4AYMC

Structure of a complex between ccps 6 and 7 of human complement factor h and neisseria meningitidis fhbp variant 3 p106a mutant
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
239
structure length
234
Chain Sequence
ALTAPLDHKDKGLKSLTLEDSIAQNGTLTLSAQGAEKTFKASLNTGKLKNDKISRFDFVQKIEVDGQTITLASGEFQIYKQNHSAVVALQIEKINNPDKTDSLINQRSFLVSGLGGEHTAFNQLPGGKAEYHGKAFSSDDPNGRLHYSIDFTKKQGYGRIEHLKTLEQNVELAAAELKADEKSHAVILGDTRYGSEEKGTYHLALFGDRAQEIAGSATVKIGEKVHEIGIAGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords COMPLEMENT FACTOR H
total genus 49
structure length 234
sequence length 239
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4aymC02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4aymC01
4AYEC 2KDYA 3PQUA 3VE2A 1YS5A 4AYNA 4QQ1A 3V8UA 4AYMC 4AYDC 3KVDD 2KC0A 2Y7SA 3HOEA 4O4XA 5EE2A 3PQSA 4O3XB 4O3YA 3UAQA 2LFUA 2W80C 3VE1A 3HOLA 2W81C 4O4UA 2YPVA 4U9CA 5T5FA 4O49A 4AYID 4Z3TA 4O3WA 4O3ZA
chains in the Genus database with same CATH superfamily
5B8CA 3HG4A 2BOLA 5I28A 3WU1A 4RGOL 3NZHL 3DA3A 1SFHA 4KKBC 1NCAL 1KSRA 2BSRB 4LVOB 3O9WC 3QDME 2BRRL 4H0GA 4UU9A 2Z7WA 4IU3A 3KPTA 1W0WA 3A47A 1SOKA 1OAXH 2BFGA 4U3CA 5CUSH 2NY0D 1QZ1A 2O93L 2XPGA 4M1GH 3X1GA 4RMWA 1E8XA 1OCWH 3BPOC 1S7SA 2C9VA 3EG9A 4KK9D 1ZA3B 1LTXA 2ZCLH 3SYCA 3RZCD 3GMPB 3LMJH 1A14H 4ZS6C 2MSPA 2AJVH 4CNIA 2J8UE 1A6ZA 1KBGL 1S3KL 1AD0A 1T21A 4L29A 3PQYB 4M48L 4NO0D 4UB0L 1PKOA 4Y4KA 4GKNA 1H3VA 2NY1B 4RSYA 4F8QA 1AHMA 3V5DA 5DLML 4HHGA 3UPRA 1IRAY 3BEWA 5KW9L 3D18B 4FG0A 2Y07L 2W9DH 4Y1SA 2LFUA 4HG4K 1ROWA 3AWFA 3LKRA 4P2QD 3UOAB 3ZE2E 5EEXA 4XXDA 2P5EB 2ZKWA 4HCGA 4Z76B 3H7BB 2HT2D 2YEZA 4PS4H 1E4KA 3MYJA 1UHVA 2Q86B 4QYOB 1U8MA 3GBML 3JV6B 2MCG1 4B60A 3DVFA 5GZOD 1O5DT 3SDYH 4OZGA 3U25A 3HI6H 4XP4L 5IEKA 3UTTB 5HYIA 1MFDH 4RDQF 1MHCB 1Q9WB 1PZDA 2ARWA 3MV7A 2LHAA 5F97E 5EZJB 1IC1A 4NO3B 1ORSB 4JY6B 1KBKA 5FKPA 3MRJB 1EZVX 1ND0B 1QVOA 2Y2YA 5I1JH 4GXVL 2OBGA 3R0NA 4QRAA 4LSIA 2PABA 2ZP8A 3BUYB 4AQ1C 5F9WB 3KZIO 1X4ZA 5BZWA 1T1LA 3G5VA 1QLFA 1XL4A 1XF2B 1J8KA 3BE1L 2OJEB 4OLUH 2N1TE 3L3KA 1S7RA 3PGRA 3U1QA 3U0PB 4YOKA 1PZAA 5AVRB 3T0EB 3NAAH 4X4XA 4OGXL 4OF3A 1B4JL 3I6SA 3ZN6A 4EKJA 4ZD3L 1QNZH 5DVPA 3KEHA 5DZVA 2VMDA 1JWUB 1JUFA 3CQFA 3IETB 2OXGA 1EHNA 3Q8CA 1EXGA 1KJVB 2SODB 2JKLA 2G9KA 4PJ5D 1T1ZB 3VJ6B 4UIMB 2ZUTA 4FLQA 3TONA 4HS6A 1CD0A 4DKDC 3BPCB 2NZ1A 3GJEA 4GAGL 5HD8D 2BS8A 3HR5B 3TBVA 1KC5L 5F7AA 5CGYC 4F91B 2WJRA 3KHQA 1LDSA 2LLNA 3GSNB 2PNDA 3DMMB 4WU5B 1U4FA 4P5RA 1JYVA 3JWOC 5EOQL 3R0MA 2XWJB 3HG5A 1KPRB 4MQTB 2G0KA 4J6RH 4NWUH 3CFNA 4GQ9H 1MPAL 3SD2A 1DFBL 2YAQA 4XTRD 3DXAB 4DETA 3QYCA 3KLDA 1RVFH 5ABZA 4YPGA 1AR1B 4RBPH 1T0MA 1RCYA 2XC8A 5I75B 3Q9PA 1T83C 3NJFA 3MV7D 2DM4A 4N9GB 4EUPA 1CT8B 1YAIA 1BCIA 3PWPE 1ZLUK 4ZFOA 2AJSH 1TPXB 4LLVA 1T66D 3ZIYA 5GZOC 4G6AD 1I9IH 4NUGL 4FA8A 1DANT 3FRPB 1DUZA 3EH2A 3EYUL 3OKOB 3EXJA 2VH5H 5EORH 5DWPA 1TO5A 2FBOJ 2WUCH 5JIPA 4LIQE 3RG1C 3UPGA 4JANA 1RZKC 4PAZA 2P28B 4FMVA 3LB6D 5DTFB 2O6PA 2ZG1A 4WO4C 5I1HL 1OIOA 2UY7B 3ZTNL 3P3SA 3L3GB 1YJDH 2ADFL 3Q48A 4QNPF 3LS5L 2ALWA 2SEBB 4KRPD 4ADJA 4LRNL 4CGUB 1L0PA 4PJEF 1U8IA 4YDJB 4MXVF 3QIBC 4R8WL 4RGNB 3RZCC 2NTFB 2ZSVB 2YQBA 3V0JA 2XBZA 2EZ0D 4HIIB 3W11C 1N7MH 1VJSA 4NNPL 1KNOA 2IH3B 1M9WA 3TBTA 5H2BA 1X5KA 3QWQB 2XNAB 1HWWA 3PDOA 3P11H 3T9WA 3ARDD 3MRNB 3NEEA 2BW4A 1AGCA 4UTBA 1PG7H 1U91A 4K3DL 4XWOC 2X38A 3ULSA 3NDYE 1AXIB 3ESNA 1T80A 3AS1A 2FX8L 3IJSA 4FFWD 4Z7UB 1R1CA 5J89A 3ZKXB 1PY4A 3ZQ9A 1FBIH 4LCYB 3RGVB 3IGLA 1T0NA 4L2YA 3FAWA 2KKQA 4KRPC 3LPWA 32C2A 5EU6D 4HXBL 4AQ1B 2QMKA 4LL4A 5J4MA 5HI4C 3NA9L 3MUZ1 5G2NA 2F15A 2QSVA 4H0IA 4IW4C 3PAYA 3CDGA 3U36B 1RH8A 5DUPL 4C4VA 4XGZA 4R26H 1EXHA 1NJ9B 2XDHA 5GS1C 4HMEA 3X13B 1GS8A 3WHE1 4IMLB 1BZOA 3GKWH 3PGDA 2YEVB 3DJTA 3HE6A 3O6FB 4UT9A 1UZ8A 1XV8A 4O51A 1T7ZA 5JMRA 3QBTB 5AKTA 1SNRA 3P2BA 4HBCL 3VSVA 3ZKQD 1YMMA 3SKUD 3FUKA 1BV8A 5GXBB 4WWPA 4H8QA 4BK5C 3N06B 3TEUA 3QZLA 4FESA 1T1YB 3LD8C 4IJ3B 3RPKA 5J56B 1E4WH 5KVGL 1TCMA 4IBQA 4M6ML 4LDOB 2IAND 4ETYA 4XVOA 2OQJB 3BN9D 4KKNA 5DJDB 2JB5H 4MMXB 2FE0A 3B83A 2HCZX 4OZGB 1DJHA 1N6UA 5E6SB 4QRFA 1E27B 3QDGB 2EDQA 1ZLDA 3BDYH 4ZDHB 3HI5L 2DQDH 4KBPA 4WFFD 2FJUB 1OHZA 5JPMA 5D1QC 1QPKA 1V54B 4P23B 1KYOJ 3CCHB 4TVUA 3CFKA 4JFDD 4AZ8B 4JAMA 2W60B 1YEFH 4LLUA 4KMQA 1D5ZA 3D4CA 3FSWA 5FEBA 2YBGA 1DLFH 4LHUG 1LWJA 1J8HB 4IHOB 4YXHH 4V33A 2P42B 5BZXA 1FVEB 5C07B 3FTGA 2HN7A 4MAUL 3QXWA 4G76A 4UINH 3T71A 3CFEA 4Q6IB 2Q1EA 3IDNA 3WKPA 1YN6B 2ZXDA 3FUJA 3ME0B 1NIBA 5DYOA 4CVXB 1OGSA 1Z3RA 1LO2H 3EOAB 4LIQL 4ZPVA 3VMPA 5B1BB 1AKJD 4NFDA 1ULVA 4L1HA 3P77A 3SCMD 3N5AA 4UTAA 5D1XB 5AKVA 4JFYB 4UQDA 3IJ8A 3L5WB 3DOSB 4BXVA 3S36X 3E6FA 1MELA 2ZKHH 5IG7A 4PJBF 4WJG3 4WUKH 4E1SA 3NJHA 5F7LB 1R24B 4OJFL 1SYVB 3F64A 4H25A 1JHLH 4GLRI 5KVEL 1GPOH 2H1PH 1QFWM 2XFXB 3C60A 3UADA 3KPSD 1G7IB 3NACH 4U1LA 4TUUA 3FTSA 5HHME 3UXFA 4FQQA 2F53A 2AJYH 1KCKA 5H94A 4QRTB 3MNZA 5ADXL 5J11B 1PF3A 3UZEA 4YBQC 6CGTA 3BJLA 1TG8A 3OHMB 2M2DA 1SN2A 3LN4A 3OKKA 3U4KA 2I5YH 1WJ3A 4S11A 1BX2B 1S7VA 3WE6A 1TF4A 