4AYMC

Structure of a complex between ccps 6 and 7 of human complement factor h and neisseria meningitidis fhbp variant 3 p106a mutant
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
239
structure length
234
Chain Sequence
ALTAPLDHKDKGLKSLTLEDSIAQNGTLTLSAQGAEKTFKASLNTGKLKNDKISRFDFVQKIEVDGQTITLASGEFQIYKQNHSAVVALQIEKINNPDKTDSLINQRSFLVSGLGGEHTAFNQLPGGKAEYHGKAFSSDDPNGRLHYSIDFTKKQGYGRIEHLKTLEQNVELAAAELKADEKSHAVILGDTRYGSEEKGTYHLALFGDRAQEIAGSATVKIGEKVHEIGIAGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords COMPLEMENT FACTOR H
total genus 49
structure length 234
sequence length 239
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4aymC02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4aymC01
4O3XB 2Y7SA 5T5FA 3PQSA 3VE2A 2KDYA 4AYEC 2LFUA 3PQUA 4AYNA 4Z3TA 4O49A 4AYMC 3V8UA 2W81C 4O3WA 3VE1A 4U9CA 5EE2A 3HOLA 1YS5A 4AYDC 4O3YA 4AYID 3UAQA 2KC0A 4QQ1A 2YPVA 3KVDD 3HOEA 4O4UA 4O4XA 2W80C 4O3ZA
chains in the Genus database with same CATH superfamily
1GC1H 4RMSA 3O8XB 5AW9B 2VRQA 4I2XE 4R3SB 8FABA 4JO3H 3X12B 5IR1B 4E9LA 3AS3A 3PL6A 3LKRA 5AKSA 1DO5A 3PIQA 1JWUB 3QEGH 1G9MC 3QO0A 3AWGA 2WWKT 1ACCA 1EIBA 3D3VD 1XCTA 3KPLA 4FMVA 4R90H 3HC4L 4Y1AD 5C3TA 3TONA 2PW2A 4PS8A 1U8LB 2WLLB 3GSRB 4DGYL 2ZJSH 2H45A 1IGCH 1U8JA 2MTPA 1TTGA 3ZTDC 2XIIA 4ZZKA 4BWUA 1HL4A 3QGVA 5IIEB 1JZJA 1T21A 3CVHA 3UOAB 2W88A 5DURB 3VFWB 2AABH 4JHAL 2WQSA 3ALPA 4G43A 4XBPB 3GSNH 3BPOC 3CSTA 2VR4A 4G5ZH 4I3GA 2IDTA 1CS6A 1XH0A 2JJSA 2PN5A 3SY0A 2ZKHH 3X13B 4XCCH 4B96A 5FDWA 1JZ4A 1ETA1 3TVMD 4G8GB 1S4IA 5FKPB 4HEPG 4IBLT 5DJ6B 3TPKA 2BO0A 5KBPA 5TQ2H 4DH2A 2RA1A 1G9EA 3H9SA 5TFSH 1XMEB 2N1KA 2W95A 3G6DH 2X1XR 2NY3B 3E8UH 3KPOB 3KLSA 1P7KA 4OQTH 3D25B 4S0HA 4WCYL 5DMIH 4QRUB 2GYSA 4ZQTA 4Z3TA 1EZSA 2QPDB 2ZNXA 3I9PA 4L4TE 2CLVB 4MCZA 2BXYA 3OQRA 4DO4A 4UNVA 1R3IL 4ONHB 5BS0A 1H8LA 4ATWA 4U6HA 2WMPA 2BRRL 5DQDH 3PGDA 3GJFA 3NFPA 2BOBB 4UTCA 5EU6A 3DVFA 4LCCB 2AEIT 5DMGC 2K9FB 2Z0BA 5E2WH 2Z34A 1CXLA 4F7PB 3BUIA 4KK5D 5LGYA 1CXHA 3SY6A 4LNRB 1YUKB 4GHBA 3VXSA 1JS4A 3GGWA 4GUQA 2FUTA 1GHFL 4N86A 1A2YB 1UH2A 1I9JL 4ZFOB 4UILH 4TQHA 3HZKA 4NAMA 5D7SL 1U8NA 3TXAA 1ZPUA 4V1DD 1A14H 3PREA 4EI5C 2X4UA 2DWDA 5DLMH 3B2DC 2ZIDA 1SBSH 3GMPB 2AP2A 1LO4L 3OG6B 1N0XH 1KXVA 3ET9F 5IY5B 2FH6A 3FULA 2AV1A 4KK9D 3TV3H 4F8PA 4PY8J 5EBLB 4PGDB 2JB6B 4PJCA 4YPGA 3NESA 2BHZA 5B38G 4P2OD 1I1YA 2WXHA 2YWYA 1M05A 3KM2A 1N64H 4U49A 5DHDA 3T3PF 1GY2A 1A4AA 4Y89A 3DWTA 3DX8B 3ZDZE 5DFAA 1Y1DA 3L9RB 3CBRA 1RY7B 1KCVH 1A6ZB 4JPIB 4NHCL 4PHZA 2FQGA 3O6LL 3PWVB 4FFZH 3SPIA 3W82A 1SZNA 2C9VA 4GP4B 3MRKA 3MJ8B 5JO5B 1A6ZA 4PJBB 5ESAB 2WLKA 4GIOA 5JZ7D 3QPXL 2A9NH 3U4BL 5JW4R 4BXSV 2OAAA 3LHPL 1ZA6A 3T2OA 3JV6B 3NIDF 4M61B 3OG4B 3QQDB 3VXTB 3HOGA 1ULVA 4PCSA 1P9MA 2K7PA 2DL2A 2EEDA 2F54D 2VXQL 3QUZA 4DZ8A 3VE0B 1HYSD 4XZUA 3MRRA 5AFAA 5JLZB 4BHUA 4N26A 2VLJA 3PJNA 4GAGL 2JKLA 3VFGH 2X4UB 3S88L 5GQBA 1R6VA 3LZOA 3ZYOA 1A7NL 3VXRE 4D65A 2PUQT 4L3CB 3CQQA 4UQAA 2NLJB 1P7KB 2CM6A 3MV9E 5J7CC 3O3BB 4MVBD 4PJBE 5CN2A 1I3UA 3HAEH 2M1KA 4HHWA 2J71A 2PO6D 1B6UA 3HE6B 4I9XA 4GXUN 5PCYA 3MJ8A 2VC2H 3GDBA 5I1LA 1PFOA 2CCVA 3AG2B 3DTDA 1ZHNB 3BZEB 5C0JB 2ZX7A 3US1A 1DBAH 2OYMA 3FCUB 2R1YA 1IAII 4KVPA 2BS8A 4Y4FB 3N85L 1RUML 3X13A 2VXTH 2IANA 1UM6L 3ZOAA 1LEKB 2EH7L 2J73A 3G5VB 1AS6A 3CU1A 1T0NB 2DMCA 3T2LA 1I1YB 2XQ0A 1Q9KB 2VAAA 4P4KC 4YVUA 3OSVA 1CXFA 2ICWI 4X8CA 4P2OA 3UTPE 1NM9A 1ILUA 4G1MB 3N44B 3K81A 2QHRH 4YWGL 1EFQA 2WM0A 1RZKC 4O2EA 1A8JH 3EOYG 5IIEA 1JYVA 3CFDA 3MV9B 5DRWA 2AXTO 1PLBA 3T6QC 2E59A 1JYNA 1UASA 3SBWA 2CNYA 4D9RD 4KK9C 2VZOA 3BOVA 4Z78A 3IGLA 4N5ED 2OW6A 4TVPH 4PRNB 3CFTA 4Y16A 1LO5B 3D07A 3ME0B 4Q9RL 4LGSB 1BFVL 2ZOOA 4ZUUA 3V7MA 1P1ZA 3I75A 3AT0A 1F11B 2BOBA 3CAFA 5EU6B 3RVWD 1FFOA 4A7SA 1JFHA 1LMIA 1ZEAL 3V0VA 2H8PB 5JA8B 4X7SL 4LOEA 2K8MA 4FTVE 1RZPA 1NDTA 2N0KA 3LNEA 3UMNA 5HPOA 4MA1C 3ZYJA 1KGYE 3HS0B 4NBYB 4MQTB 3B7TA 4NKDA 5F0MB 4YFLI 1KGUA 2IWGA 5E5LA 5I16B 1TEFA 2D3NA 4R0LC 4TF4A 3IMBA 4WUKH 4HUKB 3WFCL 1VCAA 3WJJA 1JERA 4TVPD 3FFCB 4ZFZB 4DESA 2VZ3A 2R4OA 4OZGA 1EMTL 5IWLC 1CE6A 4ELMF 3VO0A 5AVXB 2EXSA 5TJWK 4JKKA 1YEKL 4Y5XB 1A6AA 3WY1A 2AJSL 4QTIL 1X5MA 4D9RE 3UO8B 1JXJA 1OSEA 3EBGA 5AZ2H 1YPZB 4KZEL 1XF1A 4HIXL 3TPUA 2CALA 1IAMA 2GSIB 3MOAH 5GS2H 1ZV2A 4K7FB 2H0FA 1JFQH 3KLKA 4OZFA 2B1AH 5SWZD 5GZOC 5AVQB 3RI5F 1Y6KR 2VABA 1EAJA 3BO8A 1NCIA 4N2KA 2OLDA 1KYOJ 4CJ0A 2Q10A 1TYRA 5KVFH 4EUPA 1KY7A 1MJ8L 2R23B 4U1JB 3OF6A 5DJDB 1INDL 1AQHA 4I87A 2VGLM 3V0AC 2NY0D 1PZAA 2J6EL 3IJSB 4HPOH 4RGNE 2XICA 4ZUWB 2VDMH 2Y24A 3AM8C 1BMWA 1L6ZA 3EFOA 4M5SA 4ZMTA 3S5LB 2BZDA 5I74B 1AQMA 4LLMB 3PHAA 4CJ1A 2ZKHL 4OFYA 3FT4A 1A65A 1RZIA 2CDFB 4FFVD 4ONOA 4XVOA 5KVFL 5C09E 4G5ZL 4XPTL 4ZFQA 2J88L 3LK3B 2E74C 1CICA 3H4HA 5B39A 2XNAB 1TG8A 4RGOH 1ZT1A 3K3QA 2BSSA 3O3EA 1MHEA 5E6IA 2COVD 3JTSB 2Z91B 1QFHA 4MHHG 4KMLB 1MFBL 2WWOA 4K7FA 1MJJA 3IDUA 1WA2X 3KXFA 2J2ZA 5HYIA 2VL4A 4APQA 3IGAA 4BWWA 2IBBA 1X44A 4MYWB 3GKWL 1BD2E 2H6PB 3QWOB 4M1CD 3DBXA 3PABB 3KGRA 5E9DA 4XWOD 4PV9B 4QNPE 1E5ZA 5FHBH 1W0WA 