4AYMC

Structure of a complex between ccps 6 and 7 of human complement factor h and neisseria meningitidis fhbp variant 3 p106a mutant
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
239
structure length
234
Chain Sequence
b'ALTAPLDHKDKGLKSLTLEDSIAQNGTLTLSAQGAEKTFKASLNTGKLKNDKISRFDFVQKIEVDGQTITLASGEFQIYKQNHSAVVALQIEKINNPDKTDSLINQRSFLVSGLGGEHTAFNQLPGGKAEYHGKAFSSDDPNGRLHYSIDFTKKQGYGRIEHLKTLEQNVELAAAELKADEKSHAVILGDTRYGSEEKGTYHLALFGDRAQEIAGSATVKIGEKVHEIGIAGKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT FACTOR H
publication title Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 49
structure length 234
sequence length 239
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4aymC02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4aymC01
4O3XB 3PQUA 5EE2A 4O3ZA 3HOLA 4O3WA 3UAQA 4AYMC 5T5FA 2YPVA 2KC0A 4U9CA 3PQSA 2Y7SA 3VE2A 2W81C 4AYNA 4O3YA 3V8UA 2LFUA 4AYEC 4Z3TA 2KDYA 3HOEA 4QQ1A 4O4XA 4O4UA 4O49A 1YS5A 3KVDD 4AYDC 3VE1A 2W80C 4AYID
chains in the Genus database with same CATH superfamily
1BHGA 2A77L 3JYBA 3BW9A 4HEME 1HNFA 2VIRA 4K3CA 5AOIA 4UAOC 3D2UD 3FUDA 4GMSL 4N6RB 4U7KA 1HKFA 4LKCB 4WV1C 1IAKB 1VFUA 2WBJB 3VMNA 5GPRA 4H8PA 1RUPH 3AG3B 1EDHA 3NJHA 1Y18B 3EUDA 1SVZA 2Q0ZX 1SQ2N 3DECA 1IBGL 1V3JA 5TPWH 4PLNC 1S7UB 5I0ZA 1Q0YH 2Z4QB 3FPYA 1NGQL 4KOBA 4NYLA 3RDTB 3L3HA 1C1EH 4OCXH 4R7LA 2F74A 3D7PA 4AITA 1P0SE 2MCG1 1ZT4B 4LPUA 5DJ0B 4BKTC 2BY1A 3H3KA 1A2YA 2K4WA 4HQQL 1KFAH 3P9WB 5CS7A 1OSMA 3IDXL 3QDJA 1DTUA 1DBBL 2R4SL 1RZJH 3V0HA 4L8SA 5EH1A 2IMMA 2AK1H 3E6HB 3RB7A 4LHUD 5FEBA 2QGEA 2V7HB 1SYSA 2VN5A 1IC1A 3BKCH 2Z34A 1AZCA 1LEGB 2EXWD 4N2NA 4N28A 4JANB 1A7OL 1SOQA 4RAHA 4Z95H 5B3JE 3HZVA 4HLZG 3L2LA 2FQGA 1CI3M 2A6JA 1DEEA 3CV5A 4IRJC 15C8H 3SY7A 3QRLA 2OAAA 3Q2NA 1J18A 2XTLA 2HKFH 5HI5C 3BFWA 2F08A 4XMKL 2HT2C 1JK9B 1X5AA 2VR7A 2XXMB 1QMUA 1WFJA 4N6RA 5T33H 5D70H 4LKCA 4QAWA 5FGBA 3PF1A 1IAKA 4WUUB 2WBJA 4YVUA 4ES9A 1F41A 5I23A 4DWHA 2WXJA 1JPST 2ZUSA 4DK3A 2AK4E 2AC0A 1Y18A 5I66B 3ULUE 2VDPB 2WBXA 1FNSL 3FH7A 3RILA 4UQDA 3ULVF 4B9YA 3AJ7A 2VDNL 3A6BH 5B39B 5JYMA 1S7UA 1WJ3A 2B7DT 1NAMH 2ED7A 3RDTA 2Z4QA 3BYTA 2I69A 2ZXCA 2DPKA 4V2CB 4K2UL 1ZT4A 2IFFH 5DJ0A 3TT1H 5HDQL 2QLYA 2PYFB 2ODHA 3GM8A 3TYFB 1V3KA 2WYIA 3C5JB 5HI4C 4EOWH 1FFTB 2HH0H 4HZ1A 2W38A 1GPOH 2XMXA 3E6HA 3WJLC 2J4WL 4Y4HB 1SLWA 1BSIA 4GT7A 4XWGL 3B2VH 2V7HA 2EIKB 4HJSA 5CN1A 1KV7A 4WGWB 1F90L 1LEGA 5GHWH 3ZE0B 4JANA 1TITA 3ZTJH 4FZLA 1A64A 3KPRE 3ILDA 4AQZA 5I71B 1FCCA 4P9HC 1KN2H 5INDB 5KBPA 3SGJC 5AENA 1JK9A 3DNKA 4F9PA 1Q9WB 2C1OB 4GQPH 4JO5A 5JPNB 1K3ZA 2WJ7A 2QELA 5CINL 4WUUA 5DHVB 2E3VA 4LIQL 2Q8AH 4H44C 3RY6A 1JMXA 3D4YA 3FN9A 5C0DB 4J6RH 4B9IA 1EHLH 2BHFA 5I66A 1QR4A 3I02B 1UWXK 5B39A 3GPEA 2WVVB 3ARPA 4CBZA 1J5DA 2FX7L 1GS8A 2FLRT 2KHAA 4JHWL 2PYFA 1AZNA 3QO1B 3R4RA 3TYFA 3C5JA 1KY6A 3MZGB 2N7SA 3MJ9H 5LVEA 4R97C 3DIFB 3AAEB 3ZHKA 2KMWA 2MHAB 4H8WL 4ZPVB 1XX9C 4Y4HA 2YAOA 3UCRA 5FAAA 1M57B 1ADQH 4QHNB 4O5LH 2R2EB 1BYPA 3DX8B 3L4TA 3QS2A 1FSKB 5INDA 4K9EL 4YSEA 3VH8B 4LK4A 1M4KA 3FUIA 4PRNB 3S88H 1F58L 2B39A 5HYEA 1T6WA 4J3OD 5IVOA 2J2ZB 5BQ7B 5JPNA 1Q9WA 1YNKH 2C1OA 5DVOA 3X3FL 3HHSB 3QXVA 3PV6B 4XMLL 5J57B 2KUTA 2FR4B 3TZVB 2DQCH 3HNSH 2QV4A 4P5TD 5E5UB 1HWHB 4MJHA 3MGTB 4MHHI 1ZVNA 5C0DA 4IIQB 1PG7H 2ZXDA 3AQDA 2G3NA 3TM6A 3I02A 3K8KA 2WVVA 1IGCH 2JMRA 4PRIB 1AC0A 4OTXH 2XIBA 1UGNA 2AJVL 4KHXH 3L5XH 4JUSA 4YNYB 4ZFQA 2XYBA 5B5EO 4KROD 3NCWA 1CDIA 4FFWD 4BK5C 3QO1A 4L1SA 5C09E 4Q6IB 3DO7B 1T03L 2WHVA 3SJVD 3V4PB 4PU2A 1G1YA 1PMYA 2C5DC 3AAEA 3DIFA 3MLUL 4LOVA 2MHAA 4ZPVA 2E9JA 5FYKE 4JZJC 1SXNA 1NUFA 1UACH 5JQ6H 1CDYA 2WTOA 4PJXF 4QHNA 4FNLL 4DGVH 3KE0A 2R2EA 2ZKHH 3B9KB 3A67H 5EBMB 4JQVC 4BA0A 5F96H 4F58H 2H26B 4K5MA 3DX8A 4MCYB 3VH8A 4EIUA 4LOEA 1UKQA 4PRNA 2JVUA 5CEYB 4YSCA 1QLEL 3RVUC 3T04D 2J2ZA 5BQ7A 1DJGA 5E2TH 5I24A 3HHSA 3IWUA 2AANA 3PV6A 3VWKD 4MQXD 3IT8D 2FR4A 4HGWB 3TZVA 4HWEH 3MGTA 4Q7DA 1NGPL 3ZHNA 4OB5H 4IIQA 5FFGA 5ID1B 2VMCA 3RWJB 1KACB 5FO2A 3GMLB 3RPIB 5L2KE 1JFQH 2J6EL 2PNDA 1YEEL 4XMVA 4PD4K 4PRIA 3IS0X 4NKOB 4YNYA 5KJRH 4PCYA 2CJSA 1Q0XL 2OQJB 1Q0EA 4UB0H 4FCHA 3IJ8A 4OT1L 4Q6IA 3DO7A 3ZIMA 5FYLH 1AH1A 3V4PA 4EAEA 3PPEA 3KMDA 3IFNL 2OMBA 2VO8A 4PRPE 4MLIA 1NC2D 4R90L 1Z6JT 2VN7A 1F8TH 3H3PL 3VGAC 1GW6A 1JI1A 5JW3H 5HGAB 5HGBB 3RDJA 1U8NB 3WKMH 5JA8B 1DFXA 5EBMA 4W9DC 4G5ZH 3RUGE 1FQ9C 2OTWB 5FV1L 1VZIA 2H26A 3OXSB 5EUOB 4MCYA 3M6DA 2OXHB 2VM3A 3PGCB 4L5FE 1EZLA 1IB5A 1MCCA 2VDKH 3PIQB 4QTIL 2ZFGA 1G5AA 1A4BA 4Z7UE 3LZPA 5DFTA 1SJHB 3GBML 3LN4B 1QSFB 4N0CD 3VFNB 2NW2B 4HGWA 2YN3A 1RK0B 4TNFA 2G4EA 3R8QA 2NX5D 4CMHC 2R1WB 3PJNA 4DAGL 2WVPA 5ID1A 5DQDL 5F9OL 3RWJA 1BYOA 3JV6B 1ICTA 3VXMD 4CSZA 3GMLA 2DQHH 3HTLX 4JRYE 3RPIA 5A2KH 3GGWB 2P43B 4WFFE 3QZMA 4NQVB 3L3DB 3K3QA 4NKOA 2NQCA 4QKXB 1P5UC 1E6JH 1QYGL 2WXGA 4DKEH 1OAXL 3S8GB 3ZTCC 2OQJA 5E23A 3QEUB 2H5UA 4Y4FD 4L0YA 1BMZA 3US1A 4Q0XL 5JOPD 4QUOA 3EAKA 1CR9L 2KYIA 3V4VH 3TIEB 4PG9B 2ESVD 4HOZA 4ECNA 5HGAA 5HGBA 1JL8A 1S9VB 3E2HB 1U8NA 4RWHA 1FLRH 4KMLB 1MRDH 4C47A 4APQD 1YDPB 