2VLKA 3DUSA 4KX9A 3BMVA 2OMBA 2YJLA 4P4RB 4QYOA 5E9DD 5EO1B 5CWSB 1MY7A 5DYFA 4J3OH 1A8JH 2G2PA 2APBA 3MRMB 3RVTC 4BCZA 5DEGB 4BXSV 4O2FB 1MWAB 1PSKL 1DJWA 1T04B 1QTSA 4LLQB 2XWBB 4UYQA 4Z0XA 5F6HI 4QAMB 1NTDA 15C8H 4TUOB 3CXFA 4PJBA 4A7VA 1PKQE 1D9KD 1KPVB 4X99B 2Z8SA 5KTEH 4Y2OA 2FGWL 2H32B 3KNBB 4L3EE 4M3JA 4AEHH 2PETA 4L8DA 1EHLL 2IPKB 3IFOA 4MA3B 3OSKA 3L5JA 3MOBL 4W9JC 3X11B 5BUGA 5MEOA 1IC7L 1AAJA 3NTCL 4E36A 3IBEA 3MA7A 3WMQA 4NIYE 2NNFA 5L7XH 4AYMC 3BAEH 4IKKA 2YQ2A 4JPKH 4XN4A 5HDBB 25C8H 5SWSA 1R4XA 4UQEA 3JV4B 2LW3A 4G43A 4DHLA 2DEXX 4GG6A 1A1OB 3IKCB 5F3FA 4D3CH 4JFVA 3CXDH 3I84A 5L2JB 1WFTA 3BWAA 1CF8H 2QPUA 4XC3L 4YXKH 1QEWA 4XNYL 3IGUA 4ZFQA 3BQUC 4GW4A 3LXCA 3E38A 3EYUH 5DJAB 5G38A 2KPWA 4KRLB 1SBSH 2DQEL 4BELD 3BISA 4XVTL 4F7PB 2J1YA 1GGBH 3TBBA 1QEXA 1LE9B 1KELH 3QB7C 1HESA 2DWDA 1U9KA 2YAPA 3M8OL 4PV9A 3VFWA 4MNGA 3QQ4B 5EHFA 1A4BA 3RKDC 3BSZA 3QCTL 3UABA 2NDGA 2L7EA 4I5BB 4W81A 5DJZA 2EEAA 1XT5A 6PAZA 2VRQA 3QJUB 2IADB 3O4OC 5ICZB 1UD8A 3V0HA 4BUHA 2BVOB 2YPVA 1ZTXL 2F6AA 4YZWA 4PJXE 4XWGL 1HJBC 1UFUA 3BFOA 5D1ZD 4JB9L 1MHHA 4NOBA 4QT5B 1URZA 3AA7B 2IANE 1NCDL 1HHKA 4YEFA 2VO5A 3AREB 3NGBC 2IOIA 3AQYA 4XBGB 3M1CA 5DVKA 4JEGB 1YNKL 4PV8A 2OJZL 2VDMB 4O3XB 1YEEL 1EEZB 3MLRL 4PGCB 1J9SA 1T1XB 2NY6B 3SE4A 4HIHB 4AQEB 4AOFA 2DEYX 1BJ1J 1NBZA 2YJQA 4MVBC 4TUJA 3EBAA 5IB5B 1JBJA 1G7LA 2QL1A 4M6NL 4WK2B 4NN5C 3OB0H 5TPWH 4Y5YB 3SDAC 3A4FA 1R34A 3FO1B 3LNIA 1QI4A 1QOKA 3W39A 3AZUA 4P0DA 1U93A 2W9DL 2NR6D 3P1VA 4MDIB 1F4YL 2ZNWA 2R56H 4XP6L 4EVNA 3EUUA 1OGAA 3RVTD 1NUDA 2PYFB 4QAWA 2HT4C 1HSAA 4YHOH 1A4JB 4C56A 1F8TL 2PYEB 3IYLW 1MWOA 4NM4L 4OKVA 2DMBA 1XIWB 2APVA 1R3JB 1ONQB 1TMCB 1RZJL 1R5WB 2MCPL 1BBJB 2XN1A 1OTUC 1O9VA 4LOFA 5GS1B 5FAAA 2W95A 3OZLA 5H37G 2JXMA 1E43A 5I1JL 3FSZA 3A6OA 4AWJC 3WGUB 1U8NA 1E3ZA 5L88H 3WTUA 2BS71 1ZSHA 1EFQA 3L4YA 4BQ6A 1PKQA 4Z9KB 2VZSA 1SF5A 1PYWB 1GFOA 2ZCKL 4MXQC 4Z3FA 4G7QB 2VZUA 4X98A 2F1CX 3AFLA 4RZCA 5ITBL 1TNMA 1CGUA 4PGBA 4QHNB 5BZDA 2OMUA 1PZ5A 2COQA 2KL6A 3KCPB 3IGAA 3UIZA 3O3DB 4XNXH 1U8QB 3VVWA 1LK2B 3QJXA 4BGDA 1TQTA 1ZT1A 4GXFA 4KXCA 3WNLA 1SLXA 1A65A 1FZJB 5ALBH 5M95B 1J18A 2Z8RA 3DJRA 4WU7B 1JZ3A 2LV4A 4FFZA 4IU2B 4KRNA 3VFWB 1SVCP 3ILDA 3N2JA 4FTVA 2E9BA 3CPLB 4LKXA 2VKWA 4B9PA 2BERA 2PCYA 3L5HA 4U1MA 2BLFA 1I9JL 4GMTL 5CP3H 1BOYA 2AXWA 4XO9A 2ZOLB 1I7RA 3QXDB 4UT6A 5D1QE 1XHHA 3RZWA 1MSPA 2QTKA 2R69H 2XZAL 3LTVA 3L9BA 4XO4A 1AI1H 1A1NB 2OMYA 4U6HB 4WFHD 4PREB 3V5DB 4XN7A 2JH2A 3UBHA 1A66A 4RFEB 4XP6H 4IOIA 1DVFB 3B2UC 3KYNA 4RA0C 4R5XA 3RNQA 2MRYA 3PL6D 1CQKA 2AZAA 3DSNA 5DZNA 3GYRA 1AQHA 3OG6B 4ATWA 5DVLA 1G7LB 2QSQA 2E7BA 3P9MB 4TVSa 3ARDB 3C8HA 2BNRB 3CMGA 5JUEH 5LG6A 2ADIA 3BH4A 3QZWB 2R8AA 2J4WL 4PVMA 3MJ6A 2X1QA 1AXTH 3LKOB 1EGJL 3IJEA 3UZVA 2DH3A 4L2LA 1A2YA 1TJIH 2Z4QB 4OB5H 1O6VA 2NUPB 5BQ7A 4XBGA 3WIFA 3RGVD 5EO0B 1OOWA 2BSTB 5D7LB 3WS6A 5I30H 2ARJA 4LDLB 2GIMA 2CXKA 2X9ZA 4MJIB 4WFED 4F2ME 3D4YA 4U1KA 4KXBA 4Y9BA 1PNDA 3ATBA 4IHOA 2F54D 3VDCA 2GJ6B 5D4QA 1E9OB 5FFLA 2V17H 3JYBA 2VGLM 4ENEC 2WLJA 3DTXA 4PRPB 1RZFL 3V0VA 1NFDF 2JTDA 1JPFA 4N5ED 5BZZA 4KZDL 5DJZB 5AW3B 4B27A 2JKTM 4AKMA 4APXA 3FTZA 5JYLA 3K6NA 5IQLA 3JWNH 4AM0Q 4OR1A 3B2XA 3C5ZA 4OBRA 1B9KA 2BZDA 2OR9H 4JY4A 5L6YL 3EJUA 1FFOA 4WW1B 3EYOA 3ULUL 4O4YH 5FCSH 5DJDA 3RURA 1WIUA 1H6S1 3CZEA 4G59C 3ISRA 2ZXCA 4JJ5A 1JVKA 4YXLH 2B59A 2EEFA 1GC1C 3CFJB 4MQSB 5CJXA 3X17A 3DHUA 5C9JB 1RUAH 2NX5A 1MFBH 1KB9K 2QVIA 1LNUA 3VGEA 4OD3L 3O8XD 1IAOA 1YEJH 5DEFB 3LVEA 1D3CA 1LP9A 2LVCA 4JN2A 4K0OA 4TNFA 2YHGA 4N0RA 2HVKA 1PIGA 1UXSB 2ITCB 2P5PA 3L17A 4DZ8B 2B4CC 4HPYH 1CU4H 3ULUE 2FEDD 2HKFH 4XP9L 2ZCHH 1FFPA 3DK2A 4YE4H 4F8PA 2HA1A 5IB1A 1AQDB 1SY6A 4OZ4B 2FT8A 3SKOA 1DN0B 3MRFA 3IU3A 3W0WA 1ZHTA 4ANKA 4AUUA 4WFEE 2JKJA 2ZSWA 3CBKB 1XSIA 1WTGT 3NZ8A 3MV11 5F44A 1ZWIA 1JFQL 1X5IA 4ZMZA 3RWEB 4QJ3B 3QH3A 4M4RA 1S9VB 1NFDA 2R29H 3CK0H 1UH3A 3BUDA 3GSUA 2Y5QA 5B39B 2NQDA 2V9UA 4F93B 2Y2XA 3CLWA 4J3SA 3EHBB 5AG9A 1ET8A 2VZOA 4GUPB 5EF1A 2JNZA 1F2XK 4Z7WE 1JWSB 4ICXA 5DUML 3L9RA 1EZLA 5KVEE 4JZNB 3RJQB 1I82A 2GJ6D 3O3EB 1KCVL 4Y5YA 5CWSA 2IO5A 5DVMA 2OZ4L 2M8XA 4NEHB 3L4XA 5E8OB 4L1TA 4ABWA 2YA0A 4NQSA 2CO6B 4BH8B 4XNDA 1JRHI 4N8UA 5C0IB 4EDWL 3KDMA 1NM9A 4BCXA 1HAWA 2F53B 3ARZA 3SY6A 4NQDE 2L0DA 2VDQH 1AOZA 5CJQL 2JI3A 1XXFC 3OG4B 4X8JA 1MFDL 1Q1PA 3JVGC 4ES8A 4ETQB 4X9BA 5D1QD 1OY3B 4LLWB 1IL1B 4NB7A 4QTIH 1YRKA 3F8UB 4NZDA 3BWAB 4FQXA 5DD5H 1LLAA 1MVFA 3MRCB 4OUOA 1P1ZB 2XTRA 2Q7YA 3MRPA 3S3BB 4FQ2L 1R3KB 3BXNA 2O61B 4Y2DA 4JZOB 4JDEA 5D1XA 3PWPA 3FQUB 3UBGA 2FYYB 2VL4A 2VWEC 3MRCA 3QULA 3MMEB 2XTQA 1TQWA 4MGXA 2BC4B 1YEWA 3ME0A 3PIQA 3GLEA 2XE1A 1X4XA 2NXYC 3BSZH 3OKOA 3P3UA 5TDPB 1FL5B 2YUWA 3D3VE 2HFGH 3EUDA 4NKMB 5D2NB 1A1MA 2DIJA 5IBTL 3O6MH 3R06A 5EC2B 3AA0B 3SZDA 4YHLL 4FT6A 5MENB 3NFSL 2AXHA 5F7BA 2WW8A 4PGDA 2VDLB 1UB5A 3R18A 1PFCA 4GG6B 1KCVH 3FZUD 3ZVVA 3PWPD 1YEJL 2VABA 2V5SA 4D9QE 1AHWA 4ERSH 3W82A 5F7KC 5FOBA 1NGPL 4G2AA 3FL7A 5HHVL 2G4GA 3K1DA 3U6XS 3CU1A 2XWRA 2B20A 2DWSA 1O7VA 1KYOK 5EZLA 3SY9A 2A4EA 2IH3A 3TBTB 