4F2FA 3ZIYA 5MEOB 3QYMA 4OZGB 3FYEB 5DQDL 5IMKB 1LGVA 2EACA 2G9HB 3UZEC 4KOCA 2FJHA 5DZAA 1HCVA 1MWAA 4NENB 5HGDA 4R4BB 1HWHB 1IKNA 2VIRA 1GAFL 2WKLA 2XTLA 5KYUB 3KPQA 1WS7A 4XNKA 3EDJA 4W6YB 1ZHKA 3OLEA 2OK0L 2JKTM 3C08L 3S5LG 2JKIS 4R2GD 3VD2A 2ZXQA 2EEAA 5F93C 5EBWB 5GRVL 3P0GB 4YDKL 1E42A 2DWEB 3K5SA 1FH5L 1MCHA 2WBJA 1CXKA 1CGSL 2WQRA 2Q76B 3DV6A 5H2BB 4DKFL 5ERWB 4L4VB 3ML9A 1NAMA 4W9CC 4OCXL 1YEJL 3G08A 1B0RB 2FK9A 4KKAD 2OK0H 5FUZL 1GZHA 4NPYB 1QR4A 1S3RA 4CC4C 4G8IB 5ENWB 4Y7OC 1GIGH 4UBDD 2KC0A 4XNYL 4C4BA 5KSVA 3ENEA 1A7OL 5F89B 5KJ7E 4IMLA 5B21A 1F4YH 4EVNB 3QHFL 5F1NA 3QZPA 3NCYP 3L3OB 3EOAB 4UTBL 4AQEA 2XG5A 4PI0A 5DLLA 5C6TH 5E94B 4U6VL 1AG6A 1X5GA 2GY7B 2MPVA 5EFIA 4AEIL 5AOZA 5D1QD 4BQ9A 4XP9H 4L3AA 4BEIA 5IYUA 4X9GA 1L0XA 4NGHH 2QELA 3H7LA 2KLSA 1QBBA 5A2JH 5CIPB 1FNLA 3K6FA 2UWEF 2C9XA 4CC0A 4MDJB 5AW2B 5CBAB 5C0JA 4HUVA 2N7SA 1JF1B 2V2WA 4RZCB 1U8CB 4BFEA 3FFDA 2A74C 3NJKA 4HKBA 5EOQH 3W9EB 2L3BA 2CHXA 2QVIA 5JXED 3HE6A 4OR1A 4GW5B 4IYKA 3P3TA 2WVTA 1DQDL 3CVHL 1FG2B 5DL8A 3NP3A 3MLRL 5DURD 3EG9B 3QZNA 1A7NH 2WGXA 3HN5A 3HZMA 3FQTA 4N1HB 2YEVB 2GBTA 4WGWB 2CJUH 2HRPL 2NXZB 4JHUA 5HYQA 1DBKH 2D31A 2X0WA 4G9FE 3MGTA 2WWKO 4QMEA 3V4UL 4DKTA 5EEVA 1T1XA 5G3AA 3FTYA 4UIKH 4UI2A 3Q9PA 1OE3A 2J20A 3HG1B 5F7LB 2ITCB 3V52H 3ZK0A 4G80B 4GSUA 4JN2A 4TTDC 3D2UA 1UZ8B 4Z7UB 4AGNA 4OKVA 3VXPA 1ZLWK 3F3HA 2AEOA 3LDBC 3RPBA 2JSFA 2X4OA 2RJMA 5G4OA 4YHPB 1UOLA 1DL7H 4GG6F 1I7TA 1ECZA 4AV5A 1P4LB 3HZMB 4UQ3B 1AGFB 2ITDA 2W0FA 4GQRA 4JM2A 2OMYB 5DZJA 4AXWA 4PJ7B 2JTDA 2QFPA 3E38A 1NIEA 4TN9A 2HFFA 4PGCB 3DZMA 5HYSB 2W80C 3F84A 4HBCL 4TUJB 3K2UH 5JDJA 4N2LA 4YEEA 4H4NA 5GGVY 4HUMB 1EQWA 1K8DB 2BCKA 3AGWA 4H0HB 1XH1A 1V55B 2DOCA 3QO1A 1MVYA 4FEMA 3MREB 4RDQG 2ZYSA 4JFQA 3OR6A 3MQIA 5GGUA 3RU8L 1NBVL 3EHBB 4D0CB 1YY8B 3UG3A 2QQKH 5TE7H 3SPVA 3LQAH 4F7PA 1AHMA 2YPLD 1AZUA 1T2QH 3S34L 1JPTH 5E8OB 3MCLH 2FRGP 5FCUH 5I6PA 2WXGA 5I74C 1TSRA 4Z23A 5A16B 3LS5L 5T5FA 1HTYA 3KH3A 4FULA 1DSFL 2G30A 2H41A 4U7MA 4NCC1 3KLQA 2F19L 2EADA 2V4LA 2BOLA 32C2A 1FLRH 3O81A 3S34H 5BVJB 1LWHA 1UM6H 4J12A 3M8OH 2J56A 2WBJB 3Q0HA 4WTXA 5E1QA 3RAJL 2EDTA 4FHBD 3NRQA 3PG2A 4LE8A 5AZEH 3WHXA 2ZOWA 4OH2A 3US0A 2JJVA 3RX8A 5JYMA 5DRXB 1E8WA 5DU7A 1W72B 4W68A 4KXCA 4EZKA 4LQFL 3V4PB 3KPMB 3E6FB 3D0LA 3W9DA 2ODIA 3M7OA 2J4UP 2XMXA 2CRYA 2PTTB 1AKJA 3OXRA 3LEVL 4FNLH 1H3PH 1LP9B 4KRNA 3BVVA 3CPUA 3FTXA 1XZ0A 2ADGB 3NFNB 3V5DA 4WENB 3ZE2B 5HI3C 3B3IA 3BQUA 3O8XD 4MA1B 1PF3A 1ZSDB 3CLFH 4ALAL 4X4ZA 1PYWB 2KKQA 2VDKL 4LSPL 2ARJB 3SJVA 1EZUA 3C2SA 3LH8A 2KLRA 4GO9A 5IVXE 4YLQT 1JZFA 1NIBA 1ZCRA 5EOTB 4TNGA 3QIUA 3RDJA 3ZSSA 4JO3L 1AG0A 1GFPA 2FHFA 1T1LA 1IKFL 5TISO 1JWSA 3OB8A 4YBHA 3IJYA 4N2NA 1ZS2A 3UAJC 2BC4A 1E6JH 3OSKA 2VRAA 4RMVA 4TYUA 4BE5A 4Z3EA 2CR3A 2NNFA 2NUTA 2ZOLB 2HMID 3P9MA 2Q3ZA 3BAEL 4JDZA 2K45A 2X6CA 1JXKA 4AQ1B 1MFNA 4ZO7A 3N2JA 1NAMB 4FMSA 1A1NB 2WZAA 3FONB 4WI0B 4YHOH 1HSBA 2YMXL 1XTLA 4F37F 3D85D 2X9ZA 2O5ZL 3HS9A 4OGAC 1RUPL 4DF9A 5L8JB 4WW1B 2GVYA 2ZXGA 5GS3A 3GFUA 1YEJH 1D5MB 4D94A 1R46A 1TTRA 5C86A 1G7PB 4CSZA 3WS6C 2ADJB 1IGIL 4P99A 4FI7A 1ZLSL 1CGSH 3K80A 2QQLL 5A6IA 5I17A 3ULUH 5D1QB 3KPMA 3RPKA 4P2AA 1ZIAA 3L13A 1BZDA 4BQBA 5I8KH 3APNA 4JGMA 1BZEA 4U7KA 5FDYA 4P3WA 1OHQA 3IGUA 4BFFA 4E9XA 2K1MA 4R96A 3VI4E 1WHOA 1U8QA 2UXGA 5ICXB 1DVSA 4DP2X 5F3BB 2EEFA 3DTXB 4KTDH 4DVRL 4O2CB 4P4KD 1ADQA 5LXGL 4Y5VC 4PUBH 2QGEA 5KAIO 1D5XB 4P5TD 2WXRA 4LLWB 3W0WD 3AROA 3MRBB 1PRNA 5GRUL 1MI5D 5F9WC 3T65A 5AW7B 1B9KA 4G1EB 3LN9A 4XP9L 2EYSA 1M7DA 2PO6C 2NY2C 4I5BB 4MD4A 1XBDA 1J9CT 4OVVA 1BX2B 1DQQA 3NA9H 4XX1G 5CJ5A 3WG7B 4GKLA 5F2FA 1FFRA 2O6DA 3B5HA 3RWIB 3FC8A 4EJ1C 2YJLA 4JY4B 1AJ7L 4WK4B 3DJRA 5F88A 3O4LD 3WXWH 1B6DA 1WWAX 5TD4A 5I5IA 3T0EB 2DQIH 2MHAB 4J4PC 2X89D 5J1SC 1T89C 1G9MH 1MEXL 3ARDA 2X38A 4L18A 3UC0L 3VFMB 5DUBA 1ZGLA 3QJFB 3PS6A 1NJ9A 3LNFA 4M8VA 3TT1H 2YRPA 3KLAB 2GJ6E 5DJ2A 3QAZB 4DKAA 5FOBA 3WIIH 4PRHB 2NXYB 2H6UA 4E41E 1KCVL 4NHCH 1Z9PA 3VX1A 4FQQB 4MA8H 1URIA 2AQQA 3GBLA 4NIYE 1RI8A 4U1MA 4R7NB 4WV1C 1WFIA 3KBFA 5C07B 2EVIA 3T3MF 3WHXB 4MVBC 3JCUO 4RNRB 4LBEB 3V6ZB 5CZXD 2JIXD 3LAFA 4IS6B 4GRLB 4X9BA 1VRSA 3NQIA 3W5NA 2R29A 2YLHA 1I1RA 4WWPA 2H7WA 5DJ8A 2OQJB 3BDXA 2O93L 1GGUA 4KY1L 4J8RB 1XF2B 4GPVA 4NPKA 2VLRB 2NY7L 2ZPKH 1QTYT 1DVUA 1YRKA 4IBSA 4N9GA 1NMCB 2ADGA 1S7QB 3HOEA 4TQEL 1RZGA 4M9PA 2UUDH 2EP6A 2WW8A 4V1DA 3A6OA 4WTZA 2NY4B 3AA6A 1V7ML 4ELKA 1DJWA 1C16A 2F7RA 1OGAE 4QIRA 1AGEB 4HBCH 4YHZL 3ILPB 1ZTXE 4AKPA 4KROB 5B3JF 1CICC 1HC1A 5C0IA 1YC8A 3BMWA 5I5JA 4JM0A 4JG0H 2UVFA 4RFNB 1W0VB 4UDTA 1BG1A 4WTWA 2NY6D 2XXMB 3TYFB 1QD0A 3QB7C 3FFDB 3U1PA 4CMMA 3ARGB 4A37A 3GTNA 4XMUA 5F7KC 2AQTA 1AAJA 2FZ3A 4KNUA 4I7ZC 3G5ZB 1D7FA 1HL9A 3TNMA 4IBTA 4ELME 3NDYE 3MLZH 5GISL 1NEPA 2DY2A 4PJ8D 3VYOA 5D6CB 3K4ZA 2R1YB 1E4KA 5J9PB 5A3IC 1KXTA 1MDAA 2PMZA 4JKNA 3U46B 3UBXB 1DE4B 5D7HA 4C83B 5IW6B 4Y1SA 1HHGA 3FQUA 4JRYE 5DT1H 1T3FA 4JZJB 4RDBA 4PR5B 1USZA 1MHCB 3X3FL 1AGBB 4LU5L 3M46A 1VGEH 3BIKA 1REIA 1J1OL 4KK8D 4JFEE 4X7SH 3EF7A 2YN3A 4RFOL 2GSGB 1NCDH 