3LK42

Crystal structure of capz bound to the uncapping motif from cd2ap
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
242
structure length
238
Chain Sequence
DQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQERTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of a capping protein interaction motif defines a family of actin filament regulators
doi rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
total genus 78
structure length 238
sequence length 242
chains with identical sequence 5, 8, B, E, H, K, N, Q, T, W, Z
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lk4201
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3lk4202
4AKRB 3AA1A 5AFUL 3LK2A 3LK42 3LK2B 3AAAA 3LK3A 2KXPA 3AAEB 3AAEA 3AA7B 5AFUK 3AA7A 3LK41 2KZ7B 1IZNA 2KZ7A 5ADXK 4AKRA 3AA6A 3AA1B 5ADXL 3AAAB 3LK3B 3AA0A 2KXPB 3AA0B 1IZNB 3AA6B
chains in the Genus database with same CATH superfamily
2WB5A 1T98A 2WWVA 3ZC1A 5G26A 3ANWA 4OX9T 2LRKA 3AA6A 1MIYA 3UU5A 2KNDA 4M1PA 4EYUA 2MTQA 5J0ZA 4F8HA 5LCYA 3AE6A 3PURA 1G90A 1MMGA 1D0ZA 4RL9A 1BR2A 2K24A 1Y01A 5FVLA 4PJJA 3CQXC 3P50A 2OA5A 4FRXA 2CWYA 4V1Av 3WAJA 5AQGB 4ZXLA 5HAXA 3T1HT 3GN5A 3IF8B 3PQSA 1SE7A 3ONLC 2PJQA 3SOLA 4IE6A 1FMVA 3SY9A 4PJNA 1UGOA 1HR0T 4GCQA 4U2YA 1BR1A 4DV7T 1N34T 1XDPA 4WNKA 3RPUA 2R88A 4N58A 3ZLIA 2X0LB 4ZEYA 2NTYA 2LLYA 4JI1T 3QRCA 3I1AA 3A0HO 4CI2B 3WAKA 2KZ7A 3KFWX 4DMWA 4FOZA 2D5UA 3W15B 1NENA 2I6HA 3UFEA 2ACXA 2K9AA 3K1SA 1FIOA 2IMLA 3AEBA 3PU8A 1M62A 3QC9A 4JI3T 3UU2A 3P4SA 5GONE 5FMNA 1GFNA 2W62A 4PUXA 2QGSA 1D0XA 1NWMX 2CWOA 2DCFA 5LA6E 2A72A 4FZMA 4N78D 4AYID 3BK9A 4PFOA 2V7JA 2I59A 5L3EB 3VRBA 3VZTX 3T20A 5EK3A 2NOXA 3MA9A 3JC6D 4E1SA 3AE5A 5CB4E 4H9RC 4YT0A 4YHHT 2FGRA 4ZHQE 4AYNA 3S4UA 4PK5A 5IHYA 1ZHWA 5HWXA 1E7PA 3AA1A 3J9X1 2CBJA 2UXDT 2FJAA 2XM2A 5JR9B 4ZI2D 2Q9QB 5AQSB 4MBQA 3KVDD 2X9XA 4GCPA 5FY7A 2XSBA 3N9NA 5FL1A 4CXXA 4AYDC 3RYCE 2Q9QD 1XWMA 2WM9A 4AKRB 4UF0B 2IC9A 1VCSA 3PUXF 4BUMX 3SYSA 2LM2A 3U3IA 5IYZE 1OWAA 2LOSA 5F8PA 3PF1A 4BJNA 4Z90A 5G3AA 2B1EA 4WBNE 3BQLA 5JRCB 2Y0KA 3I0QA 3FBLA 4QH5A 3P8CD 1WRDA 3N2KE 3QNUA 4JI2T 3WI4A 2X51A 3ETUA 2QRXA 5JRCA 5AQJB 4O4HE 4AKGA 2XJ7A 3Q9DA 4DR6T 4IGUA 4U9CA 4UEMA 2CXFA 4AKRA 2DLRA 4IDNA 4QXCB 3PDYA 3RKOA 8PRNA 2D9DA 3RX6A 2MOZA 4XNLA 2EHOC 3UAQA 2FJBA 5LBMA 3EI0A 4EGWA 4O3XB 2V5DA 3ZMTB 1HG2A 2XQ5A 1ZOYA 3ZT7A 2WDRA 2CBIA 2W0GA 4X1YE 2XG6A 4AQFA 4C4VB 4KR8A 1Z0PA 2LSJA 4FUVA 1KK7A 3VZUX 1WCRA 1N32T 4TNVA 1PRNA 2IDOB 4HEAA 1HS7A 1MIVA 3LK3B 3BRZA 4AFKA 1L0VA 2SPCA 4PK6A 4A97A 2X67A 2VVNA 2LT3A 4LFBT 2CXDA 1ZHZA 4LSHA 5KAFO 3I9WA 4U31A 4B3MT 4GKKT 3IHRA 3RQWA 3T1YT 5CA1E 3P7IA 3PJAA 1ZHCA 2UXXB 4UVAB 4ZZBA 2FJDA 5H6RB 4GHBA 4IL6O 3PGUA 4H9SE 1T7SA 3TLUA 5HWYA 3TLVA 5FNVE 3I0OA 3POQA 3HOEA 4DBRA 4TWDA 1BH3A 1ZHYA 1U4QA 4KX6A 4H9PC 5A1LA 4HFCA 3EDVA 5C2TA 3RRWA 2CMRA 3P4RA 2FBWA 5AFUL 5AQFB 5LGNB 