1XB8A 1RK0A 3QRAA 5CF3A 1A6TB 4FFVC 2IPKA 3N41F 1CN4A 4GIPD 4ZFFA 5FM5M 3MI6A 4PUBL 3MTRA 4B9JA 1RJCA 2Y3AA 5GRUH 4ZZKA 3FB5B 2Z1KA 1I8MB 2OTUB 3MODH 3NJLA 4GEJA 3QDMA 4KTEH 2DQFB 2NXZB 4D0DB 2YUVA 2NY3D 5BO1H 1RLBA 1DBAH 2X27X 1I3VA 1YMMB 1GY1A 3B6SB 3IDUA 1GTNA 1SYSA 3IJHB 2VMEA 1E40A 1X5YA 5F7DB 4YFLI 4OQ1A 4XB7A 2WYHA 3GF8A 5AZEH 2AJXH 4JN1H 4YZFF 1DQKA 1A7RH 1JF6A 5IIEA 3GUTB 4NERA 4Y4KD 2YUZA 3FUFA 4FHKA 5FYJH 5JPNA 2F58L 3BWSA 4DTGH 3OR7A 2PF6A 4JPWH 2EDJA 4MJID 5KS9F 4CN1A 5D7LD 4PJIE 2I9LB 2ESVD 2ZXEB 4ZUTB 5EORL 3DIFB 1S7RB 3C2AL 4FFYH 3UDWA 4GBXD 1S7TA 3REWA 4APXB 2CDGA 1KG0B 3I74A 5DRWA 1LK3L 3QI9D 4NN7B 2Z7UA 4NUMA 3FH5A 5HDQH 4JK0D 2WTPA 1XF3A 1VZIA 4M1GL 5IROA 1NDGA 2Z1PA 5LNGA 4JM2B 1FH5H 3K5SA 2GCYB 2AEPL 1HXMB 2CCVA 3D30A 2EYRB 3IXAA 4MHHI 1SF3A 3AG1B 1GR7A 2DQJH 1S9KC 1ZT7B 4KRMB 2C3VB 5D2LA 2KLRA 2NYYC 4HDIB 4PIBA 4X6CA 3BOVA 2OXHA 3D39B 4JHUA 4ODUB 3QS2A 1BSIA 1G43A 3KDPB 4K7FA 3T1WA 1RHFA 5D7IF 3II3A 3C5ZD 4QKXB 1E8YA 1SXBA 5MP6H 4OVVA 1Q72L 1XWVA 5MEPB 3S35H 3VE0B 3H7BA 4P2RE 3U4BH 2F7IA 3BMWA 3TZVA 2W65B 5GRJL 4GG6E 1KUMA 2VDPB 1Z0MA 3UTSD 4YSDA 4M4RB 4DWHA 2ZJSL 1PEZA 5TE4H 3S36L 4GG6F 4U6HA 5FX3A 1JZHA 4Y4KB 1HI6B 3APFA 4GIOA 1GYVA 1NCNA 4O9HH 2YGQA 1EHKB 1QTPA 1WP6A 3MOAL 5TE7L 2YKKA 4F8LA 5BMFL 1CFSA 3HOEA 4M7KH 3CUPA 1YPZB 4PIRF 3OZ9L 1M05B 4Z1PA 4WU7A 2E7LC 1XGUA 1YEGL 4GXVH 4IS6B 1U8KB 2XX1A 3TV3L 3WNNA 1BJ8A 4NHCH 2ZAGA 1RURH 4MXQD 2NZ9C 1CR9L 3Q44A 1G90A 4I87A 4Z7WF 1ORQB 3PY9A 3ATFA 4E9XA 4O58L 1REIA 3UP1A 4MAYB 4OZHF 3VXOB 4S1SH 5HBBA 1ASOA 4U05A 3L3OC 2A1WH 3T2QA 2R69A 4ZOCA 4HEPG 2F5BH 3ILPB 1KENH 3DJ9A 4GSDH 4PPTA 1EEQA 3GXMA 1JI1A 2IBZX 4XOBA 5FS5A 5BVPH 3NJVA 4K7PH 5JTWA 5T3ZH 4LHUB 4L37A 3CX5J 3K1KC 4PLJD 2YNKA 3MACH 4EZJA 4PP1C 4PP1D 5CEZD 1KJVA 5HHXH 1TQCB 4U1KB 4RZCB 1BIIB 2KLTA 3MNDA 2EIBA 4FKEA 4PJ9A 5DK2B 4ELKB 3HRPA 4HS3A 5FO9B 4K8RL 3RPBA 3IU3B 5DC0A 2VXUH 1HQRB 1M3JA 5L2KD 1OGAE 5GS2D 2EDBA 2GAZB 3TA3D 3C6LA 5BMFH 1U3HD 4GRLB 3DVIA 1L6XA 4WWKA 1BVNT 5EUKA 1YYCA 5CS7A 1WCQA 4AM0A 3MNVB 2PW1B 3VZUX 3GHBH 3BAIA 3VXSA 2WZ5A 4HPOH 2WPGA 1A7QH 3T3PB 3ZKMC 1MQKH 3VFPA 2ATKA 3MUY1 1EJ8A 3EJZD 4MB5A 2FJGB 4JRXB 3ALWA 5J9PA 1U8CA 3KVQA 3PL6B 1JIBA 3EJYC 1G9MH 1RPQA 3WKMH 2XZQH 4S1DD 3PWUB 1HXTA 4XNBA 3ARVA 3OJMB 4LEOB 3SQRA 3HS9A 3QK0A 2EIZA 1G7HA 1BFOB 3CPUA 1XSKA 2BIOA 2A9CA 1H3TA 4HIHA 5F89B 1B90A 1JGEA 2R4RL 3U1SL 4N2GA 3RGVC 3ZTEA 1IIKA 3HHRB 5HYSA 1J05A 5DZPA 1FVDA 1K2DA 3N42B 5E1IA 4S1RH 1W16A 4ADGA 1F4WL 2ZX9A 3HG0A 5HHVH 4XMKH 1OAZL 3FFCB 4GKSB 1NFDB 3GSUB 4MYWB 1QFPA 1NLDL 4G9DA 5LCVA 2OFQA 1VFAA 4KX8A 4F2MA 2AMUA 3MRKA 2KZ7A 5C0NC 2ZFGA 1RERA 2Q7NA 5B1JA 1A2YB 2Z4QA 1Q8MA 3UU2A 4KDTC 1RZ8B 4GEIA 3IS1X 3JTTB 4DZBA 4LCWD 4UOW0 5TDOB 4Z0BH 3MODL 4NQTA 4ONGH 3TJHC 3VXSD 4HEPA 4PBWD 3ZRCC 4IEFB 1G9NC 4YDLC 3DDGA 1R5WA 2EADA 3QCUH 4AH2A 2GTQA 3UBXA 5E1AB 4DP4X 1U42A 1CI5A 1BD2D 4IU3B 2DYPA 4LQFH 3C6LB 5B38A 1F4AA 1C1EL 5LAPA 1U3HA 2B5IC 3H3PL 4Y2DD 4HWBA 2VDOB 5FDYA 1RUQH 4DP7X 5LGJA 2X6VA 2X1OA 3FUNA 4YHPA 4QRRE 1WZKA 3MBWA 3JUYA 2GT9B 4JO4L 2R59A 1NAKL 2CALA 4CJ0A 2PYED 1QYGH 2GITB 3CVCA 4GP4B 3EIFA 3ZDZE 2GTZB 1IZKA 1K8DA 1QSZA 2F7QA 3PAUA 5FYKL 4UT9L 1VGEH 1ASPA 5F7HA 3VUAA 3SY7A 1CUOA 5D1QB 2D3NA 3OJ2C 3FKUS 3HC0B 3V6BR 3ETSA 4FJ6A 1C12B 2CG9X 3MA9H 3G04B 1MOEA 2G5RA 4PJ7F 5F3HB 2YEZB 7FABL 4WGKA 1SBSL 2DQEH 1G7JA 4QRTA 3NRFA 3O4LA 1D7FA 4POZD 2OM5A 4XAWH 5DMIH 4PJCA 3IDJB 1TYRA 2FHCA 3AA7A 3LD8B 1D5IH 4IJ3C 3V0DA 4N74A 2EDNA 1FLTX 4J8QA 3IGFA 1K5NA 2CA4A 4L8SC 2BMKA 4H5SB 4Z78B 2BVOA 4JS7A 1T04A 5AYUH 4TSCH 4EAEA 1TJMA 1BW8A 1CZ8L 3DV6A 3ARGC 4K15A 4ODTL 3OZKA 4F5CE 4CUCA 1RK1A 3QDJA 3BSHA 4FYRA 4ZXBA 1AY1L 2PW2B 5SWSE 3TLRA 4LNVA 1PY0A 1QRNB 4JUTA 3L16A 4RRPM 1CXEA 5DRZB 3LNFA 1DLFL 3SPVA 1OAUH 4OGQC 1PY9A 3LK41 4JFEA 4ZD3H 4QIRA 4J3OC 3SE8L 2BVQB 1N2RB 3UDWC 1U0QA 2FO4B 3FRUA 4HGWB 4QO1A 4QRBA 3LZLA 3ZKXC 2C9XA 3DROA 5C8JB 1EZVY 2Q6WA 5IY5B 3T3MB 4A2FA 1S9WB 1CB4A 4AM0B 4AUYA 1A6UL 5CN3A 1YC7A 4NXKA 4PB9L 4PFEA 3LRHA 3HOLA 1CCZA 5E00A 3QFDB 4G1MA 2W81C 2UVEA 5T1LA 3ZQXA 4AL8H 2EE2A 4AJWA 4HIEA 4GNKB 3QCUL 2XUWA 2XE3A 1A6VH 1AE6H 4EI5D 3PQYD 4G5AA 5I0VA 3O0RL 4PS8A 5J1AA 4YHIA 3VG0H 2ZXGA 2V2XB 3MCLH 5HHOD 1WD8A 5JPMC 2X44D 1LD9A 3BT0A 1U8NB 5PRNA 1T5KA 3FQNB 1D5BA 3MXWH 3S4SA 4DUWA 3VSQA 1AACA 3I6GA 2BWIA 2JSFA 4TNGA 4EZMA 3WLBA 4U1IB 1JGEB 2CM5A 4L8SB 1NAMH 5KAIO 3FCTB 1BX2A 1OD9A 3NSJA 4OY9A 4WJKB 5EWIL 3QSKB 3O6FA 5GTHO 2F5AH 1BVKA 5ICYB 4N59A 4N1HB 4X6FA 2Z9TA 3DURA 5JYMA 4ECNA 1MI5D 1OL0A 5K9JL 2V33A 3OSVA 3PP4H 4AYFA 3WIHH 1J0ZA 4N68A 3GSOB 4OF6A 5E6YA 5ADOH 3FN9A 5T1MB 4HIPA 4TL4A 1QWHA 3C60B 4PLNC 5SWQB 2YN5A 4LPTA 1RHHB 4FQIH 5HI5D 4I9WE 3E6HA 3SE4C 4ZX6A 1OP9A 4HLEA 3UCQA 4GRWF 1I9JH 4GMTH 1VACA 5GZNA 4U3SA 4HLZG 5DRXB 3ULUF 2G3XA 3STZA 2YD5A 2WLIB 3HUJF 3QORC 4M00A 1MNNA 3FUIA 3WFEH 1I7ZA 1JTPA 4BFKA 5IGXL 2PYEE 1IQDA 1I31A 2OTUA 3CHXA 3HMWH 3KHOA 1E5CA 4OZHB 4IGBC 2WBJA 4A39A 5AALA 4B5EA 3TIDB 3RTQB 3X11A 4R5TA 2EP6A 3DMMC 5CMAB 4WTQA 5KS9B 2AQQA 1EV2E 1U8IB 3NJMA 3O3AB 3VFTA 1PG7X 1CD9B 