4FL4C 5F3BA 3KYMA 4KNQA 1C8PA 3GRGA 4KI5E 4N8VB 1KIRA 1G7JB 1FCCA 1VZHA 2LTQC 4FFYL 4KJYA 4UYQA 4YAQB 3II2A 1KCKA 4L1DA 4HK0B 4LU5H 2FT6A 1HH9B 4XZUB 1MIMH 4NZUL 2AFNA 4W9EC 2A4CA 1N0LB 2FVNA 2MCPH 2DKMA 3DJ9A 4NO3B 1AGFA 2W0FB 1BF5A 4YGAB 4ZUVA 1NFDA 1KYAA 2R7EA 3LRSB 1QLEB 4HCIA 4MD4B 1SEQH 4WUUA 1JV2A 4TSCL 4XP5H 1BFOB 3ARQA 3X3GH 3BAJA 4FQIH 4X4KA 2YBRB 1XZWA 4FXTA 5HDLA 3WOVA 1A64A 4PPTA 5FGBC 2FSEB 1P84K 3DIVA 3TEUA 2F74A 3O6FB 4TPRH 3RG1C 4M00A 4UB0H 2GEQA 2BM3A 2ZWZA 2A74A 3CHSA 4PJAE 3IFLL 3ZU8A 5DGRA 4XCFH 3W38A 3D85A 4M62H 4PB9L 5CJQH 4FQJL 3TBTB 3VGAB 2WQWA 4OZIA 3GMPA 2J6EH 2YSSA 1LMKA 3BKCL 4XBGA 4IU3A 3D0AA 4PRIA 3K8LA 1UB6A 4YUEL 4HALA 5E03A 1QI4A 1CFQA 4P9ML 4QRTB 4JHWH 1V10A 5C7ZA 3WKNA 4GXFA 4D9LL 1LLAA 4FQPA 3RUGA 3W11D 1UM5H 3SOBH 2DQFB 2YGOA 2A7BA 2XTJD 5ABZA 1X5AA 3QQ4B 1COBA 1P5VA 1ZVNA 3LPGA 4LBAA 5E99H 1SXCA 4PW4A 1YN7A 4K71C 5DVLA 5CUSL 3L7FB 3RWDA 3W2DH 2RCSH 3V5DB 4L3EB 1WFUA 2O72A 3DMMD 5FFGA 4K73A 3RNKA 5C6PB 3C8HA 4PYGA 1OAYH 1JHLH 1WYJA 4U3SB 1KSRA 3RVVD 2ZNWA 3TO2A 3U6XS 2XQYG 5CNHA 5TH2B 2CBPA 2CGZA 4E41A 1NAML 4LIQL 4NQXA 4OTXH 4HUUB 5LCVA 2E0PA 1OCCB 1XXFC 3IJ8A 5G38A 1CD1B 1CGTA 4LMQE 3UBGA 5MHSD 3AGVA 1K72A 3HB3B 4NQED 1M3IA 1YQVH 2ETWA 3ZQXA 3PGUA 1BXVA 1A6AB 3Q8BA 1XF3B 1Z3GH 5F9JA 4KO9A 4PD4J 4OZIB 4B60A 4QHPA 3BP6A 1JPGB 4CA4A 5EC1B 1GGYA 1YEDB 3U9PL 3U36A 3HEIB 2HT4C 1ACYH 4Z7VE 2XWCA 1W15A 1MWAL 2H6PA 2CO3A 3IRCA 3C5JA 2G2PA 2GBVA 3E1ZA 3NTCH 4XO4A 2D7QA 3P0VL 1H9VA 1TEGA 4O4XA 2BXZA 2BY0A 5IK3B 1FZKA 1URLA 1YEIH 2K3HA 1B2WL 4ZMAT 3KL0A 2X41A 1RPKA 4F93B 4WUKL 2WB1A 5KG9A 2CKNA 3AS0A 4A2LA 4AYFB 2NQCA 3MTXA 7PAZA 4HX1A 4P06A 3RHWF 2V17L 4G83A 3NQKA 4NNPL 1G6VK 3VSTA 3A4AA 5D1QA 1OAQH 4G7VL 2XY2A 4LHQB 4G6MH 1JUFA 2HRHA 3AREC 2LOEA 4MJIA 1IGYB 2FL5B 3QK0A 2J6WA 2VC2B 4GRWE 1N5AA 4EO5A 1L7TH 1KCSL 1EGJH 1JK9A 2R2EB 4OCYH 2NY5H 1OARH 4WI0A 1O9VA 2EKJA 1MJ7H 1P4IH 2WTRA 3G6JE 4PJEE 5IROC 5BV7H 1KBGL 4MNQD 1BCIA 4QHLB 4KO7A 4B7LA 1UD5A 4FQCH 2F5BL 2XBZA 4HK3N 4R0LB 5B5EO 3APMA 2QV4A 2HPTA 1C5BL 1MJJB 4OLVH 2Y7QB 1FNGB 2R1XA 4FG4A 2ZX9A 3P73A 3L08A 5B7EA 4JO4H 1FE8L 3FQ2A 4MKMA 4POZD 3RURA 4D0BB 4E9SA 4KQ4H 4FXKC 5CP3A 3T0BA 3CX2A 5GS0C 4FYRA 3F7YB 1BIHA 4I0PB 3N5AA 4JVWA 5I1HH 1U21A 5DEZA 1QVOB 1PJ9A 3NIGB 5F72S 2A6JB 4CSPA 1JDAA 1A0QL 3F64A 2ZKXA 2DEYX 4FI6A 2WBJD 1SQ2N 5DL7A 4NKOB 5CJ8A 1GL4B 2E27L 3RDTD 2B9BA 5HPMB 1ES0A 4KR8A 5A6LA 1KELH 4WK0B 4HGKC 5AZUA 4GCPA 5AOMA 2WB7A 4LEOB 2NMSA 4NJAH 5CHNA 4YBQD 4AIXA 3BXNB 3L4TA 2C7UA 1UXWB 1U2YA 1R3LB 2WJ5A 4F8QA 3L3OC 2FIKB 1TTAA 2QVKA 1OAZL 2DQDL 3KH4A 5C3IA 1KMGA 4PGCA 4PG9A 4XC3L 4DUXA 5T1LA 1YAIA 2CKBA 1UURA 2CMRH 4K3GA 1F3JA 2DBLH 4OF6A 4QD2E 4CUCA 3NIDB 2F53A 3ZTCC 3R06A 3IFNH 2QR0B 4JKPL 1RJYA 2XFGB 4MB3A 4NQSB 1D5ZA 5GGRB 2IWWA 1T22B 2VLLA 2I60L 5IFAL 2YUXA 4ONFH 4AYMC 1FL5B 3UPGA 4MDJA 4BRJA 1L9QA 3VUAA 1RK1A 1XGQA 4N6RA 4NDMA 4J8RA 4QO1B 4NUMA 3IGFA 4WGVB 3BP5A 4KFZC 4I88A 1RU9H 2CUHA 2EDEA 4NFBA 4B53A 1OWRM 2R0WH 4PRDB 2VO8A 1VPOL 1X5LA 5IQ7H 1DCEA 2XE3A 2C3VB 1QSVA 4U4BA 3RWEA 5EZLB 1HH6A 2YEQA 3IJEB 1AC6A 2MQCA 3DJTA 4Y5VB 4JRYA 2J6EA 4Y19D 1AACA 4G8IA 5D93C 2K6WA 3KJ6H 4LL4A 3ZTNL 3SCMD 4P23D 3D34A 1D2PA 4AGPA 3CTTA 1ZHLA 2X42A 3QJHA 3UG4A 3PWLB 4KTYA 4PMEA 1K4DA 2QDVA 1WGVA 3COOA 1K8DA 4ZPVB 4K3JH 5TE6H 3WL9B 1YEEL 1LK2B 3ARGA 2CD0A 4JGJA 4IK6A 4WJ5B 4IRSB 2VDNH 3N0AA 1NJ9B 4IK7A 2Z9TA 4CVZA 5AENA 3D4YA 4K07A 4M7JL 4OFVA 5CEZH 5DEGA 2VZ1A 1NC4B 4Z95L 1FO0H 3MBEA 4X6EB 3QDJA 1FL6B 5AOKA 3U0TA 2Y06H 5KYUA 5EDXA 3SQRA 2XBTA 1T0NA 1OCOB 3AQYA 3QPXH 1I9JH 2CLRB 1O6SB 4NIKB 3CVHH 4XMVA 3O9WD 5EZJA 5IQNA 4Z7NE 3QUYD 4N20A 4E42A 1WH0A 2GHWB 5HDBB 4YSCA 1DVQA 5D1XB 4QXUL 2GJ6D 5A43C 2P5WE 3MBWB 1J48A 3PNRB 3OHXC 1NDGB 2GCYA 2Z3FA 4M43H 5HHOD 1ZA3A 2H32H 2NX5B 3KVQA 5ISZE 2J44A 3D30A 5AAWA 1F13A 1IEBB 1KEGL 2P42B 3CN1A 4MAUH 5L8LB 2W0KA 3DYPA 3PNWA 1AIFB 4PJ8C 2BINA 2XC8A 2NR6C 3PUCA 3FO0H 4NLAA 4EI5A 1NBYB 2Y7NA 5EC2A 4F9LC 1IM9B 1TVDA 1J1OH 4YSOA 2JCCB 2GJ6B 3AA0B 4B61A 2UWEA 4HQQL 1AGCA 3JV5A 3RJOA 2FEDC 4AUYA 3NG5A 3I74A 5L2KA 3DI3B 5EZIH 1WBXA 2GJZA 3FB5A 5FUOH 3AJ7A 4X80H 4N90D 3CSGA 2D7OA 2IPUG 1DN2A 1F4HA 1Z0MA 4MMYA 1QSEB 3IEAA 1XGTA 1WA1X 1E6JL 1THAA 4TQPA 5CLTA 4I4WB 2WNGA 4YFEA 4HJJL 1MW2A 1IM3B 1NAKH 4FNTA 4Z0XB 3CZKA 4R2GB 4LSVH 2F0CA 2ARWA 5GHWL 15C8H 3BW9A 2AK4E 3AY2A 3RTLA 1AO7A 1T6WA 4Y5YA 3N1GC 4KI5D 2P7TB 2HFEA 1KEML 2IQAA 3TEXA 2EICA 5ALCL 1N26A 2PABA 3GEFA 1CPUA 1VFAB 4N2AA 3G5XB 4KHXL 2TRHA 1UCTA 4GAFB 5F1IA 2WXPA 4AZ8A 2HFTA 1OAQL 5F0LB 2P3YA 4PV1C 1DQML 1VFBA 1N6QH 3T77A 3FRUB 4XPGL 1ASOA 1CDCA 1VZIA 4ZDHB 2KI6A 5HHOE 1R24A 1OSPL 2W91A 5ALBL 5ISZD 1AY1L 3W39A 1QBMH 3HNVL 5MENA 4ICWA 1SYSA 2IGLA 2FX7H 4IGBB 4LVHC 5I18L 3RJDA 5D8JH 1PY4A 1DFBH 1S9WA 5HHQA 3L7EB 3IK2A 1VZGA 1UKSA 4L2LA 3ME0A 1RFDH 4B3EA 3WHE1 1DANT 3SYAA 2AJ3A 5BXFA 3GS0A 3NUKA 3OAYK 3AA1B 4LSQL 4XHJC 4DN4L 1FZOB 2H5UA 2IDUA 3ETSA 3C60A 4NCC2 4PJCF 1FN4B 3T0VA 3ZZQA 4PV9A 2WCSA 1JGVL 1FE8H 1YN6B 3PDGA 5BW7A 5IEKB 4HHAA 2H3NA 2BDNL 4X7FC 3TH4T 1QFWM 1IBYA 1T7YA 5ID0B 1FORH 