4AYMC

Structure of a complex between ccps 6 and 7 of human complement factor h and neisseria meningitidis fhbp variant 3 p106a mutant
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
239
structure length
234
Chain Sequence
ALTAPLDHKDKGLKSLTLEDSIAQNGTLTLSAQGAEKTFKASLNTGKLKNDKISRFDFVQKIEVDGQTITLASGEFQIYKQNHSAVVALQIEKINNPDKTDSLINQRSFLVSGLGGEHTAFNQLPGGKAEYHGKAFSSDDPNGRLHYSIDFTKKQGYGRIEHLKTLEQNVELAAAELKADEKSHAVILGDTRYGSEEKGTYHLALFGDRAQEIAGSATVKIGEKVHEIGIAGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT FACTOR H
publication title Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 49
structure length 234
sequence length 239
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4aymC02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4aymC01
4AYNA 2YPVA 4O3YA 3V8UA 3UAQA 2W80C 3HOLA 2W81C 3PQUA 4O49A 3HOEA 2KC0A 4AYDC 4O3ZA 4U9CA 3KVDD 2Y7SA 3VE2A 5EE2A 4Z3TA 5T5FA 4AYID 3PQSA 4O4XA 3VE1A 4AYEC 4O3XB 4AYMC 2LFUA 2KDYA 4O4UA 4O3WA 1YS5A 4QQ1A
chains in the Genus database with same CATH superfamily
2FB4L 5FOBB 4OZIB 4WAFA 2OMWB 1M57B 2Y1VA 3SQBB 3E8UH 4FL4C 3VX1A 4BE5A 3L5JA 4F1SA 3VFTA 3H42H 2O61A 3ZTEA 2BM3A 3QDMA 5IB3B 3QJUB 3NN8B 1J05A 3RGVB 1GC1H 3DBXA 4C54A 4KMTL 3WUWA 1UD4A 3RGVD 3VH8A 5EUOA 4KDVA 5I8KL 4PI2A 3HOGA 3QUXA 2WLHA 2BVPA 5AW3B 4IMKC 1BX2A 1NZRA 4PCSA 4HAKA 2N01B 1FUNA 2WLLB 2XKNA 3CFEA 3NK4A 4XR8C 3TGXA 3LSOB 2GT9B 4JRXB 1UA6L 4FG6C 4X6DF 4E9XA 3DOIA 5EIQA 1YZZA 5C6WH 4JRXD 5EU5B 2K78A 3IJ7A 2ZKHH 4TNFA 4LRIC 3TP4A 1WAAE 3K0YA 5E8OA 3IJYA 3QCTH 4WU5B 1CDCA 2GY5A 3VZWX 1CPUA 3U48A 3DLQR 3I75A 1WE5A 3QPKA 1PNDA 5IEHB 3TZGA 4X7FC 2O4EA 1QNIA 1XV8A 2H8PA 3RNQB 2QQNH 2B20A 3VQ2C 1C5DB 3RTLA 3FQWB 2MPAL 1TJIL 4PJBB 2I32A 2GUYA 1XCQB 2XFGB 3U1QA 2Y2XA 4GLRH 1S7UA 2UZPA 3PHOB 2YPLB 1CZ8H 4NFCA 4XXWC 1I8KB 1MIMH 1S9WA 2YPLD 3Q5YA 4I89A 1VADA 1G7IA 2LHAA 4XGZB 3MRMA 1RY7B 5J13C 3ESMA 3LEYH 4JJ5A 4X99A 3NJLA 5EZPA 5DUMH 2JWYA 3LAFA 3O6MH 5IIEB 1NGPH 4ABQA 2JSFA 2B9AA 4HMCA 4Y5VA 4BKLA 1VFAB 1FBIL 2BFVL 2WSPA 4B60A 5C70A 1WWWX 2OJZL 4O3YA 1YVLA 3D48R 3VO0A 2HKHL 3ECVA 1R5WA 4IU2B 2AERT 1MVFA 5CSGA 3BPCB 4D0BA 4OGXH 1XF2B 4K3EL 2EILB 3EO0B 5DRWB 4YAQA 5JHDA 3MOQA 3C5JA 3ZRCC 4ZSOB 5GS2H 2W1NA 4A39A 1DVFD 1YEJL 2DM7A 5KS9A 2VLRE 1KGUA 4QXGL 1M6OA 2W94A 3ARGA 4PHXA 1XGTA 5DUPH 3WFHA 3CVIL 2CDGB 4TQEL 1GKEA 4FZ8L 2G2NA 5I8OL 1AGCA 3I2CL 3OMZA 3L4CA 4LEXH 4PYHA 3MRLB 3F2LA 5I5RA 4U1KB 5ICZB 4Z7OF 4KKRA 1Q90A 3I6SA 4I0PB 3X1NA 3S97C 2NY3C 2XWBB 4B96A 5AUMA 3ABMB 4HJ1A 5LJYH 5E8DL 4I0PD 2FSDA 2IAMA 3VD0A 3JVGC 4QCIB 1R1CA 1ZJAA 2YGOA 4PPTA 2R4RH 3ZHDA 2CGRH 1CLOL 1RUMH 1QYGL 1CURA 3VW3L 2IWGA 5AENA 2NSXA 5DVMA 4I88A 4K8RC 2KDYA 2BWDA 5GGQL 4HJUA 4XMZA 2OSWA 3DX0A 3EJJX 5FYJD 4ZUWB 2FSEB 4GT7A 4JCHA 4WVRA 4BV1A 4YLCA 5GIRB 1EANA 1NBZA 3C2AL 3MRRB 4XVOA 4EDWH 2X89D 1H3GA 2IGFH 2APFA 3WLBA 4FMFA 1ERNA 5D9SB 3N6YA 4JFWA 2A4EA 2OSXA 4O2FA 2ZWNA 4D0DB 5G3AA 4HH9B 4M48H 4HEMA 4MCZA 1Q0XH 4Z23A 2XUWA 4Z7NE 1YEDA 5F96H 4EQ3A 2Y2YA 1GZHA 1HXYA 1R46A 4LKCA 1S4IA 4NJ9L 4PS3A 3V4VL 4PB0H 4L8DB 5T8IA 4GCSA 5I66A 2BP0B 2X4SB 1A6UL 3S4SG 2HYMA 3IDUA 4X5PA 4OLXL 1RZQA 4G7VL 1HKLL 3BX7C 4HBCL 2PO6B 4HQQL 4U6XA 1AHWB 5IQ9B 4MA1B 4KY1L 2MQGA 2PO6D 4FDWA 1YNKH 3VI4B 3B2XA 1LILA 4W4NA 4Q9CA 2YPKA 1HU8A 2YS4A 3FOMB 5JHAA 1QBMH 5BOPA 1FL6B 5FYJU 5IMLA 3KWWA 3LNEA 1WPCA 1AKPA 2QTEA 3MLSL 4DK5A 3PIQA 3PUUA 1K3IA 1QHOA 1RJYB 4PYGA 3W5NA 2DMKA 5F97E 5C97A 3P9MB 2YD2A 4QYAA 1TTCA 1IKOP 5E08L 1S3RA 1YYLH 3MNZB 3C12A 2CKBL 3QJXA 4PMFA 3PV7A 2Q76B 5LBSL 4HEME 4JFQA 3CHOA 2ZSWB 3EF4A 2ESVD 4NOFA 4J8RA 3T0WA 1ETZB 2WTOA 3U9PH 2OMUA 4Y5XA 4C83A 4H20H 2CO3A 3AA0B 5FCSH 2AKRA 2YPVL 2VMCA 4PWIA 4J3OG 4P2OC 2VR3A 5BZWB 2CE6A 4S0HA 3GLEA 3AFLA 4ISVB 4MAYA 4PRIB 3FYEB 3FU3A 1DBKL 4UDTB 4KKAC 1CN4A 3GSNA 5AL8A 3TEYA 4LNRB 4PRID 5DFWH 3WFCL 4DP1X 2WWKT 3GI8L 4PP1C 2DLIA 4GSDH 4TUJA 3GSNH 3DZMA 2ICEC 4EUPB 4AIZB 5JR1H 1PLAA 3SBWA 3F05A 1RKRA 5BS0A 5E23A 2YMOA 5EH1A 3VXRE 5CD3B 1GC1C 2DEXX 3FCTA 5GRUH 3G6JA 3QULB 3STBA 3ULUE 1KFAH 4YPJA 3WNIA 5I1HH 5BMFH 1HILB 1ZE3H 5C0CA 4IS6A 4L8BA 2Y3NA 1JN6A 2AXGA 4MJ2A 4YNYA 3WJLA 5FHBH 3BVDB 3OVUB 1LE5A 4WUUB 2WZAA 2E9JA 1B0GA 1TENA 3R19A 1XVSA 1UENA 5K9OA 1Q9OA 2J88H 2YWZA 1PLGH 4WUUD 5FECA 2OMXA 5KEZA 1JYVA 3V9EA 2X09A 2GKIA 3LQZA 2H32B 4ZPVB 5CP7A 3WNPA 3MRJB 2ICCA 2IIJA 4ZAKA 1IT9L 1E5CA 2AJVL 2A2QT 2A4CA 4AEIH 1WF5A 5IR1A 3GIZH 4J3OD 4UDUB 1GY2A 4K7FB 4NO2A 5E51A 5C08A 3RWIB 3I02B 4QLWA 4HP5A 3Q48A 2JB5L 2QGDA 5C0FB 3PQYB 1V3KA 4OD1H 4XMUA 2J71A 2CUHA 2V8LA 3PQYD 2LVCA 1J9CT 4BDVB 3TOPA 3ZQ9A 1ZT7B 1H6TA 4QHLB 2DBJA 4U1HB 3HMWH 4NQCA 4NBZB 5AW6B 4WJKB 3G6JE 15C8L 1MQKL 2ZG1A 3AADB 1V7NL 1ZVYA 2Y7MA 3L08A 5C0CE 1YQVL 1U3HB 5CBAB 1RLWA 1QW9A 1U3HD 2B14A 2DMHA 3IKCA 2ICWB 4KRNA 1AI1H 3FKUS 4ANKA 1YEIL 3VGFA 4PRAB 4HGWB 5L8JB 4NOBA 1IKNA 2ENYA 3GSUB 1PZBA 3LXBA 1GPOL 4Y2OA 1B90A 4XPFH 3H6AA 2EIZB 4HWEL 2OULB 3MRFA 3UG3A 3N1FC 4JFFB 3VFWA 1J9SA 4YX2H 4JNXA 4JFFD 4Y5VC 1G4RA 4XWGH 4OT1H 1WVZA 2GBAA 1KYFA 3IDYB 1CE1L 3SGEI 4GUQA 3DWOX 5AZEH 4LLDA 5DJ6A 