3DARA 1UATA 4BUMX 4KROC 1MJUH 2R7EA 4HK3J 1AO7A 3FHEA 4MS6A 5AEAA 3HNVL 4OZIA 2UY7A 1Z3GL 1HHHB 4FA7B 3JWNE 3T1FB 3P0VH 4K9EL 1UUNA 3L3OA 4O2CA 4PRHD 2JTYA 1N8ZB 1NPNA 4RH4A 5DCCA 4BFGA 1OGTA 4ODXA 3WE1A 4TRPL 3WDIA 4JM2F 2V8MA 3BH8A 1UZ6E 4PP2B 3PS6A 2AI0L 3CDCA 3QDJD 3WXVL 4A2GA 2EVGA 4Z7QF 3LZNA 2FL5B 1QWUA 3OKLA 3ZRFC 1G0XA 3UBXG 2C3VA 5D7JD 4XHJC 5GGRA 3Q8AA 4HOWA 4OZFH 5E2WH 4JO1L 1PX3A 4OVUA 4U6XB 3GNML 4OFKA 2Z91A 1SYVA 5FUZL 4WJ5B 5F96H 2YUXA 2JCCB 5FCUH 2WY3B 1A7BA 1QATA 3DSFH 4KHXL 1IEBB 4EI6A 3T3PE 5IHZA 2WWMC 4LVNC 1RY7B 1P69B 3AMKA 2VQ1A 1AR1D 2Y6TE 1JZ8A 3FQUA 1X7QA 1A7NL 4PRAA 5DRNB 3E80A 3PWNB 1CXHA 1ZHKB 3EOYG 3E2HB 4KGJA 1IZNB 1AIFA 3DXAA 4WW2F 3N9GL 5FB8B 4LAQH 5CBAA 3MGOA 3EO1B 3DO4A 4AQAB 2J20A 3NJIA 3OD3A 2Y7MA 4GJTB 3WTYA 4JM4H 4K5NA 1SGKA 3APCA 4YGAB 2Z64C 2QGEA 2FYVA 2UV3A 1OSZA 2P24A 1ZHBB 2DQHL 2UY6A 3RVXC 5HHOE 2K4TA 2R56L 3ARBC 3OMZA 4IIQC 3OLIA 4N86A 3PAZA 4P9MH 1VA9A 2DQDL 2NXZC 4ZFOL 3QXUA 2YRPA 3HLKA 3QRFM 1S78D 2D31A 3HFML 1K5WA 4AV5A 4OCXH 2X53A 2CHXA 3MFFB 1HL5A 1UACL 4LE8A 5I1DA 2VLKB 2F19H 4KQ4H 1YNLL 3V8OA 4TRPH 4L4VE 1PHOA 2Q76A 2EDTA 3QZPA 4EJ1C 3D9AL 3GZKA 5DMIL 1N0LA 2CCWA 2VIRB 4GSUA 1QFHA 2NPLX 2UWEA 5BO0D 1JNJA 3FSAA 4K5MA 5SV3A 2Q76B 2JJWA 4LL9A 2DRUA 2ZX6A 4GBXC 4OFQA 2MWCA 3BAYA 2E3VA 3IBOA 4LARH 3NFPB 5C3LD 5KSAD 2Y7SA 1IAII 2A9BA 1LP9E 2AERT 3G5VB 5KVDH 2A5UA 1U58B 1EUUA 3V0GA 2WMPA 5E7BA 5HVGB 1BM3H 2J71A 4WIQA 1CDGA 1ZK5A 1TQVA 4P5TB 3O2DH 4YSRA 1FP5A 3MGAA 4UV7H 1ZKAA 3LPFA 1FIGH 1EH9A 2VJ8A 4ZFZB 4HLJA 1YYMH 4H8WH 1M1SA 3NFNB 2OMZA 2N1KA 3NCJH 4KX7A 4NKMA 2AJYL 1DLHB 4L4TA 3QJFB 2X4NB 3AREC 2OP4L 4ZFZA 1NIFA 3MCKA 2QTEA 4YGVA 2J6WA 3OPZL 1OF2A 2W65A 5E24E 1DUYB 15C8L 2WCSA 3KLAA 5LWYH 1DSWA 4PR5B 4PMEA 1L9SA 1WF5A 5I15L 4P5KA 2XG4A 4HAGA 2BSBA 3SCMA 3ZBMA 1URIA 4PWIA 1U8LA 3VE0A 5MEPA 3MR9A 4PJGB 2ZG2A 3ZKMD 4PJ8C 3M6DA 3ZHLA 1MCKA 3AVEA 3BC9A 4ELMB 1AGEB 5A6LA 2X4OA 2OMVB 3MRBB 4PRDA 2YOCA 1AGFB 1XGPB 4XC1H 3A23A 3EDEA 2NSQA 2HJLB 4IM8A 4U6XA 3TIEB 4AKOA 4X6DE 1BA9A 3HN5A 1SM3H 3Q6GL 4QRRD 2AJUL 5C07E 4KJYB 3WIFB 4OV5B 4HPOL 3IE4A 2D4FA 3HG1D 5B21A 3ZTJG 5CCJA 2JJVA 3CU7A 3FT0A 4N8VG 3VD0A 5FA4A 4KTEL 4R2GB 4DEUA 3WDJA 3QXVA 4ZQKA 2VXTL 4WI5A 3ARGA 4C4UA 1JK8B 5T5FH 5I0ZA 4I1NB 2RA1A 4LSTH 3PF1A 4J8RB 1EANA 2R2CA 1Z7JA 3ATDA 5CJXC 1SOSA 3IT8D 5INCB 4PJIB 2I9TA 3O3AA 3PWLA 1IB5A 4X5WB 3QIWC 1XEUA 1P7QA 4K71C 1LWRA 4YHYB 1WUZA 4WGWB 1SMOA 4P2OB 4U1HB 3WBDA 4LEBA 3TIDA 5KBPA 1BG1A 1KB5B 4I3GA 4AQ1A 1YEIL 4EUPH 2QLVB 1HNYA 3M8OH 3GXUB 2VDOH 2ORBL 2Y7LA 1EEUA 1HFUA 3NBNA 2WLZA 2F58H 3LZOA 1V5JA 1DDHB 1CL7I 1X3DA 4Y2DB 5B8CC 4ZMVA 1WC7A 2XIIA 1INEH 5DEJA 3FQNA 1B2WL 2ZUQC 3CQQA 1CICB 4LCCA 5CD5C 3KCPA 1CK0H 2WUBH 4HU8A 3FB7B 1ZS2A 4PJHB 2PLTA 1F6FB 1NMBH 5KBNC 1PKQB 1ETZB 3PE9A 3N41B 3CHRA 5I74C 4TV3A 4ZS7H 1KULA 2IANA 3SDDC 2ZICA 1OV8A 3H85A 3B7RL 5DUMH 2YD6A 1QSEB 2DQJL 1UB6A 1QBLL 2CJ3A 3QUXB 2APSA 5IQOA 1FZMA 2IGTA 4IIZA 4HWEL 3SD5A 3FB8A 5I1LB 1I1AC 4PJFF 1YPZF 3L3IA 3LN9A 1Q0XH 4XB8A 5K9KA 5A3ID 5D5MA 1YPZE 1KYAA 3NZUA 1KFAH 1Q0YH 3F7PC 5B39A 1YMHA 3OKEB 4MZIA 3REVA 2V2XA 5IFHL 1UXWB 4P9HC 5DVOA 3GO1H 1OGAD 2ERJC 4XPHL 5BV7H 3NZ8B 3EH3B 2F1VA 5ANMB 3VCLB 5BOJA 3GS0A 2PTVA 4K3JL 1QA9B 1N3NA 2LT9A 3Q43A 5CEZE 1FL3B 2EEBA 1CXLA 2K4WA 1PS3A 5DRZA 1KYDA 4QDGA 3SBRA 3OMIB 4KHXH 4GMSL 1QBML 4U1SB 4H8PA 2P8LB 2EO1A 1M3IA 3II1A 1NKGA 1YEGH 4M03A 3BLKA 1IC0A 2R1WA 3UYOD 5CD3B 2Z34A 4YH6A 4H20L 2O61A 1IAMA 2A4CA 3ZL4H 2COVD 3J07A 5DL7A 1FO0B 2BVUA 1J87A 3ARFC 3DVGB 4OI9A 4FOMA 5C9JA 4KK6D 3F7VA 3LB6C 3IDGA 4CBZA 2QMJA 5B8CB 2FEJA 3O2VL 1LM8V 2OL3L 3OJDB 4XCYA 1HX0A 4HUKB 4KNTA 2EECA 3U9PH 4MZRA 2ZONA 4UAOB 4JRYB 2E9GA 2J8HA 3PPSA 3QFJD 4IRZA 5GGVY 2HT3D 2CO6A 3UTTE 3TJEL 5IROC 5D4JA 4XAKD 4EDXB 1C16B 2CLVA 4JO2L 2X88A 2W1NA 3GJFH 4JKKA 3DI2B 3QUHA 2F9BT 4MMYA 2R4OA 2VAAA 3VACA 2FSDA 3X3GL 4YC2C 1Z32X 2J5LC 1E8ZA 2HYMA 3D69B 4JPSA 1I7TB 2ZUSA 3TA4D 5EOCJ 4F9LC 2IAMC 5IYUA 1FNLA 2MHAA 5DJAA 4N90E 43C9B 5AAPA 1CLOL 4KUZH 1PZ5B 4AGPA 4XCFH 1OE3A 1WIPA 4I88A 1CIUA 3X2QB 2FD6L 1JUFB 5D6CB 1V3LA 4M43L 1S5IL 4KNSA 2XVGA 1W72A 4M93B 3HZVA 3STLA 1P7KB 1OP4A 2KZKA 2EYSB 1CFNB 4POUB 1IGYB 3MAWA 4A6YH 3VXTA 4CKQA 4UOZA 3SO5A 2MOGA 5CZXD 5TJWK 8CGTA 3O9WD 4OZ4A 5IW3A 1R0AL 4AENB 2QFPA 3MV9D 3UBXB 1FVCA 3T0VA 5IM7A 1K3IA 5D9SB 2YXVA 5LNEA 2KH2B 3HCVB 1EGJH 3V0WH 1CYGA 2IV8A 3B7SA 5FYLL 1C5DA 1I53A 1R5VB 1XL6A 3QO1A 5ELIA 4EUPG 1DQLH 3F83A 3LIUA 3MCLL 1JHKH 5J6GA 4IOIB 5ANMA 3T0XA 2E86A 2QQLH 1S9YB 3VXRE 3PABB 2CK2A 1Q9WA 1S78C 3PAVA 3REVB 4ONHA 1NIDA 4ZMWA 2E7LA 2L7UA 3FBKA 1Z9SA 2ITDA 2TSAA 2VC2H 2ZQKA 4I0PB 1A7QL 4G7SB 4LCCC 1A64A 3F00A 5TH2A 1E2ZA 1CDHA 2WWKO 2IG2L 4P46A 5IOKA 3IGKA 5LWYL 2JVUA 5F70A 2ODIA 1W8EA 1P4UA 5CP7B 1PX8A 4P5TD 5ACZB 4OF7A 3WFZA 4IEFA 8FABA 1NEZA 3QUYA 3F58L 5DK0A 5EG6C 2DIBA 4JHAH 5B1CA 4A67A 2CBOA 3HE7D 2ENYA 5I1CL 4OJAA 5DJYB 5DZ9A 3PDGA 4ZI8A 1EVUA 3BP6A 5AW5B 2Q8BH 1N6VA 1MCOH 4TNVK 1OAKH 1ZHLB 3O11B 4FQXD 4MJIE 4F2MB 2CPCA 4PLOB 1DCLA 4LDCA 4XO5A 5D7LE 3K72A 1BYPA 1N64H 4UZUA 3LQAL 