1OK8A 4XP9L 3MXWL 3BUQA 5IM7B 4D2NA 2OTWA 4Q58C 2J72A 3OXSA 5DRNB 5EUOA 4AQAB 3VFGL 1GYAA 1KUMA 2DM3A 1RUKL 2OXHA 3FUHA 3L3KB 3PGCA 2FWOB 1OHZA 3PIQA 5IMKB 5BJTB 1TVDA 2NCMA 1M56B 5B39G 5AG8A 1VENA 3H9SE 3BPLC 4OFPA 4QRFA 3RURA 4W4NA 1EJ8A 1MFDH 1SJHA 1QSFA 3LN4A 3VFNA 2FGWL 2NW2A 4GCPA 5E9AA 1RK0A 1CE1H 4Y4KD 2ZJSH 5LBSA 2R1WA 4QRSB 4DHLA 2X41A 5DJAB 4XC3H 2FECL 3T0SA 3MJ6A 4PM1A 3JV6A 4Y16B 4KJYB 1HJBC 3GGWA 4Q4EA 3WAKA 2Q3ZA 4NQVA 3FW6A 4XPTL 3C09C 2ENQA 5I5MA 1CVSC 1ZPLA 4QWWD 5CZXD 3B83A 3ELQA 3FQNB 4DP9X 3ALWA 3QEUA 5G26A 2QKIC 4OLZL 2BY3A 4XAWH 5K39B 4H4NA 4LBEB 1XB8A 4G9FD 1ZLUK 2XQ0A 1USQA 3TIEA 3KHQA 1CXLA 4PG9A 5C7ZA 4OGQC 1NEZB 1OP9A 2E27H 2P5EE 1S9VA 3MLYL 1YDPA 3ZTDC 5D2LF 4OD2B 3D25B 2PLTA 5IKCB 5IM7A 4FD0A 4FKKA 3LEVL 3T0BA 3MSPA 4QR7A 5DRNA 4AQAA 2B2XL 3L3KA 3KYKL 2FWOA 3CQQA 5IMKA 4AOFA 5BJTA 1E43A 4LQ1A 3IGAB 1AMYA 1LO3H 5C97A 3EXLA 3V0JA 5L6YH 4QRSA 1WWBX 4H7VA 5DJAA 3DV6B 5IVZB 1R0AH 1P7HL 4L4TE 4PJEF 2XXCB 2B77A 3QI9C 4O4XA 4Y16A 2OCCB 4KJYA 4M6MH 1TETL 2DN7A 4RZKA 1J1XH 5GIRB 1KPVB 2BNQB 3L7EB 1FHGA 4N59A 4P2QE 1G4RA 4JGMA 5AWNH 5K69A 4OZHF 2LU3A 2YZ1A 5FKAB 1KYUA 3SDCD 1P4LB 3FCGA 5HDBF 3FQNA 1K5NB 2AP2A 1BD2E 3MJ7B 2XSKA 4OVUA 4JFFB 3PQSA 4MGXA 5K39A 4A2FA 4LBEA 3RTQB 4LGRB 3VH8G 2CUAA 5ADXL 1YEHL 4ZX5A 1CDBA 2A9ML 3PREA 5DVMA 3GT6A 5F3BB 3BOVA 4UCFA 4IOSA 1UM5L 5BV7L 1NEZA 4M1DH 4KRAA 1P1ZB 2DJUA 5ECJE 4OD2A 3D25A 2HT3D 5IKCA 3LNHA 1SBSL 3J07A 1YEFL 1OOAA 3O11B 5IBUB 2V9TA 4TNVK 1MJUL 1G43A 1MVFA 3GS7A 3T0DA 4GG6B 4L2LA 1A4CA 3FUNA 4K8RD 4UM9D 4U1NB 3IGAA 4RDQG 1AXSB 1MJ7H 3PGFL 4TQ8A 2R2BB 5IVZA 2PTUA 3DV6A 3HC3L 4GW4B 4RMUA 3ZK0A 1JK8B 4ZUTB 3ULUC 2ZX6A 4ELMB 1PL3A 3QIWB 5JW4N 1SOXA 2ZOTA 3QDMD 4OSUL 5DHYB 5GIRA 1PEWA 1KPVA 1H9VA 2BNQA 3L7EA 1V7MH 3LB6D 5FO9B 1NICA 1NMBH 2FIKB 1YYMH 1J0JA 2F19L 5FKAA 1CICC 1P4LA 2BRQA 2MJWA 3WIHA 3FMGH 4Q74A 1K5NA 3AY2A 3DSFL 3MJ7A 4MZ3A 5EB9A 3VXOB 4JFFA 5JXEC 4JQXA 3RTQA 3APMA 1QWUA 1TTAA 4P46D 4R84A 1IE5A 3CDFA 5F3BA 3MJGX 3ZE1B 1JZ2A 3RY4A 3FN3A 3DVGB 5CCGE 1P1ZA 4ZTPL 3IDNB 1M2VB 5DJ2B 4G2AA 4N9OB 3E38A 3SPJA 3R0NA 2IFGA 1I85A 1A9EB 1Q4NX 4FLHA 3O11A 2DBLH 3LQAC 1YECL 5T3ZL 1NAMB 2OYKA 1TPXC 3BKYH 4GH7B 1P4IH 1UYWL 2ATKB 3MLTB 4XXCC 4GG6A 2PCYA 3LN5B 3ARQA 2MWCA 4U1NA 2ICWI 1AXSA 3FO2B 3IJ9A 1NL0L 4N4YB 2XIIA 1QFUL 1G9HA 4J3OH 2R2BA 4GRLB 5I30L 4U1HB 1PY0A 3F6IA 4GW4A 4HCRH 3DJRA 4MYWB 1ZPUA 1JK8A 4RX4A 4ZUTA 4ELMA 4YPJA 1WIUA 2E0PA 1YMMD 2JFCA 3QIWA 4PN6A 3G6DH 4DKFH 5I8CB 5DHYA 1BECA 3QRCA 7CGTA 5BS0D 2MCPH 5FO9A 5T5NG 5F7YC 2FIKA 2ZX9A 1G1KA 1YPZE 3ZKND 3ZYOA 3X1GA 3HNTL 4U1KB 1OW0A 3S4SB 3A6CH 1BVNP 3NH7L 3L9EA 3VXOA 2Y0HA 3GLDA 4FG4A 3NZSA 2WBKA 4E41D 3Q2WA 3NFNB 3ASOB 3QIUB 1D7FA 5EC1B 3EADA 2YRBA 4B97A 2B4CC 5IHUH 1OB1B 3DVGA 4NENB 4ZJ9A 1AGFB 1NBQA 2X10A 3AITA 3UPAA 5F8QC 3IDNA 1XDTT 1M2VA 5DJ2A 3LD8C 5D72L 3BAEL 1WAEA 1IZNB 3VXRD 2D0HA 1NANI 5FYKU 1A9EA 2Y2TA 2NY0C 2VGLM 3F05A 1PD1A 4GSDH 5B1JC 1NAMA 1T2QH 5CGYD 1XB6A 4Z3GA 3MLTA 2ATKA 1KEGL 1LMIA 3D06A 1MI5D 3G6JE 2IVFC 5HI3C 4CN6A 3LN5A 5E1AB 5E00B 3BQUD 3AWEA 2N59A 1XF2B 3WUZA 3FO2A 3HPLB 3LSOB 1TT6A 3UTPE 1S7QB 3LKOB 4GRLA 2P8LB 1W6LA 4U1HA 1F6AB 4NZTL 1J1OH 4MD4A 3SGEH 1RZFL 4K7PY 4N24A 3LQMA 1ACYH 4YDZA 1B9ZA 5I8CA 3S34L 4NERA 4GXVH 4W70A 1YAZA 1TTUA 3MC0A 3BD4A 5CU9A 2O6PA 1AANA 3ZKMD 3TGXA 4PSRA 4TNVF 1SUHA 4U1KA 3S4SA 3P3RA 3SCMB 2C3GA 1A3RL 1GIGH 2DKUA 2GIYA 2X6UA 2CO6B 3NFNA 3Q01A 1LGVA 3U7YL 3QIUA 4NQDB 2WLZA 2LLLA 1VFBB 1M7IB 4M7ZC 4OBSA 4S1QH 5EC1A 4PCSA 2PRNA 3EH1A 4GFXA 5J11C 1OB1A 3C5ZC 4NENA 1AGFA 4N2CA 3QXDB 4FQHB 4AI7A 2YK1L 4QXUL 1AG0A 4ACPA 1XF1A 3CZSA 1W2KT 3DV4B 4XPGH 4OJAA 4XZ4A 1G9NH 2XPYA 3B7RL 5E00A 5E1AA 3HE7D 1XF2A 5F9WB 3MV9D 3HPLA 3LSOA 4MTMA 3V8UA 4NZFA 3DHMA 2HLAB 1AY1H 1S7QA 4E1TA 2DMHA 3LKOA 4JPIB 2P8LA 5IOPB 5JOEA 3MJ9A 4NOFA 1F6AA 5B66O 1X9LA 1Y1UA 3IAPA 4U6YB 1IMHC 5BO1H 1QUPA 4JPVL 4HK3J 2X2HA 4I3GA 2GUOB 4NNXB 5DU7A 4UT7L 1N6QH 1ADQA 1XCQB 4YHZH 1PU0A 1NEZG 4IS6B 1GFQA 3L3OB 1TU2B 2X6BA 3SCMA 3VXUD 3NZUA 2K7QA 3H56A 3JV4B 1GZPB 2CO6A 3WKNA 4NQDA 3ESVF 1VFBA 1M7IA 5GJSH 3UBXB 2BMKB 3T0AA 3CHSA 2DMBA 4TVPD 3H3BC 3L81A 4KR8A 3QXDA 5FDWB 4FQHA 4JY5H 3TFKC 5DZOA 4YHYC 2W0LA 4Y5VB 5SWSE 1HYSC 3NJMA 4XVTH 1ZK5A 1PBYA 1YVLA 4K55A 4D9QD 3DV4A 2FIRT 1UB6B 1ET8A 1P6AB 4BA8A 3E8VA 3ZZ1A 3GTNA 4MBOA 1A14H 3N85L 2GT9B 3DZMA 2HLAA 5IOPA 1IE4A 2AGJL 3FZUC 4JPIA 5BQDA 4TULL 5I1LB 1G9MC 1F86A 1KB5H 4U6YA 4F8PA 3DXAD 2WSDA 2EIMB 2X70B 4PJ8C 4NNXA 2GUOA 3BUPA 5KOMC 2A0LD 3GBDA 1D9KC 3KD4A 4XVSH 2Q8BH 1XCQA 1ZANH 1GRWA 4ZTEA 3UEZA 4IS6A 2IGLA 1XSIA 4BRJA 3L3OA 1TU2A 3O3AB 1J8HB 5CZKA 4HWBH 4G43B 3TN0D 2CRZA 4O9HH 5JQHC 3C8DA 1BEXA 1U3JA 3JV4A 2VDKB 1GZPA 4AJVA 5E2VL 1PIGA 2RTTA 4HX1B 1WG3A 2VC2L 5GS2D 3UBXA 3HRZB 2BMKA 3WTSA 1NH6A 3PDGA 1E2ZA 2KPWA 3JWOL 1OP4A 2XVGA 3LPWA 3KEDA 3OAUH 5FDWA 1R3KB 2A6DB 4DN3H 4WCYH 3KVDD 4PJIF 4Y5VA 3O2DA 4H0IA 5I5IA 4LT7A 1U3HB 2HPOA 4P23B 5DVLA 2VNCA 4XPFH 2VDLL 4A2LA 1DQLH 5DZ9A 5TE6H 1UB6A 4OGAC 2VLJB 2HA1A 1E4XL 35C8H 3CZLA 3WXVL 1HCVA 1OAQL 1ZS2A 3B4NA 2GT9A 4PRBB 5EBGA 