4NUGL 3QHFH 4R7LA 4UBDD 1K8DA 5IW6B 2ZYRA 1JV2A 4N2CA 1Q1JH 5CXPA 3ABGA 3X3GH 2CMRH 1AC6A 3L3OA 4PFEA 3SE3A 3MGOA 4Q58C 3ARGC 3LKNB 3I74A 5L0QC 4FQJH 4JHAL 3FO0L 4X6BA 1IGJB 3NIGF 5CJ8A 3VXOA 3A6BH 2PCYA 3JV0A 4AVKA 1XCTB 4N1EA 4KROC 4NQSA 1ZV9A 3FN0L 1A9EA 5IY5B 4QRQB 4QWWC 4U1NA 5FLVA 1IBGL 4GQPH 3T3MF 5T1JA 5EOQL 4N25A 3UZQA 4JG0H 3IM1A 5FM5M 4F57H 4WI2A 5EU6E 1WUNT 1NKOA 2IAMC 4LKXB 4UZUA 2MCPL 3TO2A 3UTZA 7PAZA 4E5XA 1A7QH 4AVHA 4FFTA 4JZNA 2C7UB 2H47C 4AYEC 1AXTH 3RX8A 3WEBA 1NLDH 3FOLB 1JWMB 4OCLC 4DP7X 3F7KA 4M62H 5GISL 1MJ8H 4K2UH 5I6PA 2ENQA 3ESOA 3BZFB 3LKSB 4KTEL 6PAZA 4N2DA 4MMZB 4MRCA 4XH2B 5E1HB 2W5PA 3EJPA 3VSVA 3MBXH 1AP2A 1G0XA 2IG2H 3HBZA 4JZJB 2WOBA 2HTKC 4YHNA 1DN2A 2BS8A 3FQUA 4HPOH 3KBPA 2AC0A 2FJHB 4N0CC 1FZKA 4XPBH 4U31A 3PQSA 2AQNA 2ALWA 3MR9A 4HS3B 5E56A 5HYEA 3TWCL 4V1DA 4G7YL 1ZCRA 3IBEA 3BT2H 1XGRB 1MRDH 1LWHA 4JQVA 4XHJD 4YDMA 3T09A 1XGYH 3SE8L 3EBIA 5L2KE 4PHZA 1ZJBA 4QHPA 3NEOA 4C4KT 4AGOA 4FG0A 2D4FA 1EZVY 1NMAH 4FXLA 4Z77B 4OI7A 1L6XA 5KN5A 4RH4A 3VDAA 3LS4L 1GZHC 1M2VA 4K3BA 3ZO9A 3LN4A 4E0RB 5CM1A 1NCGA 5EFIA 4M02A 3EJYC 3RG1C 1FFPA 1S46A 4PWGA 1TLKA 3B1TA 2EE9A 1V7ML 4IOIB 1I8IB 1FIGL 1ZHBA 3QO0A 3R06B 1J0KA 4F3FA 4IRJC 2NSQA 4GT0A 1PG7X 4YXHH 3W3BA 2B0SL 3DMMA 1IAIM 3ULUC 1BFOA 4HULB 2EUXA 4JFXA 1TCRB 1NFIA 4D0CB 2AEPL 3DX8B 4Q4IA 3LH2H 1D9KC 3G04A 2YQBA 3MCLL 2P46B 3G08A 2WXQA 3F7YB 2Y0KA 5FGCE 4Y9GA 5E00A 3BI9X 4XC1L 1NKRA 1JZJA 5L9DH 3MODH 4PJ8C 4HS6A 5CZRA 3EOTH 4PS8A 1JDDA 3VWKB 2FWUA 2OFQA 3AB0B 4PGZA 1TZOA 3VACA 1LVEA 3RY6C 3VWKD 1CFTB 5TDPA 2ZUXA 3RWCA 4P5TA 5DGRA 43C9B 5HYSG 3T0EA 4OLVH 4PG9A 4HIIA 4XB7A 1Z9SA 3WYRA 3QR1A 4FQQB 4WI9A 5CP3H 5DHMC 4R4ND 2D31A 1ZV2A 3S3JA 1IFHL 1S9XB 1OSYA 1J5OL 2ZQKA 2I9LA 2P5EA 3NDZE 2FJGB 5I30L 1AZNA 1K4CB 1LEGA 3QG6B 5T3ZH 4ZX5A 5HI4D 4EI5B 3SBWC 2C3VB 4G8EA 3GT6A 3M1BA 1FPTL 1NA8A 4LIQH 4PJHB 1SJEB 3C5SA 4RAUB 3TBCA 5IJKA 5AYUL 4EI5D 3L3HB 3L3GA 1E9QA 4NBYB 1G7HB 5F7DB 3GXMA 3K19A 3LZFH 2N1KA 2E7HA 4WFHD 2GJRA 3LMJL 2YXMA 2OR9H 4XVTL 3SGKA 1DJIA 3KHQA 3VG0L 2ZCZA 2ZXAA 1S9KC 1G87A 1PAZA 4K9EC 3CDZA 2XX0A 1E2ZA 1F4YH 2VB5A 2J44A 3UIYA 3D50A 2GSIB 5HYSB 2YA2A 1XGZA 2H9GB 3QJVB 1UXSA 5FA3B 3BPOC 4KKLD 2F5BL 4BH8A 1TQSA 4A2HA 3CN4A 1JK9A 1FO0A 3ZSTA 4Z7WA 1BVLA 4WDIB 5J3HC 1IGYA 3QPXH 5EOCL 4DP5X 3V0VA 3L2MA 3TH4T 1JTOA 4FXGA 2FUQA 1FO0H 2PCFA 4JW3A 2EZ0C 1RL1A 1AGEA 4AX3A 3KBHE 4HOMA 5T3ZE 1XBDA 2YUXA 4FD0A 4MA8H 5I1JL 3E9UA 2BOCB 2P5EE 4JFUA 4LIQE 3QZBA 4L29A 1THQA 3B3BA 1BIHA 4J7RA 4GHBA 4L4VA 1QO3B 4IOSA 4R8WH 4BFGA 3VA6A 2FYYB 4HS8H 2EVGA 3EMNX 4IHOB 5KJRH 3SZDA 4F92B 4MTMA 3LJ3A 5LB1A 1NAKL 1W9XA 4AC4A 2EEAA 3OLDA 5IJDC 1OAQH 3K5RA 4S2SA 1TZ8A 4FTVE 2X38A 4W9HC 3STZA 1DBML 5B8CB 3HZYB 2BO0A 3GHEL 3GPSA 3KPNA 3BXNA 1IBHA 3FK3A 1RJLB 4PJDB 1IKNC 4DUWA 4EZKA 3H55A 5GRXG 4PW3A 1CQYA 2C1OA 3L3DA 4GKZA 4JCWA 3H4HA 3LKQA 5DS1A 4M8RA 4Z7WE 3VFSA 3OPZH 1J8HB 5D8JH 3FMGL 1G9NH 3AC0A 3FT4A 4IEFA 1OO2A 4FG2A 2V9TA 3PPEA 5HJ3A 1N18A 4DPBX 1B4LA 5KVDH 4DKEH 1URZA 2P9RA 1VEMA 4RMBA 3A6OA 3LQAL 4Z0BH 4DPAX 4CMHB 4FXKA 3FL7A 1ML0A 1C5CH 3KGTA 1R34A 3CDGB 4Z8FL 1HEJC 1KV7A 2CBOA 1FORL 3BVTA 4FL4B 4MX7A 5DC0A 1M6UA 4Z95H 4APXA 2NOYA 3DUSB 2F8IA 3I9AA 3NCMA 4JCMA 4ES9A 1AGDA 4U1JB 4XMTA 2ZJSH 1ZGLB 1P69B 4H40A 3BUQA 4AGPA 2P4AB 4OLWH 5BQ7A 2YGVA 5HHOB 4MQTB 3LVEA 2VABB 1NBVL 3NZUA 2ZX5A 4ZO6A 1SOKA 1O9WA 5HHOD 3UABA 1AYOA 1KJVA 2ED6A 3V7MA 3BWUF 2HKFH 3GUFA 5G4OA 5ITBL 2BDNL 4WKZA 2EEXA 2W8CA 3FO9B 2XNAA 1B9KA 5TE7H 1XCXA 1NGXA 2OMZA 3FFCB 1OT2A 1SNRA 4HWUA 3I85A 3P9LA 3DA0A 1HOCA 1S7SB 3FFCD 4UV7L 5IHZB 3MACH 1PFOA 4HFUL 4B9CA 4FG6D 5KVDE 1HSAA 1OAXL 2FGWL 5EU3A 1TR7A 1Y6KR 3DIFB 1WA0X 1ZHXA 2P5WA 4P06A 3SO3C 5F9AC 3V2AR 2VR6A 3H9SA 4X8GA 5G39A 1FG9C 1LNUB 3DSNB 3WNOA 1OSPL 3LVTA 5FFOA 2GFBB 4RAVA 2X88A 4CVZA 2G75B 1KF9B 1MY5A 3B4NA 3TYGH 4LPVA 2GK0B 3S4SA 4RJWA 2FH8A 4IBYA 3U0TB 2WQAA 2XPYA 4H0LC 4UQEA 1KULA 4CTDA 3UO8B 1JFQH 3MBEB 4XCYB 5IW3A 4W9ZA 2FO4B 3MBED 1MJ7L 1U8JA 4BXSV 2AJZA 5HHXH 4KPHL 1KCRH 4IBVA 1ITCA 5IHUH 4ZMQA 1OGAE 3HI1B 6FABH 4EIUA 4LP4A 3BSZL 4ZFQA 3FTVA 1EWHA 1FNEA 3BVUA 4N2NA 1G5AA 4X6DA 5IBUG 2NDGA 5DJYA 2C3WA 1T7YA 1UD5A 1L0YA 1OCZB 4PGJA 1BD2A 4FHKA 2DV6A 2XYBA 3R1GH 3RIAK 3MLXH 3PFUA 4ANXA 5BVPH 5CCHE 1UADC 5JW5B 1L0QA 4L0ZA 5C3IA 1UWYA 2UVEA 5IROA 1SXBA 2P5WE 2ZUQC 2GTWB 5BRZE 1ZGLP 2F1VA 3DMMC 1E5AA 1N0LB 4TLTA 4ORZC 1MWAB 4MVBD 4EDXB 1AO7B 2X7LA 3MRCA 4PJXF 1ZTXH 3MREB 3SSGA 2F68X 1AO7D 3DUHA 5EU7E 2JJUA 2XQBH 2Z4QA 7FABL 1MFBH 3NJTA 5DEJA 3JVFC 5DS8B 4J4PC 1JNNH 5T1MA 3DI2B 2MOQA 5EBMB 5SV4A 4PWEA 3KYKH 1YY8B 1N64H 3CSGA 1E7UA 3EADA 3F3HA 2RFXB 2YAOA 1RVFL 3RE0A 4BSWB 3B9DA 4NQXB 3L5WA 2XE1A 1KDJA 2IPKB 1EJFA 4HD5A 2NY3B 4PJCB 3QXDA 4C00A 1P6FA 5F9WC 2NNCA 2NY3D 2KZKA 2QLVB 1JHKL 3GK8L 2DKSA 2YR3A 4X6DE 3VFRA 1T5WA 2VJ8A 3DIDA 4DUXA 4HPYH 1BD2E 4WFGD 1JK8B 5EU4A 2YAHA 4H8PA 2AV7A 4WO4C 6CGTA 5ID1B 1UZGA 2EXYC 4AIOA 4NP4L 2VLME 3RURA 1ZTXE 3TBSA 3GSWB 1VKXA 4O2CB 3TBWA 4KRPB 4K8RD 3DV6A 5DA0B 1XCWA 1J9QA 4X9YA 4PJGF 3QW9A 2DWDA 3T6ZA 3EH4B 4OM1L 2VDPL 1B6UA 