4AYMC

Structure of a complex between ccps 6 and 7 of human complement factor h and neisseria meningitidis fhbp variant 3 p106a mutant
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
239
structure length
234
Chain Sequence
ALTAPLDHKDKGLKSLTLEDSIAQNGTLTLSAQGAEKTFKASLNTGKLKNDKISRFDFVQKIEVDGQTITLASGEFQIYKQNHSAVVALQIEKINNPDKTDSLINQRSFLVSGLGGEHTAFNQLPGGKAEYHGKAFSSDDPNGRLHYSIDFTKKQGYGRIEHLKTLEQNVELAAAELKADEKSHAVILGDTRYGSEEKGTYHLALFGDRAQEIAGSATVKIGEKVHEIGIAGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords COMPLEMENT FACTOR H
publication title Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 234
sequence length 239
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4aymC02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4aymC01
3KVDD 3HOEA 4U9CA 2YPVA 3HOLA 4O3ZA 4AYDC 4AYNA 4AYEC 4O49A 4Z3TA 5EE2A 1YS5A 4O3WA 3UAQA 3V8UA 2LFUA 5T5FA 4AYID 2KDYA 2Y7SA 2W81C 4O3XB 4QQ1A 3VE1A 4AYMC 2KC0A 3PQUA 3PQSA 4O3YA 3VE2A 4O4XA 4O4UA 2W80C
chains in the Genus database with same CATH superfamily
4MX7A 3T3PE 4AJWA 5I8CB 2YFNA 1NLBL 4RMVA 2PWFA 5KSAD 1YEGH 4JMXA 1I85C 2JQZA 3E9TA 4DCQA 3MBWA 1QWHA 1PJWA 1I75A 3BIKB 3WCYA 3MV7D 4MQ7B 5E8NB 4XCYA 5IFHH 3FHQA 1R3KB 4Y88A 5BMFH 2LW3A 4NUQA 4OU3A 1HHKA 1RMFL 2X3BA 4FQCH 3DO4A 1R3LB 2AK1H 3SE6A 5MHSD 2CGRL 3TL5A 5HHPA 1IM9B 1LK2A 3ZL4H 1MY7A 1O7DC 4LVHC 4A6YL 4U1KB 4Q56A 5ADPL 3BRZA 1NGYB 2JTDA 4LSIA 3OLGA 4U6TA 3MYJA 2FLBT 5TE7L 3UTSB 2Y36L 3E8VA 5HYJA 1TZHB 4Z7WF 3IJEA 4HPOL 2BIHA 2EEBA 3N0AA 1S46A 2C8NA 4UM9B 3STZB 35C8L 2AI0L 2VLKD 5FR3A 4LPYA 3HVDA 1HSBB 2W9LA 2VDPH 3IRZA 1EGJA 1CICB 1BG9A 1LO2H 4YPJA 3AAEA 1H3XA 1OP5K 4BUGA 2XVGA 4UT9H 2EH7L 4OAWA 5JR1L 4HIIA 4LVNC 3SQOL 1PFOA 2CO1A 3CZFA 1HEZB 2D0HA 1ANUA 3VRLF 3QC5X 5HGHB 1PNDA 2OSXA 3SPGA 4G76A 4YDLC 2NUTA 1TQTA 4QHKJ 3E8UH 4KVPA 2QHRH 1EAPA 4YBQC 4OGQC 2AJXH 3RLSA 2OTUB 4QRFA 2GI7A 5IFJA 3OG6B 4OBRA 2XN9B 3OJMB 2OYMA 3QFJA 4HV8B 2GK0A 4JRFA 3Q2NA 4NZJA 1IGTB 3WFBL 5GHWH 1VGKB 1XCTB 4HX1B 4NQTA 4G82A 3GINA 1BGXH 1KIPB 3EFOA 3AG1B 3S3DB 1QASA 3ZDYE 3WAJA 3QUZB 2LAAA 4OT1H 5KVEL 2WLLA 1GMEA 4NWUH 5KAQG 4Z0BL 5ID1B 5KBKA 5EEWA 4AIOA 4OF5A 3TWYA 2OMYB 3UPCA 1UWEL 2LQRA 3HE6B 3MHZA 1ED3B 2SEBA 4HWNA 2CBOA 1A3RL 5EU4A 2VCOA 2VMCA 2PABA 4PS3A 4F7KA 5FDWB 1CU4L 1SF5A 4AGMA 2OMBA 3KPRD 1AQMA 2IADB 4N2OA 1BSIA 4PRIA 2BM3A 3F65A 1S9YB 1WDAA 1KIQB 5FA3A 4ZW5A 5KVGL 2QADD 3M88A 3C08L 1KJ3H 3BDYH 4LKXA 3VXNB 1MUJA 3BKJL 4OIAA 5AKTA 5F3HB 5T33H 4DW2H 1FF5A 3SKUD 1HQRA 2X4SB 2H1PL 1KEML 4EN3A 3IU3B 1A6UL 4ZDHA 3T6XA 4L8CB 1FP5A 1ADQA 5C7ZA 2QV4A 5IGXH 3F7LA 3VJ6A 4XPHH 4WEBH 3K6SA 2FJFB 1HXYB 3ZT5A 2C3VA 3L7EA 5DRWB 5HPMA 1SOXA 3KJ6H 1EJFA 3QG7L 4BA8A 4A2DA 4N2LA 3SDAA 1H9DA 2D2OA 4Z77A 2E4TA 1N0XH 5CCGE 2KPWA 1NBZA 1F42A 2XNAA 4P2OD 1IT9L 1GW6A 4O4YL 4K94H 4KZDH 1C16A 1GCYA 4LPUA 4F80A 1HJBC 2R4RH 4Q6IB 3NZHL 4IBSA 3BHBB 2GEEA 4MLIA 4XVJL 4MXWL 3WIIL 3QXDB 5ICXB 4G3YL 4Z7UE 3RI5K 1IFHL 4KXCA 5D4HA 3V5KB 2FO4B 5LO7A 3AQDA 5T5FH 1TQCC 2X9KA 2DQUH 4M00A 3D87B 3QQ9C 5F7MC 1KCRH 3LKPB 3ZE0F 1DLHB 1GA2A 1AKJD 3V5DB 2WKLA 5FYJE 4N3UA 3ILPA 3HZ3A 3KPMA 3B8SA 5J11B 4ONFH 4OUOA 4M6OH 2ZKMX 2ZZUT 3K1DA 4F9LA 2W94A 5JW4M 1V55B 4DWHA 4O9HL 3KM2A 2VR6A 4I1NB 4N86A 1DJHA 1XH3B 2P45B 4B6ZA 3QPKA 1Y0LA 3NFNA 2MHAA 4KK6C 2PXYC 1FO0L 2DLEA 1KXVA 2WBJC 3QWOA 5K9KB 1KCLA 4LQFL 1QWNA 4XMPH 2WWOA 5LCVA 1IKOP 3HZYA 4XP6L 2CDGB 3TBVA 2XZCL 1DFBL 1LO3H 4RA0C 5C0CB 4LSVL 4UUJB 3NN8A 1MCCA 5T1DH 5JXAH 3T3MF 2CGRH 1O9VA 3HN8A 5HHMB 1D7DA 1IBGL 1YEIL 3Q2VA 5I6OA 5IZ7A 3UTZA 2FQFA 1SDYA 2VLRD 3K7UA 5DUBA 1IC4H 4MNHA 3FO1A 1MLCA 4UV4H 3TP4A 4JFXB 35C8H 3F85A 1SMAA 4F7EA 3MOQA 5DUPH 2JJSC 3OAYH 5IUCA 2CNYA 3LH9A 3HS0C 1R47A 1WE5A 2ZSVA 2MWCA 3C5JA 3WGUB 3FQTA 1M1SA 3CSGA 2JJWA 3COOA 3QK0A 4U3SA 3CSTA 5BVJB 2WN2A 5CWSA 4BFGA 1GFMA 3FTGA 1IAOA 3PGCB 1DBAL 2D73A 2ODJA 4X4KA 1TKWB 3VB9A 2DZEA 1A7OH 2VH5H 3RURA 3N1MC 3O0EA 1J5IA 1QBMH 3CTTA 3LXBA 2ATPB 1FL6B 1MFBL 4DP6X 2IPKA 2JKWA 3QUMA 2BSTB 4B9KC 1NGZB 3WYRA 4Q9CA 3ARXA 4KZEH 4PJ8A 1D5BB 5CJQH 4P4KC 3LS4L 2XQYA 5ANHA 2I9TA 2WQRA 5MEQA 3P30L 2XTJD 4CA4A 1TF4A 2IH1A 1TETH 1NTDA 4R83A 3ROLA 5EDSA 2R0LL 4UOZA 5C70A 4I2XB 4R0LA 1CLZH 4HBQA 1Q0XL 3EJUA 5AW9B 3EGXA 2V9RA 5IKCB 3ETTA 3KPSB 4DAGL 2FSDA 4XMLH 2FL5A 1XD0A 5D7EA 3QUXC 5GGTL 4DVRL 1OE3A 3FSOA 3N55A 5L8LB 5DZPA 1MJJB 2MOGA 1CZ8L 4FL4B 3WO4B 3CFBB 1KELL 4P5TC 5C0AE 1IC5H 3IKCB 4G59C 2KZWA 4PI0A 1RY7B 1TTAA 4WHTA 2E9WA 4QWWD 5CN3A 3SO3C 1WFUA 4U1IA 1CYWA 4XWOD 2RALA 5J7CC 8PAZA 1R5WA 3X11B 2YUXA 4NBZB 3N44F 3DVGB 4DGYH 3RNKB 1KF9B 1CQYA 1QG3A 2I7SA 3EGDA 4U6VH 2AV7B 3V0JA 4FA6A 3PL6D 1D5ZB 1FYTA 2ICEA 1JPEA 4X42A 4KUCD 1RHFA 5IHZB 4NI6A 4XNMA 4L8SB 1AGDA 5E95B 1ONQA 4MS8C 3RWIA 3QH3B 1MAKA 1P84J 3MRNA 4LGPB 3M07A 4HUNB 3L3HA 4I9WE 1MJUL 3QG7H 4HJJH 5D1QD 4NT6A 4X8CA 3QRBA 2BSCA 1N8ZB 2WZ0A 3HC3L 3WSQL 4LAJH 3EIFA 3F04A 4LDEB 3SJVB 1NCJA 5JDSB 1OT2A 5TQ2H 1AYOA 3VWKC 4F7TA 4PSRA 4A66A 1JHTB 1HL4A 1KZYA 1U42A 3GSNB 2A9AA 2OM5A 3TM6A 1IFHH 3BSGA 3KGUA 5GJTL 5LG1A 2BSSB 1SXNA 1XGTA 1IILE 1BX2B 5GGVL 