2O4VA 4WW2F 5I1LA 4NWTH 3BE1H 4FG6C 3P69A 5DMYA 4R9HA 3V4VB 1KCLA 2Q10A 2X70A 2F5BH 4HMEA 3QG7H 4C57C 2CDEB 1Z9SB 3IRZA 4X5LA 3AXIA 3VG9B 2QQLL 4MX7B 4N2EA 4JDVB 5JIHA 3O3AA 1HAWA 1J8HA 2VDOH 5BRZB 1RU9L 3KPSE 4G43A 4UT9L 1MPFA 4YE0A 4WNJA 1IM9D 5KYWB 4FGMA 3PLYA 4U3CA 4PWKA 1MSPA 4YDIH 1OTSC 5A40E 2P52A 1BQLH 3OHMB 4HX1A 1RVFL 3GHBL 3BHBB 4UDTB 2X6MA 5D7JB 3HRZA 2HPTA 1QWNA 3SDYH 5K9OB 1QNZH 3FT0A 2K8MA 3AADB 4R8WL 3PY9A 4TQEH 1VRSA 4CRPA 2IWVA 1R3KA 1J8KA 1GFMA 1VHPA 1YZZA 2CMRL 3D2UB 3O9WC 1FL3B 5AW8B 3U4BL 3ZN6A 4P5MB 4GOSA 3DETC 4P59L 4JG1L 4JO2L 1U3HA 4W9HC 4P23A 3UDWA 4MWFB 2UZIL 1O7SA 4TSCH 2VLJA 3QZWB 1S9WB 2HKHL 2QGBA 4J3BA 2X6AA 2NXYD 3PF2A 3ZTJG 4WK4B 1ERNA 4PRBA 1D2OA 1F00I 4U4IA 1AHKA 4JO3L 5F44A 2ATPB 1JPGB 2XKNB 4K8RH 3S4SG 4N5ED 3V4VA 5I9QC 4HFWB 2NNFA 25C8L 2CDEA 2QZ5A 2FJUB 1Z9SA 2RA1A 5T8IA 1GFNA 1GGCL 1W8EA 3F04A 2D3VA 4MX7A 4RA3A 4JDVA 2EABA 3BD5A 2VH5H 4LHUB 5BRZA 4A7GA 1MCDA 3N06B 4WEBH 3ZT6A 3D2TA 1FCGA 1AXTH 5HHOE 1R3HB 5KYWA 4FTDA 4HC1L 5M94B 3PORA 2CHDA 3GBEA 2EVFA 3UAJA 4YHLH 4JQIL 3RWHB 2FZ3B 3BHBA 3MV11 4UDTA 5D7JA 3BUIA 4HFUL 3HR6A 5K9OA 5FXCH 4M5SA 2ZCKL 1UWEH 1UXLA 2EEXA 2LTQC 3QEHB 3T0EE 3UBHA 4FMKA 1SNRA 3CZEA 2K1MA 4EIBA 2XHNA 1S7WB 1ZLSH 3D2UA 3T3ME 1AHWB 1FL3A 5KVGE 4P5MA 4IHOB 2OR9L 1DJXA 5CLTA 1A5FL 5IQLA 4Y2NA 1FRGH 4RMTA 1I9JL 4MWFA 5EOQH 3LIUA 3WD5L 2HJKB 2CHXA 3QZWA 1S9WA 4BDVB 1NSNL 1YYLL 2ICEB 5CJOH 1JZJA 1WS8A 5KSUB 1AD0B 3OKOB 2UVEA 2NY2D 5AB0A 4WWNA 1R5VB 3N0PB 1VEMA 3DROB 1WIPA 1JPGA 2ATPA 2X4QB 2XKNA 3GK8H 3QFDB 2NUTB 4JVWA 4WU5B 4Y19E 2RIKA 3HNVH 5DI8B 5J9PB 1JHLL 4HFWA 1S78C 5TF1H 3ZMEA 1A1NB 4JJHA 5HYIA 4KKBD 5FA4B 1IFRA 4C4VB 4NHCH 1CWVA 4Z7WE 2B1HL 2C3WA 2XA8H 1RUAH 5K9QG 4JDEB 3SZVA 3BUBA 4UMGA 4B0MM 4HIHB 4G1MB 2QJDA 1AZVA 1OCZB 3LEYL 4KDTC 1R3HA 1MRFL 4M1CD 4YWGH 2MOVA 5DSCB 1YC7A 1MCEA 4DGYH 4DPBX 4LCYB 3VU2A 1DQMH 5ILTL 1ASPA 3RWHA 2FZ3A 3SDAA 1P7QD 1EERB 4BBWA 1SOSA 4A2HA 1BXAA 3QEHA 1KIRB 4AGNA 4B9JA 1F4XL 3C2AL 3U0WL 5AAPA 3QJHB 3H9ZA 1S7WA 1AHWA 3PQYD 4JPQA 2OW6A 4IHOA 3FS9A 3OQ3B 3V4UH 2X09A 1VA9A 5BZXA 4GW5B 1A8ZA 1SN2A 2BX5A 2HJKA 4HUKB 4BDVA 2ICEA 1OWRM 3F58H 3N1MC 4HJJH 1FZOB 1WC7B 2JELL 2YD9A 3MOAL 1AD0A 3OKOA 4KWUA 5E6IC 5KSUA 3BT2H 2NY3D 2HAZA 4M3KB 3HZKB 1T04B 3MRKB 1R5VA 3K4ZA 3O4OC 1HQRB 1WZAA 2WXRA 2ZG1A 3BO8B 3DROA 2X4QA 3TWCH 2O6CA 4QIRA 3QFDA 2NUTA 1JRHL 2WXNA 4WU5A 5DI8A 5J9PA 2YPVL 4FQIL 4A68A 3V0EA 1A1NA 5JHDE 4IQHA 1LO4L 5FA4A 1MJ8L 2BIQA 2BHUA 4C4VA 3UBXG 1S9XB 1F3JB 4HPYL 4PJGB 4RGMB 3WTXA 2JKXA 1FE8H 4JDEA 3ET9F 1U2CA 4R2GC 2JKWA 2WUBH 5EA0L 3AM8A 1FFOB 4HIHA 1OP5K 4G1MA 3LY6A 2OBGA 2P1YA 4M1GH 2J55A 4MB3A 1XH2A 5DSCA 4LCYA 4OIFA 2WUCH 4B9CA 3OSVA 3RVXC 3QQ9C 1PX8A 4LSFA 1EV2E 5HDWA 4DGUA 1SDYA 1N19A 2MQCA 1KIRA 1PEZA 3KPNB 3LZFL 4AMKH 3R1GH 2KT6A 4FX5A 3QJHA 4EBQH 5D5MB 5MHSD 2WM0A 2Z1PA 3IU4H 2SEBB 3HC2A 4ZQKB 1BT9A 2HYMA 5HJ3B 4XN2A 4P5TB 4GW5A 5E70A 3JTTB 4RIRB 1RCYA 1FZOA 1WC7A 3JWDL 4RESB 4Y2DD 3NIFF 3HZKA 1T04A 3MRKA 4MMXC 2ZF9A 3KS0J 1HQRA 1ECYA 1FAIL 1OKEA 3BO8A 2AQNA 3P3SA 4KROB 2VN4A 5DYOB 2KDYA 4BGLA 4OZIE 4XI5D 4FYRA 3L54A 1KCWA 3RNKB 3I75B 4DP8X 2PCPB 4UZUA 3SJVB 2G60L 2F7OA 1S9XA 1F3JA 4HULB 4PJGA 4FABH 3FO0L 4AJ0A 5IJDC 4AEHH 3TBSB 3NCBB 3N91A 1EGJA 4DVBB 1HS6A 3HS9A 1FFOA 4MA7H 2WAHA 5F72S 4G8IB 4EF3A 1JERA 3VXTB 3OLGA 2XCMC 5GGVH 4HPOH 4GMTH 4Y1AD 3QEGH 2F1CX 3KPNA 1KT2B 3ILQC 1UZ6E 1X44A 4ZX3A 1M3JA 4HCRA 1XCWA 5D5MA 3KJ6L 3TV3H 1INEH 4H8QA 3VWKB 5FHAL 2SEBA 4ZQKA 4TVPH 5IG7B 1TZIB 5HJ3A 3WNOA 1E3FA 3HN5A 4NQCE 2DL2A 1K6QH 4P5TA 4RLBA 1XMWA 3QDJE 3L3GB 4Z0BL 3JTTA 2LR4A 2CIIB 5GTIO 3AWFA 5CO1A 4RIRA 4KZEL 4OZGF 3JVGA 3I9AA 2ZPKH 2P49B 1GJWA 5CD5D 3N42B 1X4XA 1IAOB 1IFGA 2GABA 3E8UH 4L1BA 5FYJL 5DYOA 3ZT7A 4Q14A 1ZV9A 3SKOB 3Q8EA 3DPDA 1M2OA 2NW3B 3BMWA 3I75A 4LCCB 2PCPA 3RNKA 4UNVA 4G7VL 3NAAL 4GS7C 3SJVA 5FM5O 4MJIB 3IKCB 3VFSB 1ZEAH 2UVFA 4FQ2L 1NC2B 4LDEB 3TBSA 2O5YH 4LHJB 3P11H 2BIIA 5KVFL 4DVBA 2R8SL 1A8JH 1JGLH 4Q6KA 3U48A 4G8IA 3KJ4B 2Z8VC 2ZAGA 1NAKL 2CXKA 2HX7A 2GTWB 3CQPA 4AIEA 4PJBB 3VXTA 4ZFOL 5D7EA 1OCWH 5K9KB 1MW2A 3CFJB 3FYXA 4ONGL 5C0RL 3QZWG 4TSBH 4YBQD 3VYOA 3TA3C 1KT2A 1MWAH 2AXGB 1JVOA 5CGTA 2IAND 1OPGL 2Z91B 5CEZE 5GS2H 4G11A 1TUPA 4ZS7L 3VWKA 1HL5A 3C60C 2PP7A 3DJSA 3T4YB 1TJXA 5IG7A 1N64H 1TZIA 1IU1A 3G9VA 3NJLA 4UQIM 3WNJA 4ALAC 2NX5B 4AWJC 5JTWA 1E50A 3L3GA 1MPAH 2Q3XA 2XX1A 4Z1PA 1L4IA 3P4NB 2CIIA 2J43A 4V2BA 1DBJH 5KZCB 3VXMB 3FQTB 1DLHB 2FH8A 3QUYD 5H2BB 3PXJA 4ZK8A 5C1MB 4PLOB 5A2AA 2G2RB 4B27A 3SIKA 4LHUG 1NFDB 4Y2OB 1IAOA 2LFGA 2CUHA 5DZJA 2NQDA 3ZX1A 1E4KA 4G6KL 1A3LH 1NANH 3FT9A 2WXMA 2ZD0A 4M7LH 4OM0L 4DO4A 3SKOA 4LCCA 5DR5L 1YS5A 4RJWA 2NW3A 4Y4FB 2CH8A 4ZOCA 4K94L 12E8H 4MJIA 3IKCA 3SQBB 4GIAA 1ETZB 3VFSA 4H8UA 5CZRA 1NC2A 1UXSB 2R39A 4PS7A 3HG4A 5CZVH 4XB3A 2ESVB 1O75A 2FJHB 3PHAA 3U30B 4KKRA 4UILL 3WENA 2MOGA 4PHZA 4WUUE 1WHOA 4APQB 1HL9A 3HVDA 5T1DL 1JHTB 2GTWA 4L3CB 3BPNC 5I1HL 4PJBA 4BZ2L 1O7DC 1JGUH 2EDTA 2V9RA 4WWKD 5K9KA 3CFJA 2G5UA 2IDCA 1IJ9A 1Z5YD 2R0KL 3WSQH 2R56L 2VW4A 4N68A 4X6FB 1UATA 1GC1C 2AXGA 5CKGA 