1VCTA 4IDPA 4AZLA 3PGRA 3CPZA 2WZIA 5EE2A 2N1GA 4H9NC 3O0EA 5J2UE 1OPFA 1IJ6A 4X1IE 5AQOB 3OKQA 3AA0A 5DL6A 3UQ7A 3ZJ2A 2ES0A 1KEYA 2JQQA 1SHZC 1IBKT 5ABEA 5FKYA 4EV6A 3MZKB 4PJMA 3HKDE 5L3BB 3H3MA 4O3YA 2UUBT 4GF4A 4H63V 1MNDA 4CXYA 2V6YB 5AQVB 4EYYR 4KP3C 4U33A 1HG5A 1QLBA 1IBLT 3POUA 2DNXA 4CI3B 3DWNA 5LBQB 1HXTA 4NXMT 4HFIA 2W2UA 3PORA 1GFQA 4YFSA 1OEDA 4QQ1A 4MLKA 1JNZA 5DL8A 3QB5A 2AXTO 4ERRA 2BS4A 2XQ8A 5DABA 5L4EA 1YD8G 3HWBA 2D0UA 2LRLA 2L9QA 3SZVA 5AQIB 5GTIO 2J62A 4YTMA 4TV8E 2EHOB 2O4VA 4DO0A 4L5GA 4N75A 2X9WA 2MPKA 3AXJB 4DUYT 2W4XA 4DR7T 2BBHA 2MHLA 3ETVA 4K0UA 1X9BA 3WU2O 2LKHA 5CFBA 1ZP0A 2KWHA 3N9PA 3SYBA 1P4TA 3CQGB 1MIWA 5TAOA 5C3JA 2WAUA 3SFDA 4AYMC 3ONXA 2PFVA 1W09A 4TWHA 4WZXA 3M65A 2XM1A 2HH7A 3LK42 3LK2B 3RYIE 3JAEA 3P4PA 3AECA 4LF7T 2H7OA 1VRBA 3C4XA 2Z6EA 1XNQT 2JQKA 3AAAB 2IIUA 2X68A 3O1HA 2DHRA 2IAKA 4HWCA 2YNKA 4F6RC 2LFUA 1MMDA 4HFEA 3ZKRA 2E9XD 5JDQA 1IZNA 2UUAT 1GFPA 4FMSA 4HFVA 3NWIA 2V7LA 3RKGA 1WLXA 5AQTB 3PTRB 2WBLA 4FSOA 3A2SX 2Y7SA 5DQVA 4D65A 3ZPOA 4KHZF 4ZOLE 5BMVE 2XZEA 3V5UA 4CXWA 2VL0A 5LYJE 2J4GA 3LK41 2XPKA 3KZIO 3FBZA 1VOMA 5LJMA 2XMXA 2JQ9A 2W81C 1YKEB 2YU1A 5AQNB 2XTQA 2CEAA 2UXNB 4DVDA 4GK0E 4YY3T 1XNRT 4KHPT 2M07A 2X9YA 1OEDC 4U7IA 4CN1A 5PRNA 2KXPA 5JDGA 3MJXA 4QX8B 3GN5B 3RGLA 3C4ZA 2IWVA 3PE0A 3ZN1B 4Q25A 3NZQA 2PG8A 2F1TA 4NXNT 2NW7A 2WMNA 4UB8O 2ZM2A 5AQQB 2WZHA 3AEGA 1HNWT 3OPCA 4QXHB 3ZCIA 5M4YA 3EDUA 4JEUB 4DV5T 3AA7B 4DV6T 3UU8A 2YINA 2C5IT 4B3RT 4AKLA 4LFCT 3HL6A 1W9RA 4IL9A 4O4LE 4NUUA 3UULA 3I9YA 3CQCB 4UVBB 4RLCA 2VL8A 2XUEA 3UU4A 1BR0A 2PTFA 4UIGA 1YKHB 2F1VA 2E9XC 2NWBA 3FZHB 4YSXA 3NKZA 3PGSA 2KLQA 4LSIA 1MMNA 3ZT6A 4UV8B 5LNKA 4J2CA 2KXPB 2NW8A 5ABHA 3HR0A 4EZ4A 2WSSV 5JDHA 2C5JA 4H9OC 5HCMA 2CCQA 3ZT5A 3DJBA 3Q5DA 3FXDB 2HPJA 2XQ7A 5AQPB 3FHNA 4GCSA 1UUSA 2V8SV 2H89A 3KBUA 1D0YA 5DL7A 4JI4T 5T5FA 4E7SA 4L9IA 5FVNA 2AE9A 2CA5A 3N5LA 4JI0T 4JI5T 4QXBB 2X27X 4HWDA 2UXBT 1GFOA 5HEOA 5L3GB 1ORMA 3FYXA 2JPFA 4GK5E 4DBQA 3TLTA 5LJNA 4PJLA 2MAWA 4YHJA 3PU3A 4LF8T 4ILBA 4C90A 4IDOA 1PHOA 2V7MA 2LE8A 2WP9A 4FRTA 4LMJA 2E5VA 1HTJF 2DWKA 2XE3A 1X79A 4RJXA 5CGMA 3ZMUB 1I94T 3AA0B 1WYCA 2Y0HA 1QSDA 4B3ST 1KNRA 1FJGT 4YJ3E 3PUYF 1T16A 2XHEB 1G8XA 5H6QB 3JTYA 4JI8T 3R84B 4Z91A 2XQ6A 4DMVA 2F1CX 3X1DA 5LMNT 5LB7B 3HKBE 3V8UA 2Y48B 3HKEE 2ODUA 4EOZB 4CTDA 5EZYE 2X0YA 2W61A 2H7VC 1JNRA 2QTKA 1US7B 4IE4A 4JUYA 3SWHA 2XSAA 5JR9A 5FYMA 3VZWX 2JMHA 4PNIA 2VK9A 3PV0F 5H2FO 2V7KA 4G75A 2CHOA 2R8AA 4HKAA 2N9DA 3PUWF 1YW0A 5JDPA 3CWZB 2PORA 2QVAA 3KDSE 3LDQB 4PW8A 4WYVA 5LMUT 3JCFA 4P0AA 4KUMB 5LGTB 4TX5A 5L3CB 5HXSA 3F31A 1OXZA 2E8IA 2OV9A 5HXHA 2BG9E 4TN7B 2VASA 4YTNA 4P09A 2WMOA 3AA7A 2A9UA 2ZFGA 4ZI3D 2YOEA 3NBXX 1T8BA 2C0SA 4TUYE 2JQHA 3N2GE 1S35A 4U7YA 3K3QC 3VKGA 1IZNB 1S5LO 2V7IA 1LVKA 4I50E 4TWFA 3BQIA 3MACA 4B3TT 2HPLA 1HFAA 4TNWA 2V6XA 1N36T 4I0UA 3RF1A 2VURA 3VY9X 