2HCZX 1GYWA 4HUUA 1P7HL 4MNQE 1PZ2A 3TJHC 3VG0L 2ENYA 3JV4A 3QH3B 3ABZA 4Z7QB 2VERN 2XPZA 3AFLA 4RISH 3OZ9H 4X5WB 5EOQL 2WXOA 1AFVH 4GQZA 2VWEE 1QBAA 1DQLL 1SEBB 2IMMA 4LDOB 4HG4K 3DVNB 4XN7A 1MQ8A 3QIUB 2TSAA 3WTWA 2X1QA 1E3FA 4IHOA 2F53D 1LO5A 2XY1A 2EZ0C 2VXVH 1I3RB 5KVEH 1I8LC 4QOKE 4F7CB 5K9JL 4AIOA 5SWQB 5JDPA 3S98A 1U3HD 4O3XB 5FGBA 2GG1A 4OCWH 1AGCB 2X6AA 1XIWA 3X14B 2CH8A 4G6ML 1OAUL 2CRIA 2DYPA 3GBMH 5DTFA 5LO7A 3UEQA 2AQRA 3QJTB 2QTEA 4GBXB 3T08A 4Z8FL 4YSTA 2ZUQC 1GCYA 2V6HA 3IDMB 1NLBH 1DLHB 4JFFE 1MAMH 5D7LD 3LX9A 3RFZA 2C34A 1KNOA 4OJAA 2EEBA 1GGIL 2C9PA 2DQTL 4ETYA 2R0LH 3PWUA 1OM9A 4NAJA 3WTUA 2CR6A 3ZL4H 3BT0A 6PRNA 1I8KB 2Z7YA 1WWBX 2AXJA 3DETD 3VE2A 3ZQWA 2CIIB 1KJMB 1YYCA 5C08D 5I5RA 2WXLA 4RMWA 4M93B 1V27A 5HHNA 4JFDA 3MLVL 3O4OC 5EBGA 3V9FA 4MZ2A 1IGTA 2IAMD 4JKMA 1FYTD 1KGWA 3DURA 5I8OL 2R2BA 4C4VA 3S9DB 3QEUB 1TZOA 4ODTL 2NSQA 4JO8A 3ES6A 3T4AB 4JKWA 2ENQA 4K3HA 1PZSA 1TQCC 4U1KA 1UATA 5T33H 1PVHA 3NCMA 3MGTB 3K6NA 3F5WB 2CHZA 4K8RH 3BC9A 2Y36H 1NCAL 1TQUA 2XTJE 2ZQKA 3MBED 4FZEH 5I1IL 3FRUA 1J1PH 1SUHA 1HL5A 1BQLL 3LZFL 2ATPA 4L9LB 2AKRA 2XWJB 1U58A 4OD3H 2XV0A 4O5LH 4N28A 3MRQB 4JPSA 3T0AA 4DAGH 3ZT5A 3JBG7 3I85A 3EFFA 4TUOB 5T1KD 4F57H 2MSPA 3L5XH 1SN5A 1OZTG 2JFCA 4BFKA 3P0YL 2QMKA 4M6NL 3BX7C 1MCIA 4NRYB 4N8CH 2DKUA 3MJ9A 4PRDA 4WY7H 3U9UA 1FLRL 1DO6A 4PLNC 1SOKA 3FU0A 3LSOA 2ZG3A 3OKDA 1RVFH 2OM5A 3GO1L 5A2AA 1A02N 3A3YB 2VLKA 1QAWA 5L6YH 1XGUA 5BZZA 3RY4A 3R0NA 3QHFH 3ZT7A 2FWOA 4N2FA 4GSDH 1OVZA 1YEWA 4YX2L 1CE1H 3K6DA 1ZVSA 2ATPB 4L9LA 5E8PA 4NQSA 3QJHB 2DAVA 2FQFA 3QCUL 5J4MA 4Z7WE 4RRPM 4FLRA 1WF5A 1MUJA 4XX1E 5BVPL 4OCNC 3KYAA 4F1SA 1NANI 2NUPA 1AGEA 2LVCA 4K94L 1JXFA 4XWGL 2E9WA 3BH4A 5D2LB 3SGKA 1LVEA 4YXHH 4U6XA 4FG0A 4QXGH 4FXGC 3RKDD 4BFIB 4PJHE 3KPRE 1XF2A 4LSPH 3INUH 4N3UA 4MXVF 1OD9A 4NQEE 4N0CC 1E4WH 5DJ8B 2EO1A 5KTEL 1N19A 5I9QB 1FNAA 3HCVA 4NM8H 5K1VA 2CIIA 2C4FU 4NN7B 1K2DA 5C70A 2XN1A 4PJIF 3FT3A 4HMEA 2J5WA 3FW6A 2M26A 5ISZB 3CZFA 5GGTL 5E2UH 2DD8H 4PJ6A 1RULH 4ZFGH 1J9RA 3QJXA 5H37G 4F3FA 5I15H 1CB4A 3NA4A 4PRHA 2EJ1A 5D7KE 1ET8A 3ZN6A 2RCSL 3HR5B 1LO0L 1PAMA 4KHXH 1KCUL 5IROD 2DTMH 3MRFA 4UNUA 4YZFE 3GF8A 4FNSA 1CGXA 1SHXA 2CBTA 2HX9A 5DTFB 2Q2EB 3AS1A 2DWDB 5SV3A 1S3KH 4TUOA 3LCYA 1X5JA 2V5YA 1OLZA 3BP4B 2YXMA 3B4NA 3ARED 5EWIH 4OF5A 4YXLH 5IESH 1GFNA 5HYEA 5FWRA 3AXHA 3KPRD 2WAQA 3AAZB 4G8FA 4O02A 2VN4A 1SUJA 2QHRL 2RQ8A 2YGNA 3G6AB 4FNPA 3RVVC 5JPNB 2BNQA 2DQMA 2CJTA 1I8IA 1GMIA 4PJ5A 2G5BB 2X0VA 3FO9B 3VI3F 3GHPA 2DPKA 5I1JL 3KR3H 1L0YA 3VWJD 1M71A 5EO0B 3ZO0A 4AMKH 1MH5A 4DSYA 4KKAC 4RFOH 3LKQB 2YK1L 3FSVA 4YN3A 2W8CA 1UT1A 1C08B 3KAAA 1MFVA 1N10A 2XTJC 4MCNA 5AUMB 4TNFA 1RD6A 3DX0A 1EFXD 1KCBA 2A6DA 1XV8A 4ZZFA 1FC2D 2FX9H 4X99B 3PPEA 4XBEH 3FQ4A 3D3VA 3TBVB 5E08L 1TJXA 1LE9B 1KJ3L 2X1PA 1ZPLA 4OLUH 1N18A 1X5FA 5AAMA 2ZUXA 4R96B 1U33A 1SM3L 3X1FA 2FQEA 3NZ8A 2F7PA 1O7SA 1RIVL 4R4ND 3F00A 4JFYA 5G55A 4I48B 1KEMH 2X4RB 3TL5A 1RZ8A 4IDLA 3KPSB 3AU1B 2MMXA 4H8WH 3MJGX 1X4XA 4YSPA 5C0BA 1VGKB 1PEZA 4Y2OB 5KVDE 5E8EA 5D96C 2XZCH 4B0MB 1ASQA 3MBEC 5F8RC 5I1CL 1P2CB 1QWUA 3N41F 4NWTL 3QFGA 4ZS6D 5C0RL 3PP4L 5HGHA 3MACH 4X8JB 1YCSA 4F20A 1XCTB 3BXNA 4PGEB 3MRPB 3UZEA 1J5DA 4FHKA 5IUCA 4JR9L 5IB4B 3FT4B 4JDZB 1T1WB 1DLFL 2F1TA 3K74B 1MOEA 1I7UB 3FT1A 3CHOA 3BSGA 4G8GE 5IJCC 4KQ4L 5C0FB 3CSYA 2EDLA 3OV6A 2ZUUA 4GMTL 3NZHH 3WY2A 5IOPB 1VFAA 1DYZA 4LVNB 5I0VA 5TK4A 3RDTB 3PP4H 4M7LH 1RUKH 5EC1A 2AJZB 3ZKSD 1KC5H 1YAZA 1A0QH 3DSFL 4IM8A 2YSSB 5D7EA 3GXNA 4MMZB 1U95A 2FNWA 4OZHF 4U2ZA 2P8LB 3ZHKA 1FNGA 2R1XB 2D7PA 8CGTA 5E8DL 3QXAB 4TOYL 3MU3A 3SQOL 3TPUB 1CFTA 3BLPX 1G5AA 1IM3A 4CC4A 3V0HA 1G5GA 3BGFB 1QHOA 1KB5L 3TEZA 3C5ZD 2E9GA 3C60B 3LIZH 1FN4A 1WSST 2AJ3B 1MF2H 1P6FA 5C8JB 2IOIA 4NO0D 1FZOA 3PFUA 1E0OB 4MXQD 3RY5A 3HN3A 4Z76A 4HF5H 1Y7VA 1OGAA 1X5ZA 4MD5B 4FZEL 3CH8A 4GO6B 4G6AC 2R4RL 5LBSH 4G42B 3TNNB 3H2PA 4P9HC 3TEYA 2PPCA 4EZMA 1TQBB 2OSLA 2YMOA 1RL1A 3QDMA 2QSCH 5TFSL 4UINH 1HYRC 4M6ML 5DO8A 2RQEA 1O7DE 4HAKA 5E1GA 2E46A 1ZMYA 2YEZA 3KLHC 3VD0A 5E6YA 4PJDA 3NP4A 3VE0A 2G5BA 3FO9A 3FT0A 3IE9A 3LXCA 4XGZB 1P1ZB 2QDWA 3NCYS 1MUJB 1RZ8B 4DN3H 3MLZL 3H85A 3C5JB 3O2VH 2VN7A 4JL1A 4MYPA 5GISH 3ZKND 3RVWC 4ANXA 4Y16B 2ZCKL 4YE0A 2N59A 3C6LD 1E9QA 4I2XB 1A25A 2M8XA 3RX5A 2WLNA 3W37A 3G5XA 1A8ZA 1HS6A 4OI8A 2WVUA 4QYOB 1O6SA 3ZBMA 5IVNA 5FX3A 3WIHH 2YKKA 2JELH 4JRXD 2NY6B 3AXIA 3NMEA 5E00B 3VSVA 1QUPA 1HEHC 2VJ8A 3BH8A 4Q6KA 1B4RA 1N70A 4GSQA 4JPWH 4N0UB 1BBJA 5CZXC 5TH2A 3GSQA 4Y4FA 1CI3M 2OXGA 2QFRA 3GMRA 3FFCD 1FI8C 4JCLA 2V2XA 3NN8B 3ZDXB 4JFEA 1F6AA 5J13C 4IBQA 1I82A 3SKJL 3C6SB 5H94B 3C9NB 4N2OA 3T8XA 2FYYB 3GMQA 3KYOA 2BZCA 3PAUA 1F6FB 3WDJA 1TMQA 3OKKB 1RURL 5HXMA 3QC5X 3MNVB 1HHIA 1EZVY 3RGVB 4E9RA 3QQXA 3G6JF 5EU5B 1MNNA 1CFMA 5L2KB 1TZAA 4HJSA 4QHUA 4BSWA 2XKUA 3FU6A 2NY5C 3APCA 3FUIA 1CWVA 4PJ7E 2Z92B 3VTMA 1OANA 2Y0LA 2F08A 5KBMA 4MTMA 3WLWD 3X1GA 2YS4A 5CSBA 1HAUA 5AW1B 1SDYA 3KXFE 5KSUA 4OKVB 1FHGA 5D70H 5A1AA 2FBJL 1G7IA 2ZF8A 4GUCA 3AAAA 4G7RB 4N6RB 2PNDA 1ICTA 3T3PE 3S36X 1WBYB 1IFGA 