5DT1L 3KHOA 3O3EB 1Y6NR 4LDCA 3ZBMA 1QTPA 2Z91A 1G7PB 1JAEA 1KB5B 2IBBA 3QPQD 1FL6B 3T4YA 2A4ZA 4Y4KB 5A2FA 4U33A 2NX5A 3BRGC 1JZGA 3NRQA 3P4NA 3WEAA 2N01B 2JJWA 3VXMA 3BKML 1DLHA 3FQTA 4X7SL 3O4LE 5H2BA 3U7AA 2HRPH 2G2RA 4PJ6A 1NFDA 4GMSH 3M7FB 4Y2OA 1C5CL 4YBLC 1KYAA 1JYNA 3ZE0E 1A65A 3WU2O 5LGYA 4DQOL 5DYFA 4U3SB 3K8LA 4Y4FA 1QI3A 1TZHB 2HLFC 2PCXA 1HINL 2ZYIA 3SQBA 1ETZA 1IBGH 4G9FB 5EIQA 1KJ3L 2FCBA 1UXSA 4B60A 2ESVA 2FJHA 1NGQH 5GRUH 2AXHA 3PL6C 3GZPA 3JBG7 5ADPH 5FGCB 3V0GA 4UANA 4APQA 1JHTA 4L3CA 1KGCE 1NMCC 5JR1L 2XXGA 5DURB 4FFTA 4FUVA 1CXKA 1G1CA 1HI6B 2JKLA 2R4SH 1TJMA 3UC0H 4A7UA 2KQMA 4NT6B 4X6FA 4K3GA 2JQAA 2ZXAA 3O3EA 5D1QE 4GP8B 1G7PA 1KB5A 4MRCA 2VZ1A 3P2BA 1FL6A 2IXQB 2CK0H 1BGXL 4Y4KA 1L9OA 1NCCH 1FP5A 3BCDA 2FEEI 1CK0L 4TLUA 1PGRB 5TK2A 4YFLF 4A63A 5L0QB 3VE2A 1PQZB 3GSVB 2XU9A 2ZXEB 4N8PA 3HCVB 2VDOB 4XMKH 4HWBA 3O2WH 4F1ZA 1CTNA 1NKRA 2QQNH 1AQ8A 4CU7A 2Q9OA 2QQKL 5FK9B 5AOMA 1JXGA 4QNPF 1SXZA 3SDCB 1HQ4B 4U3SA 1WT5A 3VRLE 4DP5X 4QHKI 3TEWA 2KDGA 3WFCL 1TZHA 3UIYA 1FNSH 3WN5B 2EYTB 4NZRH 4G9FA 2DQGH 4UYQA 1A7NL 2VDNH 3TX4A 5A6MA 4HCFA 4J3OG 3EJRA 1T80A 4WF7A 4M6OH 3TEXA 4K2UH 3AA0B 4Z7NB 3NZ8B 4W9CC 3OSKA 1XGQB 5EU6D 3E3QC 1BG9A 2EE0A 2PORA 3CFEB 4HAKA 1HI6A 3HHMA 4I4WB 3QUMH 1NOAA 2K7PA 3OHXC 1XZWA 1YHPA 4NT6A 3T0EC 1X3DA 4PRIE 1BZ9B 4GI8A 3FCSB 4UM9B 5T1LD 3UO8B 4LOFA 5I1IL 2EDEA 4LU5L 1F90H 2IXQA 4ANXA 1KTRL 3BZ5A 3K80A 5E8EB 4RFOL 3DRQB 3F2LA 1EAOA 2N1TE 5E4EC 1PQZA 2A74C 3GSVA 1JPSL 5SWZD 2I27N 3HCVA 4R5TA 2X40A 3LH9A 3QDMB 1XGUB 4C54A 4ICWA 1S4IA 3AS0A 2H2SD 3K2UL 3ALXA 4TNGA 1OGPA 3LKSB 5FK9A 5LO7A 4POUB 4LIQH 4KY2A 3SDCA 1HQ4A 4DGWC 5EWIH 4OVVA 4E42B 2O72A 3GS0A 4IL6O 3OZ9L 3QGVA 3WN5A 2EYTA 2AI0L 4P46B 4F7PB 1S46A 4FFZL 2WO4A 5C70A 2FX7H 3BESR 3O8XC 4ODTH 5IGXL 1IBZA 2YLHA 3QARA 3AA0A 3RVWC 5KUKA 4HIQA 3NZ8A 3VXPB 4KJPC 4JHWH 1PDKB 1XGQA 2GVYA 3CFEA 2OMTB 1A21A 4J3WA 4I4WA 1TTCA 5FUZL 4PW9A 5I1GL 1CFNB 1ITCA 3NSFA 1BZ9A 3FCSA 3OJVC 4XN5A 4CSTA 4UM9A 5IJCC 1I1RA 5I2IB 5DZNA 3SDXF 4K15A 5T3ZD 1WFNA 5CGBA 2Q1EA 2NYYD 4MNQD 5E8EA 5KYNA 3AS1A 3DRQA 4E9TA 2EILB 3LRSB 4P9HL 1PIFA 3PG2A 3RUGF 1YMMB 1F5WA 2BNUB 2NY1D 5F0PB 1E7UA 2EDWA 1KTCA 3ZU8A 1MZYA 3KZ8A 3QDMA 1XGUA 4JM4L 5DUML 1QBLL 5DRZB 5BS0B 4LLAA 5DL6A 4XMLH 4R83A 4M5YL 5HHXL 3BLBA 3LKSA 4Z7UF 4HJ0D 3X1NA 1U8MB 2DV6A 1EO5A 2XQYG 4R4BB 3ILPB 5DRXB 5EUOE 4E42A 1NQBA 1P6WA 3PP3H 1NOFA 2WIMA 3U82B 4E41B 1FNAA 3V5HB 1W91A 3S3CB 4EN3D 4P46A 1CIUA 1TZOA 4X83A 4F7PA 4ZMNA 1Z0NA 5FCUL 2X4SB 5L9DH 1VKXB 4QJ4B 1SHWA 2AJVH 4D8PB 3H55A 1I1AD 4EDWL 3NP3A 5JZ7C 3VXPA 2WWMC 3NMEA 1PDKA 4AYEC 5LG1A 3L8QA 2CBPA 1DANU 2QSQA 2Z92B 2OMTA 2ZYRA 4FI6A 3VXRB 1T03H 1FNLA 4GRWH 1UXWB 1CFNA 2CSPA 1J9TA 2QTVA 3PCYA 3MNWB 3WFHB 1NWOA 3A0OA 2H3KA 2XJKA 3UTSD 3BAKA 3TBYB 4ANVA 4ZW8A 3BQUB 5I2IA 3EZJB 3Q0HA 1V10A 4XODA 5I15L 2DICA 5SWQB 1JBJA 4OLWL 2VLRD 2QFRA 5AW9B 2OSXA 3B5GA 3QPKA 4LSRL 1BOYA 3LRSA 4PJCE 3MQIA 4CADB 4EN2A 1YMMA 2BNUA 3L08A 2XTJD 1MNUH 4MQTB 4JHVA 4XNYH 5FWRA 4OLVH 5DRZA 3RWCB 2L8AA 5BS0A 3JSSA 2YSSB 4NP4L 5E4IA 4U7MA 2DH3A 3OWEA 3ZY7A 1U8MA 4PP2B 5DRXA 4R4BA 2V7NB 3ILPA 4NM8L 3GSWB 2EVHA 4OU3A 4N9GB 4E41A 3V5HA 1VKXA 1YEEH 2X4SA 4KKCD 3HJ0A 4WHDA 3QNXB 4U31A 4D8PA 4X5PA 3WIFB 3N9GH 4I0PD 3WNPA 1BMGA 4EIGB 2C9QA 5I1AB 1B4LA 3MRRB 4LRIA 1LEKB 1U8CB 2W9LA 2Z92A 5C3TA 3VXRA 3VACA 1UXWA 4K7PX 3QZOA 4CN1A 3IFNH 2EH7L 5IMOB 1QRND 3EW3B 4R90H 2BOLA 3H3PH 3MNWA 1LQBC 3WFHA 3IDJB 3LXCA 3TBYA 5I1DB 3QJUB 3BQUA 3LS5L 1MW0A 1QW8A 1X7SA 2F6AA 3HE7B 3COOA 3IJSB 3MV9B 4X7TB 4FL4C 4PWGA 5SWQA 5A3ID 1Q9KB 3AABA 3B2UC 4Y0GA 3ZGIA 1HT6A 3N1GC 2E7LA 3GIVB 3WI9A 4RL9A 2CKBH 4CADA 4L8SC 4PJDB 1AHMA 4YC2B 4QTIH 1JZDC 1LO2H 3U6XA 3GINA 1TENA 3Q8BA 1YEGL 3RWCA 4MAUL 1WGOA 3Q1SH 5E0FA 2YSSA 2G5RA 4DIXA 1DVUA 4PP2A 2V7NA 3QORC 5C08B 2VLLB 2ARWA 3GSWA 4FZMA 4DAGH 3VXUB 2YBGA 2JJSA 4N9GA 1YSOA 1RJZB 3DX2A 5DQDH 1DQDH 3D33A 5C0BD 3VQ1C 2A1WH 4TQIA 3Q8FA 4HH8A 3QNXA 2M2DA 4PR5B 3WIFA 1QYGH 4UTBL 5FW6A 5I1AA 3ABMB 2ED9A 4LB8A 3MRRA 2J6WA 4M4PA 1BQSA 1LEKA 1U8CA 2IV9A 4Q0XH 2XFGB 2VLKD 3LKNB 4HK0B 1CR9H 3CWGA 5IMOA 2J5LC 4JG0L 4YLBA 2FO8A 2BNQE 3IDJA 1U8IB 5I1CH 1ODUA 5AVYB 3DURB 5I1DA 4X7TA 3HE7A 4PY8J 4Q4IA 3IJSA 1Q1JH 3MV9A 3P73B 1B3JA 4UZSA 1TYRA 2J8UB 4XP9H 3CVDA 5I1KL 5F0MB 1Q9KA 4N1CA 3GIVA 4MZRA 4JFFE 2VAJA 3DXAB 4L05A 4PJDA 1E27B 2ICWB 1RUKH 4UQCA 3L1GA 4KAQH 1FUNA 2HVJB 1EPFA 5KS9E 2X89A 4UNUA 1SF3A 1XSOA 4LARL 2PXYC 1HHIB 4YZWA 2A99A 2EZ0D 1TO5A 4KI5E 1AMXA 2YC1B 3TN0B 5C08A 2VLLA 4KXDA 3RQ3A 3RAJH 2OYLA 1RJZA 4GAJH 1JZHA 1DBML 1MWAB 5DVKA 1E5YA 3TO4C 2GJ6D 4YGAB 4GG6E 2H0PA 1SRDA 2Y5QA 4PR5A 5T5FA 3I9GH 2PN5A 1NCWH 3NJIA 3VDBA 4KI1A 1AZRA 3RY6C 1DLFH 4F91B 4NM4H 3DX3A 4ELME 3M1OA 4M48L 2X1WL 3LKNA 4HK0A 4JB9L 1EHAA 5LQBH 4KOCA 3RZCD 1U8IA 4RGND 3D87B 3MLYH 4UQ9A 3DURA 1AP2B 1RZKL 1IGMH 2K45A 3Q6GL 5IV2B 3P73A 2J8UA 3Q7JA 2BP0B 3POXA 1CXEA 3LEVH 2FB4H 2XVLA 3N44F 2B2XH 1ZJBA 3DXAA 4XRCB 1E27A 1PKQB 2ICWA 4MSWB 3KYKH 4HUMB 5CILL 3SBQA 2V37A 2HVJA 4X5QA 4DP1X 1GJUA 4Y4HC 3BDBA 4D9LL 3IDYB 2YMXL 1HHIA 1UENA 