3F2EA 2CPTA 2J47A 3DWOX 4UVCB 2DI4A 1E1HB 4C69X 2WCAA 2QA7A 2LKGA 2WU5A 4HWHA 3JADA 3UUXB 4ASKA 1AJ3A 3D0TA 2BDEA 2VKOA 2XE5A 3RIUC 4D5UA 3N9QA 3P4QA 2W63A 2UUCT 3K3OA 4O4IE 3C4WA 4Z3TA 2CHNA 4X1KE 2YU2A 1IAPA 4LMLA 1W0AA 3LBXB 2M67A 1SUMB 1NAFA 3VHLA 2R6GF 2H3RA 3P4WA 5B66O 5FXZA 2BKPA 2LSGA 2D0TA 3PUVF 2V5CA 3AAEA 3PUQA 1QJ8A 1YXRA 3FZKB 1D1BA 3N9MA 4F4BA 3BS0A 2YKSA 3BRYA 1MM4A 4AISA 3IEEA 2LSYA 2LHNA 2ZLYA 4EZHA 2LEHA 3N9OA 3KV4A 4IIJE 4GOUA 5L3DB 2XAQB 2M06A 4AUIA 2YEVC 2GK9A 2XQ3A 3AAEB 5J2TE 3KV6A 2ZM0A 3IBPA 2ZMAA 2EHOD 2CE7A 4MFRA 3T0SA 1UK5A 4JBWF 4NIQA 3UFGA 2VVSA 1HXXA 4DV2T 5JDLA 2BG9C 3K3NA 4MHCA 4QX7B 4I4TE 5AQKB 2V6YA 3UUNA 5HEGA 4FZLA 3KVBA 1M7KA 1QJ9A 3AXJA 3AE4A 3RH3A 5LGUB 2EHOA 2ZLDA 2P9BA 4O2AE 4O4UA 4DR3T 2V1DB 3E08A 2UU9T 2WU2A 1ZHXA 3QB5K 5E0OA 3A8YC 2YN6A 4LF6T 4DV0T 5GTHO 5HEUA 1YQ4A 5DJQC 3C5OA 4AQFC 3TLSA 1LKXA 3AA1B 1WYBA 1NEKA 1T72A 3EVYA 4HTEA 1OEDE 4O3WA 1MPFA 3PRNA 4FQEA 2E9XB 4G2AA 4E7ZA 3AA6B 3VU7H 3FB2A 2J1NA 4O4JE 3UT5E 4ZS3A 2JIWA 3LBXA 4IE7A 4Z8XA 5LXTE 2MNHA 4LMKA 3VR8A 5C8YE 5KDMC 2LJLA 3Q5EA 3E0ZA 3NVOA 1GFMA 3AEFA 1XMQT 5LG3A 5JDMA 4IREA 3ZC0A 3VRAA 5AFUK 1CUNA 1XZYA 5AQRB 1KFYA 3AEDA 3DP7A 4NUVA 1H7CA 4ANJA 3UQ4A 3HW9A 4UXNB 4IE5A 1ZHTA 3RYHE 1BXWA 3QOFA 4JI7T 5AQLB 3H37A 1D1AA 2X9HA 3PJAJ 2LHRA 3VY8X 5FVKA 2DWGA 4ISSA 2XAHB 2L3LA 4EXTA 2JQYA 4O2BE 3UTKA 4RLBA 4YLHA 3HKCE 4CI1B 4A5XA 5FY0A 4YJ2E 4HFHA 1FMWA 3FZMB 2HN2A 3ZYKA 5E79O 5FY1A 2KINB 1ZV4X 2R4LA 3K8PC 4GKJT 3DA4A 4U72A 2BG9A 4JLEA 3O4XE 3QUJA 1HNXT 4HFDA 2N2LA 1T1LA 5JDNA 5EK2A 3J7Yq 5CJ5A 2BVLA 4AKMA 2KSRA 4O49A 3UUBA 2VKHA 4FZNA 2XQYA 4JI6T 5D5DA 2W66A 2XAFB 2VQET 4U2ZA 2K48A 2KDYA 4TZ4C 2WJRA 4FT6A 2RPAA 4BJMA 3C64A 2R4OA 1UURA 2XQ4A 4ZZCA 3NSGA 5HYAA 3AVRA 3TLWA 2ZM8A 4DV1T 3A7MA 2X0HA 3OYXA 4DNDA 4CQIA 2CM0A 3SFEA 4U74A 3ANWB 2JRKA 2VWAA 1B7TA 1GQEA 2YPVA 2NR4A 2H88A 2IC6A 3JAFA 4KRAA 2WJQA 3KBTA 3L3PA 3ZJ1A 4HFBA 1QJPA 3L09A 4X5TA 1EZ3A 1XMOT 2RP4A 5AQUB 3VE1A 3WI5A 2XTLA 4IHJE 2QYWA 1CHUA 3ZYMA 5IUXA 3OJAA 3CVRA 1V9DA 3PUZF 2WVPA 2K0LA 4QH4A 3L39A 3L8RA 2JMMA 4PJ0O 4ZI3C 4UB6O 4X20E 1WFDA 3MK7C 1SA0E 4COFA 3MKDA 1D1CA 3C51A 4HN9A 4EEBA 2X9KA 3ZMSB 4TV9E 1HX8A 2XQAA 1IJ5A 3FZLB 3OTOT 3N2OA 4EB6E 2I0MA 5LHHB 3H3AA 2C5KT 1MNEA 4DR4T 5EK4A 4FI5A 4QWNB 3AE9A 4KBMB 4PR7A 4UF0A 4C00A 4AYEC 4YSYA 3Q2MA 4JFBA 1KNPA 2CLYB 4AXPA 1KNZA 5F3JA 2LOPA 3SRZA 3RRCA 3UUMA 3C98B 3B5MA 4MALA 4EAHA 4FSPA 4JEHB 5BR8T 2J1DG 5JVDE 5L4HA 3ONJA 3LG7A 4BAYB 2WQYA 4NPPA 5HXCA 4G76A 3NRXA 3UU6A 5FXWA 1KF6A 2VKDA 4CN4A 3U78A 3DZMA 3KV5A 3UU3A 5ABFB 2A2FX 4FESA 5TISO 2WDQA 2YDQA 3QK6A 2K5BB 2IHR1 4QH1A 4OK0A 4HE8A 4IL4A 4CN6A 3AE1A 4I55E 5JREA 5JDFA 3TZGA 5JH7E 4IE0A 4ILCA 2YDSA 4WBOA 2R4PA 2XAJB 4EIWA 4HWIB 1FEWA 1QUUA 3UPGA 5HEHA 4O8SA 4H63H 3CMLA 1WR0A 3T8OA 2WY2A 5LOVE 1YS5A 4HWFA 1G73A 4K3CA 2ERVA 5LHGB 4QHOA 3AVSA 4OHFA 4X62T 3OBVE 2BG9B 