1S5LO 1ASPA 2EKSA 1E2WA 3B2UC 1BYOA 1R3IL 1AXSB 3MUUA 3J8F7 4DERA 4Z3HA 2R56L 3FCSA 4KJPC 4NKMA 1B4JL 3UBXG 1COBA 4RDQF 3EG9A 4PG2A 1KOAA 3D3VA 2QVMA 3U9UA 4HGKC 3IFNH 4TQPA 5KYWA 1N5YH 2PPEA 4H5SB 3WFBH 5IOPA 4ZFOL 5K9JH 5HHME 4AYMC 3L9RA 1UASA 2I7OA 1E4XI 3C6LA 3MUJA 1QLRB 3PAUA 4ZFZB 2J3SA 3TT1H 3HZVA 4FXGC 2DWEA 4J39A 2DBLH 1JGEA 1QX1A 3ARXA 2K8MA 4X80L 4Y19E 2F54B 2WZPA 4NO3A 4O00A 2ZKXA 1V54B 3LK42 2F54D 1ZANL 4OZHB 5TDNA 1F6LL 2B2XH 4H7VA 1HXMB 2GSGB 4ERSL 4M00A 5MEOB 2OMVB 1UD6A 2A73A 3UBXB 3KEHA 1Q9FA 4AKRB 2AANA 1MNUL 2OMTA 3UZVA 2I9TA 5G5DA 4AL8L 2E8ZA 1MIEL 3ZKMC 1KPVB 3WDIA 5I1DB 5CHNB 2OYPA 2Z8RA 3SYOA 1FZMB 2FRGP 4M1DH 2F7PA 1WZ1H 5FDWA 3D3VE 1QI3A 1U8CB 1DEEA 3BP4A 5AVSB 1XSKA 2DQFA 1AS8A 2E9BA 1IRAY 3BKJL 4GMTH 3CC5B 5ENWB 2XN1A 3ILPA 3R8QA 3S36X 1HZHL 1U8MA 4L4TB 4H44C 1PY9A 1N59A 3S98A 1G9NC 1IC7H 1QSEE 4L4TD 4P2OB 5HYIA 3UC0H 3AWFA 4WW1B 5HDLA 3QIUA 3WNLA 1E54A 1A5FL 4P2OD 1V8HA 2CO6B 2WCGA 3ZZLA 4C59B 1C8PA 1D3CA 1EH9A 3O8XA 2XWJA 3VX0A 4LSRH 4P5KB 3V5DB 4KKAD 4HJJH 2QPEB 3DX7B 4NWTL 3T8MA 2ILLA 2YN5A 4FQ2H 4YXLL 2NT1A 2ZCKL 5KUMA 2ZX7A 2ICEB 5GS1A 1PG7H 2RGSA 4PP1D 4FXKC 2F0CA 2A9ML 3TEXA 4LGPB 2ZTBA 2I07A 4MXWH 1E28A 3K6IA 1PGRB 3VFTB 5J6GB 5JORB 3C08H 4HCRH 5F8RC 4MJ6A 1J05B 5TQ0L 2XYCA 3VXNB 5IW1A 2HLAB 5FYLH 3U4BL 3GSVA 3HUJE 3LB6C 3FNKA 1RUKH 2ATKB 2B1AH 2NZ9C 4BEIA 5KVGL 5B5EO 2R0WL 2WHVA 4R2GC 3V6OA 3K2IA 2VRKA 4YDKH 4A37A 4MB3A 3L7EB 1JE6A 2VAJA 2VR7A 2R29L 3IJ8A 3OQRA 4GIOA 2ZPKH 3UIZA 2QQLL 3OAZK 4PJ7E 2BRQA 1A02N 3US1A 2HH0H 3KLQA 4NC2B 2OQJA 3IJYB 3LD8C 2GIMA 5A2BA 3AM8A 3MJ7A 3N43F 4OCWH 1A7OL 1HQ4A 4H2AA 5FYKH 4NN7C 4UM9B 3NFNA 2E76C 1NEUA 1I1AA 2VLLA 4Y16B 5EU7C 2H8PB 3BVVA 4UM9D 4XPHH 1S7XA 4G6MH 2VLRB 25C8H 2ARWA 1QVOA 2K0RA 2VW7A 5JA8B 5JXEA 3U7YH 3U4AA 3U0PA 3VSTA 2VLRD 1N2RA 1OAJA 2WUCH 4AYSA 2TSAA 4G6JL 2MFNA 3SDAA 5KVEL 1R0AL 1TITA 1NDMA 1K85A 1QBLL 2IF7A 3WIFA 1X6NA 4FMSA 3FB8A 5EA0H 4DGYL 2VL5A 3PU7A 3GHPA 2RCSL 3S35X 4YQXH 1SBBA 1JWSB 3NFSH 4KGLA 2JI2A 3S5YA 3D4CA 3PWUA 3WKPA 3ILQC 3KPRE 3MLWL 5HGAA 3V6ZA 3V6OE 4HUVA 3UJJL 4LOFA 4N22A 1T3FA 3CJJA 4LBEA 4Y5VB 2UZXB 2NW2B 4OUUA 2A1WH 2YD3A 1L5GA 4HEPG 4TSCH 3ASOB 5JQ6L 2A77H 3CZGA 1Q0YH 4JO4L 5FYKE 5IROC 2X6VA 1P7KA 5CBEA 4RDQG 2UZYA 4GSRA 4K5PA 4LSTL 4ONFL 1KUMA 3ZKNC 5CJ5A 5GS2D 1BFVH 2AJSL 3B3IA 3H53A 4YAQB 1MLBB 4XOEA 4ZO7A 2Y5EA 3C5JB 3RNKB 4DZ8A 3T0AA 1UWEH 2WB1A 1F6AB 1HHKB 5KANI 4ICXA 4YLQT 1RZJL 3K0WA 3ARGB 4KXZI 3GDBA 3P0GB 3RUGE 3B1UA 1YMMA 4QTHB 4CN6A 3TS8A 3ARGD 3QUGA 3S5LG 4KROB 4LU5L 1F4XH 3GBNH 2O1AA 5LCVL 3LN9A 4CVWA 5I1EH 3TBTB 2R0LH 4KROD 2PORA 1R19A 2WGNB 2RIKA 3OKNA 5FF6B 2XKUA 3KGUA 4QWWD 5TF1H 4Z7NB 5CCGE 3O2WL 1WHPA 4S1DC 2V2WA 4N2MA 2GAZB 1B6DA 3V4VB 5EEZA 4NHUB 1M7IB 1VPOL 2VXUL 4TTDC 3PAZA 4AQAB 3VMPA 4XNDA 5IFHH 3SO5A 4R3SA 2V6HA 1OP3K 1MREL 2V9QA 2ZUUA 1SYVB 4B7IA 2WXHA 5L4JA 1CDIA 5DEGB 2C5DC 2LV4A 2CPCA 4LSQH 5DJ8A 3V5KB 3W37A 5DJAB 4LQFL 4I3RH 2N1TE 2P8LA 1CO1A 2FWOA 4L9LC 2ZT9C 3GMLA 4U1LA 4NSKB 3TTYA 3HPLB 2NUPA 3GHBH 2HTKD 3T4YA 4PEEA 4N90E 4D8PA 3WLBB 3S5LB 4P0DA 4O51B 3T4AC 4JHWH 4NGHH 1D7FA 3DGCR 3QUZA 4S0TD 4PG2C 4FERA 5CNHA 2X2UA 2CKBB 4MB4A 3ARVA 2ZNWA 1J1XL 2X6CA 2O5XL 5I1CL 2PN5A 2FL5A 1H8OA 3FC8A 5CKAA 4ATWA 5TTRA 4TYUA 3QFJB 3C6LC 1RERA 1P4IH 1IQWH 4N6QA 3QFJD 1MAKA 2W59A 1S8DA 3M1OA 4ODUB 5KVFH 4YBLC 1G9HA 5LGJB 5I66B 4NCC2 2DIAA 1ZKAA 2VQ1B 1BF5A 2WBWB 1KT2A 4FFYL 3VB9A 3WS6A 3RFZA 5D4IA 2XMXA 1F3JA 3TJEL 8FABB 2ID5A 3D8MA 3MVSA 4IRJB 3SGDI 4Z3FA 2DQEH 3LZOA 3RTQC 4IRJD 3VXRB 2YPKB 2WBJA 4N8UA 5DJ2A 4ZYKA 1IGMH 4NZ8A 4WNQA 3VXRD 4LOVA 4PWFA 3ULUD 2K6ZA 1JZDC 3HRPA 3BIBX 3PIQB 1D9KB 3T1FA 4N1CA 1QEWA 2HFEB 3MA9L 4JKLA 2ZP9A 1CF8H 3MRQA 4P4RB 4X50A 4F7PA 2I60H 1D9KD 2VDNB 4GKLA 5ICXB 3WMQA 2YSTA 4UU9B 4PJ8B 2HVKA 3BKYH 4N0YL 2G3XA 2X4UA 4PJ8D 1CFSA 2C3GA 4F33B 1FH5H 2WD0A 1XMEB 3OAYH 4GI9A 4RGMC 4AJVA 1UWGL 4J8RB 3WJMB 5BOJA 5KVFE 5JIIA 3F7LA 5I5MA 3JWDC 5I2IB 4L1DA 3QUKA 3TESA 5MEPA 3K1DA 1J0IA 3BE1H 5C0RL 1I85A 3TA3C 1OWWA 4IKLA 1UA3A 5D2NA 3S3CB 1O7VA 3KYMA 4OZGF 4WK0B 1OP5K 3UP6A 3B5HA 5GSVB 2AQTA 1T66C 2WLZA 2EABA 4TUJB 3OG6B 5GS1C 4MSWB 4FKKA 4NPYA 1BLNB 3D51A 2YC1A 3I9PA 1R33A 1AJ7H 2EICA 4E9YA 2FWLB 4Z3EA 2WTRA 3ZT6A 4AW4A 3AMLA 1CVRA 4PV9A 2O6DA 1UOWA 4TNVF 5FW7A 4H8WL 2DYSB 2H6PA 3ETTA 2VNCA 1KENL 3N3EA 4L8BB 4BWTA 5BUPA 2Y9RT 4JPVL 2VDLL 4NUQA 2YRBA 3GD1C 4GRMA 1UACL 1UEYA 2ZXQA 2OMXB 1XO8A 5KBKA 4OV6F 1TVBA 1YEEH 3UAQA 1TTBA 4Y4KA 3GPEA 4R4BA 2Y4SA 1MEXH 1T03L 4HC1A 5C0BE 2GI0A 3V6OC 5AOMA 3TIDA 2WYIA 1BQSA 3O6KL 3D6GA 4HZLB 3IJSB 2XPGA 4HC1H 3IK2A 5FKPA 5J3HD 4ZMOA 4JDZB 5GPRA 3D69A 1J5DA 2VCOA 3OKMA 4NO5B 5DZJA 5KSVB 1D5ZA 2EZ0D 2F19L 1GGUA 5I0DA 2RH0A 2XICA 1HHJB 2FGQX 3IMTA 1A14H 2FQEA 1DBAH 2YK1H 4LDCA 1L9OA 5E2TH 4F8LA 1I1AC 3K2UH 2AJUL 1NANH 2LU7A 3OXRB 5IBLD 1DUZA 3F8UB 3RQ3A 4A2EA 5JXEC 1ZLSH 1OM3H 5J9PA 5E9NA 4NQQA 4UIKL 1PQZB 4AZ8B 1MW1A 3CK0L 3GZPA 1XF5A 1Q9WA 4EI6B 4OCRH 2WNGA 3SDAC 5AB0A 1AQMA 5DD1H 4NO0B 4YZWA 1LO5A 4PJAA 1E4XL 4NO0D 1JNHB 1YMHA 1RJZB 2DLFH 3GZOA 4PH8A 3IFLL 3BLKA 4F7TB 