1SJHA 2HB0A 1G1KA 3LEXA 3B9KD 3MRFA 1G5AA 1PG7H 3MV8E 1T2JA 2CK0H 1R0AH 4N5UA 1OARL 4KO6A 3BPOC 3LN4B 3ULSB 4YSSA 3RTQA 4B61A 1ZA3B 3FU9A 4U7MA 5EO1B 4FX5A 5DMYA 4HCRA 1NMAL 3V5HA 2XG5A 3WXWH 1NH6A 5HDRA 3O6FD 1HIMH 1VFAB 3SYAA 2I25N 2PUQT 1SLUA 3DARA 1PKQA 2EIZB 5AVQB 1N18A 4JFBA 3FFCA 4W81A 3NRQA 3RPIB 1RZKH 1TSHA 5INDB 1BQHA 3GWJA 5KN5A 4BK5A 4CMHB 3QUYB 3JYBA 1U0QA 3QI9C 1FL5B 4IHOA 5D1ZA 5DI8A 5LGHH 4D0CB 3ZKMC 4W9JC 4JM0A 1I9RL 4FZEL 3ABKB 5EZPA 4G9FB 1Q0YH 3SKJH 1SHSA 4W9DC 5I71C 1CBJA 4AYFA 3DIVA 2ILLA 4D9RE 3MBEB 3NCBB 4LSEA 2J4UP 4ADGA 1SJMA 2QGCA 4E9XA 1BIHA 3TEXA 4BFKA 5ADOH 5HGBA 1BM3L 3FU6A 3MZGB 3OF6D 5EEZA 3MX0B 3CVBA 5TF0A 5I8OH 2RH0A 5ANME 4ZMZA 4KKCC 4XNZC 4NC1E 1K6QL 5IP4A 1MQKH 4FQQB 2ZXQA 2C5DC 4LLDA 1TUPA 4ZTPL 1RIVL 4BUMX 2Y1ZA 1P1VA 4P49A 4F2FA 2G3ZA 4N26A 1LDSA 3NUKA 4HCIA 4BZ2L 1E4XH 2J12B 2EDTA 4PG9A 4Y2DD 3FB7A 3DVFA 4GXVL 5JMRA 5IYUA 5ISZB 1U8LB 4FF9A 4GAYA 5AVSB 3Q5YA 3GBNH 4PWHA 3POXA 1UOLA 3GQFA 2ZAHA 9PCYA 4OM0L 4CVXB 2LLGA 4KXBA 1HNFA 2MNUA 4QHNA 5LCVH 5KANG 1N67A 2V5MA 4XP9H 3T0XA 3DTXA 3TIEA 2VISB 2X09A 1EMTL 2Y7LA 2W38A 5DJ8A 3P30H 4OKVA 1V7NH 5GS1C 4QRSA 1IGFH 2OL3L 2PR9A 3H42H 4AIZB 2R0LH 4PJAE 2GY5A 3CFQA 2FJUB 4E9YA 5LDUA 1MCWW 2WP3O 3O2WL 3WIHA 1Q0XH 3MUHL 5IOPB 2DQEL 3O8XD 1MHCB 3K72B 2NX5E 1G9MC 3FYIB 3KGRA 3EYFB 3PDDA 4YS4A 1DQML 1JGLH 2EQDA 1CZ8H 3K8KA 2YS4A 4MJJA 4FG6D 2C3WA 5F88B 1KELH 4G8GD 4MTMA 1J5OH 4ELMB 1EO5A 2YOAA 2VR7A 3ARDC 3MRJB 5AOMA 5JO5B 2VDQH 2W88A 3NACH 1Q38A 2CDFA 3NESA 4PP1D 4TTGA 1G7MA 5EOCJ 3VI3F 2EJ1A 1EUTA 3IETA 1X6NA 4JDVA 4PTTA 3ZDZF 4F33A 2HT3C 3QUMH 5JPNC 3OKLA 2EXWC 3VFVA 3ZLQC 4W9IC 1E9QA 3DA0A 1NGPL 3WNNA 3U30C 2NY7H 1J0YA 2J88L 4KK8C 3NEOA 1B9ZA 3CVCA 4B3VA 5IHHA 4XPAL 1RUAL 3B2UD 3R0MA 3GYRA 1DL7L 4FQ1L 1A14H 4KR8A 4NP4L 3BVTA 3RWDA 5CZRA 3EHBB 3BIKA 3NCYS 1KFGA 4MQ7A 3AROA 2CO7B 3RWJB 1TYEB 5E8NA 1EZVX 4LSPH 1R3KA 2BOCA 3L54A 3EOBA 5L4FA 2FGWH 3HR6A 2FT7A 3T4AB 1R3LA 1NZRA 3L3OC 5C7XL 1SHXA 1M1XB 3C5ZB 2CBPA 3CIAA 4K5MA 1IM9A 4R7VA 3B7SA 4IRJB 1WAPA 3WIAA 1ZLDA 5CKAA 4U1KA 5ILTL 3S36H 3ZHNA 4JHZA 3UTSA 2JB6B 3FCTB 2VXVL 1TZHA 4OM1L 1QBLH 3M17A 1LYQA 3V4VA 5JW5B 2GT9B 1HWWA 2O61A 5FO9A 3K46A 3STZA 2I07A 5BNXD 5IM7B 1JI2A 1W6WA 1LVEA 1HSBA 3VQLA 3V6ZA 1JSYA 2BH0A 1CICA 5LDSA 1Y7VA 3PUUA 3ZTNH 5HDWA 2XWCA 1MRFH 3N5AA 1HEZA 3NCJL 5CIPB 3DI2B 3LN9A 3W37A 5HGHA 3BAIA 1QYGL 2E6QA 1THQA 1UKSA 5DMGD 1OVZA 5F9WC 4BKLB 2DMKA 4FZEH 1Q72H 1COBA 4FCHA 2GK2A 3L3GA 4ZO8A 5IB5B 4UZGA 1N12A 1T1WA 3KDPB 5IHUH 2XN9A 3WDIA 1IC7H 4OJFL 3SE3C 3K8MA 4LHQB 4YEEA 2I9LA 4OIIH 4L1TA 3QO1A 3U4BL 4CSTA 2ATAA 1BM3H 5C0DA 3LMJH 1WITA 2ZUVA 5C0BA 1VFBB 4WU7B 1XCTA 5CJOL 4HX1A 2KI6A 5GSVB 4HETA 4R7XA 3RG1C 4DFHA 4NRYB 4MHHI 3QUZA 1IZNB 4GT7A 2ATKA 2XKNB 4HCRH 5ID1A 1CL7L 3MNVB 3K2UL 2GC7C 3BJ91 3MRLB 2R4NA 4KHXH 4PWJA 3TEWA 4U1NA 1NGQH 4FDWA 4HMEA 5KAQF 4HXAH 3DMMA 1AE6H 2DEYX 4U1JA 4OSUH 4LMQI 1LE5B 2X4TB 3B9DA 4M5ZH 5E6ID 3WNPA 1FNFA 4KKBC 2WKGA 4N0YL 1KIQA 4OVUA 4NQDD 2EDLA 4ODSL 1YMMD 4L9LB 5EULV 3K6FA 1FH2A 3CV5A 3NG5A 5JW3L 5F3HA 3ABZA 5C8JB 5D6CA 4YXHH 2R2EB 2X4SA 1JPFA 2WXOA 3IU3A 1DJIA 3QPXL 4OCWH 5TH2B 3VD2A 2ZXCA 1OQXA 3B3BA 3NQKA 3QG6A 1M9SA 3N1QC 3QISA 3QAQA 2FJFA 5A16B 1EWHA 3F00A 5A6LA 3DK0A 5DRWA 1JZEA 1T6VN 1JFHA 3VFNB 1JE6A 4HWUA 1D5IL 2ZF9A 1R6VA 5AZEL 4JFSA 3DJZA 4G8EA 1HDMA 4PWFA 5KAFO 2VXTH 4GBXD 4Q6IA 2VDRL 3WFZA 3P0GB 1ODAA 3O3AB 1F3DH 3MV8A 2ADFH 2HFFB 4YXLL 5IROD 3QXDA 3V5KA 4EBQH 1S7VB 1JHLL 4OCYL 2GQHA 5GGVY 4BWTA 4J2QA 3A4DA 4XNYL 2CAKA 1T4WA 3LB6C 4KKLC 5FAAA 4UAOC 3TASA 1TYRA 1M2VB 3V5DA 1K9TA 3C8HA 3L4XA 4QNPE 3LVTA 3T0DA 3GRBA 5TPWL 4PW3A 2NR6C 1AZNA 1NIEA 3TA3A 4TULL 3EYQD 1XH3A 1AJ7L 3CDYA 1F4XH 3OGOE 1TJHL 3CK0L 1T1ZB 1SFDA 1NEZB 1G7HB 4RISH 3WIHH 2FBRA 4OTXL 4K5PA 4YBLB 3WTWA 3U1SL 2K7PA 5DEFB 3R8BB 2PW2B 4WHYG 4E41E 1CPUA 2APXA 1QI4A 3ZN6A 4WLCA 5E2WL 2CDGA 3ECQA 5C0AD 3WLBB 2Z9TA 2Y6SD 5DRZB 4N0CD 1AD9B 1TQBB 3RI5F 1NIFA 4BE6A 4FI6A 4UUJA 1O7VA 1ZS8B 3FQRA 4B0MB 1J1OH 3OKMB 2F54B 3C6EA 4I13B 1T03L 4K8RC 4G6AC 3JTTB 3L1OL 3RGVD 3DDFA 3TBWA 4WI0A 3VX0A 3IKKA 4JJ5B 4PV9A 3VAEA 1JZ2A 5ANMA 1WQVT 1VACB 5FYJH 3LJ3A 2IPUK 2IGFL 4ZOEA 1KDIA 1FIGH 5KSAB 3NGBC 1JGEB 4AUYA 2D03L 1JGVH 1XTLA 1MHHA 3ET9F 4QO1B 2YLKA 1RVFH 3MV7B 3LRLA 3T1WA 2X1PA 2CJTA 3A4AA 2VJXA 3L9EA 3A4EA 4XX1G 4MMZB 4OZGE 3DJ9A 3OKDB 1U21A 3PGCA 3ROOB 2DBLL 1M2OA 1LTXA 1NWPA 4YDJB 2AJZA 3VX1A 5IW1A 1FL6A 3AB0C 3VSVA 4YLCA 4MRCA 4TYUA 4Y4HD 4L8BA 3N9GH 2FECL 1OTTD 1YNTF 1NGZA 1OSZA 1YNKH 3FB5B 2YLHA 5HHVH 1PYWB 2Q8AH 3JWDH 1VPOL 4RIRB 1XF4B 4PGZA 2VLKB 2A2QT 1MFAL 2FWUA 2JE8A 2OMNA 2QQKH 5IQMA 2EAEA 4JFZH 4AEHL 4X5QA 4U1GC 1PIFA 4ZUWB 4CSPA 3HS9A 4ZMWA 2I32A 5B1BB 3U0WH 2VL5B 1TG8A 2NX5A 4C47A 3MLWL 5TGBB 2GTZB 3DETD 4A55A 1T0MA 2IGLA 4DEWA 2PN5A 3RFRA 4G72B 4KDWA 2GJ6B 7FABL 3V4VH 4P57A 3LDBC 1TZOA 2ZX7A 5EMYA 1KMGA 3KPSA 1GTNA 3LHAA 2XX1A 3D48R 4HFUH 5EO0B 4KRLB 2VKXA 4NPYB 2HUEA 4PY7B 5J89A 5JXED 1E43A 2WTPA 4WEMB 2UWEE 4OCRH 4A6YB 5FFGA 3MRHB 1OZUA 2EDNA 2XA3A 2AMUA 4ZTOH 4LIQH 4WDIB 1AMXA 1EBAA 1SJEB 1HXMB 