5F9OH 3GMPA 4X0NA 1Y7VA 3EDFA 5BV7C 4M7LL 4QD2E 5MEND 3PP3H 4JQIA 3S5LA 1JV2B 1BOGA 1LQBC 2GSGB 4A2DA 3S6CA 3VWJB 5MP6L 4D9RD 1MCBA 3MLXH 4CMHB 5ESQA 1D7CA 3ZYZA 1GGCH 2DWDB 3W11D 5BRZB 5EOQH 3BP7A 2ZXAA 2MKWA 2JCCF 1EA9C 2X40A 3NAAL 4KOBA 4BV1A 4JGUA 2DIEA 4GW4B 5ENWA 4RFEA 4Y0GA 1N2RA 4LP5A 5I71B 1SJHB 2XA8H 1BIIA 1ID5I 3W0WE 3PV6A 4OM1L 3SE6A 1FVEA 4Z7OB 5AVZB 1HZLA 3KWUA 3MLUH 5FO7A 1SMDA 3WIIL 2BK8A 3QIWA 5EZOL 4PSPA 4TPRL 3ZZ1A 4YJZL 1JGVL 1VENA 2V2TB 1AH1A 4NO5B 4KAQH 5J13C 4WWKB 5GJSL 4M6AA 3N85H 4NQEE 1IGML 4IBVA 2IPUG 5LJYH 1HCZA 5AW7B 4HZ1A 4E9QA 1B0RA 2Z31D 2MNJB 3SZKC 5IJVA 3LEXA 4HFUH 5ISZD 4ZUSB 3D05A 4NRZA 5ERWA 4OFIA 2IPUK 1N4XH 4GT0A 4YDIH 3AU0A 1TEFA 1EEYA 5IJDC 5C86A 2RCSL 2MTPA 4ODHL 2ZYSA 3UH8A 2F74A 4LXFA 3MVSA 2KDGA 2XXGA 3EYFB 2VN4A 1RVFL 4S1QL 3MR9B 1HH9A 5DEGA 1MZZA 5IHUH 1U6AL 4PJ0O 5DJ0A 1UD4A 4LDEB 4PI0A 4QHLB 3NIDB 4MD0A 2APTA 5T1LD 2DQHH 4RLBA 5TF1L 3QQ9D 1JGIA 4FA6A 4PWGA 2EC9U 1WLHA 1OTTD 4LGSB 1MIEL 2Y06H 3VGDA 4AKQA 3EZ8A 2I9LA 4ZUTA 1M7IB 4NZ8A 1NGZB 1KZYA 2ZX7A 3F3HA 1K8DB 2Q2LA 3TBYB 3HN8A 3P11L 3UYPB 1TR7A 1OT4A 4KOCA 1J1OL 3H42L 2B14A 1LO5A 3QQDA 5D7JB 5E8EA 4FQHA 5D1XC 1EJ6A 1MCNA 4G7YH 2IGFL 4GRWE 3DVGA 4WW2A 4XVUD 4DVBA 3MLUL 3ILQD 2UZXB 3QRGH 1J5OH 3QYNA 4P04A 3MRQA 5KSVB 1A1OA 3ARGB 3IKCA 3RWIA 3WNIA 1JPEA 5C08E 4HCIA 2Z31A 4Z7QB 5D9SA 3MRIB 2X7LA 1B9ZA 1R17A 2R0KL 4H26B 2NNCA 4PB9H 3D9AH 4PRPE 2AF2A 1SUHA 2WQSA 4MA8L 3RWGB 5BS0B 3ECBA 3TC9A 1WS7A 4HC1H 1NAMB 4HKZB 5CIPH 2VMCA 8PAZA 3MYZA 2YFOA 1QUNA 1SEQH 5J13B 2XETA 4X4KA 2WBJD 3GXDA 2C1OB 2UYLB 1TZIA 5GGTL 2EC8A 3N50A 2UZIL 1JVOA 3MXWL 4HT1L 2A83B 5KBLA 1SRDA 3MUJA 1DBAL 3O2DL 1USZA 4BUQA 2NW2A 4UV7L 3C60C 3UJIL 5EZOH 3GUFA 3RWHA 4RMTA 5HI4D 1SJEA 3BKMH 3BPOB 3KLAB 1GGUA 4AIXA 3BS0A 3WEXA 4HOMA 2DL2A 3OAUH 5MENA 3QEQD 5T5NF 2VO8A 5ILTH 3SODB 1L7IL 1HVXA 5GHWL 3VWKB 5J9PB 1VPOH 5IVXE 5D7EA 5JPNB 5EWIH 3AUVA 1ILSA 4UILH 2ATPA 4JREB 4ZFOB 2ZUXA 5IVXF 5CGMA 4UQBA 2EVIA 1YEFL 4ZPTB 3SYQA 1YDPA 5ESVB 3ARRA 2Q20A 4XC1L 5HYEA 3QXAA 5DRNA 3OKNA 1JGLH 4XVJL 2Z8VC 1J88A 2CDGB 3TVMC 3ZHDA 2EDEA 3BQUB 4OW6A 4KHTH 2XKNA 3MO1A 4A7SA 4O3WA 3QHFL 3EDKA 4LF3A 4NNYA 1MEXH 3WKNA 1UG9A 1N3NB 1NCWL 3W38A 1A4CA 4MA3A 1N0LB 2K7PA 2EICA 5AVUB 2R0ZH 4Q6KA 4JO4H 3WFHA 2ID5A 5E08H 4N87A 3H6JA 4OJCA 4JVUA 4KJWC 1MJUL 3JT0A 4MNGE 4H0HB 4PJAE 4AMKL 3BZDA 2PO6C 2V6HA 4M1CD 1CDIA 4JUSA 3S3CB 2NY5H 5ECJE 1NBYA 3GMRA 3NP4A 4NKDB 3RGBA 3VTAA 4A7QA 3SDDA 5CBEA 3MA9L 1GVIA 5AVXB 4DKFL 1OLLA 5AKSA 3ECQA 2X4SB 3D0VA 4NQXB 4PWEA 3O6KL 5IQMA 1HXYA 2KXPB 3UO1L 4LB8A 4IRJD 2G9HB 4FYTA 4LPWA 2BO0A 1HAUA 2WZ0A 4FQPA 1RSFA 1WBZB 1F90H 1NAMA 1AZZC 4HKZA 4LFHD 1FFNB 1OQOA 1Q94A 2KHAA 1T20B 3GNMH 2QEJA 4FZEH 4XRCB 4TNWF 2P80D 5IESH 2MNHA 1QI3A 3QNXA 2F8IA 1L6ZA 1AGDB 3HS8A 4KWUA 3PGCB 5DHEA 3L9YA 1A47A 2YC1A 3EYVB 4PU2A 4AK1A 2WUBL 1GC1L 4TSBH 1U8KA 3CV5A 2DLFL 2EE3A 4EI6B 4WWKD 5I1EH 2Y7QA 4HAFA 5EN2A 3LMJL 2X2HA 4FNSA 3IB4A 4FS0A 4OCRH 4KKPA 3VFNA 5E8EB 4M7JL 3KS0H 3P4MA 2N3JA 3EDDA 4Z18A 3U36A 5AFUL 1YY9C 2PWGA 5JW4N 3GK8L 3I50L 1SXZA 4QRSA 1J7VR 5MHSE 5KBKA 5IKCB 4S1DC 5TDNA 5JO5A 4XMVA 3ZMEA 4MJ5A 5GGSY 4EUPB 1LO3L 1GGYA 1MIML 4KVNH 3SQBB 1QSFA 3CDYA 3GHEH 5GGUA 1R3HB 3U2IA 3NK4A 1ZE3C 4ZQKB 3V4UH 1A6WL 2NY7L 3FTUA 3D4GA 4LLDA 3CN3A 4N24A 4N2AA 3D09A 1R33A 1IAIL 3FTWA 4QTHB 3NFSH 4KZEH 5KBDA 3TTYA 1H15B 5C0EB 1XBRA 1RJLB 5T1KA 5IW6A 5HHNA 4OD1L 3G6JF 5I8KH 2ICWJ 4X6CB 4AEHL 2QR0B 3BGAA 1KN4L 1M1XA 4HIIA 2VQUA 1KGCE 1XMWA 5JIMA 5JZ7C 4F3FA 5FYLD 1A6ZB 5JDPA 4DQOH 1A8ZA 1MRDL 1O6TA 2G9HA 4X50A 5ESAB 2XTJC 3WLWC 1ASQA 1I9IL 4NUGH 5E00B 3DRQA 2OA9A 1QI5A 4HA1A 4XPTL 3QRBA 4N8VB 4O2EA 1S9WA 3Q5OA 2FEEL 4LKCA 2XG4B 5IVZB 4WFGE 5HDBE 1FNEB 2AGJL 3GBDA 2K0LA 1JL8A 4TN9A 3G5XA 5B66O 1GGIH 3BD5A 3FRUB 2BSRA 3QEGH 4GAJH 5C3IA 4YGVB 1WEJL 1YAZA 5FHBL 4UUJB 3V7AG 5IREA 1MPFA 1YJDL 1QO3B 2ADFH 4N5EC 5F9DC 3D3VA 3V52L 5GSRA 2E76C 4L3EB 1AS7A 1NWPA 3V9CA 4YDMA 1DN0A 3D25A 4FADA 3QNYB 2VDRB 1NMCC 2EDLA 2VR9A 4R0LC 2BP5M 1PZBA 4N9GA 5CGBA 3O45A 3GHEL 3DRTB 3WFEL 3BUBA 3EYSL 1OO2A 1FPTL 4ABUA 3AWEA 4HHAA 4XMKL 1H8NA 4C4BA 5T33L 4LSRH 2X2YA 2VDMH 4P4KC 2WYZA 3RBSA 2QTVA 2Y1ZA 4TSBL 4JO3H 1SN0A 3K2UH 5E5MB 4JM2C 4PJXA 5J5EA 4HZAA 4EQ2A 4XOAA 5DA4A 3LZFL 2JLLA 2AAVA 4YPJA 4JY4B 1ZHNA 4N4YB 4C8XA 1SN5A 2VE6A 3AG4B 3HIZA 2DMKA 4F8NA 5JW3L 5CCKH 3A67H 1H5BA 2LU3A 4MBRA 5FW6A 2DLHA 4DP9X 2YMTA 1MDTA 2GHZA 4P8QA 3U83A 3VA2C 5EIIA 1F00I 3QFJA 1UWEL 2XA3A 3A4EA 2IQ9L 4BKTC 3GS7A 5C8JA 4TLUA 4JZNA 3N0PB 5TH2B 1KIPA 4G6KH 3QRLA 4PJ9D 3FB6A 4JANB 3IDMB 2FO4A 2OV0A 3AAZA 3FO0H 4HGWA 1N5YH 3RVWC 1FYTB 4GBXA 3X12A 4K3CA 3V2AR 1DJZA 1WPCA 1LO5B 3ZKSD 3VE2A 5HD8C 2IG2H 4JFEB 3CHPA 4YK4B 2H8PA 3ECBB 4FSPA 4OCNC 5FUZH 5J3HC 3SKOB 4L3ED 4M9PA 4RIRA 3L3KB 1ODUA 4ALAL 3OLEA 2J72A 2EIMB 3C5OA 3LH2H 1DVXA 2X7LB 1O6SA 4FP8L 2DTMH 3D1MC 3L6FB 2W38A 4W70A 3QUKA 1MCOL 1X7QB 5C0BA 5MHSD 2P3YA 1U8PA 4YPGB 3TEWA 4PV8B 3K6SB 1MCJA 3EDJA 4XZUB 5CILL 4U7MA 2OCFD 3OZ9H 3BHBB 3VGGA 1I7UA 4M1CC 5CSGA 4PREA 5D6CA 4OGYH 5EZIL 3RP1A 7TAAA 2FJHA 2XZCL 