4BGLA 3Q43A 3RJQB 3BWSA 5EU6B 4HMDA 1ZEAL 4N9OB 2FX8L 3X11B 5EU6D 1ACXA 2OXGA 3H0TB 4LSSH 3BEVA 4I0KA 2F53B 2P24B 2P26A 4HF5L 4MD0A 4JPQA 3F58L 1OANA 2FLMA 4LZKA 2NQCA 4LLDB 4QRAA 3GZQA 3IGAA 4M7LL 3GSRA 1ORQB 2DDQH 1LMIA 2YUVA 1JV2B 5KG9B 1I7ZA 1MCSA 5GTHO 3CPLA 2O5YH 1H6FA 4G5ZH 3WO4C 4MCMA 3BGFC 3DO4A 2VH5L 3BJ91 2NXZC 4YZFE 3IMSA 4OD3H 4OD2A 1UFUA 4OFIA 1KELL 1IEAA 3N41B 4R4FH 3GIVB 4GKNA 4BA8A 5F7EH 4GG6F 3VXOB 3ULVL 1JPFA 2P80A 1XXFC 1C5BH 2YGQA 4I2XA 5AB1A 2Z92A 1A9EB 3SDXE 5LG1A 4K94L 2CBQA 4U1NB 4W6YB 2WWMC 1XGQA 2ZXEB 4TQHA 5GGTH 4PJAE 1FC2D 5HY9A 5L2KB 1E27A 4MHHI 1U8NA 2HX7A 2GJJA 2YQ2A 5L2KD 2PXYC 5LBGA 3WEOA 4NNYA 1KTLB 3FU8A 2EJ1A 1F13A 3DHMA 1U92A 3UTQA 3X13B 4YS4A 5HVHB 5L4FA 4OIAA 3WEMA 3BUDA 5DHYB 2RB8A 4PI0A 4E9RA 5B3SB 3EOYG 4KMTH 1EAPA 2E6QA 2MNHA 4JEGB 3SO3B 5D2LE 4OB5L 1WBZB 3BAJA 4TVPE 4WHYG 5I8KH 1FSKB 4KKPA 2TAAA 1CFMA 2NY7H 1A7NH 1U95B 4GBXC 1T0MA 4LVEA 1T80A 1FZOB 4IGBA 2X4QA 2H1LM 4AEHH 2OI9C 1BFSA 1IB5A 3IJ9A 4AENA 1DFBH 5DJXA 5HJGA 4LPTA 5FGCB 3OTTA 4KTYA 4C57C 1R3LB 4XPAL 3MR9B 3CV5A 3QUZC 5SWZA 1CBJA 1JAEA 4GW4B 4I2XE 3A0BO 1U93A 4DK6A 4AMWA 4PRPA 4JZOA 3S36L 4ODWB 4F27A 3T2NL 1F8TL 4O49A 3RLSA 1SXZA 1D5XA 3KZIO 1SJHB 2Z7UA 4HCGA 4YSAA 1S7TA 1UWXH 4M7LT 3D09A 1QTPA 3WDJA 3OKOA 5IQLA 1CFQB 1TJIH 3QT2A 4QPEA 5EFIB 1SUHA 2J8UF 2W0FB 4P5RA 1T5XA 1FFPB 1Y7VA 2OSYA 3IXTB 3IRZA 3AU0A 4BKTC 3FTYA 4LRNL 3V4PB 3BRGC 3DGDA 1IZNB 1BZEA 1SQ2N 5DQJB 1X7QB 3CVHB 2ODIA 5DS2A 2ZUQB 1J11A 1ETJA 4YDZA 3VAEA 3VXSE 2M06A 2PP9A 4UNTA 2WBJC 4UQIM 1GCYA 1INQB 3G6DH 4E9TA 3DHPA 3GTTA 3O2DL 3LK2A 3G04B 3S37H 4CSPA 1PKQA 1INDH 2O72A 3G08B 4PJEF 4Z76A 5E00B 1GL4B 2XFXB 2ZX6A 3CU7A 2P7TB 1X44A 2F1AA 4J4PD 3FXIC 2CUIA 4AJWA 4WNSA 1W15A 3DC0A 5D4HA 1U42A 2HKHH 4KFZC 2Y7QB 3GLZA 1RZIB 3VXUA 4JRWA 4PRPE 1G7LA 1EEZA 4XP4H 3SDDC 2FJFA 1JXJA 3AS2A 1EAQA 1HXTA 1FJ1A 2EDXA 4YK4C 5JNYA 1ADQL 2PPDA 5F9WB 2VLJA 5HI5C 3PQUA 1WGVA 5GJSL 2GITA 3SKNA 4X4YB 1O75A 2D31B 4QXGH 4JY6B 3L6FB 3CVIH 5GGSA 5B7MA 4KNTA 2EDFA 4TQEH 4WO4B 4J3SA 4D3CH 1FNFA 2EYSB 5CJBA 3DRTB 4H25B 4FZ8H 2MQCA 5T3ZD 4WO4D 2WKGA 5KSBB 1LEGB 4NJAH 3OZLA 1ZVSB 2FE0A 3B56A 4MCYB 4PJXA 1KIRA 3S9DB 2E7LC 4NUJA 4YO0A 3ARWA 4NNPL 3C5SB 3RGBA 2WWOA 4FNUA 2QHRL 4KRLB 2R4NA 3MO1B 1S5HA 4JS7A 3QXAB 5E8DH 4B7LA 5E2VH 1BP3B 4PRDB 1IGCL 3BZ5A 4GUPB 4QHUA 1DJHA 2G0LA 3GDCA 1U3JA 3IRCA 1NCWH 1L9PA 4FTVB 1CLOH 1U0QA 4FQIL 2ADJA 2WXMA 4FTVD 3H3PL 4KNUA 3Q8AA 1N0XH 4G72B 4KJPD 1SN2A 3S35L 3G5ZB 4XC3L 5GGQH 3HS8A 5AB9A 1RJCA 2XA8L 2ZKYA 5DJ0B 5HPMA 3CSBA 3DNKA 2RBLA 3QEGH 3KZ8A 1JK9B 1FO0B 2UZIL 3DJRA 1N12A 4DQAA 1FGNL 1XEUA 4Z7WB 3IDJA 4KXDA 3V9CA 3C2AH 4R26L 5MENA 3RAJH 2VLJE 4KZ0A 1DO6A 3R18A 1QWUA 4J3XA 1EJ8A 1OP9A 5I82A 4YHPB 1KCLA 2HB0A 2VT0A 3ZGHA 3GJFB 5A2IH 4X42A 3KR3H 3VZUX 1I75A 3PAYA 1NC4A 4TSAH 4MB1A 4PJXE 4PJGA 3VI3F 1TKWA 3L2LA 2A7BA 5ACMA 5A2JH 5DMYA 3KS0J 12E8L 4HEPA 5DXWA 5SWQA 1RULL 4O58L 5LHDA 4Y9BA 4N4YB 4U6VL 3KLLA 4YPGB 4JPKL 2ATPA 4OQTA 3EZ8A 3ZKMD 4G7VH 1HKLH 5FUCE 5CCJA 2WOYA 4HQQH 3BXNB 5IEKB 4WI3A 1NBYA 4KY1H 1FL5A 1G1KA 1T0NB 4OQTH 4X8JA 3MZGB 5C8JB 2E56A 2ZUSA 1N6QH 4GKZB 3MUY1 1YNTF 3QRBA 5H37G 1MFCH 3VFSB 2WP3T 3MLSH 4GSQA 3V55A 2Q2EB 5C6TH 5F7KC 1E3FA 2PKDA 1LD9A 2ZOKB 1I9JH 3FT4B 1CL7H 1R6VA 2VZ3A 1XWVA 2ITDB 4WTZG 3T2QA 1SUJA 4KO5A 1JF1A 3JWOL 1KTDB 1OAYH 1RFDL 4N8CL 3WN5A 2YPVA 4FXKB 5DD6B 1PF3A 2VTFA 1NEZG 3J7HA 4YSDA 2HVJB 1Z9LA 1G5GA 4MX7B 2D3VA 3JV6B 5EBWA 5FM8A 2YPVH 3OLEA 3QR2A 1HHIB 3LKOA 4M43H 1JPST 2HJLB 2GJZA 1BQHB 1DBKH 4OI8A 5DDHB 2OTWB 1FAKT 1TZIA 1P2CB 3VFMA 3WFCH 2WXFA 1WUZA 4TPRH 1SBSH 1D6EB 3ELAT 1ET5A 3GI8H 4YLBA 3N40F 3T3PE 4Z78B 3N04A 1BSIA 1OGAB 2DN7A 5EO9B 5JUEL 1INEL 3UJIL 3ISWA 1NPUA 1OGAD 4PGDA 3LB6D 5DD5H 4R2GB 1MRCL 4URKA 2OMZB 2NZ9D 4P4KA 1HI6A 2PW1B 3P77B 3NSYA 3L1FA 4R2GD 3ZJAA 3MAWA 5AVUB 3RWGA 4F2FA 4CSTA 2NY5L 4RZCB 2XY2A 3OXSA 4EO5A 2DW5A 4NM4L 4UQAA 4HUNB 3LD8B 4Z6AT 5BRZB 4XO5A 1ACYL 2CG9X 1IGFH 1NEZB 5IHHA 5BRZD 2HFGL 1AXIB 4NN7B 4XCEB 3KXFA 1H9DA 4IGBC 3SZKC 3R8BB 2GQHA 4YE0A 2NNFA 3HC4H 3V8UA 3THMH 4PLKC 1VGKA 1KIUA 1U8HA 2IBZY 1U8JB 4L4JA 4MDJA 3PY9A 5FB8B 2JB5H 3M45A 5I1KL 3CZLA 5IJBC 2OXHB 2Q8BL 2J6EL 3AAAB 1KCUL 2R0ZH 2XTLA 3IDNB 4J27A 4M29A 4MKTA 3T2LA 1BMZA 5E2WH 5DJYB 15C8H 4U33A 1ED3A 2W9DL 1S2EA 3GUTA 5CF3A 3O3AA 2FIRT 3KM2A 1P0SE 2YUWA 4HW6A 3JUYA 2XRAH 1HOEA 2FYVA 1KB3A 4G1MB 3QH3A 2SEBB 4JHZA 2EDHA 5JHLL 3EHBC 3ZKND 3EJUA 1GPOH 2PP8A 3EJSA 2D7NA 3ATBA 3ZYJA 3VM5A 3HC0A 1N70A 1Q72L 3SJVA 4B9KC 5BUGA 1QASA 3DV4A 5T1MB 5TF0A 1AMYA 3T2OA 3US0A 1U8QB 2APWA 4A55A 2Q7AA 2AI0L 2Y23A 3DOHA 4PU2A 3C6SB 5ESQB 3DETC 1UB6A 5DK2A 1M7DA 3G5XA 4M5ZL 1M4KA 3L5WB 4X98B 1L3NA 1QI5A 2DS4A 3SOBH 2J8OA 4Y4HC 2KI6A 3IGFA 3OLIA 4B9PA 5JLZA 2M1KA 4NN5C 2D7PA 1GXEA 4S1DD 5JIKA 1FN4B 5HGHA 1RSFA 5E6SB 5FWQA 3VFRB 1KBKA 5EOTA 2WGXA 1KN4L 2YMTA 4TTDD 3REVB 2VDKL 2YKKA 3WHXA 2CLRA 3MLRL 4M7KH 4Y19B 5DD3H 4GCQA 4PJ5B 4QRSA 5F3BA 4Y19D 4PJ5D 5JPMC 4NERA 2X4RA 1KNOA 1RZKL 2BHUA 4CJ1A 3PJSB 5D7LA 5CEZH 2YKLL 1QFUL 1I7TB 1LK2B 1E2VA 4W6XB 4L9LB 4YHZL 1V05A 1OGPA 