4NLAA 1W0YT 4Z7IA 2Z3FA 3DVGA 3L3DB 2XYCA 4EQ2A 2G2RB 2YIHA 2AV7A 1D5ZA 2O5YH 5E8OB 4Q9QL 3I50L 4HIHB 5A2AA 2ZXWB 4LSRH 1SQ2N 4JR9L 1E3XA 1RIUL 2OX5B 1HYSC 5DQDH 2COVD 1J0ZA 5JIKA 3RKDC 2EXTA 4ODWA 4XZUA 2C7FA 4XP1H 3RZCA 1J9TA 2DIJA 4NHUB 5D6DA 4ONGH 3QCUH 3JQOB 4HHAB 4LFHG 1N8ZA 2KLRA 5ICYA 5JZ7D 3KPRB 5TK2A 1SHMA 4NUGH 2CHXA 2QADB 2XCMC 1JHTA 3GSNA 3CVIL 2YO3A 4KV5E 4L3EE 3T1FA 4B3EA 1NL0L 1OAKL 2ZKHL 2BSSA 3MKKA 5EUOB 4EOWH 4N68A 4XB3A 3RX5A 5A2FA 3HOGA 5HDBB 4HKZB 1J8KA 1F86A 5IV2B 3MAWA 3V0WH 3OAZH 3LN4A 3ULSA 1HHJA 4HS3B 5EO1A 4M48H 2ZXDA 4OGAD 4NRXB 3WE6B 4JZJB 1FGVL 3RGHA 3U46A 2CJ3A 2NPLX 3NA4A 4RFOL 3WGVB 3QORA 1Z9PA 5CSGA 3VH8G 1S7UA 1P4TA 1NANI 1VFAA 4LBAA 4RGMB 2XG4B 5GRJL 1INEL 2DN7A 2EIZA 3RILA 5K59F 3R0NA 5ICUA 3RPIA 3RVVD 2WWMD 4CU7A 5INDA 2NXZC 3ZHKA 1I7UB 3QUYA 2WO3B 1DHKA 1I8MB 3V4PL 4FN0A 1FL5A 5EEVA 2OSYA 4QHMB 1IEAA 3VD3A 1LWHA 4FOZA 4D0CA 3UYRL 1UCBH 2PTTB 4FKEA 4O02L 3HN3A 3ARVA 3ECVA 3AREB 1PW3A 5C0JA 3S5LG 2YXVA 3SGEH 1MIMH 1BAFL 3P0VH 3MLXH 4LSHA 2OMTB 1WWBX 4OB5L 4OZHE 3D4CA 4KROC 3MBEA 3ZU8A 2P26A 4ZXBB 4IIZA 4LHJB 3SE8H 3G08B 2BIQA 3MX0A 1DBKH 3GLDA 4I88A 4GIAA 1IV8A 1U8QB 1BJMA 1JWMB 4UT6A 4YDKL 3ARBC 2QZQA 3QB7C 5I1DA 1S7QB 2GY7B 2BP5M 1ZTXE 5DHVB 1RU9H 3L8QA 4JPWL 4LBEB 4NQXA 2J43A 4YIQB 2BCKA 2H32B 4DPRA 1U8NB 1MCWM 4MA1C 4GMTH 1ZRUA 4ENED 1CE1L 2WUCH 2AGJL 3O3EA 1YY9D 4QR7A 5ISZA 1U8LA 1J7VR 3TVMC 4DP0X 8FABB 2VLRB 4KXZI 1E3ZA 3REVB 5JDJA 4CVXA 4PW4A 2V17L 5D2NE 5FOJA 2ODHA 4CRPA 1E6JL 1Q1JL 1MH5B 2GUOB 3FU0A 2VISA 3UACA 3TF7C 1BZ9B 4FD0A 2O6DA 2BWDA 2IF7A 4V1DE 5AZ2L 5I0VA 4HHWA 1FO0B 3KMDA 1U8IB 3EXLA 3MLWH 4FNLH 3SGJA 3RVUC 4JJOA 3D39E 1YEJH 3F7YA 3W2DL 5IOPA 2PTUA 3MLSH 3K6DA 1MHCA 3J8F7 1ZT1B 4YX2H 1NMCB 4D94A 1F5WA 4FABL 4P46B 2QSCL 2R8SH 2WTRB 3P3RA 1LLAA 3V6OA 1C12B 4YNYB 5F88A 2J8UE 2BSRA 5F72S 3P3YA 4JCHA 4MJIE 3MRJA 5AVVB 5IEHA 5CF3A 4K3DH 3TC9A 3NSJA 2QPEB 4WWKC 3IVKA 3H8NA 4M6NH 4Y5VB 2XTJB 4J3OG 1MCPH 2A73A 2EVGA 1FNHA 4XBEH 2XV0A 5FYKU 1SYSB 4UDUB 1P7HL 1MVYA 3QDGB 4R4FH 2ZCKH 4LCWE 4AIEA 2R4PA 1L9RA 2VRAA 2A3TA 5A2KH 1PSKL 2Q9OA 4JFDB 2YARA 3HS8A 3QW9A 1H8NA 1JWUB 1CF8L 1MNUL 4PRHD 3VO0A 3WI9A 2R23A 3GF8A 1Q8MA 5BO0D 5I0WA 2CQVA 1IAIM 3CZEA 2ZJSH 3DX7B 3LAFA 4E41A 3VXME 5I19H 5I9QC 2D3LA 1BD2E 5HY9A 2Q5BA 4Z7WE 4HP5A 4DP9X 2YRBA 3GSQB 3UOAB 2CO7A 5HDLA 2B1AH 4MD0B 3KR3H 2IWGA 1GSKA 4KVNL 4X6CF 5A3IC 4HPYL 3LS5L 1NPNA 4PJIF 4AYGA 2DJ4A 2QEJA 4N2AA 3RZWA 1FFOB 5FUOH 1W72L 2YKKA 1M1XA 3C5ZA 2XY1A 1JF6A 3GSWB 2Y7NA 4IRJA 4H4NA 3VRLE 4A63A 1ODUA 4IJTA 4WW1A 2JB6A 5K39A 1P2CB 2WJQA 2WBKA 3BLKA 1EHAA 3L95B 5SV3A 2GT9A 3ZTJH 3CHOA 2JFCA 3ECWA 4R8WH 3ARZA 4Y2NA 3W0WE 1F90L 3HHMA 1CVRA 1RULL 2IC2A 3A6BL 3MJ9A 1BPVA 2QHLA 2D4FA 4BQBA 1MHEB 2WW8A 3HG1E 2QDVA 1RZFL 4N2KA 5IBLC 3QZWG 4O3XB 2X9XA 1D5XB 1H5BA 5CIPA 3KGSA 4OZ4A 5JQHC 1VDGA 5EEYA 3HUJB 3B9KB 4XMUA 2B1HH 2Z8VC 5ENWA 4BKLA 4NKDA 3FC8A 4PIBA 2OJZL 4PHXA 1JHKL 1RSYA 1OEZW 1P9MA 5A7BA 1UVQA 5GRXG 5IB5A 3GSNH 3S37X 4YZWA 1J8SA 1YNLL 4OB5H 4MAZA 5EA0H 4IOFD 4GG6A 3NJXA 2IAMC 4B5ZA 1VFBA 5GSVA 1BBJB 4OCXH 4H88L 4K94C 4PR5B 4DKFL 2BXYA 1Y18B 3FTWA 5BZZA 4P05A 2ZNXA 3HB3D 3AA6B 3I75A 5IB3A 4ZOAA 3AM8C 5HJBA 4J5VA 3DBSA 2RD0A 3MRLA 4OCSL 4M7LT 1T20A 4E1TA 1FN4B 2DEXX 1A6WL 3I74A 3ZQWA 1CGXA 4R7NB 3EYVA 2W0FB 1E27B 4KI5F 3FW6A 1QUNA 2K3HA 1BF2A 1TQUA 2H6OA 1ZXKA 1J10A 1QVOB 1FFPB 1IGCH 2V33A 4WNSA 3TPUA 4WHCA 1D6VL 1QO3B 3EYUH 4P23B 3P4OB 4MNGE 2AJYL 3BFWA 5DA0B 5E8EB 5C8JA 3J2PA 2A6KA 2AJUL 3PNRB 4A7GF 2K9FB 2ESVD 2PCFA 3GTVA 5F7NC 2YEVB 5TH2A 3PDOB 4KKNA 1ILUA 1J9QA 4R26L 4Y9BA 3ARGB 5C9JA 3O3BB 4AE0A 4K3EL 4UINL 1PY9A 2DQ6A 4AENA 5DT1L 4Y2DB 3J7HA 1VCAA 3GK8H 1VADB 2UUDH 4M3JA 5I0DA 5CP7A 4JFYA 3L08A 1VKXB 3ZE0E 4UNUA 2MCPH 2X44D 4FQPA 4HLZH 4UT6H 5B38B 1AXTL 2EEAA 1FDLL 4Z3FA 2UXGA 3I9AA 1AZCA 3QXUA 2JQMA 4PB9L 5DUML 3WKNA 3DIDA 4ECNA 4JPIB 2R2HB 3BCDA 4E9VA 4Z6AT 1MDAA 3O3AA 4EUPH 2HFFA 4H8WH 1P0SE 4LLMA 1KLUB 3CFKB 1S7VA 5AB0A 5F0PB 4QYAA 4NJAL 5CBAA 4L4TE 3T6WA 4M62H 4UMSA 5CMAA 1FAIL 1HS6A 2ZCHL 5B1AB 3LOWA 2AANA 5KBLA 3DX2A 5FHAL 3K8LA 3S5YA 4U1SA 3JV0A 3T3ME 4G8GB 1CC3A 2QELA 1AXIB 3G04A 1NEZA 1BA9A 5BXFB 1NCDL 1TDQA 2OPCA 3VWJA 1KXQE 4AVIA 5DEFA 2YKLL 1DQQB 1JPTL 1XVSA 3D25B 3AA0A 4Q0XH 4W70A 3LS5H 3WLBA 3TO4A 1TVBB 3O4OB 1Q0EA 3UFIA 5GZND 1FPTH 1ZS8A 2D0GA 4LCYB 4N6RA 3IJ9A 3OKMA 2F54A 3W57A 1JXJA 5DFTA 4JG0L 1YLBB 3C87A 1M57B 3JTTA 4ZAKD 4XODA 3SE9L 1NC2D 1WBYA 3PQUA 1NCWH 1VACA 3GS0A 1A25A 1ETZB 1NGWB 2B0SH 2KDGA 4P2OC 4CC0A 3VXUE 1AOHA 2XE2A 1NKGA 1RULH 2G2PA 4G70B 1JGEA 2VLLA 2X2UA 2Q0ZX 3H54A 3HE7D 4RGOL 3S3SA 4QO1A 3ZVVA 2WINA 2GEQA 4AGQA 2Y23A 3QDMD 5B7EA 4GOSA 2EEDA 2W59A 3JVGA 5D7IB 2X6VA 2UZYB 3CJJA 4MMZA 2HTLC 3OKDA 4CTDA 1FNSL 1H6S1 2F08A 1LP9F 4H0IA 1BWWA 4YDIL 1SY6L 3BKMH 4YDJA 1ZGLM 4YZFF 3WO3B 2CLZA 1OB1B 4Y1TA 1MF2H 1OPGL 4HALA 3VFMB 4L3ED 5C3LD 2BY2A 4V1DA 3C9NA 3FB5A 1PYWA 4OFPA 2EILB 3NFSL 4BKTC 4FP8H 2YGQA 3K5RA 2ADGA 4ZW8A 4RIRA 3KCPB 1QW9A 2EC9T 4HJ0D 5ESQB 1CFBA 4HBCL 5DD6B 4Y1AE 1DZBA 2ZPKH 3GGWA 4ZUWA 4BM7A 1W16A 1PZUB 