1ML0A 4PJ8A 2KUTA 1G1CA 2WCPA 2NY3B 4KTDH 4QRUA 5ANHA 3GSOA 3JZYA 3MLWL 1OCWL 3HLAA 4YQXH 4MHHG 3UAAA 5JW3H 5F3HA 3VFOA 1J9QA 2X87A 3QDGD 4Q9CA 5JHDD 4J3OD 4Y4KC 4X8XA 2MJWA 4WAFA 3H56A 3AAEB 1G6RH 3LV3A 5BVJA 2D7NA 3FS9A 1GFMA 2QPEB 4C56B 2AZUA 1KCSH 2ROXA 1EFXD 2WKGA 5KEZA 4K94L 4XX1G 2BNQB 4PTTA 1HHIA 4HSCX 3PHAA 4P57A 4PJXF 3QH3B 1IAKB 3TOPA 3PABA 3IDGB 2X5PA 1S7QA 2XSKA 3UTSB 1H19A 1YSOA 4LCVA 5IBLC 1B6UA 4N0UB 5C92A 4UT7L 5H35A 5KSUB 3TT3L 5DSCA 1HXKA 1OK0A 1N4XL 4YDIL 3HI6L 3KPRD 1IGJB 3SO3C 4EN3D 5IMOB 2WCGA 2FIKA 5JZ7D 1XH1A 3STZB 1UC6A 3DSNB 4POZC 5HHQA 4J3OF 1MHEA 1QVOB 5AFAA 3LDBB 3QEQB 2QQKL 1R9FA 5D7IB 1EUTA 3W56A 1ZSDB 4PHXA 4UQ9A 1T22B 2B59B 3CFJA 4HKBA 2CR6A 2OL3H 3VRLE 1FYTA 1BYNA 1TYJA 3F6JA 5LXVA 1OTSD 1NGZA 4F7MA 1RL1A 4Y2LA 1PFOA 4GP5B 4WF7A 4IGBA 1MQKL 3G08B 2WXRA 4OFYA 4PD4K 1J1XH 4NAQA 4PWKA 3QUYB 5DK0B 2BS9A 3ENEA 3O2VH 1JV2A 3W9EA 3O4LE 4TQEH 5DD6A 3MUHL 4WK4B 3U7YL 4HS8L 1FCCA 4ZOAA 3TCLB 2P5EA 4Z76A 1HDMA 5L7XL 1UD6A 2CBMA 3H4HA 5TQ2L 1KPUB 1IBBA 5H94B 1WCBB 2DBLH 2DTML 4LHUD 4A2HA 3ILEA 4NOFA 2FJHB 3FONB 4PJ8B 4QRUB 3AQDA 3C5SA 3UMNA 5HGBB 4QT5A 4M43H 3BHBA 5JHLA 2F1BA 4OLWH 4OJDH 4F8TA 1NGXB 3AU1A 1E4HA 5HJ3A 5EOCL 2C26A 1J10A 1W80A 5C0BB 5DXWA 1ZA3A 1EVTC 1KN2L 3MNVA 1WFUA 2WZ6A 2XV2A 3P02A 1QQDA 5E4AA 5T3XH 4MNHA 2XWZA 1H0DB 4RAUB 2R1XB 4AQ8A 3WIHA 1ZJAA 1KCRL 3UAQA 3H0TA 2ZPKL 1CG9B 4PGEB 4PRHA 1GFPA 2QELA 5F8RC 1CWVA 3LPOA 3S5YA 1OD7A 1G7PA 5IMKA 1P7HL 4NP9A 4CW1A 3FQ1A 3CBRA 5C09E 1IGFH 5DMKB 4XNLA 1C7SA 2R29L 1KPVA 3BKCH 3CK0L 1NL0L 2BNQA 3HG1E 3RUGB 3B8YA 3CZNA 3KYOA 2XWBA 1CD1A 5E9DB 3KLHC 2FR4B 3AT0A 2CQVA 1U8OA 2Z35B 4IRSB 3D69A 3QUYD 4M5YH 2J12B 1W72H 4LNRA 1QJPA 3D39D 2NUTB 4P23A 2OZ4H 2F7RA 3HE6C 1NAKH 3DBXB 4J1UB 4L3FA 3U30C 1FGNH 1MCLA 3ARBA 5HPOA 1VZGA 4J3WA 5DQDH 2RAMA 1B2WH 1SXSA 3LNGA 4WI0A 2DI7A 2QGBA 1IGYA 4TULL 4P2OD 4OT1H 5I8EB 4L3CA 4M6NH 5T8IA 3GSVA 3GJFA 1R47A 3KNBA 1NDMA 4UDTA 4X98B 1EDQA 4WI6A 2R2HA 5GRXG 1PQZA 3O8XC 5JXAH 3N9GH 2EYRA 1LILA 3IXAB 4BK5A 2P43B 1SLVA 3FXIC 4WO0A 2R2BB 1MM4A 5KUMA 1YJDC 1W0YT 3LQAH 3QHFH 2WWMD 3CLFH 4XVSH 1NLBL 4YDVB 4UTAL 1JNNH 1TZAA 2K9FB 2MIZA 5IOPA 3P77B 3SE9L 4G8FB 2VZ1A 3O2WL 1SJMA 3QQ4A 3OKKB 4ONFH 3PJNA 1FV1B 2AEOA 4ELDA 3AA1A 5D1QA 4P9ML 3UERA 4FFVD 2WN2A 4MJ4A 2IQAB 1NSNH 3MCKB 3QC5X 3F62A 1KGIA 5AVQB 5PAZA 4I0PA 5CR1A 3AY4A 3COOA 2IPTL 3PL6A 3FT1A 3A0HO 3K6FA 3HFFA 3QJZA 4IBSA 4LOUC 1FAIL 3B9KD 1Q38A 4MAYD 3VFPB 4PWJA 4QJ5B 2X4UA 4FAAB 4KKAD 4QRPB 4XVTH 1R5VA 3QO1B 3E6FB 3BKJH 4NN6B 4YK4C 5IG7B 1JK8A 3SY0A 4AI7A 1G1OA 3SDXA 2HB0A 3IXTB 2OYLA 4ANWA 4TKWA 1F90L 1RUMH 2XXFA 2DMCA 2YEQA 2Y4SA 3QQNA 2CRIA 4KPHH 5FA4B 1EZUA 4XRCA 1S7XA 4X9HA 3RWJB 3VI3E 3KPQB 1EEZA 4R26L 1J8HD 4TTDD 5EO9B 4OD2A 1KBGH 3MGTA 4HHWA 1UFGA 1M1XB 5AVSB 4Y2OB 3W5NA 4OF0A 3QZNA 3BPLC 2MH4A 4BRJA 1H3UA 1UCTA 4WTZA 2KLSA 2HWZH 2OR7A 3WN5B 5GRVK 2XVBA 3V10A 1PTZA 1TJXA 3EH4B 1TZGL 4JFXA 4FNTA 1MH5B 5E4EC 3HMXH 2R88A 3QT2A 3MRDB 4JVWA 2C34A 1W6LA 3LKQB 2AXFA 2QZ5A 2NDFA 1QAWA 4MNGB 3S2CA 1L7TH 2G60L 4IBUA 2VCOA 3DIFA 4HP5A 4WEBL 4R96A 2VZTA 1OB1B 1KB5A 1C08A 1BQLH 3BZEA 1E4KC 3C5JA 4GRWH 1NEZG 4Y5VB 2XQYK 1QO3A 1F1GA 4HMCA 2ADGB 1CLYH 3C5ZC 4PJ7B 5C09B 5LG1A 1N10A 3VTTA 3GEWB 4ZXBC 3L3JB 3ZX1A 1KBBA 1MCFA 3RA7L 1KGUA 3B9KB 1BEYL 3PWNA 4J3UA 5IVZA 3O4LD 4JDEB 4M8RA 3QUKB 3D2UA 3OWRA 1ACZA 1LEIA 3B9KA 4L9LC 1UZ8B 4IRJC 4HWNA 4XVSL 3H3KA 3HOGA 2P26A 3EFOB 4OLUL 4HFWB 2ZZUT 3FB5A 4QXGH 5C9KA 4FZ8H 3RVUD 5ISZA 1YEKH 1FL3A 3WKYA 3S3DB 2H8PB 4I0CC 4KMTL 2MQ3A 1QFWH 2FQGA 2CNZA 1O7DE 3V95A 2X6CA 1XGTB 1ZS8A 4JMNA 5J8OA 2FL5A 4FEIA 2WSDA 1IM9A 3GJFK 1FNAA 4HUUA 1OWRM 4GQQA 3NPZB 2IMNA 2KERA 1X5LA 5IMLB 3F5WB 3SYPA 1RURL 5E2JA 4R4ND 3T8XA 3MJWA 4KKAC 4G9FB 3ZIMA 1YUHA 1KBWA 3QIWD 4KK8C 1X4YA 3PXHA 3WE6B 1RJZB 4LSSH 4U3XA 1N59A 4K7FB 3T6VA 3VFGL 1UKSA 4H13C 3L2LA 4KVCH 4U0RC 4B3EA 1E6JH 2VUKA 3C6EA 5DLLA 4XP9H 3TNMB 4BZ1L 1KJ3L 1KXVC 5FYJU 1YA5A 3KBPA 4HD9A 4LLVB 3T0EA 1PVHA 2Y23A 4I0PD 4LHJB 1OT2A 2R83A 3MJ7B 4FXGB 2GCYA 2AI0H 1RZIA 2BW5A 2D7OA 2IFFL 3NIGF 3DK0A 1E5AA 1I7ZB 5MERA 1U92B 3I6LD 4JR9L 1UJ3C 3NSGA 1QSED 4JZOA 5HHXL 3ZJAA 5DDHA 3QC6X 5JHDE 4F33B 3AT9A 5E8DL 1IEBA 4HUVB 1YNTF 3ABKB 4DVBB 2ZX5A 2RFXB 2NX5B 3Q8BA 3TV8A 1FRGH 2HAZA 4D0BA 3RJOA 1MFAL 3SB3A 3MV7B 1IC7H 2EAEA 4EF3A 3SPJA 1NMBL 4DGVH 3A67L 4HWEH 2VLME 1U30A 2VDNL 2J57A 1DVQA 2ZIDA 1Q9OB 5LBGA 4M02A 1NC2D 2X6UA 2IEPA 4Q58C 2P5WD 4B53A 4ZXBD 4DN3L 1SJEB 4MKTA 3K71A 5DMJB 1BJ1H 1UWGH 1BMZA 3GXNA 3FCTA 1YECH 2JB6A 5EV7A 3WTVA 3MBEC 4Y5XB 4PJFA 2E6QA 3EGDA 2TRYA 3I9IA 5DD1H 2Q0ZX 1XO8A 2V5RA 3SZVA 1ZCRA 1JTOA 1QTYT 3LS5H 3MPCA 2HSIA 5LGHL 3IETA 3JWDC 3LH2L 4UTCA 5F1SA 1GGBL 5D5ME 5BNXD 3ULUH 3UPRB 1MVUA 4NCDA 1L6PA 5TF0A 4WTWA 1UH4A 3LRLA 4RX4D 1HL9A 1KJ3H 3F65A 5F6HJ 2IDCA 4ELKA 4LP8A 3WJMB 1P5VB 4RBPK 5DJ8A 3U1SH 3VXUA 2G5UA 3CVIH 4X5QA 5SX4H 3HR5A 3TBVB 4WFFE 4F37K 1ZHKA 4AKRA 5E8NB 4QRPE 2V2TA 2IWEA 2YZ1A 4R2GD 1FC1A 4B7IA 2FGZA 4KKRA 4ZTPH 3TT1L 1RIHL 4OCWH 4PR5A 3GLZA 4Q6IC 4O51B 1JZ6A 3QS3A 5HDWA 4DP1X 1MQ8A 4QHKJ 4QXTB 