3OVUA 4IT4A 3SY7A 3AB3B 1HXUA 3ABVA 5KMGP 1E2AA 3Q5XA 5J1GA 3LFMA 2NW9A 3IA3A 2F4VT 3ZYLA 2CRBA 3CX6B 3EHZA 4O4XA 1Y64B 4ISTA 4C4VA 3F57A 2XASB 4DR1T 3NJTA 2N2NA 2IWWA 4AI6A 1DU2A 2LSIA 4ADZA 2XAGB 3M3ZB 4L0RA 2A3DA 5L3FB 5DQWA 1ZEEA 6PRNA 3DA3A 4DV3T 4DIDB 3ESLA 3CX8B 2L8KA 4AQGA 4O3ZA 3RLFF 1Z8UA 3VR9A 3AE8A 3AAAA 3T24A 5LHIB 2AXDS 4XAXB 3FXEB 3RC8A 3ZEFB 4PFPA 5L2LA 4LSEA 2X66A 3DTOA 5IWAT 2ODJA 5LP6E 3C50A 5ADXL 1H6S1 1Q9FA 4G63A 3CK6A 2VKJA 3PUGA 5FP3A 5CA0E 2DL1A 2OMFA 4YXDA 2V26A 4UR9A 5KX5E 4I43B 2FJEA 2HHHT 4X65T 1HNZT 4IDZA 4D64A 3RIAA 5HXEA 1LRZA 4DUZT 3O9XA 3JC6C 4JCHA 1R8IA 2OLTA 3Q5WA 2BVMA 2W67A 3LJCA 5IYUA 3RHWA 1HX1B 5ETWA 3R6NA 3HOLA 3G06A 2FGQX 2BBJA 2LM9A 2KWIB 4XZCA 3POXA 4GIWA 3CKDA 4P1NA 4LF4T 2K3WA 2PRNA 1Q9GA 3QRAA 4GYRA 2HN1A 1OSMA 2KZ7B 2E2AA 4ZS2A 3RQUA 4UV9B 3AE7A 2M6IA 2E5LT 4PAGA 2R89A 2NTXA 5HCJA 4ZI2C 3GP6A 2E9XA 3ZMVB 3EUHA 4AIUA 1LVFA 1N33T 5LG4A 5B5EO 2Y8DA 3A0BO 2Y2XA 1S94A 4JV5T 3RBHA 3B57A 2MBGA 2KC0A 2XQ9A 3EAMA 2JMKA 4JYAT 5AQMB 1UX4A 5FXVA 3RYFE 1HF8A 4X64T 4N59A 1YQ3A 3NRYA 4C91A 1W0BA 1ZKEA 2MYSA 1XDOA 4DR5T 7PRNA 1MMAA 2W00A 1IBMT 5ADXK 2BZBA 2IW5B 5ABGA 3WI3A 3E22E 4DV4T 2LSKA 3AEEA 4BA9A 4DR2T 2ACZA 4U3CA 2XE1A 4AKIA 2WDVA 3GWHA 2LHFA 4P0BA 3PQUA 4IDQA 3HA4A 1I6ZA 2M6BA 5ABFA 4E1TA 1J5ET 3ZSSA 4FJOA 3SZDA 5FL0A 3EMNX 4KI0F 4K3BA 3NZPA 2XE2A 3BQKA 4LSFA 4QKNA 3AE3A 3PUSA 4HGAA 4LF5T 3VE2A 3O1IA 2R4NA 3RC3A 1WR6A 2Y0LA 4B61A 3G7GA 5JTGA 2BKNA 3RIFA 1THQA 3AE2A 1BT9A 4ILAA 3CX7B 3A5XA 4GYSA 3RIUA 1O3XA 4ILUA 5GV0A 1MM5A 2WWUA 5F5WA 3SS1A 2W80C 3LK2A 2YDRA 3LK3A 1J5WA 2KT9A 5HEJA 2B76A 3EABA 4UELA 2JJ9A 4XNKA 4AQYT 2KMFA 4N74A 1J1JA 4X66T 2CXLA 3KVAA 3K19A 3FZFB 5L47A 2VB6A 2BS3A 5JR9C 4YSZA 4B6XA 4PK4A 3ZSTA 3O1JA 3PUAA 2PBIA 3AEAA 3ZCJA 3MXZA 1BR4A 3AAIA 3ZMZB 4ZI7E 4LFAT 4AKHA 2IUBA 3GA8A 1UX5A 2XY8B 2YK0A 3KINB 2RA1A 4H9QC 3HI2A 3TKLB 4A98A 4WW0A 2XTRA 2J4UP 2CLYC 3VKHA 3GMIA 2BKOA 3JCUO 1OEDB 5FXXA 1UCUA 2NP9A 3V5SA 4EEDA 2BS2A 5DL5A 2VQFT 2Y6XA 4KR4A 4K0KT 4CZZB 1E54A 5AQHB 2G0UA 4A56A 3LSVA 4YTPA 5G39A 2UXCT 1U5PA 2FUPA 2D2SA 3CIRA 4XBFB 2WS3A 2Q9QC 4KMCA 5KAIO 2N2MA 3KV9A 4OYJA 4RJWA 5G38A 3ZN0B 5HXRA 2Q9QA 2GE4A 5KXJA 3OYZA 2ZM6T 4OFZA 1HCIA 3B13A 3RI5A 3N9LA 4LF9T 4OYKA 5JQGE 2ODVA 2K4TA
chains in the Genus database with same CATH topology
4EIWA 1T98A 1FEWA 1QUUA 3UPGA 3D0TA 2BDEA 4ERRA 2VKOA 2XE5A 4O8SA 4D5UA 4H63H 3ZC1A 3CMLA 3N9QA 5G26A 5DABA 2W63A 3ANWA 3T8OA 1YD8G 5LOVE 1YS5A 3HWBA 2D0UA 3K3OA 1G73A 4O4IE 2L9QA 3AA6A 1MIYA 3C4WA 3SZVA 4Z3TA 2ERVA 4X1KE 5LHGB 2YU2A 4QHOA 1IAPA 2KNDA 2M67A 3LBXB 3AVSA 4M1PA 4TV8E 2MTQA 4EYUA 4OHFA 1NAFA 2EHOB 5LCYA 3VHLA 3PURA 2O4VA 1G90A 1MMGA 1D0ZA 2H3RA 4DO0A 4L5GA 2X9WA 3OBVE 5FXZA 4RL9A 1BR2A 2LSGA 2D0TA 2K24A 3SY7A 3AB3B 2MHLA 3ETVA 1HXUA 4PJJA 4K0UA 3AAEA 3PUQA 1QJ8A 3CQXC 5KMGP 1D1BA 2KWHA 2OA5A 3N9PA 3N9MA 3Q5XA 2CWYA 