2VDMB 2VL5A 4PJBF 3IM1A 1G0YR 5TGBA 2GTZA 2MOQA 3RB5A 1UADC 3RJQB 3TJPA 3ZYZA 3APNA 3B8YA 3I9GH 2LFEA 2GJ6A 5C08A 4N1CA 3FB8B 4LPVA 3MCYA 4F8PA 2AEWA 4O3YA 3NIGF 2XWBB 5IG7B 4MJIA 2VC2H 3WNLA 1O7SA 2DKSA 5EO0A 1SMDA 3MJ9H 3PREA 4Z7UB 4NPYA 3SPVB 5GS0L 2EH8H 1DO5A 2Q76B 1U8HB 1YEHL 3WKMH 5CIPH 3MRHA 2ZUWA 4PVLA 4WDIA 1SJEA 4MNQE 3QQDA 4FQIH 4HZLB 4EN3C 2OR9H 3O9WC 5DU7A 3SDDD 2VLJE 4AG4H 2O4EA 1GJWA 2G2RA 3JWOH 1RZKC 4XI5D 5E8OA 1AQ8A 1EXHA 3LKQB 4G7YL 3TZGA 1YYCA 4M6AA 2EE0A 4MBRA 1ZA6A 3MOAL 2QQNL 2OX5A 4K55A 4PJEF 3S8GB 4EIZC 1NPJA 1ZPUA 2OAAA 3DJTA 3OHMB 4NIYE 4MAUL 2WSPA 4D3CL 4L4VD 4FYRA 4P4KD 3V9EA 4DGIL 4NHUA 1PDKB 3HFML 1PEZA 3QJHB 4GO9A 4IMKA 4LHUG 5T3ZH 4MZ3A 2Z7ZA 2VWEC 4RSYA 2P44B 3CFJA 3ORJA 2AHIA 3PHOB 5E6IB 5GS0D 4PB9H 1U8KA 2Y22A 2R4OA 3HVNA 2V5RA 4NQDB 1FZJB 1G6RA 1YMMB 2F1EA 5AD0A 3EJZD 2Y1VA 3FJTA 3NRPA 3S2CA 4RLDA 4Z7VF 2X6AA 5IBTH 2WYHA 2RAMA 3CX5K 5EUOA 4GI6A 3BAEL 2Q3AA 5D70H 3PIQB 4N8UA 4NJAH 4C4KT 4HKZA 4PBXA 1AKPA 5IV2A 4F9LC 3MRDB 3BFQG 4N22A 3SGDH 1C5BL 5AAMA 4HFWB 2CM5A 3G5WA 1DVTA 2DLFL 5DFAA 3DUUA 4NRXA 2DQIL 5DD3L 3ESUF 2XV3A 4PJGF 1KXVC 1MI5B 4P4RB 3W56A 2O61B 3D39D 2OKMA 2TAAA 3BD5A 5KS9F 4ZUVB 1EEZB 2FSEB 4P9HL 5BPPA 2HLAB 3UG4A 4FTVE 5ALCL 3GXTA 5JHDE 3RL1B 2HT4C 4GBXB 4X5PA 3PGDA 1VGEH 4J3UA 4DT2A 1ACCA 1I7UA 1JPTH 4C56E 3PL6C 4C8XA 1FH5L 1QSFA 1QEWB 4WI4A 1I8MA 5J1TC 2CJUL 2Q2EB 4JFEE 4JFFE 4NQQA 3BKCL 1T2QL 2J8OA 3QJRB 4QHMA 3S4SA 3D8MA 4FXKB 4AZLA 2PTTA 3PDGA 1N5YH 3K2IA 1XZWA 3AREA 5DF0A 1ID2A 2Q2LA 4P2RB 3BS0A 4PB0H 4WCYL 4KMTL 5FGCB 3RAJL 4JHUA 5E2TL 3SYQA 2OMTA 4N2BA 1S8DB 5KYYB 2B59A 4ZXBA 1RZIB 3BRGC 2J73A 3G08A 5IMOB 4QXTB 2BRRH 1U8QA 2F7RA 3VACA 1A6AB 4GKLA 5I15L 3MBXL 1N6QL 1S7QA 1KTDB 2FJGB 5DHVA 2RCSH 5C0AB 2VDRB 3VXMD 5F7UA 1L9TA 4OI7A 4X80H 4XT1C 4JFWA 1Q9WB 1H3VA 3P9LA 5F7DA 4XOBA 1BD2D 1KJ2L 1ZMYA 5BQ7A 2DL2A 2FBJH 2I26N 1F4WH 2ZSWB 3H9HA 1OAJA 4PJ8C 4EE2A 2A0LD 3RGVB 2OR8A 4KDTA 2WQWA 4CMMB 3REVA 4MNGA 3UJJH 3B56A 1E4KA 1SEQH 2GUOA 1MH5A 3QEQE 1KC5L 1SOQA 4JN2A 3ATAA 2ENQA 4Y4FB 4BQ6A 4DN4H 1BZ9A 3QDJE 3OR7B 3LZQA 4R0LC 3EAKA 1S9VA 4N2MA 5JORB 1U8IA 5DTFB 3CHXA 3UIYA 4POYA 1N70A 2FYYA 4H20L 5DVKA 2JF1A 3W0WD 1QP1A 1DN0A 3QAZB 4TXVB 5KJRL 5CS7A 3VI3E 1AR1D 1ZTXH 2BSEA 5E4EB 3ZDZE 3M1OA 3A5VA 2IDSA 1A7BA 3D08A 3HG1D 3KPNA 3MLRH 2AV1B 2EUWA 4P46A 4M1DH 2WTRA 2Y2YA 1GIGH 2HTKD 3R7QA 5GS0H 1C12A 4ZX5A 2J1YA 4G9DB 3ZL1A 1BQUA 4ALAH 1DQKA 4HMDA 2X4QB 3P4NA 3PORA 4JPSA 5BZDB 3MA9H 1YVLA 2ICEC 4RX4A 3BGAA 3I9IA 4L4TA 2BVYA 1LEKB 7PAZA 4ODTL 2CRMA 4OFQA 1CR9L 2LTQB 4UDUA 1F13A 1IBHA 3QDGA 2AF2A 3VGEA 2NW3B 4XOEA 4HXBL 4N8VA 3WEOA 1SFHA 3UG5A 5H35A 4W9FC 1BBDL 5LLIC 3LNEA 2KERA 4JFDA 5ACMA 4NSKB 3K71A 2NY3C 5AENA 2F1TA 1OAXL 2ICWI 3QVAA 5GRVK 1FVEA 1G7JB 3NQIA 4IDJH 5SWQB 3DX7A 2LT9A 3BE1H 2L7EA 4NKOB 3OAYK 4MQXC 2VKWA 4MGXA 4C69X 4AQ1C 3VDBA 3IK2A 1RLBA 2ZP9A 2YRPA 2OJEA 3QS2A 4DOHE 4L05A 2X70B 5L2KE 1ZOXA 4URTB 2ZOTA 5E56A 2IWWA 3O8XC 3RTQC 1FFOA 2BLFA 3LEVH 4BSWB 2AK4D 3FFDB 4XOCA 3GSWA 1B88A 3PAUA 4N2CA 2FH8A 5HGAB 3TWCH 2IWVA 1X5HA 2I5YH 3ZR5A 1CDBA 4O4UA 1J1XH 2M83A 3VDAA 3ZMNA 1P2CA 3D18A 1G90A 4N2FA 3TEYA 3RX8A 3L95A 3FQYA 4H40A 3OKOB 1HK6A 1KLFB 3QPQD 4HHGA 4B60A 3KZ8A 2F15A 1AGBB 2V7NB 1KZQA 1GAFL 3NH7H 3VM7A 2AKRB 3UAJA 2G9KA 4TUOB 5C07D 2NY0B 2G5BA 3TTSA 1EIBA 1BZOA 4KXAA 1XL6A 1MHEA 5D1ZC 3KGTA 2WNWA 4JDZA 1ZWIA 4UTBL 5CINH 1JRHH 2DKUA 1OALA 2OR7A 4M7LH 2RR3A 5SV4A 2CJUH 1P7BA 3SPJA 4N5EC 5FO8B 2PNDA 3HUJA 5DS8B 3UCRA 4ATWA 1IZKA 1H3TA 4MYPA 4ORGB 4PJ5D 1JPST 3V7AG 3V4UL 3CN1A 2E86A 1QFWI 1E6OL 4KHTL 1XF2B 1G6RH 2F6AA 1P4BH 4MCMA 3OC5A 1IGIL 3DYPA 4PJAB 3H9SE 3N06B 4FYTA 2H3XC 1B2WL 1RUML 4Q52A 1L9NA 4WTZA 2WMPB 3IN2A 3QBTB 3UBXI 4KH2A 1QSEB 4TQPA 1BBJA 2W9EH 4HK0A 5FHBH 3GHPA 2J6EA 1N6QH 1NCAL 2G9HA 1H3PH 1NOFA 4PJ6A 2MRYA 5F9JB 4XBMA 3AA6A 2ZXEB 2DJUA 1NC4D 3HHRB 5EEUA 2A1WL 3X1NA 2FE0A 4C83A 4ZZFA 3PHQA 3CZKA 2AC0A 5F9OL 12E8L 3FQ4A 1JYXA 1KCSH 4FXTA 1RK0B 5IREA 5HHOE 4NFDA 1TTRA 3G7GA 1CFTB 1E27A 2P43B 2VMFA 3N43B 4JZNB 4XO5A 1J5CA 4RAVB 2WIIB 1NFDF 3OKKB 5D5MB 1QVOA 5EZIH 1KC5H 5EOQH 4FZNA 1QO3A 2Q10A 1UH3A 1NAKH 4P23A 1HWGB 1ZHYA 3B2VH 4JPKL 1NINA 5I73B 1VF5C 1DBJH 2Z35B 3CWGA 4JB9L 2YQGA 5D4JA 3WTVA 2ROYA 2VR8A 3OKEB 3QFDB 4LRNH 2P5EE 3VQ2C 3VXUD 3WUWG 3ZRSA 1KG0B 2XV2A 3ARGA 5KJRH 3Q48A 3FT0A 3O3BA 4GXUN 4M6MH 3V4PB 5F7EL 1F8TL 1RZJH 1T7ZA 2DI9A 3K4DA 4FQJH 3T8VA 4M4PA 2HA1A 1VKXA 1U2HA 5FS5A 1A47A 3MLUH 1GFQA 1RJLB 4O02B 4TSCH 4YSAA 3WU2O 3KLHD 4WK0B 4YE4H 4P3WA 1I3RB 3MRBB 5DHVH 1MJ8L 3TBTB 1CGVA 3NTCL 1SGKA 3EGSB 3FQUA 4KITB 2E27L 2XXMB 3IMVA 2NDGA 2D3NA 4XNDA 5BV7L 2HSIA 3ZZSA 5E99L 1KLUA 3CFKA 4HXBH 5FUZH 3QJQB 4AKPA 3HNVL 3Q6GH 3MO1B 5DGQA 1G9NH 1BXAA 3VZUX 2YC1B 3L1EA 1B0RB 1GGBL 3TT3H 4A7SA 4Y1AD 3V0IA 3FZUD 1YEDB 2AP2A 2X2YA 2ZUXA 1R46A 4ODVL 1ACYL 3G5YB 5DEGB 2F0CA 4C56A 1IB5A 2QZ5A 3UTQB 2YGVA 2Z6FA 4FSPA 4ONHB 4XN4A 7TAAA 3JWDC 1P4IH 2MPVA 1QWUA 3DC0A 3FQNB 2JMMA 4CGTA 3MGOA 3RDTD 4WRLA 3ISYA 5E2UL 5HI5C 1TVBA 5L6YL 1XF5B 5ETUB 5IESL 4MNQD 1QFHA 2WZ5A 3BUIA 4LCYA 5HGDB 1NLDL 