3T0ED 1DVFA 3KYNB 1KLUB 2V2WB 1I85A 4A7TA 3QJOA 4ZO9A 2XQ0A 2CK0H 5D1ZA 2XN9D 2DWXA 5DMKA 1OSPH 2ADGA 4MBOA 5FYJD 1QR1A 4GY4A 2J1NA 5DT1L 3QJSB 3DDFA 3LN5A 2A9AA 1UT9A 3RIFF 4UTBH 3SPVB 4NCC2 1OM3H 3TPUB 1BFTA 4JREC 3F05A 1FAIH 3AWGA 1S5HB 5CLYA 1AKPA 5IIEB 1WZLA 4KXZI 3GUTA 2PP8A 2FWSA 5ESQB 4X2UA 1EMTL 1RJZA 4TS6A 2J1ZA 3TH4T 2EE6A 4Z6AT 3FRPG 2YO3A 2J4WH 1P6FA 1JPFB 3RDTD 1E6OH 1U92A 1AO7B 4OZIB 3L3HA 5DHXB 4B5ZA 35C8L 1CLOH 4KUZL 4BBWA 5E6IC 2P8MB 4R7DA 2LLGA 5H2BB 1XGTA 1ZS8B 4BE5A 3KMDA 4HJGB 1ZEAH 2FZ3B 2UWEE 2DQGH 1Y18A 5CO1A 1RZJH 1RZPA 1MFAH 2GG1A 4X4ZA 4O5LH 4PJDA 3AA6B 4JCLA 4R4BA 3UAFA 1DBML 4LRIC 4EEEA 2WXPA 2I60L 3MDJA 5FOBB 3OL2A 4OI7A 1PRNA 1MJJA 3W9EB 1TXKA 2OCJA 2EIEA 4G6JL 4L8CA 4JFZL 2YSSB 1R3JA 4IOFC 4IK6A 1ZT4B 1F0LA 1DVTA 1TCRB 1A5FL 4MJ2A 4XPFH 3QUXD 2XICA 4YFLF 4TF4A 3R7RA 4IJTA 3WN6A 2LFGA 2WXQA 1WAAF 4KK8D 5CEXB 1TIUA 3ES6B 4GG8A 3W2DH 4IKIA 4MCZA 4N2IA 2J3SA 3VXSE 1DL7H 1XH0A 2OMXB 1ZHBA 2UY6B 5EZPA 3N1QC 4G70B 5D2NA 3MRRB 4FNRA 3LZQA 3FQ2A 2BCMA 2CDEA 3DX7A 4HSQA 1HNFA 2BY2A 5FYKH 5GJTH 5ISZB 3VYPA 1NIAA 4Y9EA 2VLKD 1KTCA 4PN6A 2XY1A 4JHVA 4LCIL 1KCBA 3HB3B 4R0LB 2PN5A 2WVUA 1QBBA 4FQXC 4H2AA 2XCMC 5I19H 2NY2B 2EKSB 3TCXA 5HSFA 3HMXA 3QI9B 3MRPB 1T16A 3TNNB 4XP5H 3SPCA 1VACB 5F0LB 5FHAH 1UCBL 1HIML 1IGCH 2BHFA 2Q8BL 4HCRA 3WSQL 4M7LH 4U1GB 4DEWA 4M6OL 1IBZA 3PJSA 4I85A 1RHHA 3ZRSA 4FXKB 5I9QB 5DURD 2X89D 2XKSA 2KQMA 1ZEAL 2YMOA 1PZUB 1LMIA 4TSAL 1WYJA 2XV6B 1U41A 1C08B 3BZEB 3LZFH 4IQHA 3VXUE 1C9SA 3E9UA 2ZPKH 1TQCC 2XQBH 2C4FU 1M71A 5F89A 3FFDA 5DI8A 3MLZL 1F11A 5KSBB 4YNYA 4PRIE 5I76B 2R89A 3GD1C 1ZLVH 2EE0A 3NIFB 5GGSB 4MCYA 4LGPB 4CC4A 1EMTH 3RY4A 4F7MB 1KTLA 1R3LB 1P7QD 2A74B 2GSMB 2WK2A 3INUH 1TDQA 4UIMA 2DI9A 4P9HL 1BVLB 2GJRA 3QUZD 5D7IE 3SOBH 4NQDA 3RY5A 1CTMA 4WVRA 5E2WL 5I8OH 4XWOD 5FGBC 2ARJB 1TVBA 1WUNT 4RFNB 4I2XB 5KAQF 2CSPA 2AXGB 3FT2B 1MRFH 4NZJA 5J57B 4R97B 1KOAA 3F7YA 5F9JB 5IB1B 3MZGB 3HCVA 3AT8A 5FXCH 1NCTA 4HAKA 1XF2A 5KJRH 4GRMB 3B3IA 1Z2KA 4N0UE 4FQCL 3IWVA 4N2FA 3NCYS 5GGQL 4ZODA 1IO4C 3SGJA 1U95B 5G4NA 2V3EA 3OPUA 4NQEA 2PPEA 2HFTA 2OK0H 4WNQB 1VCBC 3QXTA 5I75C 3AREA 4RNRA 1NKOA 1D6VH 3KXFD 3GMNB 4ESKA 1VERA 1M7XA 1RK7A 2FH8A 1SHXA 3FN3A 5DFVD 1NBVH 1E42A 2AK4D 3ULVL 3UAJD 4KXAA 5E70A 5CZXC 1CGSH 2PPFA 2ICEB 4O02L 1KCUH 3VWKD 4BINA 4FI8A 5L8LB 3BDYL 3NDZE 3BVTA 1Z9OA 1T66C 1C12A 1U8MB 4JDZB 3P9LB 2BWQA 3KL3A 1QSEE 2MNUA 4NP4L 5JQ6H 1IBYA 1WBYB 3BRZA 2M1KA 3I6GB 1XH2A 3BAEL 3PP4L 5AL0A 3GLDA 2FR4A 1C5CL 5EFIB 25C8L 1JRHH 1XZ0B 4YXHL 3MCYA 2IDTA 4JFFD 2B1HL 3LEYH 4JO5A 4PTUB 1YQVL 4RJWA 4PJHE 1M56B 1MUJA 3X3GH 1INDL 5CJOL 4EXPX 4BFRA 4G3YL 2DAVA 1JGDB 2G5BA 1CLVA 1KACB 1QD0A 4DK3A 5HHQB 1ZD6A 3QI9A 2ZWZA 3AXIA 5J1SC 5HYJE 4CSPA 4WY7H 3QIBA 4BKLB 2A9DA 5IMOA 2WVVB 4MDRA 4MTMA 2IWFA 4N0YL 3CFCH 3DX9B 2VR7A 4AC2A 3JWDL 1MLBB 2I24N 1M9SA 4NQVA 3DROB 1WFOA 2IH1B 4RLCA 1ZV2A 3LRGA 4NN6C 1AR2A 1Z6JT 4Q6IA 5FCUL 3VI3A 5T3ZE 1TVBB 4X8GA 1ZLWH 3MLSH 1WITA 4FD0A 2BVQA 5HGBA 2OULB 2X4QA 1IM3B 1MF2H 3IFNL 4GKZB 3ZZSA 4DKEL 1CI3M 3ULUD 1OZTG 2CGRL 3SKMB 3VRIB 4ZMYA 2K4AA 3GXPA 5GGSA 2YD4A 3EJRA 1FZMB 3BSGA 5GZOA 4JKNA 2ICWA 2BH0A 3H9SE 2VB5A 4R3SB 2NTSP 1H0DA 4N2MA 5C08D 1A6AB 2YWYA 2K6YA 2VDQB 1S8DA 5IUCA 1H3PH 5DJ8B 2O5ZL 1B3JA 5BXFA 3O6ML 1VFMA 5IK3B 5AAMC 2OXHB 3JQOB 3PWUA 3PGSA 3AU1B 3FU7B 3HI1B 35C8H 4WSKA 1RZGA 5I1AB 1KIUA 4F1SA 2ZOOA 3EH5B 3V8CA 4X6BA 1E4JA 4FULA 2NX5D 2FJGA 2LTQC 3E7JA 2QDWA 3EADA 2Y1AA 1UACH 5CZKA 4ELMF 4P2QB 2YA1A 4P5MB 1S46A 3D08A 4ANVA 4ATTA 4ELME 5EOCH 2I7OA 1K2DB 5BS0E 4JKWA 4YLQT 3MV9B 4XODA 3V7AE 3GI8L 4ZFGL 3NCYP 4KQ0A 4WY7L 1EAJA 2YRZA 4R7NA 2R2EA 2DQUL 3M1BB 1JFHA 4C59B 1RD6A 4M7ZC 3HE6B 2YAOA 5GS3A 1SEBA 5AVWB 2MKLC 3POCA 5GRJH 3SKNA 3D25B 5JO5B 3A0OA 3LKPA 2AW2A 2E9JA 3IAQA 3ZDYE 1QR1B 4EVNB 4DFHA 4D64A 1IAKA 4P07A 1UH2A 3EZJB 2BOCA 2LTQB 1YMHB 3OKEA 1WWCA 3P4OB 4J3BA 4HUVA 3ZOAA 4UQ2A 5D2NC 1ADQH 1SZNA 4LVOC 3TBSB 5ITBH 2E5EA 1B6DA 4M8QA 3SEPA 2NY5L 1LL1A 5DDHB 4F33A 2CXGA 5A2FA 2WMPB 2ALAA 3IJSB 1X5XA 3FU0A 4Z7UA 1ZJBA 3OXSB 2NNAB 4G3YH 4ZMPA 5K59E 4R90L 4J2XA 4I13B 1RXLA 4CGTA 4KK5D 4P2AA 3HG2A 4F58L 1I4FA 4Z8FH 1SY6H 2DQIH 5MEQB 1RZ8A 2WNWA 2CZNA 3GMLB 2D7PA 3ILPA 5ACLA 5IVOA 1BF8A 5KAQG 4ZO6A 3BDXA 3CGTA 1HHKB 4I48A 4FRWA 4ENZA 5DLMH 5TGBB 5EZIH 2APFA 4ICWA 1YY8B 4J7RA 2XWTA 5IHHA 1OPGH 1DQTA 2G30A 4DJMA 5HXMA 3WTSA 3WLWD 2MHAB 5IMMB 4JM2A 3FO2B 4ISVA 4LGRB 1A4KB 1FE8L 3DJSA 1BQHG 1G0DA 2W5PA 2VLKE 4P4KA 1CPUA 1KTDB 1RZKL 2CJTA 1RZFH 3SCMB 1X6LA 1DQDH 2BDNH 3LKSB 4O3YA 2HJFB 3C09C 2CHNA 3U6RA 3MJ9A 4YIQA 1BAWA 1WV7T 4HKJB 3TA3A 3AM8C 3H6AA 3O45B 4AIZB 1SM3L 3Q6GH 4U7SA 4W1TA 2J6EL 3QIUA 1N0XH 4O4UA 2Q8AH 5BV7L 2X12A 1U6AH 3MRRA 4U1LB 3CMOL 4DW2L 3SE9H 4QXVA 4HUWB 3EO1A 1KJ2B 4AQAA 4BK4A 32C2B 3S0PA 1CT8A 3CDZA 1FO0L 4U1JB 5CIPB 3WTWA 5CLXA 2X9KA 1NSNL 4L5FH 4NQDD 1HHJB 5HY9B 4E5XG 2AQNA 4MX7A 5C0JB 3IJHA 5D1ZC 5BRZE 5ALCH 3MJGX 4JFXB 1A6WH 2E0PA 1T6VN 4NLAA 2VJ0A 1ETB1 2NQ3A 3QAQA 4RMUA 1XGUB 4IS6A 5GSVA 1KCLA 3L7EB 4GAFB 3SO3B 2BWDA 4U1SA 4Y7MA 3CHQA 2EXTA 5JOPD 