3H6JA 3GSXA 5L7XH 4PCTA 1K6QL 1TQVA 4WIQA 4QHKI 3SJVE 2A6IA 3FCSB 3T4AB 1MFUA 4AFKA 4TOYL 2FO1A 3A0OA 5FUCC 2RTTA 4JFBA 1BZDA 4BZ1L 4O9HL 3ZDZE 4KTEH 3MLTA 2X4OB 3MBWB 4OFQA 2NZ1A 4LCYB 1XD1A 4I9WE 5IOPB 2V3FA 4Z5RA 5AVTB 3KYOA 4XNAA 3FZUC 4OCSL 3SYSA 1GA2A 1NFDF 1QSEB 2ZP0T 3GMNB 4X6CF 4MQ7B 5DK3A 2WLYA 3RPIB 3B5TA 1OCWH 1QSED 3IF1B 4YBLB 4FABL 3C6LD 3QQXA 4FZLA 3D0LB 4IKNA 1XQ4A 2DLHA 5C07A 1T22A 1CLYH 1HKFA 1JGDB 3CH1A 1TNNA 2PR4H 2JJSA 4FMKA 3TWCH 3NJGA 3JYBA 3RWEA 5CEZE 4JLRB 1DTUA 2YGPA 5TDNB 2CIKA 2X5PA 2IBZX 2ZOTA 2AK4A 5FFGA 4LSDA 3RTQB 3HKZA 3RILA 1DJYA 2B8OT 2W60A 1QFWI 3FCGA 3P1VA 2NR6C 3RTQD 4ZUUA 2CZNA 2A73B 1RIHL 1O9VA 1MCEA 4LFHD 5ADPL 4XNBA 4DVBB 3EBGA 4K7PX 3HUJB 3ATAA 5FDWB 1AD9A 3SE6A 5AVZB 3TURA 3QJHB 5SWSA 4U7KA 2B0SH 1ZLWK 3R4RA 1IC4H 2FGZA 3WD5L 5DMIH 5IFJA 1MG3C 1UEMA 4JR9H 5BZZA 4Z7AA 1Z1WA 1IKFH 1SPDA 1U9KA 1J0HA 4MAZA 4YL9A 2AEPH 2ETWA 4JJOA 4OIFA 4QRPA 1RURH 1WFJA 4PJ7B 3U2IA 4GXVL 1DN0A 3TA3B 1T7WA 3X17A 5L88H 5C07E 5EWIH 1IEBA 1IZJA 4X4MA 4YFDB 3TA3D 2OX5B 3ROLB 1FYTB 3Q5OA 1R5IA 5BJTA 2KBGA 3SKOA 2DM2A 3AW5A 5GS1B 1ORSB 1FYTD 4UILL 5H35B 1O6SA 2MMXA 5HYFA 2Z3FA 4M7JL 3S96A 4FOZA 1G7PB 1T89C 3KL3A 3PHQB 1MKFA 4YIQA 3QQDB 2LTQC 4IKKA 1KLGA 4MJ6B 4MQSB 3TM6A 1F97A 1AANA 4CDHA 2R1YA 5LGHL 1T2XA 2FZ3A 1WG3A 3F6IA 1JV5A 3JV4B 4WWNA 3VFOA 3GSVB 3TC9A 4CKQA 3U9WA 2QDVA 1DVYA 2FQDA 4YVUA 4RRPG 3QHTC 2YXVA 5SWSE 5J57B 1FPTH 1LEKB 2IQ9L 3KPRB 2VISA 5T1LA 4LF3A 4P4KC 5KAFO 4M6ML 5HGGS 3HS0A 3KPRD 3UPRA 5LAPA 2WLIA 4MDRA 2PTUA 4YGVB 3FF8A 3LMJH 1E4KA 4QRPE 4OZGA 5A2AA 3VG0H 3X1GA 1Y0LB 1T20B 3W2DL 4X4ME 3UAJD 3UL4A 1I8UA 1KIQA 4WY7H 4AGQA 2PYEA 4EBQL 2XVGA 4YJZL 2MKWA 1CFBA 3OAUL 2F5BH 4JHBA 5EC2B 2X9ZA 3Q3GB 4RMWA 1LO3L 1S7XB 5F89A 4UF7C 1PKOA 3KPPA 3FUHA 3NSGA 5EOCH 5EEXA 1CGVA 2WWKO 3RUGB 1IJ9A 1FVEA 2V9UA 5JXED 2VC2B 3SDAB 2GUOB 4YDLC 2Q7YA 3PG2A 3WIFB 4HIJB 1TLMA 3SDAD 4OLUH 2KDGA 4O2EA 4KX9A 1CDUA 3KPOA 1J5IA 2YIHA 3T8XA 2GY7B 3MRNB 2IADB 1OB1A 8CGTA 1EO5A 5CZVH 5FGBC 3OKEB 1MCLA 2WCPA 3Q01A 4NKDA 1CICC 1SOSA 3ETBF 3IAPA 1W8EA 3ZE1E 4LBEB 1KPRA 5F44A 3VY8X 4OUUB 4DUVA 1PEZA 1QA9A 3VCLA 3MRKA 2E9GA 5EDSA 1J8RA 2OSLA 3K71B 1DBMH 1A3LH 3MX0B 1GHFL 1E5BA 1GMIA 3FT3B 3P30H 3HBPA 4CNIB 1CJYA 5CBEB 5FYKU 3BD5A 4JPIA 2PYEE 2VSKB 3W0WA 4Y2LA 1Y6NR 4FFVC 1HCVA 1PSKH 2HCZX 1CLVA 2CUMA 1TEGA 1XZ0A 3EDJA 3OGCB 3W39B 3BGFB 3WO4B 3EGXA 2NXZB 3DX1A 3H7BB 2XC8A 5F7NC 1GS7A 1BGXH 3BWAB 4WCYL 3MRHA 2NXZD 1WT5C 1NOLA 2J2ZA 1DQLH 4N90D 5IK3B 5GGRY 2PMZA 1KGWA 1SRDA 2IV9A 2V5SA 2YZ1A 3FMGH 3MFGB 5DQ9B 5FK9B 3TT3L 1BXXA 2X4TB 3MUGA 1A2YB 1M9SA 4M93C 4PJFE 2VLKA 5D7SL 1BVZA 5DHVB 4CJ0A 4I48A 5BV7H 1MH5A 4KRAA 1Q94A 3N06B 2WWMD 3PWPA 1EDQA 2XWXA 4OI9A 1FYHB 2PXYB 2V2WB 3HR6A 4GRWE 4UT6L 4Z8FH 3QUYB 4XP6L 2PXYD 3WS3A 5DSCB 3QUYD 4WEUD 2AXJA 3BDBA 3FT2A 1A6VL 1QABA 1KCKA 4OKDA 4WW2B 4JFDA 5I26A 1M05B 4R3SB 3N44B 3LPGA 5DFAA 1GYCA 4IJ3C 3H8NA 4PP2A 3MNWB 1JP5A 3TCLB 3HA0A 2GEQA 4KZDL 5D7IF 2ZOOA 3W9EA 2P47B 1IBZA 4AYFB 4AYDC 3NJVA 3FO2B 3OB0H 3WI9A 3NIDF 3IXAB 3U0WL 4GBXB 3W0WE 5I1LA 4FMVA 3MFFA 3ILDA 4EJ1C 5C09A 4GBXD 4AYGA 1LP9F 2OI9B 3MMEB 4GH7B 4GG6A 2ADYA 1MFEH 2F74A 4LVHC 4UV7H 2BSBA 3LEXA 5CEYB 4ODXB 5T5FH 3V0EA 4YFLI 5D71H 5GJTL 3K4AA 5HDOA 3QUZD 3RWHA 1F1AA 2VLKE 4FI7A 2A9BA 2AJXL 2QSQA 4WU7A 4WTXA 4ODHL 3S3DB 2V5MA 3VD4A 1WD8A 5MHSE 2H41A 4XX1E 4C4VB 5F71A 5LWYL 3TFKC 1DLHA 1O7SA 1MFMA 2HLFC 5EZJB 3SBQA 2X4PB 3E80A 4IIQB 3FO1A 4J28A 2Q2LA 3FF7A 1DP0A 1QJ8A 3ZTJG 1KT2B 1NCAH 1OHQA 2GVYA 3VRIA 5B66O 1OPGL 4KU1A 3BSZA 1NCUA 3IU3B 4TRPL 3EYSL 1IGTB 3A0HO 3HE6B 3KH4A 3PNWA 2JCCE 3PRZA 2UUDH 2H1PL 4JFVA 4P04A 2DD8L 4HUXA 3L4ZA 3RVUC 4HSCX 3BSZH 5AWNL 2G4GA 1XZWA 2WBJB 3L95A 4KVNL 4DW2H 4M4PA 4J2XA 5F6HI 3L5XL 2WBJD 2JKRM 3FQRA 3DRQA 3HCVA 1R47A 2X4NB 4DSYA 3VRJB 5CMAB 4GG6E 2OL3L 3IU4H 3NCFB 4U49A 4MJJA 4FRXA 2C8NA 4RNRB 1WC7B 1WIPA 3V0DA 3UC2A 4TLKA 3SDDB 5C0BB 3BISA 5E1AA 1NKGA 2E7MA 3CUPA 5K93A 2ZUTA 3SDDD 4HZ1A 3B7TA 4YK4B 5C0BD 1WD9A 3QUKB 3VE0A 2UX6A 2J8UA 1X5JA 1BV8A 3U2JA 3BFOA 5EZIL 7FABH 2JI3A 1W0WA 4K4KA 5T3XH 1IFGA 5HI5D 2ZWSA 3WKNA 5K1NA 4C4KO 3LN5A 3MV9A 4MDIA 5F88B 3K2MC 2EH8L 1B2WL 3JV5A 3QZPA 4CSSA 4PREA 4PTTA 4WWPA 2H4EA 5FCUL 4OTXL 2ZOLA 4L8SA 4NZUL 6PRNA 1C12B 3RIAF 1JGUH 5I76A 2R1WB 2WNWA 4PJEA 4AT6B 3GK8H 1JHKH 4URTB 4KXBA 3PP3K 4LPYA 1W91A 1ACZA 2WC7A 4Y8DC 4GRMB 3QQ4A 2CHXA 4U3XA 2JKJA 3BIKA 1JGLL 1BDYA 5FX3A 1YEHL 1ZHLA 2D03L 3CE1A 3L9EA 5D7KE 5FDYA 4G9FE 4HUMB 4HXBH 3NEEA 5GRJL 5T3XE 4OM1H 3HS0C 4M3HA 3TIDB 1PPIA 1BHGA 3C60B 1LWRA 2J8UE 3OJDB 5D72L 2R39A 4BHUI 2D3JA 3C60D 1JZ7A 5FS5A 3CC1A 3D69B 4MKMA 1B4JH 1RZ8B 3OJVC 1WZKA 1VACB 3LHAA 1OF2A 2BMKB 3IDIB 1QP1A 4CVXA 4ZFOA 3V0AC 4RJXA 2HG0A 2ZG2A 4F58L 3T6VA 3F12A 2DQTH 3QIBA 4NIKB 4XOCA 3VXTB 4KGJA 5CIPH 1QSVA 1IAKB 3ZE2F 3ZXAC 1FFRA 3RL2B 1HWGB 1SM3L 4PJEE 2HXAA 2YMXL 4ALAL 1Q9WB 4M8VA 1JZHA 4N8VA 1RIVH 3ZE0E 1HFUA 1V5JA 3SDXB 3ULVD 1CUOA 2G5RA 4PJAB 3JTYA 4FCHA 3RZWA 4H88L 5LAXB 1JRHI 5ALCH 5JW4R 1YEFH 1HE7A 3QAZC 3HOLA 2E4FA 3GSQA 3WE6A 4ONHA 3BAEL 5KAQF 6PCYA 1PYWA 4Q9BA 