3V4UH 1IZNA 4J4PA 1F45A 2JIXB 4OCMC 2Q8BH 5ES4B 1RUAH 3OPUA 1KPUB 2AJYH 3VFNB 1ZAGA 4AH2A 1SMOA 4XH2B 5JHMA 1W8EA 4PVNA 1YEFH 4JUSA 1KN4L 2QR0A 1CTOA 3HHRB 4AL8C 3GMNB 3UDWC 2NSMA 3B5GA 3PFQA 4Q58C 4BK4A 1BJMA 4QRRE 4M3HA 3PWJB 1F3JB 3SY9A 1FG2A 3U9UB 3V5HB 1EFXB 2YZ8A 5DZVA 5FC9A 2HUHA 2NOYA 1S7XB 4FQXC 4MDIA 5JHDE 3LRGA 4QF1B 3U0TB 3ILPA 4NRYA 3MAWA 4POYA 3NJIA 3S36L 4DUVA 3DK2A 2QBWA 5HY9B 1PQZA 3RFZC 3TCTA 3WNLA 5AW3B 2FHBA 4S1DC 2NSXA 3DDFA 4L3EE 4G6JH 3ULUC 2I26N 5IB3B 2QSQA 2NR6D 3BSZA 4AEHH 1N59A 2ATKA 4RETB 4WEBH 5HPMA 5SV4A 1B4LA 1OB0A 1WZ1H 3N9GH 5D2NC 3GSXA 5E8PB 1IBZA 4TULH 3V0GA 4O3ZA 5F96L 2E7MA 5E56A 4E1TA 2NQDA 5ESVB 3VZTX 3LV3A 4OLYH 1E4WL 5EIIA 1T1YA 4KJWD 4KHTH 4AEHL 5CJXA 4KV5F 4G7SB 1VF5C 1ZT7B 4GW4B 5H37A 3T0WA 3Q3GA 3RVTD 4QJ4B 2PPDA 4NO5B 4XXDB 5D6CA 2C4FT 1HIMH 3KWWA 4OLZL 2EABA 3RY6A 2PYFA 3S96A 3TTYA 3O9WC 4J39A 3NACH 1ZSHA 4P5MA 3G5ZA 3TNMB 3TCXA 2DI9A 4KKLD 2RFXA 3D3VE 5AZ2L 1UCBL 2X1OA 5TF0A 2BSBA 2XZCL 1M2OA 3FCBA 2VLLB 4PJFB 1OCWH 3V7AE 3KVDD 2UXFA 5EIVA 1AZRA 1T6VN 1TOXA 2FJGA 3N3EA 4G7YL 4FX5A 4ZJ9A 3VD9A 3VH8G 1OTUD 3UTPD 2X4QB 5T1DH 4TSCH 3SDYL 4N3TA 1ZHKB 1KGXA 4U0RC 4K7PL 4Z7OB 2KH2B 1FO0B 2EIZA 4P2YA 2Z6FA 1EEYA 3PDDA 4HK3J 5DYOA 1VESA 3DSNB 1E40A 2FJHB 3DNKA 1AH1A 3PQYE 3MDJA 3ZKNC 5JHDA 5J6HB 1NINA 4Y88A 3M17A 4BJLA 2PO6B 2YOCA 4DPRA 2MQ3A 3LH2H 5DF0A 1PY0A 1FUNA 1CR9H 5HVFB 2AXGA 5EU3B 1EEQA 3MI6A 3ZKMD 3BI9X 3G6JB 3EO0B 1A4KA 1X9QA 3QPQD 4FXGB 3UU2A 1QNZL 1NSNH 4HXAH 4PJEB 4XNXL 3MUGA 4I9WD 5F1KC 4CRPA 1A7BA 2FJUB 2B1AL 4PP2B 3LKSA 4LSRH 4KI5F 1THCA 1BGXL 1HQ4A 3RVUC 2YO3A 3AQZA 2BC4B 3V6ZA 1B90A 3E7JA 3S3PA 3WKML 5IMOA 3DUUA 4L9DA 1W72H 4HMCA 1INQB 4IRJC 4HT1L 4PJCE 3H8NA 4DIXA 1QOKA 2R59A 4X6BB 3TIEA 3PQYD 3GLEA 5B8CA 4QRFA 5DZ9A 5JW5A 3EO1A 3WI9A 1MFCL 3GB7B 3P3UA 5MHSE 4K3EL 4AUIA 1YUHA 1PU0A 4X6FB 5DMKA 3ZE1E 2Y2TA 1BLNA 4WW1A 4NO2B 2BW4A 4TTGA 1X7SA 4NRXA 1CGVA 2W07A 3MOAL 5EU7E 4NO2A 2OR9H 3NIGF 4D8OA 1NGQL 4KTEH 1TJHL 2Q0ZX 3WEXB 5BXFB 1J87A 2R2HA 3E80A 5I1CH 1UD6A 2SEBA 3L95A 4WVRA 1NCHA 5HHQB 3MLXL 1VDGA 5DEFB 4L4JA 3WBDA 3QULA 5DRXA 1INQA 4G8EA 5T5FL 3Q48A 2I69A 4FRXA 4RQQB 2EYSB 3C5SA 5J3HD 3ZTJH 1YNKL 5FYLE 4J7RA 4UT9L 1ZIBA 3BE1H 5EULV 3FSWA 1UKQA 5B3JE 2BX5A 1NAMH 4BUHA 1WBZB 4JCWA 4LCCC 3D18B 4L8SC 3CXDL 2A9ML 3HKZA 2ODHA 4A7GF 4J3BA 2PCFB 1IMHC 3EHBD 1OY3B 2EVFA 1YN6A 1YZZA 4YL4A 2EIEA 3B3IB 3BQUB 1ZWIB 4LVEA 2ZUWA 2ENJA 1CFSA 3VI3E 5DZPA 5DO2D 2J4WH 3WN5B 1DHKA 1FVEB 2PTVA 4XCNB 3PL6D 2I9TB 4PRPB 2GE4A 4PP1D 1KCSH 1EXGA 3GKZA 5EH1A 4NXKA 2MTAA 4RAHA 2IC2A 2IOMA 3RZCC 5IJBC 4PUBL 5I17B 3O0RL 2UY7A 2OR8A 4HWEH 3ZIMA 2MKWA 1OF0A 3NBNA 1JF6A 1A7OH 2IMNA 2XG4B 2YPLA 5FA4A 4MMXB 4CDGC 5E5MA 2W0PA 5J1AB 3MRHB 2P5EA 2NW2A 1IARB 3DC0A 1E5BA 3UIYA 2XN9B 4X7DC 1MCFA 3DYOA 3QXTA 4Z7UE 3BAYA 5AVVB 1E4XI 4LRNL 3TIDA 1G7MB 3V0IA 1FH5H 1YEGH 3ETTA 1G94A 2BSRA 4FF9A 5L4IA 1JTTA 5GIRA 1W72A 1JRHI 2PF6A 3QW9A 5FYJL 4POUB 5LB1A 3KE0A 5MEPB 1NL0L 1KBVA 5IQ9A 1QLRB 3RBHA 4NS0A 2IH8A 1LHZA 1E5UI 1PDKA 1M57B 4H1LB 1QFPA 1TO4A 1HOEA 4F8LA 2TSBA 3BSZL 3FRPB 4DGWC 5BZDA 5KS9B 1M6UA 1R3JA 1M53A 5CO1A 3RGHA 1X4YA 3O45A 1J9SA 3GSUA 3ZW3A 2ZUSA 1AE6H 4HOMA 5DSCA 3IYLW 5I8CA 3HG4A 4HZLA 5IB3A 1KCWA 4ZSOA 1WGOA 5I73C 1L3WA 1KTJA 2P24A 4AEIH 5FYKL 3Q06A 1ET7A 1KN2H 2OMXA 5CP7A 2W60B 1WT5C 2GEEA 4BD4A 2FNBA 3HRZB 4PY7B 4YSRA 4ZW3A 4O3YA 5JXEC 5LDUA 5CCKH 4U1HA 3QG7L 1H0DA 4PJGF 5T1LB 3ZRSA 3KG5A 3OJVC 3BAXA 2DDQL 3ETBJ 5K69A 4JK0D 2F1CX 4XNUL 1FP5A 4MXVE 1DQTA 2O5XH 4JFEB 3VYPA 4I9WE 2NT1A 2Q2LA 5IKCB 3ARRA 1UKTA 5LGJA 5HGAB 2B1HH 2GJJA 3GSNA 1E3ZA 1E5AA 3BLKA 3SBQA 3TBYA 2ZKYA 4B6ZA 3QYNA 5DJXA 4IIQC 1ZA3B 2CG9X 4NBZB 1S3KL 2HXAA 1UWXH 3L5HA 1EK3A 5IOKA 1E8ZA 1YEHL 3NACL 3OVUB 4Z7WF 4XMLL 4UBDC 3PDOA 5A2BA 4H1LA 2HLAB 4BDVB 4QHUB 1QWHA 4BSWB 3PYCA 4Y2DD 3OD3A 3MV9D 2I7SA 4H1LG 1DQMH 2Z7ZA 5AL8A 3IN0A 3L4XA 3ZMNA 4OM0L 4M1DL 2NY1C 3D06A 4KDVA 4R97B 2AQ2A 4RRPA 3EUDA 4E9QA 4NZ8A 1KIPA 1N8OE 1GKOA 1SBBA 3FB8A 1RUMH 3IXTB 1AXSB 2JKXA 5C0CB 2V2XB 3NN8A 2YUWA 1QASA 2OTWA 3N1QC 4LARH 5IMMB 2XRAL 5IHUL 3PWLA 4MCZB 1OP5K 4HD9A 3QCVH 5CIPA 3QYCA 1J1XL 4FNLL 3HBGA 2FL5A 2XG4A 3QRBA 3SKMA 2QTVA 4K8RD 1MCNA 2MCMA 1UXLA 5LGHH 2ZAIA 4PJFF 3ZDYE 1ZJBA 3HUJA 4JG5A 2MOQA 3MX0A 4FLSA 1SM3H 3QZBA 2KZKA 4G6FB 3LRMA 1HXUA 3OKLA 3F65A 2X05A 4Q9RH 1DBJH 1OP3K 5F89A 3RB5A 5CEZL 3RWFB 3FCSA 1JPST 3IU4H 3BHBB 1F00I 5GRVK 1UYWL 1VHPA 3LTVA 3N42F 3QUYB 3EJSA 5C0GB 4UTAA 4MCYB 2DQGH 3DWNA 2Z35B 1YNTA 3HMXL 4XBPA 3V8CA 4ELDA 4ZMVA 2PPEA 4MNGA 1U3HC 4P2RB 3A24A 4OFYD 1MCKA 5T3ZL 5GSRA 2MPAH 4V1DE 1G7HA 2VXUL 4FS0A 4AYEC 3C5SB 1VFOA 4KQ3L 4PJEF 3BP7A 4H8VA 1X9UA 4LKCB 5D6DA 5DEFA 4APQC 4TSAH 4N22A 1OTSD 5JPMB 3TZGA 4HH8A 4HUWB 5E6ID 3WN6A 1HHIB 4MAUL 1EHLL 5GRJL 1PG7W 1ACZA 1BF2A 3SDXF 2Y0KA 4AKRA 1XFPA 1Z9OA 6PAZA 2ALAA 4UOJA 4PI2A 7PCYA 1C5CL 3BDYH 3LKRB 3HBZA 2LABA 5JQHC 2FIKA 5E9DE 2IOOA 3EJZD 3D4ZA 2CO4A 3HJ0A 4OZHA 4JY6A 3IXAA 2AABL 4GS7B 3DOSA 4JHAH 3HPJB 1KCRL 5JHLL 4RAUA 4BH7A 3LY6A 3GMLA 3UCQA 2TAAA 4H5SB 1J11A 3I02B 3A6CH 3I3DA 4L4TB 5ACLA 