3EO1B 1AZUA 4BZ1A 1Q9KA 4PRHB 1URIA 1S5HA 2VLJD 3BD3A 3VY8X 4MJHA 4LLVA 3HC4L 5FYLE 3LSOB 1KDJA 4U0RB 4J6IA 1KCBA 4H8QA 5DD5L 1FAKT 1CFQB 2BOBA 3IE9A 3EUDA 2LLNA 2QPSA 1QRNE 2OXHB 4L48A 1U9KA 3VXRE 5IJCC 1G7QB 3CXDL 4OLVL 3TT1H 3WV0A 5D7IA 2VN4A 3MDJA 2Q87A 2UZYA 3R4RA 2AMGA 3O0LA 4S1QH 4WNQB 5FVNA 1U30A 2NZIA 3GHEH 2F2HA 4OZIF 3QEQA 4JHWL 1E6OH 1NWOA 2FX8H 1QAWA 5GSRA 5L4MA 4BSVB 3BVUA 2FATL 4WW2C 4R2GC 4YJZL 3IDGB 4NO5A 3NJHA 4R90H 4OZFH 5G4NA 3KCPA 4DQAA 2XA8L 3MUGA 5ESQA 3DX8B 3QUZC 4I3RL 1QFUL 2JI2A 5CU9A 4APQD 5E0QA 4NWTL 1AC6A 3HLAB 4W6WB 1IEHA 1RUKL 4H7VA 5AW1B 2PPEA 1ZHBA 5DL5A 2EDDA 4N0CC 3QIBA 2XQYK 2GBTA 3C6LD 4FERA 4W9ZA 5KOVC 1A7RL 1E9OB 3FB8A 2K4WA 3HJEA 4U1LA 3DMMC 2A1WH 1TXKA 3ZRCC 5JHDD 2XWBA 3BSZL 5IG7A 3BPCA 1AIZA 5J9PB 3UO1L 1FCGA 1JNJA 1UKQA 2ZCLL 1W72B 2ZICA 2XQBL 3SPVA 1KWKA 2O6EA 5DSCB 1DUYB 4JFFD 1Q9FA 1A4JA 3LZLA 2E7BA 3PQYE 3DWOX 4BUHA 4XBGA 3S88H 4A1RA 4FMKA 5B5EO 4XWGH 4X7DC 4FQHA 3DK2A 5FX3A 5FKPB 3BO8A 1JK8A 1U8MB 1MCEA 1JZGA 2XQYG 2R0KL 3MNWB 3D7PA 3MRCA 1NCHA 4KY1H 3OSVA 3LKQA 3HB3B 4KRMB 3UGUA 4PJHF 5EC2B 1SLXA 3GSRA 3LK2A 3LZNA 4PJXB 1RFDH 5EG6C 3K91A 2XZAL 3QJHA 2YAPA 2Y0KA 1J1PL 3GM8A 3MRQB 2VN5A 5L2KA 2VQTA 2F74B 3CQQA 4JFPA 3PHOA 1P7KA 4Q8BA 4AKRB 1ICTA 1U6AL 1TFPA 3NTCH 2IQAA 2JB5H 3W9EA 4JO1H 3MCLL 2I69A 1E5ZA 4OIFA 4PJDF 4TRPH 1MIEH 5BV7H 4IU2A 2B15A 4K3HA 2PMZA 1T0PB 1CBVH 1FVDB 2ESVB 2B4CL 1B9KA 4TM9A 2R69L 4WY7L 2J1NA 4XCFL 1RJZB 1CK0H 5EF0A 5I5RA 3WKYA 4FZMA 4NKIL 2H26A 2NCMA 2WCGA 1GZHC 2E7CA 1CD8A 1JV5A 2XLLA 3GT6A 3QDJD 3TA3C 5KYXB 1BFOB 5EBLB 3TN0D 5GGQL 3ALWA 1KPRB 3PWPD 3T0EB 4HFWA 2XPYA 4S1SH 5FUCE 3CVHA 3OXSA 3CIQA 1ACYH 2BIIA 4PLNC 2JNZA 5MEPB 1MI5A 2NDFA 4G8FB 4WJG3 5JA8B 5E9DB 1D7FA 5HDQL 4LCIL 1T0NB 5A43C 2FSEA 2JK5B 2P4AB 2Y5EA 2HLAA 1FJ1B 5E0FA 4GBXA 3QC6X 5T3XE 2A9DA 3VCLB 4BKSC 5E8DH 3D2UA 2EEFA 5CEYA 4OGYH 1DJZA 2JSFA 1BYNA 4CDHA 3ZQ9A 2MKWA 2PCPA 4OLZL 2WXGA 2PWGA 3KYKH 2C4XA 4NC1C 4PS4H 4P2RA 2VUYA 3IFOB 5FCUL 1R75A 1O7DE 5IVZB 1PLBA 5I6KA 3ESPA 1XCWA 1RZGA 3SYPA 4WUUE 3X13B 3V0EA 4A7QA 2CBTA 1S8DA 5KYYA 2BW4A 2VDNB 3H4HA 3HZMA 1RZIA 2D0FA 3NJGA 1FSKB 3EOAB 4XH2B 5IMOA 1Z0NA 2EDBA 3DVNB 1T1LA 4H25B 5DR5H 1A6AA 3CX5J 4HD9A 4BFRA 2WY3B 4XPTH 3BGMA 4WI7A 3AG2B 3GRWA 2X3AA 3CH1B 4HH9B 4O2CB 1L3WA 2FJGA 4U2ZA 1CFMA 2F1BA 2CLVB 4KU1A 5HHOA 3GIVB 2ODIA 1FL3B 3KLKA 1HT6A 3SCMD 5C2BH 4JQVC 4NZ8A 3M86A 4RRPM 4X7EC 4Z76B 4CKQA 3S3JA 2JH2A 4Z7AA 1MCRA 2FJHA 4RGNB 3NFPA 4JAMA 4ZAKB 4OGAC 4M5YL 1AIFB 1E67A 1NC2B 1TTCA 3ZE2B 1PD1A 1YJDL 4CMMA 4EXKA 2XXGA 4CJ1A 3VXQB 5B4MD 4WFHE 4ZS6D 2BFGA 1UJ3C 5KSBF 1OAUH 4X4YA 1ETA1 4Y4FA 1E4WH 5KSUB 3OR7A 4QGYA 2WWMC 3REWB 3QDMB 5JORA 4BZ1H 2IANB 4HW6A 1AGCA 4DPCX 1BT9A 5E7BA 2AFNA 2J56A 1PG7X 3ULUH 1BXVA 1IAKB 2ENPA 2ZP8A 3SBWA 2QVKA 4OLYL 5CEXB 3WO4C 2IBGA 2HN7B 3T6QC 3ARPA 2K4TA 2AV1A 2ZCLH 3GMNA 4ZBJA 3PABB 1CD0A 1YEEH 4OD1H 5FO2A 5FK9B 1SOKA 3GUTA 3DSNB 1MZYA 2YBGA 4QEGA 1GZQB 1I3VA 4QHLA 2X4QA 5BZDA 4FLQA 3L9BA 5EOCH 1LEKA 1H0DB 3B2MA 1XF3B 1CGTA 1YYML 1MREL 3BVNB 3H9SD 3BZFA 2NW3A 5KOMC 2LFUA 4KQ3L 3DO3A 3RZCC 2XBZA 4GMSL 1HCVA 5D6DC 2GSGB 4D7BA 4X6CE 3WTYA 1E30A 5BS0D 1R5IB 4PJIE 4GB9A 2E74C 1WEJH 4LSDA 4E5XB 3B7UX 2XZAH 4GI9A 1A7QH 5SWQA 1V3LA 1BAWA 1JFQL 3P11L 2XIIA 4NKOA 4YHNA 5DO2C 4KPHH 3U0TB 3B9AA 1WLHA 3ABMB 1ESOA 5DJYB 4BRJA 1FZKA 1CIUA 5CN2A 1PG7W 2AAAA 2C9PA 4W4OA 4DUXA 5ALBL 3IMUA 3SDDB 5L9DL 5DXWA 1JPSH 2BNRE 2R29L 2G4GA 2DJMA 4OZHB 4XCFH 4C4VB 4UU9B 4XHJC 5CD5D 5AKRA 2R0ZL 1QNZH 4BSWA 3IBOA 4Z7QF 3U48A 3FFDA 5HGAA 4FXGB 3GP6A 1XV8A 3QORC 4L4VB 3U25A 3CVDA 4YSUA 2VDLL 1INDH 2WVPA 4WV1B 4LOVA 3VXRA 5I74C 2KZBA 1SXCA 2P5ED 5FF6B 5TE6H 3ZDXF 5LJYH 5KG9B 4AKOA 2V7NA 1QI5A 4GY4A 4IS6A 4H1LG 2HJFB 2OZ4L 3N85L 2X7LB 3P02A 4IRSA 2IWKA 1SYVB 3H4FA 5C0NC 5IVXF 1ASOA 3LH8A 3VUAA 2YK1L 1MCQA 3PXJA 3JTSB 4MAYD 4RFEA 5I30H 2W1NA 3CXHK 1TNMA 4ZSOE 1HE8A 3CLEH 4FMVA 2WVSA 5DS8A 3BZ5A 4Z95L 5KVFL 4RMUA 4HEME 2A7BA 4ICXA 5CP3A 3G6AA 1K4DB 3RU8L 2GABA 3GTTA 2CKBL 1A4AA 1N9PA 3KLLA 4GAFB 1A4CA 2DIAA 1XL4A 2AITA 2BVOB 4JY6B 1QSEA 4KI5E 3VE1A 4XC3H 1C5DB 3CDCA 3CVHH 2J8UB 2EIJB 2M26A 1MRCL 1WH0A 5F9JA 2BY3A 5B1KA 4H8WC 3DDGA 4G6KL 1NPUA 4MMXB 3PQYA 3EYOA 1XO8A 3QSKB 1JMXA 2F5AL 4F8LA 1RK0A 4U6HB 1CG9A 4WU5A 2IPTL 4JZNA 1V05A 4YK4B 1OP5H 1JZIA 2PYED 2OW6A 3L3IB 4MRBA 5D5MA 2AEIT 1EXGA 3T77B 3PWVB 1JK9B 4J1UB 4GCSA 5CO1A 5GS3A 3SGJC 4QRQB 1D9KD 5HI4C 4CC1A 2WUBL 3WEBA 1LEGA 1PIGA 4FLOA 5CSZB 2Z35A 4H8HA 4G8AC 5DJZA 4Y8AA 3VXMB 3WFDH 1E28B 3QFDA 4FHKA 4UB0H 3DURB 5G5DB 1KG0A 3ULVH 4ZYKB 1N5AB 1RIHL 4NO0D 2BVPB 3L17A 4Z7WB 3Q2LA 1XSKA 3S36X 2W92A 4CADB 1JUFB 3MV9D 3T8XA 3M1CA 1S78D 3GRWH 1LGVA 4W9KC 1E8ZA 4I0PC 5EN2B 1U8OB 3MRBA 4EI6A 4MA7L 4CW1B 2NY6B 5TF1H 3GLAA 2NY1D 3EGSA 3W1ZA 4I8DA 2DI8A 4HYTB 1N6VA 3L5XL 1A3QA 2QQLL 4QJ4B 2R4SL 2IBZX 1XHHA 5DVOA 1A9BB 5DK3A 4FFWD 3AS1A 4Y19E 3L2NA 4KNUA 3LKOB 3UBXG 4J4PA 1B0RA 4OQ1A 3I3DA 2FHFA 3GJFB 1AR1B 1QHOA 1BVZA 1ZHKA 1T21B 2QLYA 3KM1A 3HG1B 2WJ5A 2EC8A 5B1JA 3BN9C 3TF4A 3G5YA 1UD3A 4U4IA 2NSQA 1IBZA 3D3VE 3RGBA 5IQ9B 1MM4A 