1P4TA 4FRXA 3SYBA 3CQGB 4F4BA 1MIWA 4V1Av 5J1GA 3WAJA 1MM4A 5TAOA 3IEEA 3LFMA 2NW9A 2WAUA 2LSYA 4AYMC 2LHNA 2ZLYA 5HAXA 3ONXA 3GN5A 2PFVA 4EZHA 3ZYLA 2LEHA 3IF8B 3PQSA 3CX6B 3N9OA 3KV4A 4IIJE 2PJQA 4O4XA 1Y64B 3M65A 4ISTA 4GOUA 3SOLA 3F57A 2XASB 4IE6A 2XAQB 2HH7A 5L3DB 3LK42 2M06A 2YEVC 3LK2B 2GK9A 3RYIE 4AUIA 1FMVA 3AAEB 3SY9A 5J2TE 2N2NA 3KV6A 4PJNA 4AI6A 2H7OA 3C4XA 1VRBA 2Z6EA 2ZM0A 2LSIA 2XAGB 3IBPA 2ZMAA 2EHOD 4L0RA 4ADZA 2A3DA 5L3FB 4GCQA 2CE7A 4MFRA 1BR1A 3T0SA 5DQWA 1ZEEA 3AAAB 6PRNA 3DA3A 4WNKA 3ESLA 3RPUA 3CX8B 2L8KA 2X68A 4AQGA 3UUXB 4N58A 4O3ZA 3O1HA 2DHRA 2IAKA 2YNKA 1HXXA 3ZLIA 2X0LB 5JDLA 4F6RC 3K3NA 2NTYA 2LFUA 1MMDA 4MHCA 4QX7B 3QRCA 3I1AA 4I4TE 3AAAA 3T24A 4CI2B 5LHIB 2E9XD 3WAKA 5JDQA 4XAXB 3UUNA 3FXEB 3RC8A 1IZNA 2KZ7A 4FZLA 3KVBA 3ZEFB 1GFPA 4PFPA 4FMSA 1QJ9A 5L2LA 4HFVA 3KFWX 2X66A 4DMWA 4FOZA 2D5UA 4LSEA 3DTOA 2V7LA 1WLXA 2ODJA 5LP6E 3C50A 3PTRB 5ADXL 1H6S1 1Q9FA 4G63A 2WBLA 3W15B 4FSOA 3RH3A 5LGUB 3A2SX 2Y7SA 2VKJA 5DQVA 2EHOA 3PUGA 2ZLDA 5FP3A 5CA0E 2OMFA 2P9BA 4O2AE 4O4UA 3UFEA 2V26A 2ACXA 2V1DB 2K9AA 4D65A 3ZPOA 5KX5E 3E08A 4ZOLE 5BMVE 1FIOA 4I43B 3V5UA 4CXWA 1ZHXA 3PU8A 5LYJE 3QC9A 4IDZA 5E0OA 3LK41 4D64A 3FBZA 3UU2A 5HXEA 5DJQC 3C5OA 4AQFC 1LRZA 1VOMA 1LKXA 5GONE 3AA1B 1WYBA 3O9XA 3EVYA 5LJMA 3JC6C 4HTEA 4O3WA 2XMXA 5FMNA 1GFNA 1MPFA 4JCHA 2W62A 2W81C 1YKEB 2YU1A 2XTQA 3PRNA 4PUXA 2CEAA 1D0XA 2E9XB 1NWMX 2QGSA 2UXNB 2CWOA 2DCFA 4G2AA 4DVDA 3Q5WA 4GK0E 5LA6E 4E7ZA 2A72A 3AA6B 3VU7H 3FB2A 4FZMA 4O4JE 4N78D 2BVMA 3UT5E 3BK9A 3LJCA 4ZS3A 2J1NA 4AYID 5IYUA 2M07A 2X9YA 4PFOA 3LBXA 5ETWA 2V7JA 2I59A 3R6NA 5L3EB 2KXPA 4IE7A 4Z8XA 3HOLA 5JDGA 3MJXA 5LXTE 3VZTX 2FGQX 2MNHA 4QX8B 3T20A 3GN5B 5EK3A 3C4ZA 2LM9A 3PE0A 2NOXA 2KWIB 3MA9A 4XZCA 3ZN1B 3POXA 3JC6D 4E1SA 5C8YE 3NZQA 4GIWA 2PG8A 5CB4E 3CKDA 4H9RC 5KDMC 2LJLA 2F1TA 2FGRA 2NW7A 3E0ZA 4ZHQE 4AYNA 2WMNA 3S4UA 2PRNA 4PK5A 1Q9GA 1GFMA 5IHYA 2ZM2A 1ZHWA 5HWXA 3QRAA 3AA1A 4GYRA 3J9X1 5JDMA 4QXHB 3ZCIA 5M4YA 3EDUA 3ZC0A 4JEUB 3AA7B 5AFUK 5JR9B 1OSMA 2KZ7B 4ZI2D 2Q9QB 1CUNA 2YINA 4ZS2A 4MBQA 3KVDD 4UV9B 3DP7A 4NUVA 2X9XA 4PAGA 1H7CA 4ANJA 4GCPA 2C5IT 4AKLA 2NTXA 3HW9A 5FY7A 3N9NA 4UXNB 4IE5A 3HL6A 4CXXA 4AYDC 4ZI2C 3GP6A 2E9XA 3RYCE 2Q9QD 1ZHTA 4O4LE 3RYHE 4NUUA 1BXWA 3UULA 2WM9A 3ZMVB 3EUHA 4AKRB 4UF0B 2IC9A 3I9YA 4BUMX 3CQCB 3SYSA 4UVBB 3H37A 1LVFA 4RLCA 1D1AA 2VL8A 3U3IA 5IYZE 1OWAA 2XUEA 5JH7E 5LG4A 2X9HA 1BR0A 2LHRA 4UIGA 3VY8X 2LOSA 2Y8DA 5F8PA 4BJNA 1YKHB 2F1VA 2Y2XA 1S94A 2DWGA 2E9XC 2XAHB 4ISSA 3RBHA 2NWBA 2L3LA 2B1EA 4WBNE 3B57A 3BQLA 4EXTA 2MBGA 2KLQA 5JRCB 4LSIA 4O2BE 3UTKA 2KC0A 1MMNA 2Y0KA 4UV8B 3I0QA 5LNKA 4J2CA 2KXPB 2JMKA 2NW8A 3FBLA 3HR0A 1UX4A 4YLHA 4EZ4A 2WSSV 3HKCE 5FXVA 4RLBA 3P8CD 3RYFE 5JDHA 1HF8A 2C5JA 1WRDA 4H9OC 4CI1B 4N59A 3N2KE 3NRYA 4C91A 2CCQA 3WI4A 2X51A 3ETUA 5FY0A 1ZKEA 2MYSA 4YJ2E 5JRCA 3DJBA 1FMWA 4O4HE 3ZYKA 4AKGA 5FY1A 