1WA2X 3X1BA 1C16B 1Z1WA 4P07A 2YC1A 2CRIA 5FVNA 4NQUA 3TN0A 2J3SA 3IDMB 1IM9B 2W9EH 5I71C 4PWHA 5A2LH 1E4HA 1MWAA 1XIWC 2WXIA 3NN8B 3SODB 2MPVA 4FLOA 5L7XH 4XCFL 3OLDA 2WB1A 4UQBA 3ARVA 4E9WA 2PO6D 1KBGL 2GYSA 4A1RA 2KLTA 5I6NA 1MVUB 3NFSH 1DVZA 4WK0B 1FIEA 3IGFA 3U36B 5JXAL 2A6KB 1JXKA 4F5CA 2NR6D 2XBDA 5KEZA 3MBED 1OM3L 1UQSB 3RPKA 4ZMXA 1T66C 1WUNT 1YEHH 2C8NA 2EEBA 1NGYB 1GOFA 5B4MD 1UM5H 1EHNA 5D1QC 4H20H 4QJ3B 1BIHA 1AP2A 4H1LH 1BXUA 4H25B 4X5WB 5DJ8B 5IV2A 4DZ8B 2NXYB 4AC4A 4MA8L 2BP0A 3D0LB 4RRPM 1SDAB 2J25A 3FJTA 1YEFH 2CDGB 4XRCA 1MJUH 1PKQA 4MSWA 1EZSA 3HN3A 5L4IA 4F57H 7PCYA 1TQCC 2VAAA 4NNPH 1M3IA 4G6JH 1RPKA 3ARDD 3PGFH 4NO3B 3G6JF 1C16A 4XP4L 3BFOA 3IDMA 5AVXB 4GT0A 3HC3H 4HMDA 1FSKC 1IM9A 2ZICA 3G04B 3WEXB 2CKNA 5MEQB 4GSQA 5B7MA 3NN8A 4JMNA 2GITB 2BIPA 4HA1A 4GAGL 3MODH 3L4ZA 2F7QA 4OSUH 3MGOB 5L8LB 1P4UA 2ZAHA 2YXFA 3LKPB 1JF1B 5AFUK 1H5BC 1F3RB 2J1YA 2V6HA 2F19H 2D03L 2X0VA 1MVUA 2RBLA 2NPLX 4F15B 5E8OB 1JZ7A 3U36A 2A6KA 4JM2F 3DSFH 2GTQA 3NSJA 4LQFH 3O2VL 1UQSA 2YMOA 4FHBD 4OIIH 3CQFA 1NGYA 1HHKB 2ZXGA 2AJZB 3UERA 1UCBH 3UJJL 2QKSA 4MVBD 4X5WA 4H25A 5DJ8A 3O3BB 4DZ8A 4IOFD 2NY2B 4IBZA 1TOXA 3NCYP 4AYSA 3D0LA 2CDGA 3NCJL 2VDNB 1EX0A 1II4E 1K2DB 2GK0B 4NQDE 5T3ZH 4UUJB 5E8DL 4YK4B 1UYWH 4XNZB 3CCHB 2BIMA 4YHML 3FKUS 3ZRSA 2KPNA 1NL0H 4NO3A 2XWXA 2QR0B 3QZNA 4ZFZB 4ENED 2HRGA 3QUMB 2ICCA 4RAUB 3E7JA 4OY9A 3VI4B 3WEXA 3HUJB 3G04A 3ULUL 2NSMA 5MEQA 1H6TA 3AS2A 4JRWA 3MO1B 1KCVL 1D3CA 4OV5B 2GITA 2XZCL 1P7QB 4EMZA 4X6CB 4I3SL 4FA6A 3MGOA 4PJIB 2KC0A 2CZNA 1GL4B 3LKPA 3QP3A 2JLLA 1JF1A 4GSRA 4Z78B 4G82A 1BZ8A 2ZE0A 1EHKB 1H3TA 1N59B 5E8OA 3PQYB 2X4OB 2VABB 3TONA 4PVMA 2BS8A 4YDKH 1SZNA 2JKTM 3K6IA 3BQVA 5M7QA 5D6CB 1VADB 3ARBB 1HHKA 3LVTA 2AJZA 1IX2A 3II1A 3QJRB 3U9WA 3B7TA 1CGTA 4LCIL 2ZLDA 2VXSL 3NEXA 3QZBA 3MBXL 3O3BA 1L0XA 2NY3B 4OUOA 3U4EB 3EJZC 3SPIA 3TLRA 3KLHC 5D72H 2XWBB 3VZTX 4ZOEA 1K2DA 2GK0A 3FU7B 3LQAL 3VG0H 4UUJA 2EKSB 1JJUA 4LSVL 2VLMD 4X4KA 4YSUA 1XHHA 3LXAA 1B90A 1NUNB 1PZUB 3CCHA 1A6UL 2XETA 3ABZA 4GKNB 2DKSA 2ZP0T 4NZDA 2QR0A 3HC4L 3T8XB 4QRRE 2X1PA 3NCXA 4ZFZA 3QUMA 1SVBA 3QUZD 4RAUA 3VI4A 4NZTH 3HUJA 4KKLD 1ROWA 2N1KA 3IMSA 3KWXA 1RZFH 4JG9A 3MO1A 1MFMA 3S34H 4OV5A 1P7QA 4X6CA 4PJIA 3MRIB 4WK2B 1EJOH 3D39D 4YFDB 2F1TA 1F13A 5TISO 4Z78A 3P40A 1U30A 2WP3O 5ABZA 3DOIA 2ZWZA 1WCBB 2Y9RT 1N59A 3HOGA 3PQYA 4G7SB 2X4OA 2VABA 3TJEL 3D4GA 4KH9A 4X6BB 3C2SA 2BC4B 2W07B 5D6CA 1VADA 3ARBA 1Z3GL 3FTSA 3FQYA 4LSTH 3O6MH 4IEFB 5ALCL 3RVTC 4Y2DB 3K0YA 2CO7B 3U4EA 1MCSA 5AW4B 4WTXA 3LPPA 4I7ZC 1DVTA 1OAUL 2XWBA 3CHQA 3MLXH 4WW1B 4JFPB 2YK1H 3V8OA 3WELA 4QXUH 2HX8A 3FU7A 5I8EB 1MHHB 2EKSA 3LZNA 1T22B 5I16B 5TDOB 1OCCB 4JKNA 2W59A 1BJMA 1TNNA 2A2QT 4GKNA 2M06A 5IR1B 2N3JA 3T8XA 5AFAA 1RERA 4GRWB 5AZEH 1CBVH 2XKUA 5IESL 4NPYB 1KIQB 1R75A 4JFOB 1IAIL 3DX1A 4ZSOB 2VLJE 2H6PB 1CLOL 4FRTA 2AV1B 3MRIA 3L2NA 4Y1AB 1CFVH 3HB3C 2P47B 2BVUA 4F92B 1AOZA 3F6LA 4PYHA 1D7BA 1BIIB 4AUYA 1CD1B 1WCBA 3PWUB 5GRZA 5KVDH 3V7AG 4GXFA 2EE3A 1RH8A 4X6BA 5DS1A 5EOCH 2YXVA 2BC4A 1SXSA 1FNFA 2W07A 3P02A 2WKOF 5FYKL 3I2CL 5F3FA 1CLZL 4DGIL 1ORSB 3ZE2B 4UU9B 4IEFA 4K3JH 4Y2DA 2J73A 2CO7A 5L88H 5BRZE 3B2PA 1PX3A 2XN0A 4WW1A 4JFPA 1Q90A 2YPLD 2IAMD 5I8EA 1MHHA 1T22A 5I16A 3WU1A 5TDOA 3X14B 3HG1E 4PJ7B 4CVWA 2DEXX 5IVXE 5ADOH 1MY7A 2ENYA 2AJYL 4WY7L 2F5AH 5HD8D 4BFIB 2BHYA 2DLEA 3K72B 5E2WL 5IR1A 1IC0A 2CR0A 4BK8A 5L4FA 2AGJH 4WO4D 4TULH 4U6VL 1MEXH 3I85A 4P9ML 4NPYA 1CFQB 1KIQA 1LWHA 3EDKA 2NSXA 3GEWB 4JFOA 6FABL 4ZSOA 2CO2A 1I8KB 3AG1B 5CSGA 2H6PA 2AV1A 1NIBA 1PYWB 2QFPA 2X3AA 2X9YA 3EYQC 4Y1AA 4XVJH 4J2XA 1IZKA 2AVFA 4FESA 1G0XA 3MYJB 2MTPA 3CLEL 1BIIA 2HWZL 5MEPB 1CD1A 5A43C 3PWUA 2CKBB 3MA9L 4FFVC 1U3NA 4G83A 4HOWA 3UAFA 2W9DH 4XC1L 3IFPB 4QYAA 4ZI8A 2C4FU 2VC2H 1SEBB 3CFTA 1ORSA 5BZDB 3JWOH 4UU9A 1WHPA 3QUYB 1FH2A 1S8DB 3NSYA 4X4XB 3S96B 1QFOA 4PJAB 1OSPH 2HG0A 4WEEA 1BX2B 1NUDA 2Z8SA 5HVHC 4GQ9L 4NUJB 5AL0A 4L5FL 5CSBA 3T2OA 3T3MF 3QIBD 2WIIB 3IS1X 3X14A 4PJ7A 5EFIB 1IC7L 5F7NC 2QLVB 5LXGL 2XZAH 4BFIA 1J11A 4XZUB 1OAQH 3K72A 4KQ4L 1N26A 3A5VA 4MJ4A 4KI5C 1U4FA 1CUOA 4A6YL 4WHTB 3OR7B 2AEQL 2H32H 4I9WE 3W2DL 1YA5A 1FA4A 3FTWA 1CFQA 2HFTA 4FQJL 3NK4A 4WWKB 4X2UA 1ZHTA 4OLYL 3P0YL 1I8KA 1PYWA 2WQWA 1UUSA 2QQLH 3FTVA 3MYJA 5F7HA 3CLFL 4QTHB 1IQWH 1RU9H 5DVNA 5MEPA 4UT9H 2CKBA 1OAKL 1VCAA 4FP8L 2X4TB 3TTYA 2JB5H 2C9XA 3FT1A 3VU1A 3QIWC 3IFPA 3DARA 5GISL 1BQUA 2C4FT 2P44B 1RVFH 1SEBA 3GHBH 4WO0A 1ZLWH 5KTEL 3L9RB 5F7AA 5SX5K 1RMFH 3S35X 4ANWA 5BZDA 4R8WH 4LRNL 2BO0A 3QUYA 1S8DA 4X4XA 3S96A 3KGTA 4PJAA 4YX2H 2CMRH 5AYTA 1ZTMA 3EHBC 1H6EA 1BX2A 4LNRB 4XNMB 4NUJA 3JUZA 4JO2H 5E08L 2BDNH 2WIIA 5EFIA 3TVMC 1GCFA 2FEDD 4Z8FL 3SDDB 1GFPA 1AYOA 3PAVA 1PSKH 1IIKA 4AL8L 1AS8A 3KR3H 4FTVB 1KC5L 4CKQA 3HG3A 4WHTA 3OR7A 2WCSA 2WWKO 1EMTL 3PRZA 5D1ZC 4W81A 1U0QA 3SBWC 5E5RB 4JGJA 2EADA 3P0VL 1I8UA 5B1AB 25C8H 4HXAL 4WWKA 5FFLA 1O6SB 1GGCH 1BPVA 3D12B 2R89A 3NCEB 4XMXA 5I18L 5T1JA 1JNLL 2FD6L 2DQDH 4D0BB 3OLEA 3RRQA 4J23A 4QTHA 2R9HD 3S2AA 2X4TA 1XH0A 4KNQA 1CXIA 1KYFA 4G3YH 4M6AA 