4DZBA 2A9DA 4ERSH 4MMXC 3NZSA 2C4FU 4BRVA 2XZCL 4NPKA 5BO1L 3BEVB 4AQ1A 4AYBA 2NPLX 1MNUH 2JB6B 4LLMA 4K3CA 3LS5H 4XMPL 1T04B 4KI5F 1O5PA 1QFWL 4BH7A 5D2LB 2JJTC 3HN3A 3IGAB 2JK5A 2XIBA 4P3CL 5C86A 3CQFA 1U6AH 5IJCC 3BRDA 2AJYL 4HKXA 4FT6A 4TVPD 3F6JA 4E41A 3CD4A 1QRKA 3H9YA 4NHCH 3KPMB 4OD2B 1G1YA 3EOAA 1T83A 4QY8A 1A65A 1QHQA 5BV7C 4PRBA 4R0LC 1JPFB 4I2XB 4PV8A 3KG5A 3P40A 5E7BA 3BRFA 4AUUA 2UY6A 5ES4B 2A0LC 4YXLH 1GOHA 4L2LA 1NUDA 1S7WA 1U8LA 2PUQT 4HLZH 4JDEB 2OCFD 4X6FA 4XPTH 1YNTA 2A6DB 5K39A 5F2FA 5I0XA 1L6ZA 2Z31C 2Q6WB 4Q6KA 2DYPA 3MTXA 1XSOA 2YJLA 1RK0A 4ZW6A 5ECJE 4YDNA 1FVDA 3HI6L 2DICA 3VVVA 2WINB 3RWDA 3NPZB 3VXSB 3FBKA 3U4BH 2DWYA 5KANG 2BVQA 3HW7A 4YSPA 3VXSD 3HN5A 1BEYH 4E41E 1RUPL 2R29A 2IH3A 2WM0A 3CCHB 5F7UA 5BRQA 4IGBB 2R0WH 3SPVB 3UO1H 1ZHKA 2X4QB 3PXLA 3O3BB 4IGBD 3QORB 1ZLEA 2DY2A 2R29H 4HKJA 1EO8L 3UDWC 5AW8B 4WV1A 3UTTE 4K7PL 4AQEA 4KR8A 4G6KH 4FJ6A 4BK5A 4G71B 4LLVA 4PLKD 5KBPA 3WAJA 1LEIB 1U93B 5DO2D 4PRPB 4JZOB 1MCNA 4TTGA 4MXVF 2H2SC 1JPGA 4PRPD 3RVTC 1D5XB 2ENSA 2RMNA 5B21A 2D2OA 1LE9A 5AAWA 2GSMB 1S7TB 3LZQA 2F1EA 3VQMA 4NN6C 3HAEG 4DTGL 2BPBA 4A6YL 5JW3H 3VFUA 3WLWC 4TQIA 1NJ9A 1R0AH 4HWBA 3DX6B 4YVNA 1IFRA 3GEFA 4N6RA 4H1LA 5F3HB 1F11B 3BH9B 2NUTB 4QT5A 5FM5O 3ZDXE 4PRHB 2X1QA 3WTSA 4CDGC 4HWBH 4DGYH 4X0NA 2GCYA 4H1LH 1LO2L 2VGLM 1P6WA 3ARPA 4MZ2A 3O4OC 4N3TA 4FJZA 4PRHD 3SPGA 4EN3C 2F5AH 2OAAA 4YSEA 4F4BA 1A25A 2FT8A 1RZFL 1J1OL 3GMRA 3BP7B 2DQHL 3D18B 1I9EA 3MLWH 5I1GL 1P84J 4OJEH 5GZOA 4R7NA 1FDLL 4D64A 1J8KA 5IB2A 3DTXA 1KWGA 2WXJA 4GG8A 1UYWL 3EJCA 1Y18A 3N1QC 1IGIL 4MWFA 1P84K 1T21B 1OSEA 3IAQA 4ONFH 2F61A 3RYMA 4WJ5A 5D1XA 3DETD 5D7JC 5DLLA 3SKJL 4L5FH 2PCPA 3RB7A 4Y4HB 1SY6L 4NT6B 4NN5B 3QPQC 4Y4HD 3MA7B 4X4XA 4PBDA 4UOQA 1IILE 1RZJH 3ZGIA 5LCVA 1G90A 2VLJD 4HHGA 4W68A 4P57A 4KOCA 4Q6IA 2BNQA 2P8MA 4HV8A 1R5VA 3BD3A 1B4RA 4RRPA 3NAAH 3LNGA 1NC2A 5LCVH 2QTKA 1UT1A 3PP4L 4MMYA 4JFYB 5JPMB 4CVUA 2EDKA 4I9XA 2I69A 4YO0B 1B0RA 2X44D 1CYWA 3CHXA 1SHMA 4L8SC 4S10A 2W65A 5K9QI 3OF6D 2PTTB 4I18B 4W9FC 1IBYA 1LQBC 2DQJL 3QZLA 2VXUH 4OCNC 1F2XK 4JPSA 1G1CA 5BVJA 4JM2F 4P23A 1H8SA 3D4GA 1EX0A 5DJCB 4J8QA 2BP8A 3A67L 1ZS8A 4FYRA 4G9DB 4L5FE 2XXFA 4ZD3L 4PUBH 1UB5B 4MA3A 2R9HC 2EYRB 4LQFH 3DXAA 2YD8A 2LT9A 1NCBH 3QDGE 3R4DA 5E6IA 2LOEA 3FZUD 3V6BR 3NCBB 4MZIA 5I24A 3EGSA 5IM7A 3HBGA 3QB7C 3C75A 3ZL1A 1HS6A 5JYMA 4JFEE 3QCUL 1W2KT 5FUOL 2BNQE 1P5UC 2Y06L 4WEMB 4A2FA 5DYOB 5D70L 1J1XH 1JOIA 1XF4B 2CA4A 3Q1SH 5I8EA 3U4EA 5HXMA 4YC2C 1PFCA 4J5VA 3MHZA 3QWOB 2J1YA 1WDAA 1IC0A 3V52L 2VZSA 2CIIA 2VN5A 2C9UA 4FFYA 2NR6D 3CGTA 5C0GA 3UU2A 4ABWA 3Q6FA 2ATPB 4FFYH 2I26N 3T3PB 3H85A 3SKMB 4FULA 3BEWA 5DZVA 3SQOH 4HJEA 2QPFA 4AK1A 1NBYB 2HFFB 3ZR6A 2NY2C 1NFDA 4K5OA 2QKSA 4X6CA 3DXAE 1NH6A 1Z3GL 3F7QA 4DP8X 2B15A 1FFTB 1ZDQA 4U05A 5CSZB 1IQDA 2QVTA 3D12B 3P11L 1PDKB 3FTWA 2A4ZA 3MA9H 4TUOA 1ZLVK 3GI9H 4O4UA 1YDPA 1KN2H 3L3KB 4NKIL 4EXKA 1JF1B 1H8NA 2CWRA 2JKLA 4P2CG 4AKQA 1QRNA 4FRWA 1F58L 4JO2H 4YWGL 4LSIA 5A2FA 3D87B 1I1YB 5I1AA 4LHUA 4XTRC 1D6VL 3D30A 3D07A 2OP4L 5EBWB 1MW3A 3GXUB 2R8SH 4KJWD 1SFHA 1T83C 1NGWB 2WJRA 3EO1B 4A63A 2OLDA 2WZ5A 4JFOB 3FUKA 3P4MB 1TZGL 2VDQL 2F1BA 4ODTH 3BWZA 1G6RL 2X41A 3MCG1 2VSCA 1NICA 1MCPL 4AM0Q 2XWTA 1ROWA 3MLPA 2NX5E 2WW8A 2CO7A 4WI8A 1NSNL 2AS5M 1L0PA 4P4KB 1HI6B 4IYKA 2OJEA 2ZAIA 3L1GA 4OM0H 5E94A 4KKNA 3WXWH 32C2B 4P4KD 1E9PA 3ALWA 3RWGB 2OCCB 4HWZB 4XN1A 1MAMH 2AJ3B 4KKCC 2VQUA 3NSDA 4MNGE 4W70A 5GGRA 1OAKH 1QSZA 1U8OB 3GSOB 1UACH 4NRYB 3VU1A 4JFSA 1OCOB 3OWRA 3QRAA 1KIPB 4I8DA 1KG0B 3DTDA 1QRNE 3DYMA 3O3EA 1NGZB 2XQYG 1T03H 4WEEA 2YRPA 3CFUA 1PL3A 3NP4A 3TYFA 3QXWA 4AGLA 3AG4B 2YFNA 3JWNE 5C7ZA 2L7JA 2ICWI 2Y07L 3O6KH 5DHEA 4QO1B 4ZW5A 2WTPA 2M26A 4MHHG 3ZTJH 4BK5C 1F90L 4YDLB 5EZLA 4MDJB 4UTBA 3QRLA 4XP9H 3D33A 5D1ZA 1QAWA 5EB9A 4X0KA 3S3BB 1DVTA 2R8AA 1FGVL 2FEDC 2HUHA 4UTBH 5IHLB 5KSAA 5HSFA 2PLTA 5TQ2L 3OAYK 3F7RA 4TNGA 5AAWC 2AJUH 4GXUM 4AIXA 4LMQI 1CICB 4OAWB 4IBTA 2IANA 1A9BA 1ECZA 2CUAA 4H2CA 1C1EL 4PB9L 3ECBB 3D05A 2DRUA 4UOZA 5T1KA 1CICD 1GGTA 4YHLL 3CK0H 3O3AB 4JM4H 5DF0A 1JYWA 3OKDA 3GP6A 3QC6X 2FBRA 2EDTA 4ZTOH 1MCJA 2OS7A 1RMFL 2P43B 3EGDA 1BOGA 3KDMB 3QH3B 2FX9H 4UAOC 1IAOA 1A3RH 1WWBX 2FBJL 3D0AA 3FB5B 4Y2DB 1KGCE 1VLXA 2IFFL 3FU9A 4GRLC 1ZEAH 4Y2DD 4IBSA 4O3XB 4RETB 4IBLT 5HP5A 2BERA 3GJEB 4WI0A 2DYRB 1JRHL 3DV4B 5IFAH 2OYLA 1J1PL 1DQQA 2YBRB 3EDKA 3MXVL 3BRYA 4HF5H 3SE9H 3ZDZB 1DL7L 2JKXA 4XMXA 4UTAL 2YOAA 4M93B 4I13B 3BZEB 4FG4A 1M7DB 3G5XB 5DRZB 3B7UX 4OR1A 3JTBA 4I9WD 3ZQWA 3Q2VA 1TMQA 4MNHA 2Z0UA 1E67A 1HEZA 4I3GA 3CLWA 1KB5B 1DUYB 2YEZB 4G8IB 4LLWB 3T9WA 1FFQA 3KCPA 1NGYB 1TU2A 2A6JA 5J8OA 1AMXA 3WHXB 3BUBA 4OJYA 1AFVL 1U3YA 4DFIA 4IJ3B 4RBPK 4GS7C 3FONA 4K94H 1GGCL 1P1ZA 4F7CA 2VR8A 1C8QA 2F7IA 4NUMA 5DMGC 1P4LB 3JYCA 5LNEA 1ZXKA 1CGUA 3H56A 1X5FA 3ZQXA 3V0IA 2VN4A 5E8PA 4TM9A 4LVHB 2OZNA 3OV6A 3I50L 1AVAA 4N68A 3MC0A 4DFHA 1UZ6E 2X42A 4IDLA 2KUTA 5C0DB 3C5ZA 1NGQL 4MLSA 4AVJA 4RMTA 3MLTB 5C9JA 4OB5H 4UQ2A 3CDFA 1AIFB 4Z5RB 1H3PL 2RALA 5E6IC 3KMDA 3UTOA 1UOVA 1H3WM 1SYSA 