3VFSA 2AXHA 1CGWA 3P11H 4WFED 1CF1A 3UTQA 4R4BA 3WTTA 2WKOF 15C8L 5KEZA 3HI6L 5LBSL 3FO9B 2AJSL 1E8XA 1EDQA 5FFOA 1YEFL 3ARFA 3H1ZA 4OV6F 2IAAC 3C5ZC 3BESR 3GMMB 4N59A 5E4IA 2GHWB 3ZY7A 1NMBH 2NNAB 3FUEA 4Y9EA 3SD5A 4U05A 4HCGA 1XF5A 4XAWH 5I1KH 4WUUA 1I7TB 1LE9B 4N2EA 2AXJA 3OZ9L 4HIXH 2N2MA 5FEBA 3QEUB 5HGDA 3RHWK 3DRTB 2EDOA 2DL9A 4NS0A 1RUQL 4PRHA 1IAIH 2BCMA 3NPSB 4ZX6A 4JHAL 3LQZB 1LP9E 3Q44A 3VTTA 2C9AA 4F8OA 3LSOA 5LWYH 1ZGLA 1NQBA 3CFNA 1HXTA 4YZFE 4XNXL 3S48A 3WLWC 3FRUB 1CFQA 5I2IB 4UV7H 2B8OT 5EEXA 3ZE1B 4K23L 3HOLA 1H5BC 2X4UB 3N85H 4BHUA 2ZG3A 2EDFA 2VW6A 4FFTA 1G7QA 1CDGA 3NJIA 4J3WA 2FHBA 4YXKH 3JXAA 3Q01A 4ZO9A 1T7XA 2MEJB 4LVEA 5T3XL 4GRMB 2VZ3A 3FONA 3AQZA 4B95C 3D06A 1P9MC 5CZXD 1F18A 3JWOC 3I84A 4WNQA 4H8VA 4PJBE 2X0UA 2AK4B 4X7SL 5CJXA 4E42B 3CFMA 2IBBA 2Y3AA 3UPAA 5DD1L 3RU8H 1PZSA 4YEFA 1QPPA 5E70A 4EDXA 4BSVA 1N64H 1CGUA 1EO8H 2IH3B 2W80C 2Z31A 3NIGE 3GI9H 3FS9A 5J0BA 4TTDD 4EDWL 4PHZA 2WXLA 1CLCA 1ND0B 2Q7YB 3S6CA 5I1HL 3QRCA 4Y1SA 1I1RA 2Y2TA 5DZAA 2FX9H 3DX8A 4HJGA 4X6DF 5FYLH 2K6ZA 5C07B 3RIFK 3SYCA 3V6FB 3VMOA 3VFGL 1OCWL 5EU5B 5I1JL 1X44A 3HLAA 1UC6A 5SWZE 5KYNA 4KR4A 2ZUQB 4Z0XB 1EHLH 1J9RA 1F3JB 2J5LC 1DVXA 4HUVB 1P5UB 2V2TB 3TONA 1E9OA 4LAQH 1G6VK 4PJ5B 3CLFL 3OMAB 5DS1A 3VFOB 1JGUL 1FZMA 3FUDA 3H85A 3OPZL 3HAEG 4M1GL 5T3XD 3EH3B 5J9PA 3MN8A 2F5AH 1DR9A 1W72A 2X38A 2Y25A 2L3BA 5DSCA 1DUYA 4JRYA 4UIKL 5I5IA 4KGJA 4WFGE 1EAOA 2ZP0T 4KGLA 1FLTX 2CPUA 3HE7C 4QDGA 1F6LL 1IE4A 3DIFB 2EP6A 2DQFB 5FKPA 3AQYA 4HOXA 2IQ9H 4HWZB 5CP3H 3MNWA 1U8MA 1CLVA 1DEDA 1LK3L 5DC0A 1QLRB 1XZ0B 4CN4A 3T65B 4JRXE 3V9FA 1NC4B 4IOIB 4Z7VE 5EC2A 5HYFA 3IF1A 2WYIA 4PJXA 1ADWA 3BH8B 4KTDH 3QXAB 1ZGLP 2ZOWA 2EYRB 3MRGB 4FYQA 4PR7A 5AZUA 3NA9L 4TOYL 3EG9A 3FTYA 3MRQA 4Y89A 3LRGA 1QATA 1RK1B 4TUKL 2WCPA 5BRZE 1VEPA 4KVCH 4ZFOL 2HFGL 1CXEA 1DDHB 4MA7H 4AKRA 4LSQH 4PJGE 1HZHH 3IJSA 4X8XA 4YBQD 5KS9E 2HCZX 3TYFA 3HI1A 2MNHA 2BFVH 4CDGC 2XSKA 1FVDA 4DK6A 3MMEA 2ESVA 2Z8WC 5C6WH 3PHAA 2UZXB 3PWNB 1RJZA 4LF3A 1FV1A 2ALWA 4C4UA 4G43A 5ESAB 1CE6B 3H6JA 3QZWB 1BFOA 4C4BA 1UURA 3NZUA 1KPRA 1LMKA 4ANXA 4NM4L 3T0EA 1NAML 5G4OA 4XVOA 4BWWA 2K7QA 4J28A 3VWJC 4WF7A 5MEPA 4G8FA 3D0AA 2ARJA 5E9DA 1OANA 3H7BB 5JIIA 1JZ3A 2WZPD 4DH2A 2JK5A 4HPHA 3KBFA 3DA4A 2IWFA 1CFNA 2HH0H 4J6RH 4XCCH 5AOZA 5LBSH 2BIPA 2F7PA 1P7QD 4Z3EA 1OK0A 4XPGL 2UZPA 1BQKA 5IB4A 3TO4C 4AQZA 4HEMA 4N8CL 3BP4B 4F5CA 2VYRE 4YLQT 4PIRF 5JW4Q 1KGIA 2ADJB 4TVPE 3D6GA 4KFZC 4GKZA 4YBHA 1X5LA 4GUPB 4DKAA 5MEOA 3QNXB 4Y1AB 1A1MA 1YEWA 4GAGH 2JQAA 1AGEB 2LOEA 4K7PY 1ZE3H 2C3HA 4OF8A 2CJSA 3IFOA 25C8L 1QMUA 2VLME 1EZVY 3X13A 3II2A 3D69A 2MMXA 3TZVA 4L29B 4XNXH 3GS4A 5GS0C 1N0LB 5ELIA 4RWYH 3EOAA 1KENL 3JVGC 4K23H 3RVWC 2OMFA 3DVNA 3OQRA 2YSTA 3NK3A 4H25A 4LLWA 4PGBB 4U3HA 4YHMH 2HFTA 1IAMA 3T0BA 1MQ8A 4HH9A 3RDTB 3IXAB 3QJUB 3UJIH 1DBML 1L0XA 1OW0C 5D2NC 2CLVA 3KYMB 2HVKB 1VFMA 1D3CA 4YHLH 1ZXQA 4JREC 5AYUH 3GIVA 1NOAA 4ANWA 1E3FA 4Z76A 3UPRB 1SXZA 2NYYC 1C7SA 3WI5A 5DJCA 3DTDA 3KLQA 1AIFA 1NC2A 1J9CT 1YCSA 2BNRD 2JKXA 3G6JA 4Y4KA 3WEXB 4HGWB 5KZCD 2FB4H 1PFCA 1VZHA 3GXFA 4UILL 3SDXA 3EJCA 3QJTB 3VXQA 4X6BA 1SBSL 5DEZA 4XPFL 2QFPA 5I1HH 1BFTA 2Y72A 5AVWB 4QPEA 1XH1A 2BX5A 3FCSA 4QF1A 1UD2A 3OB8A 2XWJA 2IANA 3II3A 1X4YA 2PR4H 4QI3A 4D0BA 3LZPA 1P4UA 1PBYA 1IAKA 2DMCA 3ZKNC 2ZLDA 3WN5A 4KK6D 2PXYD 5KTEL 1RERA 2LVEA 3L3KA 1ZV2A 3TTYA 1BJ1H 2O93L 2WLIB 3PABA 5C0EB 5HYSB 1CFSB 2WV3A 5AAWA 4ZODA 2K0RA 3IDJB 5FK9A 1XGUA 1KV7A 3DSNA 2BP0B 3O6MH 1S7RA 1MCBA 1TZGH 1AS7A 1UWGL 4FFYA 4DZBB 3DGCR 1A66A 1HYRC 1S5IH 3ASNB 3POHA 4ZQKB 1IARB 4FLHA 5FM5M 2H1XA 5CEZE 3MFFB 3QDAA 1P69B 2N7SA 1H0DA 3VYNA 3IU4L 3KNBB 3LKRB 2Y7MA 3BVNA 4NQCE 3CHPA 4S11A 3I02B 1ZV9A 4I3SL 5IQLA 4W9CC 4J3BA 1VAHA 1DSFL 3C6LB 1D5RA 2G30A 1F1AA 4IMKC 4KI5D 5JHDB 2DQCH 3WY4A 1YQVH 1PD0A 3LNDA 1AH1A 2H9GB 2NQ3A 1XGPB 4E5XA 1GRWA 4QRPD 2FLRT 3TXAA 1IE5A 4IIQB 3AABA 4JFFB 2XU9A 2P80D 3N1PC 5J1AA 5DJYA 4IDLA 4DQOL 1WVZA 4GO6B 2D3VA 3QZBA 4FQLH 2O5XH 2CIKA 2Y0HA 2O1AA 4C4VA 1A0QH 2CUAA 4M43L 5AAMC 1ORSB 3ESVF 1T3FB 3NSXA 3BGFC 4NGHH 4OUUA 4WEEA 4EO5A 3P73A 4PV8B 2CMRH 1ZT4B 4XCNB 4GKOA 4M9PA 1CIDA 4B9FA 4AE1A 4K71B 5FW8A 1S9WB 5B7MA 1K85A 5C71A 1M42A 2HTKC 1FLRL 3MROA 4RGMC 4AM0Q 2DQHL 3NCEB 5LXGH 5EC1A 3NIFF 2V3FA 5FF6A 5E08H 4JO2H 1U3HB 4UM8B 5KG9A 5F7LB 4DFIA 5DHXB 3IXTB 4BGLA 1NGXB 2B5IB 2E7LC 2HJFA 2X7LA 4PJBA 3N41F 1SYVA 3QUXD 4FJZA 2HVJB 4M3KB 5DHMC 4AGOA 1EA9C 2V9UA 1Y6NR 4NZRL 3FUKA 3JTSA 2F5BH 3AREC 5HHNB 2WO2B 1SF3A 2ALAA 4P5TD 1LD9B 4PRPD 3LZFH 5INCB 3NSGA 1BFSA 5C6PB 3UZQA 5BW7A 3FTSA 4GLRH 3TN0B 3RP1A 3IPFA 1K4DA 3PWPB 3N3EA 4ZFZA 1BFVL 3FBQA 2IDCA 3OWRA 1KB9K 4B7IA 1PLAA 1X9UA 3PXHA 5J13B 4ZXBC 4LKCB 3S8WA 1RZJC 2LGNA 4M56A 1U2CA 4H8UA 4EVNA 5BJTB 5SWZA 4P2QD 1OSEA 4U1MB 4Y19D 5T5NG 5J6GA 3AGVA 3QZPA 2BVOA 2G5RA 4LARL 4LL1A 3E6FA 4F58H 2VB5A 1JOIA 2J4WH 1MPAL 2QGEA 4WO4A 3ZL2A 3HNTL 3QJFB 3NCMA 3WENA 3A0HO 1NFDE 3GBML 3MXWL 5KVDE 1WCQA 1C5DA 5FB8B 3D3VD 1DBMH 1K8IB 2VXUL 4PJEA 2ITEA 1TU2B 5DJAB 2IMNA 1YPZB 4MMXA 2H45A 4UQ2A 1G9NC 1T5KA 4B9JA 