3FXDB 2HPJA 3Q9DA 2KINB 4IGUA 4U9CA 7PRNA 1ZV4X 4UEMA 3K8PC 3FHNA 1MMAA 3DA4A 2W00A 4U72A 4GCSA 2CXFA 5ADXK 4AKRA 4JLEA 2DLRA 3O4XE 3QUJA 2BZBA 2IW5B 3WI3A 3E22E 3KBUA 4QXCB 2N2LA 3PDYA 1D0YA 2LSKA 3RKOA 5DL7A 5JDNA 5EK2A 5T5FA 4BA9A 4E7SA 8PRNA 4L9IA 3J7Yq 2XE1A 2BVLA 4AKIA 3RX6A 5FVNA 4AKMA 2LHFA 3GWHA 4O49A 2MOZA 4P0BA 2CA5A 3PQUA 2VKHA 3N5LA 4FZNA 2XQYA 5D5DA 3HA4A 4QXBB 2X27X 4XNLA 2EHOC 4E1TA 2XAFB 1GFOA 4FJOA 3UAQA 2K48A 2KDYA 3SZDA 4TZ4C 3EMNX 5L3GB 5LBMA 4FT6A 4O3XB 1ORMA 3ZMTB 4BJMA 3C64A 3FYXA 1HG2A 2JPFA 4GK5E 3NZPA 2XE2A 3BQKA 4DBQA 4LSFA 5LJNA 3NSGA 4QKNA 2W0GA 4PJLA 4X1YE 3PUSA 4HGAA 2XG6A 5HYAA 3AVRA 3VE2A 3O1IA 4YHJA 3RC3A 4AQFA 1WR6A 3PU3A 2ZM8A 4KR8A 4C90A 1Z0PA 2LSJA 2Y0LA 4B61A 1PHOA 3OYXA 3G7GA 2V7MA 2LE8A 4DNDA 4CQIA 2CM0A 1THQA 1BT9A 4U74A 3ANWB 4FRTA 4FUVA 1KK7A 2JRKA 3VZUX 2VWAA 1HTJF 2DWKA 1B7TA 3CX7B 2XE3A 2YPVA 1PRNA 3A5XA 1X79A 4RJXA 2IC6A 4HEAA 4KRAA 3ZMUB 1HS7A 1MIVA 3LK3B 4GYSA 3AA0B 1WYCA 3KBTA 3L3PA 5PRNA 1O3XA 3ZJ1A 4AFKA 2Y0HA 4ILUA 1QJPA 3L09A 5GV0A 2SPCA 4PK6A 1EZ3A 2X67A 1MM5A 1QSDA 2WWUA 2LT3A 4YJ3E 3SS1A 2W80C 2XHEB 3LK2A 2RP4A 1G8XA 3LK3A 2CXDA 5H6QB 3JTYA 2KT9A 1ZHZA 4LSHA 3I9WA 3R84B 3VE1A 3WI5A 2XTLA 4IHJE 3IHRA 4DMVA 4UELA 2JJ9A 5CA1E 3P7IA 4XNKA 2KMFA 3ZYMA 1ZHCA 2UXXB 3OJAA 3CVRA 4UVAB 3HKBE 3V8UA 2Y48B 1V9DA 2CXLA 5H6RB 3KVAA 3K19A 3HKEE 2ODUA 2K0LA 4GHBA 4EOZB 4H9SE 5EZYE 2W61A 2VB6A 2H7VC 2JMMA 5JR9C 4ZI3C 4B6XA 4X20E 4PK4A 5HWYA 3O1JA 5FNVE 3I0OA 3MK7C 3PUAA 2PBIA 1SA0E 3POQA 3HOEA 3MKDA 1D1CA 3C51A 3ZCJA 4DBRA 3MXZA 1BR4A 1BH3A 4HN9A 3AAIA 3ZMZB 4ZI7E 1ZHYA 2QTKA 1U4QA 1US7B 4IE4A 4JUYA 3SWHA 4H9PC 5JR9A 4AKHA 5FYMA 5A1LA 3VZWX 2JMHA 1UX5A 3GA8A 3EDVA 4PNIA 2YK0A 3ZMSB 1AJ3A 2VK9A 3KINB 4TV9E 1HX8A 2RA1A 4H9QC 3RRWA 2CMRA 5AFUL 2V7KA 4G75A 1IJ5A 3HI2A 3TKLB 4WW0A 2XTRA 5LGNB 3N2OA 4EB6E 5LHHB 3H3AA 4AZLA 2C5KT 2J4UP 2CLYC 3VKHA 1MNEA 3CPZA 5EK4A 4FI5A 4HKAA 5EE2A 2N1GA 2N9DA 4H9NC 1YW0A 4QWNB 3O0EA 3GMIA 5J2UE 5JDPA 4KBMB 1OPFA 1IJ6A 4UF0A 4X1IE 3CWZB 2PORA 4AYEC 3KDSE 4PW8A 5FXXA 3OKQA 3AA0A 1UCUA 2NP9A 3Q2MA 3V5SA 5DL6A 4JFBA 2CLYB 4AXPA 4P0AA 5DL5A 4KUMB 5LGTB 4TX5A 5L3CB 5HXSA 2Y6XA 3F31A 4KR4A 1OXZA 5F3JA 2LOPA 2E8IA 1KNZA 3ZJ2A 3SRZA 2K4TA 2ES0A 3RRCA 2JQQA 3UUMA 5HXHA 3C98B 4CZZB 1SHZC 4TN7B 2VASA 4MALA 4EAHA 1E54A 4P09A 2G0UA 4FSPA 4A56A 4JEHB 2WMOA 3AA7A 3MZKB 2J1DG 5JVDE 4PJMA 2ZFGA 3HKDE 4ZI3D 3NBXX 5L3BB 4O3YA 1U5PA 3LG7A 4BAYB 2C0SA 5HXCA 4H63V 4GF4A 2D2SA 4XBFB 4TUYE 4G76A 3N2GE 1S35A 3NRXA 1MNDA 5FXWA 3K3QC 4CXYA 2Q9QC 4KMCA 2N2MA 3KV9A 3VKGA 2VKDA 1IZNB 4OYJA 4EYYR 4RJWA 2V7IA 1LVKA 4I50E 4KP3C 3U78A 3ZN0B 1HG5A 3POUA 3KV5A 3BQIA 3MACA 2A2FX 1HFAA 2HPLA 2DNXA 4FESA 5HXRA 4CI3B 2Q9QA 2GE4A 3OYZA 3VY9X 3QK6A 5LBQB 2K5BB 3F2EA 1HXTA 3PORA 4OFZA 1HCIA 3B13A 1GFQA 4OK0A 3N9LA 4YFSA 4HE8A 4OYKA 5JQGE 4UVCB 4QQ1A 2DI4A 1E1HB 4C69X 4I55E 2QA7A 4MLKA 5JREA 5JDFA 5DL8A 3TZGA 4IE0A 2ODVA 4WBOA 4ASKA 2XAJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AKR B;  3AA1 A;  5AFU L;  3LK2 A;  3LK4 2;  3LK2 B;  3AAA A;  3LK3 A;  2KXP A;  3AAE B;  3AAE A;  3AA7 B;  5AFU K;  3AA7 A;  3LK4 1;  2KZ7 B;  1IZN A;  2KZ7 A;  5ADX K;  4AKR A;  3AA6 A;  3AA1 B;  5ADX L;  3AAA B;  3LK3 B;  3AA0 A;  2KXP B;  3AA0 B;  1IZN B;  3AA6 B; 