2IH1B 2LLGA 4UB0H 4N2FA 4NRZA 4D94A 3DA4A 4DP2X 3QWRD 2HLFD 1WCBB 5DL5A 3PDGA 2FJSA 5C07B 4XPAH 3VXQB 3CH1B 4FQXC 4AH2A 2BIHA 5C07D 4HKZA 2IOMA 3PJLA 1BQRA 1EQWA 2YLKA 4XT1C 1KXVA 4NNXB 3RWEB 3MGTB 2B16A 1KJ3H 4AOFA 4B53A 4XE0A 2W9LA 1LP9A 3ES6A 1B3IA 3M1CA 4RWHA 2OMNA 1OB0A 3RVUD 1Z3RA 4NX0A 4JN1H 3WEAA 2XBZA 1XF3A 3O6FC 4IBZA 2R2BB 3DX2A 4ZQKA 2FGRA 2OMYB 5EORL 1A4KA 1AGBB 4HOZA 5KWYC 4ZX6A 1EHXA 2I24N 5HYQA 1USQA 4KK5C 1QUPA 1BAGA 3AAZA 4K5MA 2VZ1A 1A1NB 2PWFA 1F4WL 2DH3A 2WZ0A 5SWSB 1G0DA 4HH8A 2DKMA 2N56A 3KJ4C 4LHQB 4M3JA 1KLFA 4NQVA 4V2BA 5EUKA 1BOYA 4X7SL 3O2DA 5SWSD 5AEAA 1Z5YD 2Z34A 3G5VA 4U1SB 4EN2A 4WTWA 3LK41 3AU1B 4GAGH 4X5XA 1I8MB 4QRPB 4U3SB 4S0SD 1DZBA 4QRPD 2OBGA 3F85A 2NW3B 1HDMA 4QRBA 1OTUC 1XAUA 1E5ZA 1X5IA 4YHOH 3BH8A 2ZF8A 4ACPA 3SKOB 1AZRA 2X10A 5DT1L 5J12C 2ZXGA 2HPOA 3NIDE 4MXQC 4RMQA 1ADQA 3MJ9L 1WFNA 2WQ8A 5CJQL 3S96B 1PIFA 1LP9E 1GZQB 1TIUA 2JQZA 3JWNC 4GB9A 4XNUL 5E9DA 4DPCX 4PGEB 5HHVL 4KV5F 3HBQA 1CU4H 4X5RA 5GJSH 2LLNA 4LSPL 4XN8A 2WNKA 3BO8A 1U8PA 3FTGB 4UQCA 3KL0A 3C09C 2GW5A 2N7BA 2BHFA 4TULL 3RU8H 1GSMA 4YE4H 4A7VA 3IDMA 1P1VA 3EKCA 3G5WA 4NM8H 5FYJL 1GGBL 2ZF9A 4PR5A 1K4DA 3M17B 2QHRH 3HS0B 3KPSA 3ZE1B 3X14A 1IGCH 2JJVA 4B95C 1SEQH 3IJHB 4GKSA 3SYPA 1EAOA 5HHQB 1CDGA 1SF3A 3CMOH 3HG0A 2A74C 2HRGA 3L7FA 3H3PH 4FQIH 3SE4A 2R2HA 3GFUA 4U1MB 2X12A 4GFXA 2N2LA 3MZTA 4QTIL 1VFOA 2UWEF 3V4UH 2J12B 3WIIH 4V33A 4AXWB 1GW6A 4JY4B 4N58A 1FGNH 3D9AL 5E9DE 1EEQA 3FHEA 2J5LB 4LEOA 3UEQA 4UM8A 4N0UA 5BW7C 1K8IA 4EOWH 3T04D 4PVBA 2Q7YB 2C4XA 1U8KB 4POUB 4PJFB 1BAWA 4O2EB 5D1ZC 4LLYA 5BXFA 3D0VB 4F8QA 3KPOB 3AZUA 4N3UA 2JMMA 1RPKA 4I0CC 3RVWC 4B6ZA 4QRUA 1TZHB 4A67A 4GRWB 3QAZB 4IIZA 2AXFA 3PF1A 4NKDB 4DQOL 1FNSH 2AABL 3TV3L 3S88H 12E8H 1FF5A 4MMXB 3TF4A 3C8HA 3KPSE 1KPRB 2JTDA 3I3EA 4O58H 1DYZA 1WWCA 4XNYH 5DRNA 3TJHC 4D9LL 1BBJB 4XNKA 1Q1PA 1WA1X 4WGKA 3T0DA 4BSJA 2OSLB 4JN2B 2ZSVB 4JPKH 3IETA 2QSTA 1Z9NA 4KXAA 5EF2A 3FN3A 1UZ8A 2X1WL 2LAAA 3BQUA 4KHTH 3W0WB 2O6EA 2QPSA 4KVCH 1E4WH 4LLUA 4PS7A 5ITFA 2AQQA 3RWJB 5IB5A 4JVUA 3W0WD 5IF0A 4G80A 3N1PC 3EGXB 4X4ZA 1Q0EA 2CLZB 1MFAH 5DTFA 5C0EA 3V8OA 2FECI 3SGDH 2AQ3A 1T4WA 1JNJA 1KJ2H 4N0UE 5BV7B 4R0LB 4FESA 4JFHD 4PRNB 2R0KL 5HGBA 2VLKB 4G8FA 2MCAA 4HFWB 3FQTA 4I48B 1NIFA 3QA3A 2VLKD 2QTVA 4N8CH 1NCNA 2A0LD 1AR1C 5B7FA 5F1SA 2WXLA 1JZ3A 3WS3B 4QIRA 4Y5YC 4P48A 2Z31B 3IFPA 4B0MM 4FA8A 2CHDA 2Z31D 1QEXA 5C2BL 5IMOB 3BYTA 4NPJA 3VVWA 2MQ3A 1J48A 5IBTL 3HRZA 5ADXL 2XN9A 1FLRH 2Z91A 3QDJA 1SLWA 1PZ5B 4PP2B 4O3ZA 2JCCB 5I8CA 4G8GA 5JUEH 3HE7A 3FRUA 3K4DA 3PL6A 2BCKA 5CWSB 1INEH 1T1WA 3UJIH 1WISA 3AS0A 1EHKB 2B5IC 4G2AA 1F45A 3DROB 4Q74A 1SJXA 3HNSL 3GS0A 1IV8A 4X6EB 4A66A 4FZEL 2OL3B 5IJVA 1I8AA 4TS6A 2F74B 2ARJA 4PJ9B 3LEXB 2YLHA 5GS3A 5G55A 1BCIA 5A16B 3F83A 2QT6A 5GV0A 3ABLB 3ZO0A 1EXHA 1TZAA 3C5ZC 2CBTA 2QSVA 2UY7A 4PJ9D 1CXHA 3ZHNA 4KUCF 5EIIG 3NZHL 3PABA 5MEQA 3MLVH 4LSVH 3JZ7A 2H2SD 4GUCA 1YC7A 5TE6L 1GAFL 3REWB 3RVTD 4Y89A 5HYJA 2M83A 3NSCA 1CLZH 2EE0A 2QELA 3TXAA 1YNLL 3T6QC 4FLHA 4ZUSB 1HJBC 3Q9PA 4KI5E 1K3ZA 1QLFA 4X5WB 4W4OA 4KUZL 1G94A 3EIFA 2C9RA 4JO5A 2L8AA 2XN9E 3DK0A 1QQDA 2HT2C 1ICTA 3KAAA 3QDJE 3MSPA 3H4FA 4G8GE 3BN9D 1DANU 4KDWA 4AKOA 4LL4A 5DEFA 3FUFA 4EN3B 3O4OB 1YEWA 5ACLA 4OJDH 3WEXA 4EN3D 4XXCA 3FQRB 2Z93A 3APCA 2X0UA 5D6CB 3ECWA 4BFIA 3WTTA 2XG4A 1T2QH 2W9DH 3TBVA 1H15B 4J12A 2X1PA 3UAEA 5EIIB 3Q05A 5JHLA 1JVLA 3MRPA 2HJFA 4YUEH 2B1HL 3IJEB 4Y9EA 4NCC1 2OV0A 4G9FB 5IVXF 5D7JB 5JHLH 5E1AB 4FI6A 1DDHB 4L3CA 5D7KD 1UURA 3H7LA 3U7WH 3GB7A 4G9FD 3OX8A 5D7JD 3P3TA 4OKVA 1NMBL 4NUPA 3VE0B 5T3XD 2GTZA 3GMMB 4D7BA 1NAMB 2UXVA 1W0WB 3QPQD 5J6HA 4FQ1L 4JRYB 3VM7A 5CLTA 2NNXA 3LN5B 5LNGA 4MDIB 2PW2A 3UJTL 4AEEA 4FA6A 1VESA 1VENA 4UMSA 4EMZA 1CFVL 2LE9A 1RUAL 4P9HH 2R23A 2ZUVA 4M5ZH 4B5EA 2D7TH 4GOSA 5L4IA 1BJ8A 4PJIE 2Q10A 4L8SB 3GMQB 3QWQB 4ODSL 3WY2A 2WCSA 3BP6B 2ADFH 4LSUH 3VYPA 3S3PA 3OAZH 5DMJB 1QR1B 1BA9A 2F15A 5EO1A 1MDAA 3OZ9L 1AZUA 3LDBC 3ZE0B 3B7SA 1PLCA 5F9JA 1C16B 1BECA 1U8IA 1NPNA 2K7QA 3F5WB 3TZVA 1F56A 2D7MA 1A6AA 3LKPB 4OVUA 4Z3TA 4MXVE 2K9FB 1YEGL 4KQ3L 4JQIL 4YFLF 1DBJL 4IRSA 4G1EA 4YHMH 4Z7VF 4F37F 2X6AA 3D7PA 2R9HD 4R97C 4Y88A 5DJZA 3L3JA 5T33H 5IG7A 1K6QH 4KRMB 4LCWA 2C9AA 4R5XA 4BZ1A 4IBWA 2F7RA 3ECUA 4QYOA 4PY8I 4F9PC 3D39A 4RX4A 1VGEL 1P5UB 3SE4C 2JQAA 4CC4A 4F7EA 5FO9A 1KXTA 3QNZA 4O9HH 3H9HA 5CIPB 1NIEA 3FFDA 2X9XA 3SEPA 3BRZA 4K5LA 4DGWC 5C3LD 3F12B 1I8LA 4JREC 5J11B 1YN7A 4AYID 1KGJA 5FO8A 2HG5A 3NEXA 3AXHA 4AJYV 1HCFX 1CDJA 1TTUA 1ONQA 4FABH 1TCMA 2OYMA 3MV7A 1BPLB 3QZWG 2ZWYA 4JDTL 4U6YB 2JKSA 4KKBD 1YS5A 1I3GH 3TNNA 3VNYA 1BIIB 2J4UP 4Y4FA 2PYFA 5INCA 1YYMH 5FO7A 4NAMA 3O3DA 5G2NA 2NNAA 3VXPA 5IT2L 2ZWZA 5HHPB 1ZGLM 3G5YB 5D1QA 2NY2B 4Z78A 1SFDA 1Z0NA 3NPSB 1ND0B 3QQ3A 2YRZA 2NY2D 1FG2B 4XNMB 4DZBB 2VERA 4YDIL 1HAUA 3EYFA 3RZCC 2QSCL 4KO6A 5J1AA 4LCWE 4TV3A 3WL9A 5ADPH 4HUWA 4OF0A 1HQRB 3MRGB 3TVMB 2CJTA 1EVUA 2MCMA 2NMSA 4UT7L 4FZMA 2CSPA 3CSYB 3QNXB 4WWID 4YDJA 5AW2B 3TVMD 1B0IA 1ZT1A 2W9EL 4F9PA 4E41B 1SHSA 4HK0A 1RZPA 4E41D 3BHBA 4I77L 1ETA1 