2Q6WB 1NCCH 3VWKD 2PPDA 4ZUUB 2H2PD 4U6HA 4PGDB 3DXAB 4IBUA 5BVPH 4KK5C 2QKIB 2FO8A 2FGQX 2YRLA 5DMIL 3L3IA 1SBSH 5FKAA 3GM0A 1ROWA 4YE0A 3T77A 3P3TA 4BV1A 3ML9A 4GQZA 1JK9A 4J1UA 4LHUB 4TSBL 1MEXL 5I66A 5IFAL 4QRQA 3T4YB 1ULVA 3CXHJ 5C09B 5CSZA 1Z5LA 4F20A 5HBBA 1UM6L 3U1QA 2AQ3A 5EHFA 1UWXK 4IMLA 4AQEA 2YMXL 1QHQA 2YUWA 3DVIA 3EYSL 3QCTH 3UEQA 2WO4A 1B3JA 2FX7H 3QGVA 3S37L 3SYOA 1XSIA 2JJTA 3DURA 32C2B 5E5UB 1N5AA 1DLFL 2BVPA 4F2ME 4PRAB 3VFPB 2Z93B 3VI4B 2PYFB 2Z0UA 4NXSA 1JUFA 4LOUC 3NIDB 3IFNH 4DOHB 4ERSL 4XP5H 3H9ZA 1ZVSB 1BREA 3J27A 3VG9C 5E24E 4GFXA 2BXZA 5EN2A 1R4XA 2BK8A 1JCVA 3QI9D 4HA1A 5IQ7L 1HKFA 5DD0L 4CW1A 1ZKAA 1UWGH 1CGSL 1X5AA 2D7TL 4JPVL 3ZKMD 4UQCA 2OMWB 2AXFB 3CFEB 4XO3A 5AWNL 5I26A 2WLMA 1TEYA 3VH8A 4K2UL 3O6KL 4S10A 2HMIC 1QABA 4F15B 1B6DA 1A9BA 4OGZA 1PPIA 4JKLA 5GTIO 3UPGA 4ZD3H 3GJFA 5MENE 2AJVL 2F19H 3RX9A 2X88A 1T21A 3NK4A 4NEHB 5FGRA 4KKCD 2DJSA 3HMXL 1MCKA 3DI3B 2RFXB 3C60B 3VGHA 1G1YA 1KUMA 3MRIA 5I6XB 1CO1A 1G9ML 5IB2B 1UYWH 3TBCA 4XXCA 1V7MH 3S5LA 2NY5H 1H3WM 2GFBB 3CLWA 3FT9A 5K9JH 1YG9A 2BSBA 2NW2B 3FMGH 3FO9A 4G6FD 1X5KA 1VIWA 1AO7E 2CA3A 2ERJB 4OFIA 3X12B 3KE0A 4R6UA 1E2WA 2F18A 3H9SB 4X4XA 2XVKA 4GW1A 2YD3A 2N59A 4WFGD 1KSRA 3MYZA 1Z3GL 1I7TA 3HHSA 4LLUA 3PJSA 4WSJA 3QEUA 3OVUB 1Y07A 2P5WE 4FHBD 2XTSA 3RBGA 5BS0B 2DQGL 4FFYH 3DRTA 4Z7OB 3B6SB 2DYPA 5IF0B 2BY0A 2WXPA 5IBUB 1V3MA 2CALA 4Y5XB 3UAJC 4NO2B 1KXTB 4X83A 5A40E 1CDJA 4JRXD 3FRUA 5DZ9A 5I2IA 5GGUB 3OAUL 4QRTB 5D96C 5DVNA 3TEZA 4MB1A 1JZ7A 4WHYH 2V9QA 1CFVL 3K6OA 1NEZG 4AV4A 3UU2A 2R88A 3F7KA 3L13A 1BIIB 4NZRH 2MJWA 5FXCH 1JXFA 1H8SA 5BRZD 5D1XB 1BXUA 4JM2A 5AW7B 3BH9B 3AS0A 4HEPG 4DZ8B 2L8AA 1MW1A 3FZUC 3ARDD 1EXUB 4TVPL 4E42A 4NHCL 1SLWA 4KKZA 5C3IA 2LABA 2R9HC 1QUPA 3GBDA 5EU7C 3RHWF 1RK7A 2ZWZA 3WNIA 2IH3A 3TO2B 4E9TA 2P5EB 2K6WA 4OBSA 4AEIL 5G39A 2HT3D 5F93C 4P5RA 2HRPH 4E2OA 3OR6B 4Q97A 2BIMA 4Y16B 2XICA 2BDNH 1ET7A 4O51A 4Z0XA 1F3JA 5BV7C 1IL1B 3NJMA 4I18A 3KWUA 2V2TA 1CB4A 4GRLA 3NAAL 3ARSA 1FZOB 2YPVL 3QIUB 4KXDA 4J8RB 4WI6A 3VFOA 5HVHB 3EJRA 3OX8A 4FA8A 3TNMB 4PJHE 3GI8L 2NNFA 3EO9H 2OW7A 3IE4A 4G7RB 3IJ7A 1JF5A 2A74A 3KJ4B 5GZOA 4NQCA 2X89A 4PVBA 2VDLB 4NNYA 4LOFA 1F45A 1WAAF 1E7UA 4YDNA 4HOMA 5IFAH 1TJIH 2ZX5A 2DQFA 3DX0A 2VR4A 2H6PB 4HWZA 3D4YA 5C0RL 2VLMD 1AHWB 1UM6H 2DQDL 2MOVA 2OI9B 1R5VB 5E2VL 5IW3A 5E5MB 3RIFF 1KGCE 1CL7I 1OT1A 1TZIA 1QLRA 1XZ0A 5FYKH 4PJDE 1O6SB 4QOKB 4KO7A 5DWUL 1I31A 4IGBB 5IT2H 3BH4A 4YL4A 1NFIA 2PO6A 5C6TH 5K1VA 5BCAA 2R1XA 4LSSL 3T08A 1UZ8B 3MRGA 4N8PA 3JBG7 3BAKA 5I75C 5IWLA 3BJLA 1RK1A 2PYEB 3O45B 1YS5A 2MSPA 4POZC 3MCKA 2CKBB 1DDHA 3QULA 2EO7A 1QJPA 4B50A 4JPVH 4NN6B 1MHPH 3VD5A 4PJCB 2APBA 2C1OB 1D9KB 2YZ1A 4I89A 1PCXA 2X9ZA 4OR1A 3ECBB 4LLYB 2P8PB 4WAFA 4AKQA 1A7PH 1MFDL 5CEZL 2UZXA 1J18A 2EDRA 3GB7B 4LSUL 1KB5L 2JCCB 3PF2A 4ZW6A 4F57L 5ESAA 3UEZA 1A8JH 4NO0B 3X1EA 4AQAB 3QZWA 3B7YA 3BUTA 3MV9B 3PGFL 5D93B 5E8PA 2ENJA 4GPVA 4JG1H 3T71A 1F0LA 1A4KB 2JJVA 2G60L 3BQUA 3LKNB 5DJXB 1ID5I 1MFEL 1USZA 3PE9A 3FUNA 2DBJA 4AT6B 4PJ7A 1K5WA 4WNJA 3WY2A 2NY1B 2Z92B 5G2NA 5F3BA 1I1FA 1HINL 5AVXB 1KJMA 4FFZA 5GV0A 1U41A 4Z78B 1SXSA 2DH3A 4XXWC 4G11A 5EWIL 2P5PA 1YRKA 4J12A 3VNYA 4KBPA 3SBRA 2ED7A 4PTUB 4GUPA 1Z3GH 3APFA 3CU1A 1WSST 2XG6A 3JWNG 4IRZL 2DAVA 3ZHLA 3QNXA 4KKBD 5CEZD 2EYTB 1NBCA 3ULUC 5GRWA 3SQBB 3N6YA 4AYSA 3WI4A 4ZMVA 3PWLB 1TQWA 3GPSA 2QGDA 2E9GA 3U9WA 3P4LA 4L29A 3IJYB 3V95A 1HKLL 1OY3B 1Q9LB 3CMOH 1N0LA 5CZKA 3KL5A 4YAQB 5D71H 5JHLL 3RX7A 1I7RB 2GPZA 5JPMB 4YMPA 4OFYD 3GJFH 2VUOA 1B90A 1X3DA 3L6FB 3UTTE 5KSBE 4HIEB 3IXAA 1F1GA 2W0KA 4GQQA 3KYMA 2HVKA 4OIBA 1FORL 1CQKA 2D3JA 5MERB 1WICA 4BFNA 2DTML 4XMKH 4G1EB 1KFAH 2DB8A 4KNQA 4MJ4A 5T1LB 5SWSE 3BRDA 4TVPH 4NXKA 4HK3N 3I6SA 4MCNA 3VRJA 3O2DA 4HT1H 3WUWB 3SPIA 3WDJA 5AVYB 2CUHA 4N0UE 3VA2C 5DVLA 1SRDA 1TVHB 3VU1A 5T1KA 3ZSSA 4ODUB 1TYJA 1CTOA 1BOYA 1R3IL 1PX3A 3AS2A 2KS0A 4K8RL 3LB6D 4KKLD 4N90E 3DX4A 4XP4H 3X3GH 2XYBA 4HC1A 2E8ZA 3MOBL 4IBLT 4NNPH 1UA7A 1IBBA 3GHBL 5HJ3A 3LQAH 3TU6A 3QIBC 3WMQA 2A6IB 5M94B 2P8MA 1UXWB 3DUHA 1I3GH 2NR6D 2OMXA 3BAJA 4PGCB 5EUKB 4XNLA 1KYOJ 5IVNA 5KVDL 4AV5A 4BDVA 3D9AL 4R84A 3TJEL 2WLNA 4BEIA 2JXMB 3KVQA 1F6AB 3DZMA 2WLIA 2FECI 1A64A 2R0WL 4L9DA 4ZO7A 1XR8B 1S5LO 3IDJA 4P99A 4Q9RH 5C0FB 2BP0A 6PAZA 1OD7A 4QJ5B 2WBWB 4IKIA 1ET5A 3NABL 4DZBA 3RVTC 4ZQKA 4JKWA 2O5ZH 4AK2A 1J9SA 3NZ8A 4G5ZH 4N0RA 1CXKA 3KNBA 4K8RD 5C0RH 5TFSL 1OGAD 3I02A 4DO5A 4K3CA 4D9LH 5IHBA 4ZMAT 3CN2A 3ZYIA 2WJRA 3K3QA 4OLEA 1IFRA 2ADYA 3T0AA 4OFKA 2H9GA 4KJPC 2W65B 4UTAA 1ZHLA 3ILEA 4Z7QE 1HHGA 1YN6A 3QQ4A 4JPQA 1OP3H 1RURL 1KT2B 2E0PA 3G5ZA 3DTUB 5BZWA 5B4MC 3U9PL 2AABH 3O2VL 1AD0B 1XT5A 3TCLA 1N2RB 4J3OH 1J0HA 1QBBA 1KN2L 1S9XB 3X1BA 5KW9L 4KJYA 4KOCA 4CU8A 1HH9A 3ZDXE 4E9WA 3GIZH 4O3WA 4LVHB 4FLRA 5G26A 43C9A 3QEHB 5K9OB 1ORSA 4KZ0A 1T3FA 5DJDA 1I7ZB 1DEEB 4PV8A 5IVXE 4ELMF 4F57H 4JFHE 4OZIA 3HG4A 5EZOL 1ZT4A 4XCNA 5D7LE 1UD5A 4C58B 3VGAC 1DVFD 4KK9D 4LVNB 3WL9A 5BO1H 4PJFB 1ETB1 1NSNL 1U3HA 2R7EB 1DQLL 4FKKA 1OT4A 3IRCA 1ZANL 4G80A 2WVVB 4YDLB 3A6CL 2RJMA 