#chains in the Genus database with same CATH topology
 2WB5 A;  1T98 A;  2WWV A;  3ZC1 A;  5G26 A;  3ANW A;  4OX9 T;  2LRK A;  3AA6 A;  1MIY A;  3UU5 A;  2KND A;  4M1P A;  4EYU A;  2MTQ A;  5J0Z A;  4F8H A;  5LCY A;  3AE6 A;  3PUR A;  1G90 A;  1MMG A;  1D0Z A;  4RL9 A;  1BR2 A;  2K24 A;  1Y01 A;  5FVL A;  4PJJ A;  3CQX C;  3P50 A;  2OA5 A;  4FRX A;  2CWY A;  4V1A v;  3WAJ A;  5AQG B;  4ZXL A;  5HAX A;  3T1H T;  3GN5 A;  3IF8 B;  3PQS A;  1SE7 A;  3ONL C;  2PJQ A;  3SOL A;  4IE6 A;  1FMV A;  3SY9 A;  4PJN A;  1UGO A;  1HR0 T;  4GCQ A;  4U2Y A;  1BR1 A;  4DV7 T;  1N34 T;  1XDP A;  4WNK A;  3RPU A;  2R88 A;  4N58 A;  3ZLI A;  2X0L B;  4ZEY A;  2NTY A;  2LLY A;  4JI1 T;  3QRC A;  3I1A A;  3A0H O;  4CI2 B;  3WAK A;  2KZ7 A;  3KFW X;  4DMW A;  4FOZ A;  2D5U A;  3W15 B;  1NEN A;  2I6H A;  3UFE A;  2ACX A;  2K9A A;  3K1S A;  1FIO A;  2IML A;  3AEB A;  3PU8 A;  1M62 A;  3QC9 A;  4JI3 T;  3UU2 A;  3P4S A;  5GON E;  5FMN A;  1GFN A;  2W62 A;  4PUX A;  2QGS A;  1D0X A;  1NWM X;  2CWO A;  2DCF A;  5LA6 E;  2A72 A;  4FZM A;  4N78 D;  4AYI D;  3BK9 A;  4PFO A;  2V7J A;  2I59 A;  5L3E B;  3VRB A;  3VZT X;  3T20 A;  5EK3 A;  2NOX A;  3MA9 A;  3JC6 D;  4E1S A;  3AE5 A;  5CB4 E;  4H9R C;  4YT0 A;  4YHH T;  2FGR A;  4ZHQ E;  4AYN A;  3S4U A;  4PK5 A;  5IHY A;  1ZHW A;  5HWX A;  1E7P A;  3AA1 A;  3J9X 1;  2CBJ A;  2UXD T;  2FJA A;  2XM2 A;  5JR9 B;  4ZI2 D;  2Q9Q B;  5AQS B;  4MBQ A;  3KVD D;  2X9X A;  4GCP A;  5FY7 A;  2XSB A;  3N9N A;  5FL1 A;  4CXX A;  4AYD C;  3RYC E;  2Q9Q D;  1XWM A;  2WM9 A;  4AKR B;  4UF0 B;  2IC9 A;  1VCS A;  3PUX F;  4BUM X;  3SYS A;  2LM2 A;  3U3I A;  5IYZ E;  1OWA A;  2LOS A;  5F8P A;  3PF1 A;  4BJN A;  4Z90 A;  5G3A A;  2B1E A;  4WBN E;  3BQL A;  5JRC B;  2Y0K A;  3I0Q A;  3FBL A;  4QH5 A;  3P8C D;  1WRD A;  3N2K E;  3QNU A;  4JI2 T;  3WI4 A;  2X51 A;  3ETU A;  2QRX A;  5JRC A;  5AQJ B;  4O4H E;  4AKG A;  2XJ7 A;  3Q9D A;  4DR6 T;  4IGU A;  4U9C A;  4UEM A;  2CXF A;  4AKR A;  2DLR A;  4IDN A;  4QXC B;  3PDY A;  3RKO A;  8PRN A;  2D9D A;  3RX6 A;  2MOZ A;  4XNL A;  2EHO C;  3UAQ A;  2FJB A;  5LBM A;  3EI0 A;  4EGW A;  4O3X B;  2V5D A;  3ZMT B;  1HG2 A;  2XQ5 A;  1ZOY A;  3ZT7 A;  2WDR A;  2CBI A;  2W0G A;  4X1Y E;  2XG6 A;  4AQF A;  4C4V B;  4KR8 A;  1Z0P A;  2LSJ A;  4FUV A;  1KK7 A;  3VZU X;  1WCR A;  1N32 T;  4TNV A;  1PRN A;  2IDO B;  4HEA A;  1HS7 A;  1MIV A;  3LK3 B;  3BRZ A;  4AFK A;  1L0V A;  2SPC A;  4PK6 A;  4A97 A;  2X67 A;  2VVN A;  2LT3 A;  