2B16A 3HE7D 2JF1A 4I8DA 4N1EA 3BUBA 1QUNA 2BFVL 3BPLB 3LH2L 1JE6A 3MVSA 4JFFB 4Z7QE 3L16A 2Z93B 2GTWA 1PLGH 7TAAA 4NENA 4MQ7A 5EU4B 3LPFA 4XPHH 3WFBH 1RUQL 3L4YA 4S1QH 2VDOH 3RL2A 1WAAA 1NEZA 4C58B 2VR3A 3C8KA 2ESVB 1R3HA 1Z5LA 1IGIH 1QSFB 1U8KB 1IAOA 3N85H 3U2SA 4B41A 3F6JA 3EO0A 4Q56A 5TE4H 5DFWH 1EAPB 5HYJD 2VE6A 2IG2L 2VDOL 4QWWC 3IXAB 1OSZB 2ZOTA 4RA3A 2D9CA 1FFTB 2BJML 3ZE2F 2IGFH 1KT2B 4AUUA 2ED8A 4LOVA 4H26A 1NCBH 3LDBB 3W81A 4JRXE 2R8SL 3O41B 3L3GB 1G6RB 3CPLA 4LDCA 3QWRA 3I3BA 1UOKA 1Z66A 1I8UA 5IHBA 1EX0A 3POQA 4PRNA 1WEJH 5C08B 5CBEA 3MNZB 4CVWA 1GFQA 3DWOX 1WC7B 2Q3AA 3DIFA 1FBIL 1KIRB 2HJFB 4JM4L 1F56A 1Y6NR 4Z78B 1G7HB 6TAAA 2O4EA 5LCVL 4ODHL 5DDHA 5E1AB 2HJKA 2ZX6A 2GSGA 1KPVB 4NWUL 5F6IB 4Q4IA 5J1TC 4HIQA 4WW2C 1EAPA 3D50A 3QI9D 5DMKB 2FECI 5FIEA 1RK7A 4Y9CA 1IGFL 4MAZA 3U2SB 1AFVL 3BSZH 1ZXQA 1HVXA 3ZKQD 2D8KA 3KWXA 2IO5A 5JHBA 1VACB 1A4CA 3FF7A 3O2DA 3VFPB 4NQCB 2DLHA 4FMKA 4FDWA 4M5ZL 3RJQB 5FO8A 2BLFA 3B2VL 2E4FA 5ETUA 3KHOA 2W9EL 1N8ZA 2A9NL 3U4BH 3VXUD 1NFIA 1FLTX 4NKQB 1FA4A 3MJ9L 3F2LA 1PKQE 3BKMH 3LNDA 1HQ4B 3C6LB 5DJXB 5EB9A 4UNTA 4QTFA 2F74B 4NKDB 3WFDH 3WLWC 4BH8A 2FGWH 3CE1A 4MAYD 2XVBA 1OCZB 4IRZH 5JQ6H 3KLLA 4JG0L 5F44A 3L4CA 4QF1A 3OKNB 3V0VB 3QDJD 2JI3A 2EDFA 4PB0H 1W0VA 3Q6GL 1H6FA 1KTCA 3QDGD 3A0OA 4M7ZB 3RQ3A 4UQCA 1XH3B 4MA7H 4E5XB 4WO4C 1YPZA 3IFPA 1NFDE 4GP5B 4U1LA 2WC7A 3WV0A 1NOFA 4JBSA 4ES9A 3GTTA 3QAQA 4HH9B 4YAQA 4XBGB 3B6SB 4MQSB 3REWB 4Z7NF 2AEPH 3JVGC 2JNZA 4H0LC 3UGXA 2D7MA 5BCAA 1MI5B 1I9EA 4PJAB 4X9YA 3FFCA 1R33A 4P46B 1Y1UA 4YDIL 3D0VB 3HTLX 1I1AC 2CXGA 1WICA 4EN2A 5DSCB 2JLLA 4TRPL 3QEQE 3ZE0E 5B1JC 1NGWA 4DP1X 1MWOA 1M05B 2AEPL 3Q43A 3G9VA 5IMLB 3SO3C 3S96B 1JV5B 4EI5D 3ABKB 3TJPA 4HAFA 1MG2C 4NFDA 2Y6TE 2W38A 4IJTA 4ZAKB 1YC7A 3UCRA 1AE6L 4ES8A 4Z3GA 3F01A 4HIHA 3CIQA 4EUPG 4LP8A 3ML8A 4XOAA 1D7CA 1IC4H 4TLUA 3O3BA 1O75A 2P5WA 4LAJH 2AQ3A 5JDSA 5D1XD 4BQ6A 2FLRT 3OAWA 4U1KB 4APXB 3VMNA 5JDSB 2ZUYA 4JB9H 3WE1A 1AHKA 5DA0B 1C7SA 4QKXB 4G75A 3SPHA 4FQIL 2N01B 1NPNA 5HYJA 1DBJL 3HFMH 5SWSD 3FH7A 4PY7A 3U7YH 1Z9SA 3RWCA 5DK0A 2I32A 3GK8L 4YHML 5JPMC 2HT2D 2CLZB 3V2AR 3WXVH 3VI3B 2OMZB 4ICXA 2I9TA 2APXA 2XWXA 3H54A 1E54A 3FZUC 4YHIA 4KXAA 5ENWA 5DJ6A 4PB9H 5CJQL 4ABWA 3CSBA 4IGBC 4LVHB 1KWKA 1U8IB 3KXFD 4XO8A 2VXSL 2JB5H 1I31A 4XNDA 1E4XL 2YWZA 1LEGB 2FGZA 2E6QA 3N1MC 4EKXA 3EXJA 2YRBA 4PJDB 4PRHD 1J8KA 4FG6D 2HWZL 4D64A 4Y0GA 5KS9A 4UU9A 1S7RB 2CBOA 3QQ9C 3UYPB 5CP3H 5KSUB 1UH4A 3EKCA 3PGDB 4GRWH 2BMKB 4HSCX 5E99L 4M1DH 4NUJA 3Q2CA 1FGNH 4A7GA 4U1MB 3IMTA 3P4LA 1G0DA 5TQ0H 4B9YA 2B5IB 2PR4L 5F0JB 5ITBL 1CIDA 3ARFB 2ZWSA 5AZEL 1UGKA 4XB7A 3Q01A 4N2BA 5GGSB 5CAYB 1U8CA 1JPEA 2DRUA 1IBHA 3P77A 4GY4A 1F0LA 12E8L 5HSFA 3W9EA 2JQYA 4CU8A 3P30L 1A6VH 2Y25A 3IGKA 5HGBA 1SHMA 4RDQF 1RJCA 5CBAA 3LN4B 2V3FA 5TPWH 2J1WA 3G9AB 1MFCH 3D39A 5JXAH 5T5NF 3T5WA 2XHNA 2V33A 5EUKB 2Y1AA 1AGDA 1ZT4B 4TNVK 1WZ1L 3VFRA 1FDLH 1V05A 1WT5A 2P80D 5C9KA 4GQ9H 1J5OL 1MFEL 2Z31B 2AJZA 5EOCJ 4X42A 2GIXA 3LIZL 4GBXD 3U6RA 1JBJA 2XA8H 1B0GA 3HI1B 5F1NB 3GI8H 1BM7A 4WI6A 2WQUA 1T66D 5F6HJ 2OCCB 2I5YH 3ROOA 4MFHA 1TZGH 1MG3C 2YR3A 2WZPA 3S3DB 4QGYA 1XHHA 4FI8A 4P4KB 4LNRA 1I7UA 2KLTA 1UZ6E 2Z64C 4EIZC 2W07B 2UVEA 3ZMRA 3WELA 3OMZA 3IDJA 3BO8B 2KDGA 2ZXBA 3QRLA 2NZIA 4MDRA 2BERA 4RMQA 3BRZA 2WKOA 2RTTA 4A2GA 3R19A 4U2YA 5JHAA 2EH8L 4JZNB 2R56H 3VA6A 1T89A 3WE6B 5F7UA 3ARDC 5AVUB 1IU1A 5C0BB 4F9PC 4ZQKB 3VFOB 3D25A 4X50A 1HCZA 5SWZE 1OM3H 3VWKA 3QIBA 1H3TA 4O02H 1MCSA 2ICWA 3HPLB 2DJSA 5IW1B 3VWJA 3ECUA 4S1RL 1M2VB 1T7XA 5IMKA 2QQLH 3ULUL 2OA9A 4LP4A 3UC2A 4GLRH 2RD0A 1L7IH 4OLXL 3RX9A 4N4YB 1K85A 4LCWA 4YK4B 4FTDA 3MRMB 4DGIL 2FIRT 3U0WL 3LKPB 4AFKA 2QKSA 2J2ZB 1DVZA 4EDWH 5JIDA 4Z0XA 4WI4A 4WNSA 3MPCA 2HP4A 5F3FA 4B9IA 4FZ8L 2H8PA 1NDMB 1UA6H 1A4JB 1T1YB 2GI0A 4H2AA 2K0RA 4ZUTA 4ADIA 3X14A 3ULVD 5EG6C 5EU4A 4KU1A 3WO4C 2A2QT 1J0HA 3GXFA 4OQ1A 4FTVD 5ITFA 1DQDH 4M6OH 3A4FA 3MC0A 4GRMA 3BWUC 1G4RA 4FJZA 4J3XA 5K59E 2A6KA 4G8AC 4MNHA 4F33B 1CZ8L 1AD9B 4JO4L 3LNIA 4LQFH 5C2BL 3ZRCC 2HVKA 1MCPH 3NDZE 4U3CA 4WHTB 5IB4A 3CBJB 4XHQA 3DV4B 3SDAD 4YSEA 2ED9A 3BEWA 2OZ4H 4HCGA 4PJFA 1OOWA 2GJ6A 5M95B 4G71B 2AXFA 5DJDA 5A2KH 5K9QG 2DLFH 3IAPA 4I1RA 2J8HA 3T0XA 3EYFA 2LFGA 2E27H 3V0FA 1AR1C 2CO1A 2ZF9A 3W9DB 4LSFA 4J6RL 4WEUD 4PJIA 3L5JA 2IANB 2OULB 3GPEA 1LDPH 1N68A 1S7WA 2GSIA 5CD3B 2YGQA 4FE9A 5AB9A 4M5YH 1IIIA 5FLVA 3VVWA 2JQMA 4G9DA 1KC5L 1YYML 4ISVA 1EA9C 1OSYA 1M56B 5I30L 2VSMB 2AVFA 1NUDA 1XGTB 4NNXA 1AHWB 3HUJF 3SKOB 2SODB 5EZJB 2EINB 1QR1A 1S9VA 1T20A 4PJEA 1G7IB 4YDJA 1J5IA 1A6PA 3M1CA 4QXTA 4BXVA 4QRRA 5I30H 3ZZ1A 1NWOA 1HDMB 2PRNA 3SO5A 4F7EA 2B59B 3GHBL 2ICCA 2VAJA 1HSAB 4TSBL 3GRBA 4N59A 2AANA 2D4FA 3JVFC 1WFOA 2QSTA 5IHLB 4R5XA 3VI4A 1BEYL 4ZPVA 5DUMH 1QPXA 3NCFB 3DTUB 3MLUH 3WO4B 3FF8A 1SFHA 5C7XL 4MZIA 4ECNA 1ZLSH 3LZLA 4XMLH 2BIHA 2B0SH 5E6UB 2B14A 1ZLUH 3SGDH 2HAZA 3K4AA 3HG1D 4ZMPA 1XGUB 1FQ9C 1LILA 2OXGB 5I24A 5EN2A 3SGKC 1OK8A 2ESVE 4XCEB 5E2TH 1TSHA 1BQLH 2N2LA 4HUCA 4LPWA 4YHLH 5D2LE 5FYLH 4HUXB 5F7FA 5KANG 3U4EA 3EYQC 