4EZKA 4F8QA 4OCRL 3D48R 4UV7H 5LXVA 5I5RA 4JQIH 1PZCA 3C87A 3L9RA 4PJGE 1SQMA 5CGMA 3JTYA 1UWXH 1N9PA 4YE4H 4KMTL 5EU7C 4Q2ZB 3W81A 4ZZFA 4M3JA 7FABL 4NGHL 4UINH 4YOKA 3LDBB 5B1CA 3I3EA 1BVNT 1P4BL 4LNRA 4XNMA 2Y1ZA 1AXIB 1A5FH 4FDWA 2EICA 4K9EC 3IU3B 1OSYA 3WD5H 4NIKB 4JKPL 4QF1B 1W6WA 3QNZB 4JFSA 1NSNH 2XVBA 3IMRA 4NFCA 3CNKA 3BFQG 3SBRA 1IVLA 3SDDA 3QHZH 4NWUH 4PGEB 5D5ME 4C4UA 4FTVA 4QGTA 1WA1X 1FH5H 1L9RA 2JJTC 2N4IA 3O81A 4QYOB 1KBKA 1Q9FA 5ESAB 5CIPH 5AUMB 2XN2A 3NJKA 4F8OA 5EU6B 2YQGA 1EQWA 1NCGA 1XGTB 1O6SA 2XPGB 4GY4A 2JXMB 2IPTL 1YQ2A 3K2KA 3FL7A 4H1LB 4OZIF 2WD0A 4LEXH 1TMCB 2YAFA 3BP6B 4D0BA 1I3VA 1RZPA 1VACB 2VW7A 2VOTA 5T1LB 5ACZB 1U41A 4RMRA 1HU8A 2ROXA 4P06A 4AK1A 2R0LL 4JN1L 4N2IA 1MRFH 3EYSL 3AFLA 1C7TA 1E7VA 5ILTH 4MDIB 2UXVA 3AQXA 5IEHB 1DUZB 2W80C 2V5MA 2VSMB 3VFWB 5SWZB 4XN9A 1JVLA 4Q2ZA 3QFJD 3C2AH 1BQRA 4IRJD 1ASOA 2WYTA 2Z9TA 3QWNA 5HI5D 1UZ6F 1HXUA 4P2OB 2X4PB 2O1AA 2HT2D 3V0VB 2VUYA 1ADWA 3IU3A 4ZMPA 4WI4A 3U9PL 1MW3A 4QF1A 3QNZA 2XE1A 2NMSA 5IFHH 2WZ5A 3GSQB 2VZOA 1DL7H 2R83A 2CGZA 4BCYA 1LILA 4PGEA 1IO4C 4HS8L 3SEPA 3ULVE 4QYOA 5ESAA 4FC3E 4XAKE 1G94A 5AUMA 1F4WH 4WI5A 4FQIH 2M83A 3KYAA 2X53A 2BCMA 1MWOA 1T0MB 5EU6A 3T8MA 1M7XA 1GOHA 1XGTA 3LAFA 2XPGA 1WBYB 1LO4H 2JXMA 4H1LA 1MJ8H 2R69H 1L3NA 3BP6A 3CFIC 4L9DA 4ATWA 5E6RB 3KL3A 3ZGHA 5HI4D 1I7RB 4AGLA 1VACA 3PWPD 4Q9QL 5T1LA 5DC4B 5ACZA 5GS0L 1RUQL 4WFGD 1MCIA 1LM8V 4MNQB 4X8CA 2EQDA 2E7BA 4QDGA 4MDIA 2YGQA 4MJIE 4MS6A 1DUZA 4IRZL 5IEHA 1KMGA 3VFWA 1A0QL 4XTRC 5SWZA 2NY1B 4UTAL 2V3FA 4JPSA 3LZFH 4YDLB 2JH2A 2A9BA 2VZVA 4KZDL 5EO0B 5LWYL 1XBRA 2YEVB 4P2OA 2X4PA 5G4NA 3U2SB 2OULB 1YY9D 3GHEH 5EZIL 1MUJB 3V0VA 1P9MA 1J12A 3WMSA 2EDYA 5FF6B 4IKKA 4EN3B 5J13B 3JWDH 3I3BA 3GSQA 1MREL 4FAAB 4OKVB 5EZLB 2W95A 4Y5VC 1FAIH 1I1AB 3GBLA 5ICYB 5HPMB 5GGTH 1TZ8A 3VSTA 2NX5E 3PWLB 4QXGH 2Y3AA 4XBPB 2Z3FA 1T0MA 1YMHB 2R4NA 1UFGA 1WBYA 2G30A 3VXME 3IPBA 2F7RA 3O0RH 4OCMC 1PLGL 3MV01 4PJFF 3ZR6A 5DTFB 1HXTA 3CN4A 5IB2B 3SZDA 1I7RA 4I18C 3UTSB 4NZUL 4KZCA 4GEJA 3PU7A 4RRPA 4XO3A 1TQBB 3MMEB 2BSRB 4N2BA 3PNWB 2VLRB 2P80D 4MNQA 3EH2A 4Q9CA 5KVEE 4XWOC 5JOPE 4UYPA 3O6FB 4WLCA 3T0WA 3LRLA 3D05A 2XTJB 4OGYH 43C9B 1PZSA 1T7VA 4HT1L 3JTSB 2CAKA 2B08A 2RHEA 2F15A 3KJ6H 5EO0A 3FTXA 5D4QA 3KXFE 5FHAH 3IGUA 3U2SA 3FHQA 4YHOL 2VXUH 1BP3B 1MUJA 1IRAY 1UEYA 3K4DA 5GSRB 1KOAA 4EN3A 5FF6A 3REVB 4KZEH 4JFDE 3MFGB 4OLXL 4WEMB 4OKVA 3RGBA 5EZLA 1ZS8B 1P84K 3N5AA 5A1AA 3G5XB 4UBDC 1I1AA 4WFHE 5ICYA 4I0PB 5HPMA 2K9FB 2JKSA 4O3ZA 3PWLA 1U3HC 1RIHL 4P23C 1FFNB 4XBPA 5E5MB 4KO5A 4X4MA 1YMHA 2JE8A 3ZE0F 3NAAH 3MRCB 3TYGH 5CKAA 5I1EL 3RA7L 2D3JA 3M45A 1OXYA 3W11C 1QRNB 5DTFA 1TR7A 5IB2A 2EUXA 2DAVA 5ABDE 5KVFH 4DOHE 3UTSA 5A2IH 2R8SH 3F84A 4GPVA 3TJPA 2I9TB 3FQ1A 5TJWK 1NAKH 2DWDB 3MMEA 4OQTA 2BSRA 3PNWA 2VLRA 4OJCA 3QR1A 3K81A 1OD7A 3SPVB 1ECZA 4ONGH 5C0RH 1IGTB 3O6FA 2Y7LA 1ZV2A 4OF0A 4G9FE 4XO5A 1RPQA 3VG9C 1CTOA 5GGRY 1FZMB 1AQDB 3UEQA 4QT5B 1CGSH 3GHPA 43C9A 3TBVB 1XL4A 3JTSA 4L3ED 3IYLW 4X80L 3GQFA 3EYOB 1L3WA 1IEHA 2J21A 4GI9A 1PCXA 5FGCE 4HLJA 4F9LC 2ATAA 4L1TA 5HDOA 1E6OL 2EUWA 3L1OH 3FXIC 1SN0A 3RVUD 5IWLA 1SMAA 5B3SB 5GSRA 1ZLUH 5C0BB 5E9DD 4LMQE 3REVA 1XCXA 3BAJA 2NY7L 1WV7T 3P4MB 4I3RL 3K8MA 1ZS8A 1ZHNB 1CB4A 3UJTH 3G5XA 4J5VA 4I0PA 3FU5A 4G6KH 5ICXB 3RJQB 1FFNA 5E5MA 4EZMA 3HI6L 1W72H 5DR5H 1BM7A 3MRCA 1D5XB 2APXA 2EXYC 1SPDA 2VLKB 3V5DB 1A4KB 1PAZA 1QRNA 1EEYB 2VQ4A 3L4CA 1XD1A 3FT3B 4JJ5B 4LPVA 3GSNL 3CZFB 2AJXL 1KN4L 4G8AC 5KN5B 2I9TA 3X13B 1JG9A 1RQ5A 1MLCB 2ALWA 2DWDA 5I1HH 3FAWA 4G6FD 4BZ2H 3HS0C 4ONFH 2WZ0A 4HSAC 4GF4A 3HBGA 3VTAA 3SPVA 2F8XC 3B2XA 1IGTA 2BRRH 2R0KH 1EBAA 3P9MB 1FZMA 1AQDA 4X7FC 4QT5A 2RFXB 5CUSL 5BV7C 3TBVA 3VFUB 2VZUA 3MLSL 1M7DB 2EDKA 5DJDB 3FRPB 3EYOA 3VXSD 1UZGA 2AAAA 3WV0A 2ZNWA 1TQVA 4Z7NE 2GI0A 5HVFB 4RDQF 4ALAL 2R29H 3WIIL 4E9SA 3SDAC 4JVPA 5DLLA 1L5GB 4GAYB 3OB0K 4H1LG 4KTYA 3UTTD 2R7EB 4BYHA 2GJ6B 4ABWA 3P4MA 3BH4A 2P9RA 2D7NA 1ZHNA 4Y5YC 1ZIBA 1C5CH 1JS4A 4F37K 4MMZC 2BPBA 4ODWB 1CFSB 3EDFA 5ICXA 2H1PL 2VC2B 4AM0Q 1HCYA 3BRZA 4UZGA 2AEOA 3WYRA 2ICEC 1D5XA 2C9VA 4DP7X 1SJVA 1HINH 2VLKA 3PJSB 4MA3B 4TYUA 2Y5EA 1A4KA 4HWUA 1D6VL 1KJ3H 5DMJB 1EEYA 3QDME 5C92A 3FT3A 5DEZA 4JJ5A 3RZCB 4OCYL 2OPCA 1KTBA 4RGNB 3CZFA 3SN6N 3HEIB 5KN5A 3ESOA 3X13A 4XX1G 1AO7D 1MLCA 3TS8A 3BZEB 5AVSB 3A6OA 3WHE1 1WWCA 4XOBA 3P9MA 3CFBB 2RFXA 4WTWA 3VFUA 1M7DA 3AM8C 5DJDA 1MVYA 1I9EA 4B9KC 3FRPA 3H8NA 2H32B 5AFUL 4X9HA 1L6ZA 1WITA 2Y1AA 4RVBA 1A3QA 3LHPL 4HWZB 3EFDL 1CGYA 2YUWA 1I9RL 1XO8A 2JKNA 1L5GA 4FFYL 4GAYA 4E9QA 3D9AL 2AITA 2QGDA 1JE6A 1Y0LB 2ERJB 2R7EA 2X2IA 2EH8L 2GJ6A 3EJQA 4M7KL 4WEUD 1N4XL 3PAYA 2P5WD 2QQKH 4QRPD 1HL8A 2C26A 1IBHA 7PAZA 2PO6B 4ODWA 3MJWA 1CFSA 2C3XA 1JZ6A 4RRPG 5T5NF 4C56D 2OL3L 2DJSA 4LXFA 3SKJH 5EO9B 3WFCH 1F4HA 1HOEA 3MBEB 3PJSA 4MA3A 4FA7B 4DW2H 4MCMA 2ISDA 5EUOF 3IXTB 5G2NA 3RZCA 3EH4B 3IM1A 2OZ4L 1WAAA 3CX5J 3AACA 3QQ4B 2ZSWB 4NQED 5KUMA 5LCVA 3BZEA 4OCNC 4XN4A 1U8LB 4PJ5D 3BSHA 5DZVA 2KERA 1UWGH 4HLZH 4E41E 3QG6B 1JGEB 3Q2VA 4N0RA 3CFBA 2QSCL 5CFHA 1CD9B 4I9XA 