1NGXA 3IXTA 3K4ZA 3PY9A 3ZKQD 4PS8A 4X9BA 1MNNA 3GLZA 4R97C 2JKNA 2HVJA 5EWIH 5DL7A 2E5EA 1J11A 1A6VH 3SEPA 4A7VA 5DC4B 1ZV5A 5LN8A 4LSFA 1ZEAH 2ZUSA 3GO1L 4JO4H 5INCA 4NFCA 1OAYL 2TSBA 1RPQA 4NO3B 4IQHA 4FJYA 3ULVC 4JKPH 5HYJE 1F56A 3ZX1A 3JT0A 1TMQA 5F9AC 4PI2A 1MW0A 3TFBA 1PVHA 4LASL 2WSDA 1XAUA 2CCVA 4JZOB 3CQFA 4DEPC 5BJTA 4YGAB 1HKLH 4AJVA 2GHZA 4F7CB 1J0IA 2BOLA 5MEND 1FG2B 1E0OB 1HYSD 1DUZA 1W2KT 5CJ8A 2GAZB 4ZFOB 3RKDD 1NEUA 5FB8A 2Y24A 1U58B 4HF5L 1XCQA 4AVHA 2B08A 4X99B 1OE1A 5T5NF 1K8IA 5CD5C 1JMZA 2ZOKA 2R89A 1FHGA 3TYGL 4KUZH 1T22B 1UCTA 3MXVH 3EO0B 5I23A 3CUPB 3WFCL 2FEDD 1A3LH 1TTFA 4DTGL 4NJ9L 5FCSH 3RY6A 4IBWA 1AO7D 3LIZA 4UYQA 4ZUUA 3OJVC 3DXAA 4FFZH 4PGDA 3QFJE 2F1CX 1G4MA 2QKIA 2V2WB 2YAEA 5CNHA 1AY1L 3GPEA 5ECGA 1E8YA 3CDGB 1I1AA 3U4KA 4UIMB 4M7KH 4JFQB 1CDHA 2EIEA 4HWBL 3VFTA 3DHPA 5GS2H 2P5WD 3MOBH 4LHUA 4KMLB 3T4YA 3N42B 4HLJA 5I8EB 5C09A 3QAZC 2EACA 4K3BA 1KPUA 1GKEA 4MAYC 3SBWC 4AC2A 3H2WA 1EEQA 4DKEH 5ABZA 4YQXL 4J27A 3X3FL 1BDYA 3H3PH 4L8DB 1M7IA 1D2PA 1GGUA 2NCEA 1SDDA 3BVXA 1KB9J 3EDJA 5E23A 3K2KA 4PRAA 3C09C 5I18H 4GG6F 1BQ5A 4AMKL 2A38A 1L7TH 3DOSA 1ZVSA 2YD7A 3PV6B 3D0VB 2NXZD 4BCXA 2JKSA 2R0WH 2VDKL 2GCYB 4PRIE 2NSXA 3VD4A 1TQCB 1MRDH 4M8QB 1K5NA 1XIWA 4O58L 1UD8A 2E47A 5CD3B 2OMWA 1A7NH 2AXFA 4ZG1A 3FXIC 5LG6A 3NCYP 1X5XA 1OWWA 3E80A 4I77H 2P24B 3O2DH 2D31B 4YSRA 2K1MA 4HQQH 2ZOLB 2X2HA 2OMZA 3VXTA 5DJ0B 2W0PA 4ZMYA 4KROD 2MNWA 4F7MB 3SN6N 2PXYB 4P5KB 2YQBA 4DP7X 4FULA 4HC1H 2GB2A 4F8NA 4NDMB 3WD5L 4PRNB 1FBIH 2WBJB 3IDNB 4QY8A 2VDOL 5K5YA 3C60A 3ARBD 1JTPA 2Q86A 1UWYA 4Z7NB 3FT2B 5BMFL 4W4OC 3RWCB 4FQCL 3G6DH 2AK1L 2YJLA 4L0YA 4F4BA 3DGGB 1RJYB 5B38G 4TLSA 1R34A 2GFBA 1KN2H 5GRUH 1MWAB 2NW2A 3CZLA 4KTEH 3K6NA 1GOFA 2HUHA 4KTYA 3TVMD 4DVBA 5I1GH 3V9CA 1XEUA 3KD4A 3BW9B 3QQ3B 1CLOH 3WS3A 1A9EA 4U6XB 5D2LB 5BS0A 1LO2L 4FKHA 4FI7A 5ITFB 4GQRA 4UT9L 4X6FB 2C9VA 3VGGA 1FC1A 4QRPB 3B6SA 4NN7C 3HS0B 1PLCA 3N50A 3WKPA 1KGCD 2NY0C 2X4OB 4XN1A 4IRSC 4EI5A 4NKMB 5GGUA 5DK2A 1KBPA 1ZANH 2WNXA 2KMWA 1U8CB 3E8UL 2QHRL 4FQXA 4JDTH 4OI9A 1NDGB 2AJXL 4GYBA 3WNJA 3GSUB 5JYMA 1ZK5A 3P9WB 2RGSA 1PL3A 5FA4A 3Q8CA 4TNVK 4UTAH 2JELH 2R56H 3IJHA 2EDWA 4X6DE 1T1XB 5D1XA 1MLBA 2NY2C 1BZ7A 2Y2WA 3DRQB 2PRNA 2LFGA 1T7YA 1FNEB 1SJVA 3BH9A 3UAEA 4DZ8A 1OGSA 3CZNA 3EADA 2NUPA 3IDIB 5GHWL 1EXUA 2XHNA 4S2SB 1UZ6F 4M29A 1JPGB 5ECJE 3VG0H 1BGXL 3AJ7A 1AZZC 5CZVL 2RACA 5IJKC 1ZY9A 3TO2A 2O72A 4OT1L 3WJLA 4NWUL 2DWSA 1IEBB 3WEMA 4BYHA 3S3BB 3M8OH 1GW0A 2XIDA 3TNNB 1TR7A 4TN9A 3JVFC 1P6AB 2IOOA 5EE2A 2PF6A 4Y16A 3OHXA 4RAHA 3V0GA 1MCOH 1TENA 1WCBB 3KWWA 3QUXB 1UFUA 4ANUA 4HIJB 1JZFA 3ZBMA 3BWZA 3LPOA 1NCOA 4P5TB 1QX1A 4PRPB 2PCYA 1IKNA 1I1YB 5DK0B 3DA3A 2R29A 3D5OF 1P6FA 3QIUA 1KJ3L 1OK8A 5JIPA 2A9BA 4OGXH 5FM8A 1X5YA 4DW2L 5T33L 4RZCA 5I82A 3IYLW 4YSOA 1PS3A 3WNKA 4P2QB 2A83A 5A3ID 1UA6L 1F4HA 4WZ9A 5IGXL 1DVYA 2HKFH 1FI8C 4WEBL 1M71A 4MXVF 1RQ5A 3DX9B 3FN0H 1QOKA 3APMA 2H6PA 3RKPA 5J57B 3WEAA 1XGQB 3KJ6L 1AHWA 3D3VB 3QUKA 3QRGH 2X4NB 3Q5TA 4KKAC 1XSOA 5E5MA 4LEEA 1K4CB 4QOKA 3S9DB 4ZUTB 4IGBA 4K94L 5ABDE 4KZDL 3A23A 5DHEA 2R4RL 4ZJ9A 3UTTD 1DVZA 1UZ8A 3VWKB 4LCCA 4EXPX 2YRZA 3MRPB 3LCYA 1DQJB 3ZSTA 1QQDA 2WJ7A 5IBLD 1IM3A 5T5FL 1ZE3C 2DWDB 2DQUL 3GXDA 4RFNC 3O45A 1KCRL 4EZLA 3SZDA 5AQ0A 4E68A 1KWGA 2RIKA 1WC7A 2DWXA 3ASOB 4Y2LA 5SWSD 3MGAA 4ZMXA 4XVSL 4K7FB 4S0SD 1OCOB 3BPOB 1FYTE 3LK3A 2BNQE 2LV4A 4M6OL 4L1BA 4ONFL 2WCSA 2P8PA 3T2NH 5ABAA 3LIZH 4UI2A 4H1LB 4UT7H 4ZFGH 4U6YA 2X41A 2JCCA 3ZQXA 1PZ3A 1QSVA 4N90D 5B1JC 3NJLA 4JGUA 4AQAA 1P6WA 3QHTC 2IAMD 2DMBA 3OJDB 1QKZH 1E90A 1DJXA 3BEWA 1A9VA 3MV9A 3WD5H 4XMPL 1A4KA 2VDOH 4LPTA 1UUSA 2QT6A 3I2CH 4MCZB 1RKRA 5TDPB 2MQ0A 4MBOA 1LO3L 5DJXA 5G38A 1U36A 2NXYB 3QI9B 2WWKT 2ZX8A 2VN3A 3BQVA 5I0XA 4PV1C 3ARFC 5JLZB 1HWHB 5T1DL 4X6EA 1V8HA 5JXAL 1ACXA 3ES6A 1BZ8A 4HS8H 5IK3A 4HSCX 1BAGA 3RB7A 1RAMA 3L5WB 3MJ7B 3O4LA 4Z78A 2OLDA 2Y07H 1IC4L 1ZD6A 2A4CA 5I71B 4PGEA 5HHQB 1J8HB 1SDAB 3MTXA 4UV4L 1ORMA 1MDTA 1F3RB 2ICWB 2YD1A 3HR5B 5D7KD 3SY6A 4CVWA 1S7WB 4DK3A 5DUPL 4HGKC 1GY2A 3BP5A 2FEEL 4XNZB 4N4YB 4PAZA 3OD3A 2F61A 2X4PB 1EEUA 4LLQB 3PJNA 1BEYL 2DY2A 1PKQE 1Q9LA 3FFCE 1UXSB 5EUOF 1GYCA 3V10A 3OPUA 4YAQA 4AWJC 1G9HA 5EU6A 5HDBF 1A7OL 2VH5L 1FGNH 4G6FB 1JNHA 1QBML 3L6FA 3DJSA 1ZLEA 3VXSA 3FDWA 3GNMH 1RZPA 4Z3IA 4GKNB 3HTLX 4QHUB 2K45A 4KZEL 5MERA 2DQJH 5CJQL 2ZOUA 5D9SB 4G1EA 4BK8A 1YMHB 1CURA 5T1LA 4Q2ZA 2Z31C 3AY2A 3L9RA 4NBYB 3HG3A 1UACH 2R51A 2FD6L 5CZVH 2M06A 1R24B 1TETL 2YPLA 3WUWA 5GS1B 3CN3A 2EDXA 1KTLA 1CLZL 1S9KC 1CD9B 2NNCA 4NAJA 3PS6A 3SD2A 4JRXB 4Z7VB 4JFHD 2CO6B 5GGSY 1G7PB 3GSOB 2QSTA 5AFAA 5D7LD 5DZLA 1BVKB 1OV8A 4XMLL 4Z3JA 5JNYB 1K8DA 2A6IA 3A24A 4B7LA 4NQEB 3LHPH 1UXWA 3VD1A 4FMFA 2KZKA 3BRFA 4I1RA 4GW5B 5BRZB 5AUMA 1IC5L 4R3SB 3EXJA 3CC5B 3LNFA 1GZPB 2RBLA 4DGVL 5IJVA 2YNKA 3ARDB 1AOZA 1X5FA 4QMEA 3OSKA 3V2AR 2Z64C 1JGDB 2JXMA 3HMWH 1F6AA 2YEQA 4DGYL 3WXVH 3AWFA 4GUOA 4U6VL 5AW5B 4MYWB 3UBXB 1PF3A 1LNUB 2CDEB 4RDQF 1OAQH 1YUHB 3AUVA 5C0FA 2FLMA 2WKOA 1UA6H 2AQ1A 5JPNB 1JYWA 1C5CH 4MDJA 4ODHH