5FGCB 1HJBC 1SNRA 3TBCA 4U31A 1AZCA 1WFNA 4BBWA 1A6WH 2ZYHA 2DMGA 5I1LB 1FNSL 3S4SG 3CZEA 2H1PH 3GM8A 4GG8A 1A1OB 2EE0A 4PLOB 5MEQB 1ANUA 5FPIA 1FZMB 2Z8WC 3GXMA 3OAZH 3OAUH 1IZKA 3GRWH 1ORQB 3I2CL 2EE2A 1SLWA 2YLKA 2K4WA 4WEEA 2OV0A 2LAGB 2VUOA 2AKRB 2W1NA 2XWJA 4JFXB 4ZYKB 4ILDA 4HJTA 3C6SA 3WKYA 1TKWB 4MD0B 4JO2L 1WZAA 2ZT9C 4JQVA 3T0DA 1GFOA 3NJGA 3PE9A 3GMRB 4DP5X 4OIBA 4TUJA 5FW6A 2R9HD 2ZUVA 3JT2A 2WWNA 5EBWA 4KXZI 3SDCD 4ZMQA 1KBWA 1AOHA 5AG9A 2EZ0D 3PNWB 3P11H 1WVZA 3T71A 5DI8A 2BHUA 3OMAB 5AW6B 5GZNC 4H8HA 3BPLC 1AZNA 3AY4C 3MUZ1 1QP1A 3GSVB 2PYED 5B3NA 2K70A 4RWYH 4B50A 4WW2F 4ZMOA 2YD0A 4FA7B 3ZZSA 4BFGA 4O49A 3L2MA 2JI2A 3D39E 4LOUD 5EZOH 1KNOB 3EUUA 2FJFA 5BV7B 4Q74A 5KS9E 4GFXA 2CAKA 4J5VA 4YNYB 4OSUH 5KWYC 2J7LA 5E00A 5E0FA 1H3GA 2VOTA 4JS7A 2OW7A 2AAAA 1RP8A 3K6SA 3SBRA 4ESKA 4J4PD 3H53A 5MI0B 2BSSB 3BUDA 4FSOA 5ANMB 1P69B 3GLDA 3LK3A 2QKIA 4ACTA 2C7UB 5L0QB 3PY9A 4LVOC 1K4DB 4ZNEE 4NQVA 2VXQH 4Y7MA 1JGDA 1SY6L 3JYCA 1KB5B 1ILSA 2DTML 1I3VA 3WMSA 4BK5C 3LD8B 4HWNA 4HIHB 4PJ5E 4K94C 3H9HB 5HDBF 2E9JA 1DSYA 1G90A 2VQ4A 2Z7WA 2WVVA 4W9GC 1T2JA 1SY6A 1DJIA 4D3CH 3JQOB 3QDGE 4JVPA 3VB9A 1VSCA 2R83A 1FZKB 1J05A 4TKWA 5AVZB 4YDMA 2XRAH 1NGWB 4KNTA 5GZND 2CUMA 4QXTB 1V7NH 4RA0C 5CSGA 4Y9BA 2KZ7A 4WHYH 4R7XA 4NDMB 3I6GB 4JJ5B 4TULL 3REVA 3MYZA 4NX0A 2V5MA 4AQZA 5LGHL 1KIUB 4AI7A 2YD9A 3KW8A 2AAVA 5DD3H 3FHEA 4IKLA 4MXWH 3NA9L 3ZKXC 4G8GA 5FKPA 3DRQB 4NUGL 4YDZA 4AIZA 4NAQA 4ZSOE 1SYVA 5EORL 3CK0L 4ZT1A 4JFFD 1N5AB 1AS7A 1HINL 4WFEE 1F02I 3HRPA 3LKNB 3HWBA 5ANHA 1KG0A 4H44C 1TVHB 5T1MB 2E5EA 3KXFB 1F90H 1TZIB 5TK2A 3X3FH 1CVSC 3VFWA 2Q7YB 3QR0A 4LT7A 3GLAA 5E6IB 3I9GH 2VQTA 1KT2A 1NSNL 3O3UN 3IDYB 1U8JB 1N9PA 2J5LB 5F7DA 2HH0H 3TH3T 1CL7I 3GSOB 3PUUA 5DC9B 4U7SA 5CJXC 3ISRA 3WD5H 4HJEA 3MBXH 2N1TE 4LESA 1W16A 5JHLA 2X70A 4FYTA 2V9UA 1OHZA 4YDJB 2DYSB 2YD5A 1WJ3A 3KDMA 1ZS8A 1AQ8A 3ATAA 1IAOB 3CFJA 2R51A 3PL6B 4HV8B 3QNXB 1ADWA 2GKIA 3DRQA 4R3SA 1NEZB 8FABB 2XV2A 4HIJB 2R23A 5HDOA 3Q13A 1SN2A 3B2PA 3RIAF 2ATAA 1W8NA 1OM3L 1ZLDA 5G39A 2VDNB 4GYBA 4UB6O 1GZPA 4OGAD 4W93A 1M7IB 1XF5A 2J12B 3B7UX 4A6YH 5CM1A 2BVPA 3B1UA 4NQDB 4R90L 1TIUA 3QUMB 3FT2B 3VFSA 1C08A 4N9OB 3H4FA 2FWSA 3AABA 2XXCB 4PRBB 1DBBL 4HCRH 1KB9J 1Y0LB 2A5UA 2OJEA 3VDAA 5LQBL 3U1QA 3MLXH 4D7BA 1T5XA 4YS4A 5ICZA 1MCRA 3CUPA 4AM0B 3DIFB 4DGYH 1IAKB 1JV2B 1XCQB 2X9XA 9PCYA 3SODB 2GTQA 4FKKA 3T0ED 2IFFL 5T5FH 3BFOA 3GZPA 1V8HA 4AYNA 4Z7WA 4APQD 4Q8BA 2J8OA 5I26A 3M1BA 4F7MB 2JJUA 4NYLA 1G6RA 4GIPD 2AZUA 3ABLB 4H26B 2W94A 4N68A 4WWKC 1KLUB 4OCXH 4LHJB 5BZXA 4DGVH 1T80A 3HG3A 4L5FH 2XYBA 4QEGA 5HI3D 5JR1L 5CFHA 1PSKL 4NJAL 1P5UC 5BRZE 2YKLL 4WCYH 3KPSA 5DMIL 5J57B 2VJ0A 4BK8A 1DTUA 4WU5B 1R3KA 3CC5A 4GAJH 2VM9A 3HBPA 1UJTA 3FTWA 3ZL2A 4ODSH 2Y0HA 1HHKB 1X5YA 2R4RH 4QRRD 3VE1A 4MA3B 1B0GB 1UM4L 4EN3A 1GTNA 2XQBL 3MJ6A 2EKSA 5GGVL 3SDAC 4AYBA 4JX0A 1GA2A 3WSQH 1YY9C 4RMUA 1MLBB 1CD1A 3HMWH 4PW3A 1HKLH 1NCCL 2PPAA 1BIIA 1LNUB 3NPSC 3G5VA 4E41B 1CC3A 1DJHA 4ONGL 3ALWA 3SE9H 5L4FA 1INEL 4KX9A 5EBLA 5DS1A 3NEOA 1PD6A 2PTUA 3ULVC 4TLKA 4HGWA 4UILL 3D4GA 3MR9A 5KW9H 1RU9L 2K6ZA 4YZWA 3VM5A 1R9FA 1R0AL 1TR7A 4D7PA 1E9OA 1Q72L 3VWJC 3ZHLA 3ECWA 4GKSB 5HHVL 3Q05A 4ZFFA 1E28B 3ZDZB 3CHPA 4KH2A 4K8RL 3F85A 2X2YA 1NGYB 3BP4A 1I7RB 3T0EE 4OAWB 1AQDA 1MREH 2WP3T 2WSDA 4HU8A 4N9GB 5I6XC 5CLZA 4M5TA 1D9KB 3GMMB 4ZAKD 3X1NA 1RIHH 5F7HA 1I1FB 2DQGL 4IU2A 5E8NB 3T6WA 5D2NA 3P2DA 5B1CA 1L5GA 3UIZA 2WGNB 1G7LB 4Z77B 4PRAA 1GC1C 3D09A 3H0TA 4IDJH 1J9TA 1WV7T 4GG6A 3ALXA 4GQQA 4RNRA 4EN3B 1H15B 1RVFL 1Q1PA 3II1A 3TYFA 3VGDA 4TNEA 3FOLA 4BKTC 2VSCA 3QCTH 5FDWB 2P4AB 4KGJA 4K5MA 4H40A 1TQVA 2GITA 1I3GH 5DJAB 2ZAGA 5DHEA 1L9SA 1FV1B 1E43A 2H1PL 1MCJA 5ECJE 4CU6A 1I7ZA 3RWJA 4TVUA 4K5NA 3KCWA 4LQ1A 2HFGH 4I77L 1KGJA 3IMWA 4FP8H 4Y4HD 1KJ2A 2YAQA 3OPZL 1AQDB 1NBVH 1ORSB 2C9SA 1T03L 4Y4HA 2I07A 4QRAA 4Z9KB 2VXTL 4HJGA 4ZNEA 5ADXL 4NKIH 2VN5A 1UXWA 5BQ7B 5IT2H 3QDAA 3TJEH 4KAQH 1ZV9A 2EECA 1NCOA 2FD6L 4ZOAA 5C0AA 1T3FB 1A1OA 5F1OB 2FYYA 3GMQB 1D6EB 2XA8L 2QZ5A 4G6JL 4Q6IC 1H3XA 4RX4A 1JZEA 4NKIL 3VXNA 3BFWA 4D0BA 2YOAA 3U6XA 3ULVF 2AJVH 5EORH 1PS3A 1UVQA 4RSVA 1IGJB 1J0YA 2GIMA 5CIPH 2Y5TB 2LVEA 2IG2H 3GBEA 4TVPL 2YAPA 5DJCA 3WNNA 1W91A 3QIWC 5I2IA 4YR6A 2K0LA 4H25A 4XOCA 3I9GL 2CR0A 4GIAA 3T3ME 3U83A 2K78A 3Q2LA 2BJMH 4K5LA 1SLXA 4XVUD 1MAKA 4KOBA 5JIPA 1YY9D 2R69H 1CXIA 3EW3B 3VFMA 2Y2WA 3WD5L 3HHSA 3HN8A 2H26A 4IRJA 1NKGA 1UJ3C 2YAOA 5C0IB 2Z4QA 4IBYA 4BIKA 1BQHA 1NCJA 1DLHA 4HS6A 2O5NA 5B7FA 3ILQC 3VXUB 2I85A 2IAMA 4QNPF 1T0MA 1V54B 4NBXB 1BX2A 5AVWB 2DI8A 2JMMA 3PJSA 1TLKA 4FABH 5D7JB 4QTIH 2CE6A 3MUY1 4Z0BL 2ZE0A 1KPRB 3LRHA 4QRUA 1EANA 1IGFH 4BKSC 5LG6A 2A73B 1H3VA 2CWRA 1FGNL 3K2IA 4JQXA 4NYLB 4WDIA 5FB8B 3KPOA 1BVKB 1B88A 3HNVH 1AVAA 2GT9B 3B7YA 2X27X 5HD8D 1EHLH 2YIHA 3FUNA 3NJLA 3MLSL 5HHMD 3T1FB 2CRMA 5AYQA 5A2LH 4D5UA 3OKEB 5C3LD 3B9KC 3L5WB 1ZTXL 3W2DL 1U4FA 3VDCA 4DETA 3VFRB 4HSAC 2ROXA 2NY0C 1KJ3H 3W5MA 3ZVVA 4QRPA 5DQJA 5FOBB 4HPOL 3RAJH 4MZ3A 4QTHA 3I02A 2ODJA 4NQXB 1PZBA 4IRZL 2A4EA 4JFSA 3P4NA 