1ULVA 4M5ZL 4ZUWB 1KXVC 2H32A 4NKDB 3WE6B 4R26H 4LU5H 3QVAA 2EINB 4OKDA 5AAMA 3ARDB 2DJMA 3MGAA 4HWZA 4XP5H 5IBLD 2E59A 2YAMA 2NZIA 5K5YA 4RFOH 3VXRE 4L0PB 1RJLB 1QKZL 1ND0B 1T7ZA 1KJ2H 1Y0LA 4I87A 4ZOAA 1JPSH 4HV8B 2BVPB 4UT9A 2W1NA 1DQTA 2HLEB 2PO6A 3TA4D 5IY5B 4LAJH 3ECWA 4FEIA 3C12A 3WNLA 5EO9A 2NR6A 2GKIA 4RMVA 3MBEA 3EMNX 2YAHA 4OZHE 4WUKL 4DKDC 5HVWA 3IXTA 4FFZH 1UJ3B 3CVHH 1XGRB 3ELAT 4Y5XB 1MF2H 5IW1B 5JQIB 5CD3B 4HJEA 4FRWA 5BZWB 2ENPA 1DVFC 3QQ4A 1O6VA 2ZSWA 4FKEA 2EO7A 3IN2A 1W80A 5TTRA 4G1EB 5DC0A 1U8LA 2D73A 3I6LD 3CG8A 3TH3T 2D4DA 3QG6A 1JGEA 4F37F 4DKTA 4EUPH 1AI1H 2QPDB 4BJLA 4ZUWA 5CIPB 4D3CL 3WE6A 1MLBB 4NKDA 4ZNCD 5DZPA 5KVGL 5LJYH 3GO1L 1BAWA 3O0LA 3W1ZA 3ARDA 2AXFB 3BMVA 5D4HA 1N67A 3M8OH 1O7VA 1DO6A 1RJLA 1QPPA 4NB7A 1ND0A 3FFDB 4M9OA 4P9HH 1E67A 1OGAB 1ETJA 3EYUL 3M86A 2E6PA 4HV8A 4L48A 2BVPA 4AQ8A 2NY6C 4I0KA 4JM4H 4LF3B 1QBLH 1X5MA 5AW2B 3ULUD 3I6SA 3VWKC 3ULVC 5HHXH 4JDTL 3OZKA 3MRDB 2JCCB 2HCZX 4JQIA 3O0EA 3WJJC 1RURH 2XN9E 2Y36L 4U1GB 1YG9A 3AA1B 3ATEA 4PJDE 2BSEA 1IT9L 3NK3A 2HJFB 3RI5K 3ETSA 5AB2A 1CICD 2OYMA 4XMWA 3EBIA 4Y5XA 1XGRA 5IW1A 5CD3A 1NCNA 5BZWA 1U93B 5JXED 3P30L 4HJGB 4EDWH 5F6HJ 2NZ1A 2MRYA 2C9AA 4ACTA 5C08E 4G1EA 2F68X 3UO1L 2QPSA 1R34A 2CPUA 4S10A 1EDQA 2IAAC 4Y9FA 4HIPA 3VWJA 3CXDH 1OZUA 2AQ3A 2YZ8A 4RMBA 3S3PA 2NY4C 4TVPE 5CIPA 4YL9A 5J1SC 3CH8A 1MLBA 1AFVH 1INDL 4LPXA 5I15H 3VD1A 2AXFA 1JN6B 4Z3JA 1A7BA 2WNGA 5I28A 3QUZB 5TFSH 4FA8A 2HXAA 3FFDA 2Y1VA 1OGAA 3FFCE 5IW6B 4D9QE 2BWDA 2CD0A 1N2RB 4LF3A 4Y7MA 3SQOL 4ZD3H 5DL5A 1GOGA 2KH2B 4NP4H 1ORMA 3MRDA 2JCCA 4S1RL 4NN5B 1J0IA 1U91B 3AA1A 3NIDB 4TLKA 4ZX6A 4TVSa 4FKHA 1LE5B 5F9AC 2HJFA 5BOPA 4H0LC 5DD1H 1X5HA 2RCSL 4LSUL 5IJKC 3WLWD 3N6YA 1JYXA 4JFUA 4JFXB 1U93A 4XNUH 4HJGA 3FRPG 3T0XA 1A3ZA 5F70A 3ZR5A 5DF0A 3FCBA 2XWZA 4YR6B 5FC9A 4AZLA 2YKKA 4DZBB 3BDXA 1VGEL 3BAXA 5KW9L 5KBKA 4KRLB 5CJ8A 4U2ZA 2EH7H 5FDYA 1YNLH 2E9WA 1AQKH 5FHBL 4HJUA 4M8RA 4NAQA 3U30C 3WGUB 3EUUA 2R59A 4ELMF 1FVDB 3I74A 5HGHB 3NBNA 2NY0D 3LS5H 4IJ3B 1ML0A 4LOUC 4P3CL 3BRDA 4F4BA 1JN6A 1HZHH 2AFNA 3QUZA 1OAYL 5HI3D 4F5CE 2R69A 3IDIB 4C58B 2RB8A 5JO5B 3RU8H 4NPJA 1KDIA 1CYGA 2AQTA 5IW6A 1AZZC 4RSYA 1Z5HA 3R7RA 1X5XA 1N2RA 4MAUH 4ZO7A 4PGBB 4C4BA 1X5KA 1QPKA 3QWRD 3ZE1F 3V7AE 3NG5A 1B0GB 4PG2A 4G7YH 1U91A 1ZDQA 1MQ8A 1CE6B 1H8NA 3GNML 1PKQE 1LE5A 2NTFB 5I6XB 3MI6A 3PRNA 4YVNA 2H1LM 3HAEH 1TF4A 3CSFA 2VKXA 4KK5D 3T2PA 2D3LA 4JFXA 2VL5B 2YHGA 3NIGB 4UTBH 4N0FB 3SD5A 1NMAH 5KWYC 1WT5C 2B0SL 3HMXH 5FYKD 3SYAA 2VDML 4YR6A 4DZBA 4B50A 3FH8A 3AT9A 3C5ZD 5G39A 1CZ8L 1FC1A 2OLDA 5LBVA 5HPOA 2IAMB 2L0DA 1JWSB 4GJTB 4JG0H 1S7VB 5ENWB 1XEDA 2YRPA 1FVDA 2ZT9C 2BOCB 5HGHA 5GGTA 3QCUL 4AQEB 4X0NA 3U9UB 1TLKA 1MELA 1FLTX 2XV6B 1GS6X 5I1KH 3RI5F 4A2GA 4WO4B 4LPWA 2Y1YA 4IKLA 2VO5A 3IDIA 3QJXA 1VLXA 5JO5A 3QJOA 5GGSB 5TQ2L 2BY2A 4HJTA 4L9LB 3BX7C 3Q3GB 4GSXA 1LWRA 4ZFOB 4PGBA 4RFNB 2E7CA 4JGUA 4FYSA 5AYUL 2Y6SC 1B0GA 4W9FC 3W9DB 3II3A 4HCIA 3LS4H 1CE6A 5L0QC 3S37X 4LSHA 1Z3RA 4FHKA 1NDMB 2NTFA 3GMNB 1MN4A 5C0ND 2Q86B 3VQ2C 1QFWL 4DFHA 4AYBA 1AZUA 5BZZA 5HP5A 2VL5A 5FW8A 4ADGA 5A6LA 4N0FA 4PS4L 2EDNA 3KGRA 5F0LB 4TUOB 2CCLA 3IMVA 4K71C 3DO4A 1KBWA 4YUEL 2MPAH 4M48H 2VT0A 2IAMA 4FG0A 1UADC 3GPSA 3QIBB 1JWSA 3TFKD 5J3HC 3CZJA 3C6LD 2YFOA 1S7VA 1J0ZA 3CN3A 5ENWA 3S5LG 5KG9B 4NBZB 4OM1L 1HYSD 1MAJA 4KXZH 4AQEA 5CEZL 5I0XA 2W88A 3U9UA 3H54A 4FQXC 1L7IL 4ZW6A 3ZQWA 5CLXA 1W72B 1BFSA 4ODVH 4LP5A 3Q6FB 4N86A 4WO4A 1HN1A 3LXBA 4POZC 4HGKC 1ED3B 4LLWA 5CILH 5EEZA 4KBPA 5GGSA 3FB8A 3FZUD 4L9LA 3MV8E 1YEJH 3WL9B 3Q3GA 5IFAH 2YMXH 4ZFOA 4PJ8D 4JRYD 5DQJB 2FQEA 2YIHA 1BAFL 3MUZ1 4WFFD 2EVGA 1D9KD 3SPCA 3W9DA 3ZL1A 3LNEA 4XNKA 3BVVA 4Z7QB 1NDMA 3GMNA 3ATFA 2Q86A 4R7NB 3U1PA 1WGVA 2E9BA 4XCFH 2QSVA 4XXWA 4I2XB 1KBGH 2C1PB 5C0JB 1AD9B 3DUSB 2IBZY 5ELIA 4TUOA 3VI4E 4FXLA 3HUJE 4M61B 2VDPL 5E1GA 1GH7A 1OAZL 5JXAH 4Z7IA 1OM3H 1UUNA 1G7HB 2M07A 4L4VE 2XQBH 2VTFA 4ZDHB 5KG9A 4PJIE 1HIMH 2Y06H 1T4WA 4O58L 5F89B 3GMQB 3ISYA 5EIIB 1SHSA 1W72A 4MA8H 1CO1A 3Q6FA 2CBTA 4OGAD 3PQYE 1ZHXA 4HS6B 4R4FL 4QPEA 3VCLB 1TSHA 2F53B 1TCRB 1ED3A 4OLEA 4F80A 3FH5A 2FBJH 5AZ2H 5A7EA 1BVOA 2I5YH 2VRQA 3WL9A 4FG6D 2I24N 3D85D 2NT1A 2DIEA 4BZ2A 4MXWL 4O02H 1XGYH 2YD6A 5DQJA 2YJQA 4XP4H 5D2NB 1E90A 1SOKA 4A7TA 3FB7B 3KBPA 3VGDA 3DC0A 4GP5B 4BZ1H 3KLLA 4R7NA 4MNGB 1OGSA 5F7FA 2V3DA 3H2PA 1E30A 3H7LA 4PV1C 2VKWA 4N2LA 2MSPA 3DLQR 2YS4A 4J8RB 1QP1A 2R29A 1RFDL 3EIFA 4IM8A 3C75A 2C1PA 4I2XA 5C0JA 2D03H 1AD9A 3N1QC 4H5SB 4N26A 5FUOL 1RIVH 4M9PA 1UA3A 4M61A 2P5ED 3BD3A 1GY1A 3RL2B 4KPHL 3LIZH 4ICXA 4AX3A 3HOLA 1G7HA 3B5TA 5CAYB 5BVJB 4UAOB 2B8OT 3CFMA 3O9WD 4ZDHA 3JQOB 5D6DA 2VJ8A 4IK7A 4XVUC 2MKWA 5F89A 3NSCA 5ACMA 3CK0H 3GMQA 5EIIA 3SKUD 5MHSE 4DJMA 1HTYA 5E56A 2GUYA 3FC8A 1MRCL 1EDYA 4HS6A 1DR9A 3VCLA 2VW6A 4LZKA 3H4FA 3NCJH 4K3EH 2F53A 1TCRA 4UB8O 1X4YA 5E8DH 1LDPL 2X3BA 4ODXB 5FGRA 3C08L 4L4TD 3LZRA 4YHMH 2H1XA 3R06B 2BS71 4PUXA 5D2NA 1ONQB 1OLLA 5E99L 5JIKA 2Y7SA 3FONB 3ULUH 1W0VB 3FB7A 2R1XB 3HI5L 3MR9B 5DA4A 2IH8A 3AB0C 2QV2A 4S1DC 5CNHA 5D4JA 4ZNEA 