE C;  1T16 A;  5ADX L;  5T5F A;  1OPF A;  8PRN A;  3AA1 B;  2K0L A;  3SYS A;  3UU2 A;  2XMX A;  5IYU A;  5E79 O;  5DL5 A;  2MNH A;  3VY8 X;  4O4U A;  2XTR A;  3LK4 2;  4KR8 A;  3A2S X;  4F4B A;  1BH3 A;  2Y0K A;  1H6S 1;  2LHF A;  4FRT A;  1Q9G A;  2IWV A;  4FZL A;  2F1C X;  3A0B O;  5DL8 A;  1PRN A;  2XE2 A;  5DL6 A;  5EE2 A;  3BRY A;  2FGR A;  5KAI O;  1GFN A;  2ZLD A;  3AA1 A;  3VY9 X;  3AAA B;  2J1N A;  3PQU A;  2KXP B;  2KZ7 B;  7PRN A;  1ZHY A;  4CTD A;  3HW9 A;  1QJ8 A;  5G38 A;  4AKR B;  2J4U P;  2JMM A;  3NSG A;  3PGU A;  4FT6 A;  3TZG A;  3LK4 1;  4XNK A;  4RLB A;  3VZW X;  4C00 A;  4JCH A;  5G3A A;  3HOL A;  3JCU O;  4AFK A;  2WJR A;  3QRA A;  4GCP A;  2R8A A;  2MHL A;  2N2L A;  4QQ1 A;  3VE1 A;  5G26 A;  2KZ7 A;  4G75 A;  4AYN A;  1ORM A;  3A0H O;  3LK2 B;  4FMS A;  2F1V A;  1PHO A;  1IZN B;  3POU A;  4K3C A;  2OMF A;  2XE1 A;  3C5O A;  4N58 A;  4AKR A;  5GTH O;  3POQ A;  5JDP A;  5G39 A;  3DWO X;  3PGR A;  4GCQ A;  5GTI O;  1GFM A;  4RJW A;  3HOE A;  2POR A;  4GHB A;  2M06 A;  2W81 C;  3KZI O;  4GF4 A;  3V8U A;  2JQY A;  3SZD A;  4E1S A;  4AZL A;  1T1L A;  3LK2 A;  3AA7 A;  3LK3 A;  3G7G A;  3SZV A;  4AYI D;  1IZN A;  3O0E A;  5AFU K;  1GFQ A;  2ODJ A;  3GP6 A;  4KRA A;  5B66 O;  2KC0 A;  2XE5 A;  3AAE A;  3SY9 A;  6PRN A;  2ERV A;  4FZM A;  4FSP A;  5D5D A;  2XG6 A;  3PF1 A;  3KVD D;  2N2M A;  1E54 A;  3DA3 A;  4GCS A;  4D65 A;  2R4N A;  4LSI A;  2F1T A;  2R4P A;  3JTY A;  1THQ A;  3QRC A;  4D5U A;  4LSF A;  5ADX K;  3T20 A;  1HXT A;  2WJQ A;  1MM4 A;  5B5E O;  4PJ0 O;  4AKM A;  4FRX A;  1ZHW A;  3AA7 B;  2R4O A;  3LK3 B;  3PGS A;  2AXT O;  4FUV A;  4RL9 A;  5GV0 A;  3PQS A;  1GFO A;  1MM5 A;  5DL7 A;  4XNL A;  5FVN A;  2PRN A;  3AAE B;  3EMN X;  4N74 A;  4U9C A;  2Y0L A;  4UB8 O;  3UAQ A;  1HXX A;  2X27 X;  4BUM X;  5KAF O;  1G90 A;  5H2F O;  4E1T A;  4C4V A;  4LSE A;  2R89 A;  3VZT X;  4RJX A;  4PR7 A;  2M07 A;  2Y7S A;  3WU2 O;  1ZHX A;  3AA0 B;  2W80 C;  3AA6 B;  4FSO A;  3POR A;  5AFU L;  1BT9 A;  4G76 A;  4FES A;  4FQE A;  4AYD C;  1BXW A;  2YPV A;  2IWW A;  4LSH A;  2ZFG A;  3DZM A;  5PRN A;  2R88 A;  1OSM A;  2Y2X A;  3HWB A;  3WI5 A;  3T0S A;  1ZHT A;  2WVP A;  3FYX A;  4AUI A;  4C4V B;  3AA0 A;  5TIS O;  3RBH A;  3VE2 A;  3AA6 A;  4O3X B;  1HXU A;  3BRZ A;  4KR4 A;  3NJT A;  3DA4 A;  4FOZ A;  4K3B A;  3DWN A;  3BS0 A;  1QJ9 A;  4FZN A;  4RLC A;  4O3Y A;  3SY7 A;  4C69 X;  2FGQ X;  2X9K A;  1ZHZ A;  4JFB A;  3VZU X;  1S5L O; 