4UF7C 2VXUH 4JG9A 1FORL 4NP4L 4H8WL 2WTRB 4UOW1 4EI6B 5BOJA 3DKHA 5GGSA 2A6KB 1OD7A 5IJVA 3VB8A 2V7HA 3BJLA 1IQWL 4GXVH 3EAKA 3AW5A 4J2XA 2DF3A 2VT0A 4Z7QF 1QFWI 4M7KH 3CZJA 1KXHA 4QXVA 4ANVA 2VYRE 4GKNB 1U3ZA 1J7VR 4XP4H 2AJXL 4D0DB 5F7EH 5C07E 5IWLA 4XPAL 1RK0B 1KOAA 2OI9B 4HZAA 1QX1A 3H9SD 2Z8VC 3DX6A 4FTVA 3KYKL 1MF2L 2VR9A 4Y1AE 4AZLA 3LB6D 3LKPA 4P05A 4YE4L 2YPLE 4FQHB 2FBRA 2EXYD 3PAVA 1IGCL 2OI9C 2XWZA 4OI7A 1F4XL 1OAUH 2NX5A 2AXGB 5EU3A 5FOJA 1R3HB 2BWDA 3LK41 3G7TA 5F3HB 5A3ID 3QEQA 1U93B 3A22A 3PJSB 4PWEA 4KO5A 4LFHG 3RBSA 2PP8A 1ZY9A 2OMFA 2HJFA 3HC3L 3VI3A 1HQRA 3QIBB 4KFMA 5K5YA 4KROD 3BD4A 2A9MH 1HK6A 1IO4C 1ZLEA 2HKHL 5K39B 3V0WH 2VDLL 4K2UL 4OF0A 4ORZC 3L95B 4GI6A 1HH9A 1L9RA 5B1KA 3IB4A 1Q9LB 1A9VA 1N0LA 4EE2A 4HWUA 2QQQA 1SJEA 3ASWA 5KN5B 1J9QA 2WWMD 3B9AA 3S8GB 1S7RA 1SDAB 3C12A 3OB0H 3DA0A 4ZS7H 1F4YL 4HZ1A 3SDAB 3QDHA 5CZVH 2FWLB 1XR8A 4FJ6A 4GKZA 3WY3A 3DX4A 1T5KA 5CR1A 3KWTA 2OMVA 1TQWA 2MJWA 2QSCL 3U1SL 3EJRA 3H9SE 3RE0A 1BREA 2DQ6A 1Q8MA 3QI9C 1BQUA 2LHFA 1AO7D 1MCDA 5C07D 4HKZB 4R6UA 1O9WA 2D0HA 1ZT7A 5J9PA 3H3KA 1UB6B 4FZNA 4FLQA 2VO5A 2LGNA 3RL2B 4E9VA 2P7TA 1UACH 4MAYC 4X9FA 4PY8I 3UFIA 5B1AB 4G9FA 2H47C 3OJDB 4KZCA 2RALA 3R4RA 2ISDA 1X4ZA 1KEGH 4ODUB 4G9FD 2F53E 1NC2A 5GRUH 2PW1B 4A38A 3Q44A 4AL8H 1A14L 1RLBA 3LEYH 5AVTB 2DIJA 3QUZD 1XCXA 1HCFX 1S7UB 4JCMA 4PJGA 5DS2A 5EOCH 5IHZB 1S9YA 3MLRH 3MUUA 3KCPA 2RBLA 4KZDL 4FKHA 4WJ5A 4PS7A 4WHDA 3OPZH 3PCYA 1T03H 1FYTB 3POXA 2BVYA 4E5XG 5KAFO 2E7HA 3TVMB 5L7XL 2R69A 1TDQA 2XPGA 3LQMA 3LZPA 5DYOB 4OZFG 4ZMNA 5IROA 1ACXA 1FZJA 4R83A 1GPOH 4M03A 4XVSL 2WVSA 3UGUA 4F37K 1CBVL 3AA0A 1UD8A 3MJ7B 3K1KC 2FUQA 4M8QA 4X8GA 3AG3B 4DTGH 2GJRA 2F18A 1R5IA 1ZKAA 2CKBH 2V3EA 5DHMC 1C16B 2IXQA 1IILE 3DLQR 1KN4H 4AG4H 1S78D 4CSSA 4HIIA 5B38A 3JWNG 1J12A 3GI9L 4OBRA 3LKOA 3V79C 1BOGB 1NGPH 1IEBA 3LZQA 4ODBD 1XD0A 3HE7C 4PJ9B 3O4LB 4BKLA 1U8IA 4OT1H 4C00A 4OFKA 1BOGA 3B9EA 4WJKB 1N67A 2CNZA 2PCYA 3VFVA 1XGYL 4NO5A 4XCCL 4M7LT 4ZTOH 1SJXA 4EZJA 2DDQH 1QVOA 1WCBB 3PRNA 3IM1A 2ZX8A 4HG4J 1I7RA 3BH9B 3UABA 5EF1A 3AAEB 2IPTL 5ESQB 1ROCA 1FNEA 4JFWA 3MV7E 1NCGA 1HEZB 1SXNA 4PJIB 2QPFA 2BSRB 2YA1A 2PR9A 2OL3H 1BECA 1UZGA 2P80A 3SKMB 2D73A 4Z6AT 1XR9A 4GW5A 3RU8H 3NOIA 2Z1KA 3WTTA 5GRXG 3H9YA 1NLDL 2YA2A 2KZ1B 1BA9A 4PIRF 4PSRA 1OGPA 2IXQB 3UAAA 2P5WB 1I1AA 1S7XA 3P4MB 3FB7B 5LAXA 3IJ7A 1DVYA 2UZPA 2Z4TA 4ERSL 3T3PB 1VIWA 3O2DL 4LSHA 4H20H 3HC0B 3UZQB 1PW3A 1NLDH 4JE0A 4ZO9A 4OD3L 1CCZA 5C0BE 2VXSH 3QG6B 3JWNE 5L8KB 4HDIA 4HULB 1GYUA 1JNHB 2UWEE 4F8OA 1JGIA 1SPDA 3HG5A 2VUYA 2Q3XA 4LLWA 3ELAT 5B66O 2VLME 5E9DB 3IETB 4O4YL 4JM2C 4Y19A 4G59C 4P48A 5GJSL 4A67A 1DJXA 1XGQB 1EVTC 5F9AC 3ZDYF 2CA3A 3HR6A 4JFDB 4J3OH 4HC1L 4HKJB 3VGGA 1A5FH 4OF7A 2H4EA 2Q76A 1WZMA 3PGRA 1VEOA 3K6IA 4QHKI 1TCMA 2ID5A 1MHPL 4FGMA 4ZXBB 5ITBH 2X9YA 2F8VA 5F9JB 1U3YA 2C9AA 1DR9A 4O4YH 4Y2LA 3UJJH 4G9DB 1GZQA 3MMEB 5KBKA 5EU5A 5I82A 2FATL 3FQTB 4E9TA 1ZHTA 2ADJA 2JB5L 4MMZC 4BZ2H 4U6YA 1HN1A 1IC7H 1KBPA 1ED3B 2JQZA 2VDKH 4LCVA 4NQUA 3ZE0B 2FX8L 1NICA 1MWAB 4Q2ZA 1K3IA 1MJUH 1Q38A 2AVGA 3MRJA 4Y9GA 5DD0H 2VMFA 2OMXB 4HISA 2DLFL 3CGTA 1WAAF 3WNJA 3CN2A 3PABA 3SJVD 1IC7L 3HG2A 1QACA 1IKNC 2MNJB 5I8CB 4HU2A 1MRDL 4RVBA 1Z5LB 4UT9H 3OKOB 2VDRB 2HSIA 4F80A 3ARBD 3UX9B 4F8TA 4PCYA 5CF3A 5ADPH 2VDML 4QCIA 4V11A 2VC2L 2A83A 3NIGE 5CSZB 5HJDA 2L7EA 2BSTB 2E7CA 4B9PA 1EEUA 4RFEB 5HYFA 4X0KA 3T4YB 1ZWIA 2FEEI 1G1OA 3BESR 1VFMA 2IF7A 4LSEA 3A6CL 1MVUA 4HLZH 1UH3A 3SDXA 2X44D 2G0KA 5ADPL 3KVPA 4LSTH 1XR8B 5D7IB 1J5HA 3UTOA 3OKLB 3TFBA 3MNZA 4E68A 1CDYA 5PAZA 5ABAA 2VABB 3BQUC 1GRWA 3GSNL 5DR5H 4DEUA 3RPIB 5D1ZD 5FA4B 5J1AA 1EGJL 3AWEA 2B39A 3FH8A 3UTTA 5I5MA 1MY7A 4AJVA 5IESL 4HPYH 5DQJB 1UD4A 2NNRA 1BQHB 2F58L 4RZKA 5K9OA 3SYPA 3EO9H 1H5BC 3WTSA 2X4TA 2AJUH 2H26B 2J4WL 3BVWA 4A6YA 3FUKA 4E9YA 1GW0A 4UM8A 2YD7A 3FB8B 3BZ4A 1X7TA 2ZUQB 5HGGS 5IF0A 2BOCA 1RZJL 3BWUF 4HFUH 3QFJB 2G75A 4HF5L 4IJ3B 2ZXAA 32C2B 4KRMB 5BRZD 5FYLL 3MN8A 4YHLL 1NCBL 2ZSVB 5BVJA 1INEH 1YJDH 1VFBB 3APFA 5HDRA 2DWTA 1Q9KA 2VAAB 3Q8FA 1SVZA 3A23A 1RCYA 2NUTB 3ZHFA 4BELD 4X6BA 3TIEB 5GTHO 1L7TL 2HLAA 3T1WA 4X7EC 1KXTB 1G1CA 3U46A 3UBXA 2HT4D 1G6RH 4LLYB 2BSTA 1CE1L 2P47B 4JFFA 2VW7A 5SX5H 3F7RA 1DN0B 3P0VH 1L7IL 3QPKA 4OLXH 4GKNA 4BA8A 3WS6A 3Q1SL 1HOCB 3QORB 1HNFA 3WJLC 3A5VA 4B9JA 4TUKL 4XVSH 5I1DA 5IJKA 3UEZA 5B1JA 4CC1A 2LLGA 1A9EB 1BM3H 5GGUB 1WO2A 5DJ0B 5FWQA 4L8CB 1N2RB 3CQFA 3SDDB 3VH8A 5GS0H 3Q5TA 2CZNA 3QJZA 3KYMB 4QKTA 5D7JA 1KYOK 5CJBA 3V4PL 3QWNA 3QG7H 4JRWA 1ZGLP 1BPVA 1TVBA 4JQIA 3S37H 2K3TA 3V6OA 3IMVA 4G5AA 5C0RH 1BYNA 4MQXD 5I66B 3MJ9H 1D5IL 2O5XL 3HIZA 2ITDB 2ZCZA 4OUUA 4PLJD 4YOKA 2O6PA 4AUJA 5I1AA 1ZANH 4I0KA 1OARL 2V0AA 1ZLVK 3OC8A 3QUMH 3GXTA 3N42B 2JCCA 3W11C 4DCQA 2EDJA 3EFDH 3FU8A 3K6OA 4QQ1A 2JV6A 4DOHB 1BT9A 2CJSA 5FV2A 2A1WH 4L0ZA 1K2DB 4GBXC 4MCYA 2BP5M 3S6CA 4PB0L 1BP3B 1WE5A 2J43A 2ITCA 1KGCE 4PP2A 4Q89A 3ARBC 4A2MA 4R7DB 3RZCD 1CLCA 4B9CA 3QQ9D 3MV8B 3F7QA 3R8BB 3BVNB 2CK0H 3PAZA 1NUGA 3K8KA 3ARYA 4HDIB 3UJTH 4OCRH 4YSQA 5ID0A 4XNMA 3T20A