2DM7A 1F45A 3TEYA 3EYQC 1PCXA 3MRGA 3VGAB 4Y5VA 1D6VL 3IFOB 2BIHA 1RIHH 4AC4A 3KDMB 4A2MA 4AYSA 3GP6A 1AGFA 1XGPA 1CFBA 1UOWA 2HUHA 5I6OA 1Z5HA 3FW6A 4G42A 3CSBA 2NNAA 3ILQC 4FI6A 1JYWA 1K6QL 2R0LL 5K9OB 1IARB 1JK9B 1MJ7L 3DTDA 3FC8A 2IALB 1T7YA 3FH7A 4M8QB 4Z7VB 3SPIA 3LKNB 3UZQB 4BFFA 1YG9A 3GMMA 4N1CA 3MNMA 2JELH 1UGNA 4R97C 1DUZB 1KIQA 2ERVA 1ETZA 2EEXA 3KXFE 1DVSA 5D72L 2OMZB 5CJQH 3ZR5A 1HS6A 4LF3B 4JFFE 4UUJA 3VXRB 4FQLH 1ACYL 1SQ2N 3GIZH 3MRFB 1NH6A 3QG7L 3TO4A 3G6JB 4Y4FB 5IQ7H 2VLJD 4MXWH 5T33H 2VR5A 5A2CA 2VW7A 3RDTA 3NGBB 4TLKA 2AS5M 4R7NB 4JFYA 2NOYA 3T2PA 3LX9A 5I16B 2ZKXA 2Q7YB 2F08A 4PLJC 4QOKD 1TYEB 1HHJA 4BSVA 5ESVA 5LBSA 4GIAA 1ES0A 4HYTB 3EOAA 2DQGL 4TVPL 1T20A 4PG9A 2GKIA 5DD0H 1BEYH 1JYNA 2Z31C 4QWWC 4EI5B 4XNUL 5FR3A 4NM8H 4YHNB 4KK9C 3BKYH 2HFGL 2V5YA 2F54E 5IBTH 4XPFL 3T6QC 1MFUA 2MPAH 4LLMA 2C4FT 4ZUWB 1MF2L 3IFNH 4KFZC 4YUEH 1XR9A 1GZQB 4IBZA 2C7FA 3BLBA 4DGWC 1FLRL 3G5XB 4O02A 4AIZA 5C6WH 4ZJ9A 3LNEA 5KTEL 4LLDB 4UB8O 3MKGA 3T0SA 2EXYC 4LNRB 7FABH 2F8VA 1XB3A 4HCFA 2WTOA 2NY2C 2O1AA 3ZDZF 2MPVA 4D0DA 2QHLA 3EYFA 4HOXA 4U2YA 4LASH 3T8XB 1KTKE 4TUKH 2PWFA 3VFRB 4XMPL 1G4RA 4YWGL 4MJIA 4NT6B 5B7MA 4B97A 2F7PA 4M8UA 3MV01 4W9GC 1NGQL 2VDKH 2WXLA 4KJYA 2VQ4A 4HW6A 5JIHA 1RULL 3EGXB 3FCUB 1QZNA 2HLFD 1E9PB 1T2XA 1FG2B 4OZHA 2X4PB 4Z7QE 1BZ9A 4J1UA 3TPKA 5EC1A 3OQ3B 2WVVA 5D55A 3NMEA 3GI8H 1WGVA 2BJML 2YPLA 3LEVH 2Z7ZA 4PJ9C 4QJ4B 3TBSA 3EW3B 5HHMD 3FU8A 1CO1A 2EJ1A 5B5EO 5IESL 4ZMOA 1YEDB 1FN4A 2YD3A 2XWXA 2JQYA 3HAEA 4LLWA 3ESMA 2ADJB 5C0GB 4MFHA 3IFLL 3IFPB 1V05A 2PO6B 5F3BB 3A4AA 3US9A 5F7EH 5TE6H 1HNGA 5GZNC 2WXJA 2AQTA 3OLDA 1FFOB 2JKRM 2MOVA 2OSLA 1Y1DA 4U1MB 3DX0A 4WW1A 1GGTA 3ESOA 4KJQD 1CDCA 3ML9A 4YHML 5IF0B 2BVYA 1N59B 1RFDH 5I1GL 1GJUA 2X0UA 3QULB 4YIQB 2L3BA 5CBEB 4PHZA 1YECL 3B56A 1T2QH 3WLBB 1KDIA 1G6RL 3KPRB 2VDRH 3TURA 1J9RA 2EDDA 2HVJB 3K2MC 4LEXL 2H32H 4Q9QL 1IEAB 4NN5B 4GO6B 4E41E 5DZOA 3BVWA 2PXYB 5FV2A 1NGXA 3F5WA 4PW4A 1QLRA 4F7EB 1LQSR 3GMOA 4Q6YA 3FCGA 2PPAA 5KJRL 3K19A 5E2VL 2C1PB 4WKXA 3V4UL 2EUWA 4N8CL 2CH8A 4KROB 5EZLB 1BH3A 1DQML 4FERA 4JG9A 4NQEB 4L1DA 2EDWA 1JPGA 3T8VA 4E0RA 1KIRB 1E28B 4B9YA 4A7GF 3WKQA 4MLIA 3P9MA 4FQ2H 3CD4A 5L2KA 3HZMB 4I18A 5F72S 1P2CA 4N0FA 5IFJB 4Q8BA 1D5IL 3VXMB 1CGSL 1CGYA 4O02H 3QJHA 5F1IB 5HY9A 2I32A 3FAXA 3SGDI 4PSRA 4RMRA 3ZYIA 1DVUA 2Y9RT 1WFJA 1NBVL 4IDJL 2QV4A 3F7QA 4MYPA 1TZOA 3L1FA 5L4IA 3K6OA 4JDTH 4NZFA 5FKAB 1A1MB 3A5VA 5C07D 1MHPL 5GRZA 4HPHA 3WO4B 2UX6A 1XR8A 3QEQA 3FTXA 3ZHKA 1M4KA 4KFMA 5CZRA 1WZ1L 3FO1A 1KTLB 2A74A 4I3SL 4N5UA 4G1EA 4OF5A 3QDHA 4AGQA 4F80A 4NQVB 5KSBF 3UAJC 4NP4H 2EZ0C 2CE6A 3CZLA 3SPHA 3VD2A 3HFMH 2GEQA 3C75A 1BOGB 3LK3A 2GBAA 4DEPC 4GUOA 1RK1B 2IDQA 3D48R 3V7MA 2TRHA 3E3QE 3DMMD 3KPLB 3QXAB 3F85A 3SE8H 1OT1A 4B96A 2PCPB 5BUPA 3I9GL 3VXTB 5E2TH 5FKPB 3MRKB 3QQ3B 5F2FA 4WWNA 2EVJA 2C3XA 4TVPD 5DUJA 2CUMA 2K9UA 4HEMA 4HJIA 3TO4D 1GH7A 4J6IA 1V3KA 1ZAGA 5J06A 4HC1A 1IEHA 3T65B 2W94A 1IKOP 1JZGA 3F84A 1KN2H 4FFZL 4P2RB 4GSDL 2B3RA 3JYCA 2ZWYA 2QQNL 3MLXL 1V7MH 5GS0L 4RQQA 1NL0H 1YEIH 2JKNA 3KLLA 3HLAB 1W0VB 4Q4EA 3LY6A 1JWSA 1CGTA 1UA6H 1T1ZA 2XACC 2GITA 3NUKA 3N1MC 3HJEA 5F71A 5TK4A 1I1YB 5D71H 3TYFA 4APQB 4ZMXA 3L5IA 3HVDA 2QKSA 2C1OA 5A3IC 3BYTA 4IMKC 1S9YA 5J11C 1UASA 3BCFA 3OAYK 4JPWL 2ATKB 2GJPA 5FW7A 2D8KA 1P4LA 3V55A 3GSQA 1FJ1B 3DGGB 3QARA 2FIKB 5L2KB 2H3NB 1RZ7H 1TU2B 2DPKA 3W57A 3BZ5A 1JDDA 2FATH 3OV6A 5DQDL 4BFOA 1U3JA 3KPOB 1YNTA 1GYWA 4D3CL 1JGDA 3BRGC 1S3KH 4M48H 3RPIA 1PAZA 2NLJB 3J27A 4LSQH 2G3MA 5EN3A 5A2KH 2XHNA 1ZHLA 3O11A 2VZ3A 4JJ5B 3UC2A 3ZSTA 4DOHB 4P23C 1N6QL 5JPNC 1QABA 3UTTA 2Y07H 3BIAX 4WKZB 1UJTA 4AKPA 1G9ML 3AS2A 4XP5L 2EUZA 4PJDE 3NABL 4WTZG 4FKHA 1INQA 3FHQA 1FCGA 1MCRA 3P73B 3WFDL 4CVZB 2FO1A 5E6UB 4P3CL 3RY6C 1SQMA 3QIUD 5KYUA 5TF1H 3GSXA 4JJHA 1KMGA 4XPBH 2XJKA 4C00A 4BFIB 3BUTA 4GW5B 4LZKA 4NJ9L 5JOFB 4P2RA 4MMZB 4TSAH 4OCLC 2BIIA 4NBXB 4YLBA 1L0YA 5GGVH 4Z7OF 3SDAD 4FF9A 2CPUA 2Q3XA 1KTBA 3ELAT 4FTVE 3U0TB 4LPYA 4W68A 3OF6A 3H42H 4NRXB 3BH9B 1DVZA 2JJTC 3VY9X 5JHAA 2YLKA 4X9YA 2IAMA 4XN2A 4PR7A 5T5FA 2HFEB 5L2JA 3AAAA 4JFPB 1U95A 1XSJA 4B0MM 3T20A 2CO7B 4XHJD 5T1LB 5KOMC 1A9BA 3W9DB 4LEEA 2WYTA 1CICD 1F97A 1BBJA 5DFVC 1TO4A 3VWJA 1JF5A 1JXGA 2N7SA 5IM7B 4W9ZA 5HJBA 5L9DL 3ZSSA 2OMWA 4NO5A 2JLPA 1OAYH 5B1JC 3JVGA 5C0CB 1IBHA 3N40P 1NCGA 3LEVL 4MWFB 3V6FA 1KTJA 2FIRT 2IDFA 2IGLA 3U46A 3ZTNH 4KDWA 1LP9F 2JCCE 5FGCE 2EYTB 2ENPA 4XP1H 3R4DA 1WICA 2BIQA 2NW3B 1MVUB 2FUTA 3U82B 4F9PA 2WC7A 1M53A 2R4LA 2OI9C 1UA6L 4PJIA 2LOEA 2EDMA 1KC5H 2Z6FA 4G5ZH 2OMTB 4URKA 2HUEA 3GB7B 4HT1H 2HPTA 3MV8A 4W4OC 4N75A 3MROB 5DO8A 3CZJA 3QFJB 3B37A 3HPJA 2YLHA 4E9YA 1S7VB 4UIKH 1BG9A 2MCPH 1T2QL 4KQ3H 4CC0A 1MPAH 3IMUA 5T3ZL 2VE6B 4NQQA 5DO2D 3FQWB 4G71B 4MMXA 3PUCA 1Q1JH 5E08L 1QLEB 1LE5A 4L48A 3F12A 1ZVYA 1ETA1 5IBUG 3IMWA 2BNQD 3LQAC 2ITEA 5ALCL 4UQ3B 3O2DA 3E9TA 1ORQA 4X4YA 1HXMA 1KJ2L 2JIXD 2O72A 1K4DA 3MREB 3OAZH 5D1XD 3VX1A 1S7UA 3ZLQC 1GMIA 2A9NL 4OGAC 3AMLA 5E4OA 2E8ZA 1CBVL 5EU6E 5MERB 1KGJA 3RVVC 3UTPE 2RMNA 2X2JA