#chains in the Genus database with same CATH homology
 1GFP A;  2XTQ A;  2LFU A;  3WI4 A;  2GE4 A;  2Y0H A;  4O4X A;  3SYB A;  3T24 A;  4D64 A;  2QTK A;  3POX A;  4AYM C;  4PUX A;  3UPG A;  2K4T A;  2KDY A;  1P4T A;  2YNK A;  4B61 A;  4O49 A;  4O3Z A;  4O3W A;  1MPF A;  4N59 A;  3K19 A;  3PRN A;  1QJP A;  1YS5 A;  2XE3 A;  2O4V A;  3AAA A;  5ADX L;  1Q9F A;  2KXP A;  4AYE C;  5T5F A;  1OPF A;  8PRN A;  3AA1 B;  2K0L A;  3SYS A;  3UU2 A;  2XMX A;  5IYU A;  5DL5 A;  2MNH A;  3VY8 X;  4O4U A;  2XTR A;  3LK4 2;  4KR8 A;  3A2S X;  1BH3 A;  2Y0K A;  1H6S 1;  2LHF A;  4FRT A;  1Q9G A;  4FZL A;  5EE2 A;  5DL8 A;  1PRN A;  2XE2 A;  5DL6 A;  2FGR A;  1GFN A;  2ZLD A;  3AA1 A;  3VY9 X;  3AAA B;  2J1N A;  3PQU A;  2KXP B;  2KZ7 B;  7PRN A;  1ZHY A;  3HW9 A;  1QJ8 A;  2J4U P;  4AKR B;  2JMM A;  3NSG A;  4FT6 A;  3TZG A;  3LK4 1;  4XNK A;  4RLB A;  3VZW X;  4JCH A;  4AFK A;  3HOL A;  3QRA A;  4GCP A;  2MHL A;  2N2L A;  4QQ1 A;  3VE1 A;  5G26 A;  2KZ7 A;  4G75 A;  4AYN A;  1ORM A;  3LK2 B;  4FMS A;  5AFU K;  2F1V A;  1PHO A;  1IZN B;  3POU A;  4N58 A;  2OMF A;  2XE1 A;  3C5O A;  4AKR A;  5JDP A;  3POQ A;  4GCQ A;  1GFM A;  4RJW A;  3HOE A;  2POR A;  4GHB A;  2M06 A;  2W81 C;  3V8U A;  4GF4 A;  4E1S A;  3SZD A;  4F4B A;  4AZL A;  3LK2 A;  3AA7 A;  3LK3 A;  3G7G A;  3SZV A;  4AYI D;  1IZN A;  3O0E A;  1GFQ A;  2ODJ A;  3GP6 A;  4KRA A;  2KC0 A;  2XE5 A;  3AAE A;  3SY9 A;  6PRN A;  2ERV A;  4FZM A;  4FSP A;  5D5D A;  2XG6 A;  3KVD D;  2N2M A;  1E54 A;  3DA3 A;  4GCS A;  4D65 A;  4LSI A;  2F1T A;  3JTY A;  1THQ A;  3QRC A;  4D5U A;  4LSF A;  5ADX K;  3T20 A;  1HXT A;  1MM4 A;  4AKM A;  4FRX A;  1ZHW A;  3AA7 B;  3LK3 B;  5GV0 A;  4RL9 A;  4FUV A;  3PQS A;  1GFO A;  1MM5 A;  5DL7 A;  4XNL A;  5FVN A;  2PRN A;  3AAE B;  3EMN X;  3UAQ A;  4U9C A;  2Y0L A;  4Z3T A;  4BUM X;  1HXX A;  2X27 X;  1G90 A;  4E1T A;  4LSE A;  3VZT X;  4RJX A;  2M07 A;  2Y7S A;  1ZHX A;  3AA0 B;  2W80 C;  3AA6 B;  4FSO A;  3POR A;  5AFU L;  1BT9 A;  4G76 A;  4FES A;  4AYD C;  1BXW A;  2YPV A;  4LSH A;  2ZFG A;  5PRN A;  2Y2X A;  1OSM A;  3HWB A;  3WI5 A;  3T0S A;  1ZHT A;  4AUI A;  3FYX A;  3AA0 A;  3RBH A;  3VE2 A;  3AA6 A;  4O3X B;  1HXU A;  4KR4 A;  3DA4 A;  4FOZ A;  1QJ9 A;  4FZN A;  4RLC A;  4O3Y A;  3SY7 A;  4C69 X;  2FGQ X;  1ZHZ A;  4JFB A;  3VZU X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...