4XTRD 3UAAA 3UTTB 5J5EA 2WANA 1OXYA 3B6SB 4ZODA 1OP3H 3UTTD 3MV7E 3EJZC 2R2EA 4WO0A 1K2DB 2E6JA 3ARBB 3HS9A 1Y07A 4PRBB 4LESA 3RDJA 2J5WA 1HH6B 2CXKA 4HIHB 3NBNA 2VZOA 1RLBA 3ARBD 4KAQL 3WKYA 2CH8A 1B4TA 5TFSL 4QRRE 5JDSB 3GO1L 1EEYA 3IEAA 2HSIA 3KWTA 5KW9H 1WGOA 2ZWLT 4UNVA 4ZUTA 3E3QE 3ISRA 1MF2H 3ZIYA 1VEPA 1XR9A 2J4WL 4LOUC 1R3KB 1HHHB 1FNGB 4R5VA 4WSJA 1IARB 3FHQA 3CLEH 5F1NA 1UXWA 4KI5C 3NMEA 2XBTA 1QPPA 4TUKL 1OCCB 5LGHH 1CD1A 2GYSA 4KKCD 1SDYA 1P7QB 4WJG3 4PWKA 3ZDXB 4GLRI 3HE7C 1NFKA 2QZ5A 1P7QD 2BVQB 3BLPX 4WQOA 1SLVA 4QNPF 4R7VA 2WP3O 1E6JL 4HJGA 1SF5A 3EDDA 5IB4B 1XH3B 1UM4H 4M6OH 4U1GC 3EH1A 4M9OA 2C3XA 1S7RA 2V7NB 4LCCA 2ISDA 1HYRC 4HKJB 5AVWB 1CGYA 4WTQA 2VZVA 1O5DT 2A9NH 2V0AA 2I5YL 3NIFE 1QSFA 3WXVH 2GE4A 4A7GF 5KOVC 3V7AE 3DPBB 3ZU8A 3WV0A 3W2DH 1KB9J 4I5BA 4DVRL 2JH2A 1DBBH 1SJVA 4EBQH 4YBQC 1X5MA 1HJCA 3BW9A 3OAUH 5C0ND 3EFDH 4QOKA 3RX9A 4EZJA 2AV1B 1LO3H 1CK0L 4GIAA 1KB9K 1V3MA 3NZ8B 2Y6TE 4F8NA 3ZDYF 5GS0H 2CNZA 2BY0A 3N2JA 1BJ1J 2AEIT 4XAWH 3BKCH 4G43A 4AI7A 2R51A 3LEVL 1SZNA 2V17H 3SDCC 5GSRB 3KWUA 3BZ4B 2CDEB 3CG8A 4UAOB 1DJZA 3QEHA 4OZIF 2VZUA 2MHAA 3WU1A 1RP8A 4JFPA 2XVBA 4GRLB 2DJ4A 4AQ8A 3EFFA 4QUOA 1MLCA 1Z9OA 3DUUA 4GRLD 4JB9H 4OIIL 2MIZA 4P07A 2WKOF 3D4YA 3IFOB 4FGMA 4R7NB 4ELKA 1OP5H 4OSUL 2EVJA 1G7QB 2VXQA 3B2VH 5KYUA 4P2QB 3VSUA 1QSFE 1GHFH 2J6WA 4GG8B 3V6FB 3GGWA 2W81C 2VXQH 1GZPB 4MJIA 4DKFL 1YJDL 2PCPB 3B2DC 1DJSA 4GAYA 2Q5BA 3QDGB 4RQQA 1I3RB 5CINH 4QMEA 4JO3H 3QDGD 4MZ3A 4ZFFB 1WJ3A 1BAFL 3VFGL 4O4XA 3I6GB 4JFEB 3NJJA 1T4KA 2BNQB 4M1GH 1W16A 4P9HC 5F1IA 1A7PL 2BSSA 4JFED 4L1BA 5IESH 2BNQD 2BXYA 2Q3ZA 4XBPA 3DYPA 4DOHE 4ZQTA 5IKCA 2ITEA 1A1OB 2FECL 2BY2A 5HDQH 3N40P 3MDJA 1I1FB 1PD1A 1NM9A 1EERB 1X9QA 1IJNA 2BY3A 4QF1B 2W65B 5DMGD 3FRPG 1P4UA 4YHIA 3U2SA 3DO3A 1RK1A 2QMJA 1LDPL 4PJBF 1AQDB 2X05A 5JMRA 1A6VH 5BVJB 4BUGA 5BO0D 1CR9L 1RHFA 4XN9A 1DO5A 1TETL 2EACA 3G6AB 3MJ6A 4BBWA 3HG3A 4XB8A 4PUXA 4TNVK 3TZVC 4A38A 1GIGL 1MUJA 3DURB 5ANMA 2DQUL 3IWUA 2ITCB 3L17A 3DYOA 3T1WA 2GC7C 3DVGA 5EEVA 4P8QA 3FQNA 4R7DA 1RUQL 5E6IB 2AZAA 3DXAD 3QO1A 2KXPB 4NZRL 5C3TA 4DP6X 5E6ID 2N7SA 1IBFA 4PV1C 5AD0A 4WWKB 4XP5H 3KVDD 1NCCH 4FQXB 2VIRB 4UT9L 3TN0C 3JT0A 4BFJA 3C87A 4CC4C 5H94A 5GJTH 1BVOA 5CN1A 1UT9A 4WWKD 2CM6A 4FQXD 2BS9A 2BC4A 1NCOA 1JTTA 3CDYA 2G5BB 9CGTA 2P3YA 3HVDA 1IL1A 4ODHH 1I8LC 2FT6A 3KYNA 5DK0A 3QI9A 4WHCA 4U0QB 5KYXA 4OJFL 3CFKA 5LWYH 2FHBA 2WVVA 3QEQA 1A8JH 4UWQB 3O6FB 1LL1A 3APNA 3GBMH 3F7VB 2G60L 3OKKA 3O6FD 2VDQB 4YHYB 1UH2A 3PDOA 2BNUB 4TL5A 4Y4FC 4N2LA 1UJ3A 1OPGH 5DYFA 3ORJA 1WTGT 3BEWB 4TRPH 3EYSH 2UX7A 2ADGA 4KK5D 5ANME 5BZXA 2NX5B 2H1PH 4J6RH 2Z7ZA 5TDOB 3E3QC 1MWAL 5AWNH 5ABZA 2NX5D 4KVNH 4UQ3A 3SCMA 5DRXB 4TLUA 2EC9U 1G7MA 3L5XH 2VDRL 2ERJB 4O02H 1PY0A 1WZLA 2BOBB 4OZFG 2PPCA 2OPCA 4MNGB 1PY4A 5HI3C 3VFVB 4QJ4B 3MV8B 4M6AA 5FAAA 1FFNB 3HG1A 2X1XR 4L9DA 4JG9A 2WIIA 3MV8D 3N9GH 2AK1L 3NCWA 5E5LA 5J12B 1OARL 3NA9H 2FO8A 3OMAB 1MM4A 2C9XA 2B59A 4HX1A 3WFDH 1ZSDB 3BP5B 4MXQD 1TJGH 2V7HB 2ZCHL 4NQDB 2VN7A 2OZ4A 4XRCA 3HNTH 3VRLE 4DGVH 2R69L 4AZUA 4GP4B 3IDGB 2OZ4H 5GGVL 2Y36L 4AGNA 4KH2A 3KPLB 2CHZA 3OSKA 2DQDL 5KJ7E 3EXJA 4NFDA 2WIMA 5K1JA 1KY7A 2EH8H 5KTEH 4K8RL 4A7UA 1E50A 1SMDA 3CZFB 5HDBB 3IN0A 4NZUH 3IN2A 1TJHL 4ZPTA 5E94B 2DQCL 5I1IH 4DP0X 2G9HA 2D3LA 2A74B 4MBOA 3S34H 4HHAA 5D7EA 2WV3A 4M5YL 1TJXA 1LJMA 3HG1E 1UM5L 2IWVA 4Y9FA 1SJMA 4BUMX 2UYLB 1W0VA 1ZMYA 2XLLA 5TE4L 3VI4F 4FQLL 2BSED 3HPJA 4FKHA 1ASOA 1M7UA 5CLWA 1GR7A 1ZWIA 2Q86A 4LCCC 3W57A 4B9FA 3DVNA 1G9EA 3LXUX 4LPWA 4Z7UE 5I6LA 3SN6N 3U46B 2IDUA 5CILH 2UV3A 2CLVB 2X40A 2HJKA 1AY1L 1OAZH 5EZLB 1CD9B 2F6AA 1BM3L 4XOAA 4L37B 1OSMA 3A4DA 5D1ZB 3CFJB 3RDTA 1GYVA 4F2EA 3LRSA 1YLBB 4IRZL 1LQSR 4X0KB 5D1ZD 4JY5L 4F58H 1WBYB 1NL0H 2AAVA 2YAPA 2FEJA 2R4PA 2VQTA 1L9SA 2Z4TA 3RVWD 5B38A 5GS0C 1JPTH 4QGYA 3UYRL 1YG9A 4NQEA 4AQZA 5K59F 2QKIA 1Z0MA 5ETUB 3ZKXC 3FTSA 2YMXH 1HIMH 4WUKH 7PCYA 3QG7H 4DGIL 1JUFB 4P46C 3K8LA 3CTTA 2UWEA 3O45B 5GRVL 3MLZH 5JOFA 4LEEA 1BOGB 1IAOB 3MCKA 5CFAA 2KZ7A 1WH0A 2Y5TB 1MFVA 4ZS7H 4KO9A 3BAEH 4D9RD 2OK0L 1EO7A 1M71A 4PY7B 4KV5E 4Q6YA 2IDTA 3FUJA 3AAEA 3KLDA 4KKQA 1BZ9B 1DQML 4MZRA 4FNLH 4NWUH 4OF5A 5JHBA 3V9FA 1ZV5A 3EAKA 4XVSH 4QRTB 4B27A 3C8KA 4OIBA 2NLJB 3JTSB 2WAHA 1WBXA 1HHGA 4F24A 1MVUA 5CU5A 2VR9A 1YN6B 3E8UL 4GW5A 3JCUO 1HYSC 5FIEA 5JXAL 3H42L 4J3OF 2AXHA 2XACC 3SQRA 2FNBA 4Z1PA 1AR1D 2HX8A 2LQRA 4Y5YB 1GC1L 4LT7A 3PGCA 5TGBA 4NQEE 2BLFA 4Z3GA 1BZ8A 1A4CA 4RISL 3O9WC 2JXMB 1JWUA 3QDME 1ZVHA 3WAKA 3X12B 2K1MA 4I1PA 4ETQB 3HHRB 5LKNA 4YDVA 1ZD6A 4UIMA 1T1XA 3VDCA 5EUOE 5BOZG 4MAUH 1CBVH 4JANA 4FC3E 5EBLB 4NYLB 5LXGH 4XE5B 2YAMA 3NT0A 4L3EB 3BVWA 2ZLDA 1Z6JT 4LVNC 1JZ6A 4L3ED 2JIXB 3UTSA 3BGMB 2VERN 2XTJE 5J7CC 2D73A 2PCXA 4HIXH 2JIXD 2DJSA 3QCTL 2X3BA 5ADOH 1N3NA 3HI6H 2BH0A 2IO5A 3AT0A 3CN1A 1XF1A 3M8OL 1ZTMA 1YUKB 3IPFA 3RB5A 5CEXA 8PAZA 3OAWA 2OM5A 1W72B 3QR0A 2PPFA 3G3LA 2QQNL 1Q8MA 1RUPH 3X1BA 3EJRA 1DVFB 5AL0A 4FAAB 3Q8BA 5ABDE 4MD4A 1YPZA 4ZNEA 1CZ8L 1GS8A 2HLEB 3I6KB 2B4CH 1ILUA 4CADB 2EYTA 2TRYA 2VKXA 3KS0H