3MACL 4LESA 4MNGA 2XZCH 1MFBH 4YSOA 3BEWB 3US9A 4QGYA 4J8RA 2F1BA 3EJJX 3MREB 3UBFA 3QFJB 2FT6A 2WXHA 3SGKA 1XZ0B 2YGVA 4H5SA 2ROYA 4IRJB 5EORH 4AKPA 1V5JA 4JHAL 4PB0L 3QRGL 4OQ1A 1KJ2B 2JJSC 4NKIL 4JEGB 3RL2A 2ZOLB 5EE2A 2ITDB 1NINA 1KEML 3BVDB 1JTPA 1LHZA 1KTJA 4ODHL 1C5DB 1DVYA 2XFXB 1C5BL 3F7KA 1IGYB 5BVJA 2WGNB 1GGUA 4PFEA 3GXFA 3THMH 4LSEA 2VXSH 4IMLB 1HXXA 3MBXH 4L8DB 1YLBB 3OPZH 3SYSA 3EO9L 3DWNA 4BSJA 3TL5A 2ADFL 3LK42 4F1SA 3N1PC 2H3NB 3V4PL 2OJEB 3UJIL 4A7GF 3INUL 4EQ3A 5FB8B 3CVHB 3LQAH 4HG4K 2X87A 3AQZA 4ZO9A 2VQ1B 4ODXA 2K6WA 2BSCA 1ZTXE 3TTSA 1X4ZA 4JPKL 2X88A 2DH2A 2J7LA 5HSFA 4XPBH 1A6UH 1JFHA 1JYWA 5KSAD 2XI9A 3R06A 1KSRA 3PWPB 1ONQA 2OI9C 2PYEE 4MKTA 2V9UA 3FONA 1W0VA 2RQ8A 2R1XA 3MR9A 1XGPB 4EUPB 3DK0A 3AVEA 4JFZH 4S0TD 2UXFA 5F7EL 2CCVA 4X8GA 5D71L 3BEWA 4QXTB 3QJZA 3L3IB 1MM5A 1KLGB 3S36L 3MREA 2Y2XA 3QFJA 3CJJA 1NCUA 5EUKB 1XZ0A 2OP4L 4IRJA 5GGQL 1KJ2A 3TJEH 4YPGB 2ZOLA 4JRXB 5I0YA 1YJDL 1GHFH 2ITDA 3VZWX 3BZ4B 4YXLL 3H42H 4X9IA 1C5DA 2XFXA 1Z3GH 4AG4H 1IGYA 4G8GD 4YAQB 3ECQA 1DZ0A 4XCCL 1E9QB 2B4CH 4LLMB 2Z31C 3US0A 5ALCH 2FX8L 4IMLA 4PD4J 4E68A 2GB2A 2WKLA 4L8DA 1E40A 4FNUA 4TRPL 1CG9B 3EJTA 1J0YA 2BWQA 1BZQK 2N0MA 1OAUH 2H3NA 3VFTB 2OJEA 3UOAB 5E6ID 5FB8A 3LRHA 3CVHA 4FFZA 3QR0A 2DQEH 4LSQL 4XHJC 3ZSSA 4ATTA 2VQ1A 3K6FA 1VB9A 2IOIA 2VR6A 3C9NB 3FNKA 4CGTA 2WXQA 3JWNH 4JBSA 2E47A 3PWPA 2DMCA 4X50A 1S7TB 5F6IB 3V79C 1YNTB 1H8SA 5DC9B 4EI5C 1YYCA 1TYJA 3T77B 2XZQH 1FNHA 1XGPA 4R2GD 4EUPA 4K94C 3WJLA 4FZNA 3EOBB 6PRNA 3NOIA 1OANA 1CLOH 5LGHH 3PDDA 4QXTA 3UP6A 3L3IA 1AKPA 1KLGA 1J88A 2B20A 2WN2A 1BJ8A 5FIEA 3RVXD 5EUKA 3QQ9D 5BUAA 1T0NB 3IDUA 1OF2B 3CIQA 3QQDB 3SE9L 4YPGA 5JORB 2LLGA 4JRXA 2AJUH 3WGVB 3BZ4A 1F6FB 1MAMH 3ZO9A 1QO3B 3I2CH 2R4RL 4YS4A 4YAQA 1RI8A 4NCC2 4PH8A 3UAEA 4HYTB 3L5WB 1E9QA 4LASL 4DGIH 2EDHA 4LLMA 3MLRH 3ZUNC 4BWUA 3BSGA 1OQXA 4C4KT 1CG9A 4EKJA 5KJ4A 3VI3B 3VFTA 1O5PA 1NCAH 2HMIC 3CHRA 3TP4A 3KZIO 1YAIA 2DEYX 5ANMB 2CJUL 3NIFE 5IJVB 2LV4A 1KYOK 3UTPD 4BELD 3ARUA 2DQUL 2YD5A 4CL7A 3SY0B 3C9NA 3D3VB 1R17A 3MFFB 4RFEB 5E2WH 1AYRA 2IG2L 2DWEA 1S7TA 5ALBH 1YNTA 5TE4L 1RZ7L 1D6EB 3D08A 3T77A 1VPOL 2K70A 3FU6A 4P9MH 4JZJB 3GRGA 2GBTA 2YRLA 3TBWB 4K07A 2P80A 6FABH 1CIDA 3IDYC 4DESA 3EOBA 1NM4A 2BSBA 1NBVL 4FG2A 4NRYB 2JI1A 4PP1C 4X8JB 4YHIB 3LH2H 2H9GB 2Y69B 5EIIG 2WXOA 3CLEH 4FTVE 5D4IA 5AB9A 2HTLC 1T0NA 3F85A 1OF2A 2IWKA 3QQDA 3EJCA 3MLWL 5JORA 3Q8CA 3ILQD 4XC1H 2TRHA 4OCWH 3VSUA 1N5YH 1QO3A 4E9RA 4CC4C 1K72A 3L5WA 4KK9C 4ZMLA 5E9DB 3OJDB 5B8CB 2B15A 2NYKA 3CLWA 4PJGF 3VI3A 4AVIA 4G6ML 3EF7A 4HAGA 3B43A 3LMJH 3HAEB 4GQ9H 5ANMA 5I1JL 4L5FH 5FWQA 5IJVA 3DVFA 1DE4B 4YLCA 3SY0A 1J5OL 3KLAB 4ODBD 1NCJA 3OAYH 3D3VA 3S5YA 3IAQA 3MFFA 4RFEA 4BK5A 5EEUA 3NVQA 4A6YH 4N0UE 4WHYH 1OP3H 1G9MH 4J3OF 9CGTA 1D6EA 3N43B 3SYPA 2AEQH 3VB9A 1UGKA 3W2DH 1CFTB 5D5MF 3BVXA 4G6FB 4JZJA 1OALA 4G80B 5I0WA 1ZHKB 3TBWA 5JDSB 4ERSL 3EBHA 4OLYH 3GXMA 4Z7OF 4UDUB 4UQEA 4NRYA 2WSPA 1BF8A 1Q9GA 4X8JA 4YHIA 2YJLA 3F7RA 4KX8A 4JQVA 2H9GA 5KSBB 3PGRA 3CLFH 3ZDZE 3VXSB 4GHBA 1KGYE 2WQ8A 1FO0B 1OAKH 4M02A 3ARYA 2E4FA 3TA3D 4PV9B 5EU6E 1GKOA 1NPUA 4DVRL 2NNCA 5GRJL 3RYMA 2E74C 3HG2A 3VUAA 3BYYA 1DBAL 4ANUA 2DD8H 3C60D 5SWSD 1IC4L 3UXFA 3UTTB 5E9DA 3OJDA 4LRNH 5B8CA 4CMHB 2F58L 1WZ1L 1X5LA 3SYOA 1J0KA 2HFEB 1S5IL 3QXAB 4PJFB 3HAEA 3SGEI 2WPGA 2IGTA 1DE4A 2EDOA 2OMUB 1P5UB 3FRUB 4PAZA 1WFTA 3KLAA 4ZMWA 4GI6A 1FWXA 4NRZB 2FUQA 4YSPA 2PR4H 1RUPL 3HMXA 1I75A 2UZYB 4PVNA 4XX1E 1SLUA 1AO7B 1EMTH 2W94A 1CFTA 2V5YA 1Q0YL 4G80A 5JDSA 1ZHKA 3P0VH 3UU2A 1C1EL 1SY6L 4HXAH 4KKBC 3V7MA 4AJWA 2GG1A 3KGSA 4XNZC 4UDUA 4TUJB 5DGQA 5DWUH 3BLKA 3UX9B 4J39A 4LCVA 2K3HA 3MCG1 1U42A 3EDJA 4KNTA 5FOBB 5KSBA 5HJGA 1LD9B 3RJDA 1COBA 3HMWL 3S98A 3VXSA 1T0PB 1FO0A 2CGRL 3R4DA 3N42F 4PV9A 2FSEB 4FLQA 5C7XH 1XF5B 2ZOOA 4OD3L 1TJGH 2YD3A 2CRMA 4Z95L 3H2QA 3UTTA 3LOWA 4KMTH 2HX9A 1BWMA 1JUFB 2K0RA 15C8L 1ES0B 5HYJB 2P5WB 3AUVA 2HKFL 4QRPB 4D0CB 2Y23A 7FABH 1CN4A 4JO1L 4WJ5B 4YSTA 2HFEA 3PUUA 3QXAA 4PJFA 2PKDA 4J3TA 4MNQE 4C56B 4PI0A 4EUPG 3ARBC 3UZVB 1LLAA 2OMUA 4WW2C 1P5UA 3FRUA 4P3DB 4PJBF 4XNXL 3C09B 5D70L 5DMGC 5T33L 4YHKL 4NRZA 4H88H 3X17A 1SGKA 2NY3C 1BVLB 3VAEA 3V4LA 4DF9A 5KYUB 3LRKA 2UZYA 1QSEE 3F8UB 4KO7A 2QKIB 3FYEB 2HLFD 3SE3C 1JV5B 1WE5A 5J8OA 1AO7A 4NQEB 3MRBB 5HGGS 1L0QA 1NAML 3GMOB 4WI6A 5E51A 3VWJC 2NYZA 4A66A 4AENB 2DIAA 4PJ5B 2WYZA 3KPSD 3PL6D 4TUJA 2IFFL 3TT1L 3P3UA 3OAWA 1CGUA 3MUGB 4PY8I 4PWFA 4F7KA 2GTZB 5FOBA 1Y6MR 2AQ2A 1LD9A 4WI7A 4EOWL 3W9EB 2XBZA 3C5SB 1B2WH 5I76B 3ZVVA 2QDWA 1GPOL 1FFRA 1SFHA 3K4AA 3S8WA 4MA1B 1HE7A 2FSEA 1NFDF 3MV7E 5I6KA 2EEFA 3BEVB 1XF5A 3BP5B 1NA8A 2QDVA 3G6AB 2A5UA 1X9QA 3V6OC 5GHWL 4O02B 2BVYA 1UJTA 1JUFA 1L7TL 4FSPA 1MQKH 2JTYA 2BFVH 3UTSE 1ES0A 2PWGA 1L9PA 4YN3A 3TT3H 2P5WA 3DK2A 5HYJA 4QRPA 1KN2L 4D0CA 4PW3A 1TDQA 4WJ5A 3T9WA 5MP6H 4F7MB 2IV8A 1ZWIB 2VLRE 2G75B 4C56A 1I82A 3HG0A 3UZVA 4MLSA 1OV8A 2VL4A 3U9PH 1MCPL 4FQEA 4P3DA 4JKLA 1ILSA 2W65B 4WI0B 5D1XD 4QNPE 3QPXH 3KS0H 5KYUA 1BVLA 2ZWYA 3C8HA 3KWTA 4J6RL 1EHLL 8PAZA 2QKIA 5DHVA