4LFB T;  2CXD A;  1ZHZ A;  4LSH A;  5KAF O;  3I9W A;  4U31 A;  4B3M T;  4GKK T;  3IHR A;  3RQW A;  3T1Y T;  5CA1 E;  3P7I A;  3PJA A;  1ZHC A;  2UXX B;  4UVA B;  4ZZB A;  2FJD A;  5H6R B;  4GHB A;  4IL6 O;  3PGU A;  4H9S E;  1T7S A;  3TLU A;  5HWY A;  3TLV A;  5FNV E;  3I0O A;  3POQ A;  3HOE A;  4DBR A;  4TWD A;  1BH3 A;  1ZHY A;  1U4Q A;  4KX6 A;  4H9P C;  5A1L A;  4HFC A;  3EDV A;  5C2T A;  3RRW A;  2CMR A;  3P4R A;  2FBW A;  5AFU L;  5AQF B;  5LGN B;  1VCT A;  4IDP A;  4AZL A;  3PGR A;  3CPZ A;  2WZI A;  5EE2 A;  2N1G A;  4H9N C;  3O0E A;  5J2U E;  1OPF A;  1IJ6 A;  4X1I E;  5AQO B;  3OKQ A;  3AA0 A;  5DL6 A;  3UQ7 A;  3ZJ2 A;  2ES0 A;  1KEY A;  2JQQ A;  1SHZ C;  1IBK T;  5ABE A;  5FKY A;  4EV6 A;  3MZK B;  4PJM A;  3HKD E;  5L3B B;  3H3M A;  4O3Y A;  2UUB T;  4GF4 A;  4H63 V;  1MND A;  4CXY A;  2V6Y B;  5AQV B;  4EYY R;  4KP3 C;  4U33 A;  1HG5 A;  1QLB A;  1IBL T;  3POU A;  2DNX A;  4CI3 B;  3DWN A;  5LBQ B;  1HXT A;  4NXM T;  4HFI A;  2W2U A;  3POR A;  1GFQ A;  4YFS A;  1OED A;  4QQ1 A;  4MLK A;  1JNZ A;  5DL8 A;  3QB5 A;  2AXT O;  4ERR A;  2BS4 A;  2XQ8 A;  5DAB A;  5L4E A;  1YD8 G;  3HWB A;  2D0U A;  2LRL A;  2L9Q A;  3SZV A;  5AQI B;  5GTI O;  2J62 A;  4YTM A;  4TV8 E;  2EHO B;  2O4V A;  4DO0 A;  4L5G A;  4N75 A;  2X9W A;  2MPK A;  3AXJ B;  4DUY T;  2W4X A;  4DR7 T;  2BBH A;  2MHL A;  3ETV A;  4K0U A;  1X9B A;  3WU2 O;  2LKH A;  5CFB A;  1ZP0 A;  2KWH A;  3N9P A;  3SYB A;  1P4T A;  3CQG B;  1MIW A;  5TAO A;  5C3J A;  2WAU A;  3SFD A;  4AYM C;  3ONX A;  2PFV A;  1W09 A;  4TWH A;  4WZX A;  3M65 A;  2XM1 A;  2HH7 A;  3LK4 2;  3LK2 B;  3RYI E;  3JAE A;  3P4P A;  3AEC A;  4LF7 T;  2H7O A;  1VRB A;  3C4X A;  2Z6E A;  1XNQ T;  2JQK A;  3AAA B;  2IIU A;  2X68 A;  3O1H A;  2DHR A;  2IAK A;  4HWC A;  2YNK A;  4F6R C;  2LFU A;  1MMD A;  4HFE A;  3ZKR A;  2E9X D;  5JDQ A;  1IZN A;  2UUA T;  1GFP A;  4FMS A;  4HFV A;  3NWI A;  2V7L A;  3RKG A;  1WLX A;  5AQT B;  3PTR B;  2WBL A;  4FSO A;  3A2S X;  2Y7S A;  5DQV A;  4D65 A;  3ZPO A;  4KHZ F;  4ZOL E;  5BMV E;  2XZE A;  3V5U A;  4CXW A;  2VL0 A;  5LYJ E;  2J4G A;  3LK4 1;  2XPK A;  3KZI O;  3FBZ A;  1VOM A;  5LJM A;  2XMX A;  2JQ9 A;  2W81 C;  1YKE B;  2YU1 A;  5AQN B;  2XTQ A;  2CEA A;  2UXN B;  4DVD A;  4GK0 E;  4YY3 T;  1XNR T;  4KHP T;  2M07 A;  2X9Y A;  1OED C;  4U7I A;  4CN1 A;  5PRN A;  2KXP A;  5JDG A;  3MJX A;  4QX8 B;  3GN5 B;  3RGL A;  3C4Z A;  2IWV A;  3PE0 A;  3ZN1 B;  4Q25 A;  3NZQ A;  2PG8 A;  2F1T A;  4NXN T;  2NW7 A;  2WMN A;  4UB8 O;  2ZM2 A;  5AQQ B;  2WZH A;  3AEG A;  1HNW T;  3OPC A;  4QXH B;  3ZCI A;  5M4Y A;  3EDU A;  4JEU B;  4DV5 T;  3AA7 B;  4DV6 T;  3UU8 A;  2YIN A;  2C5I T;  4B3R T;  4AKL A;  4LFC T;  3HL6 A;  1W9R A;  4IL9 A;  4O4L E;  4NUU A;  3UUL A;  3I9Y A;  3CQC B;  4UVB B;  4RLC A;  2VL8 A;  2XUE A;  3UU4 A;  1BR0 A;  2PTF A;  4UIG A;  1YKH B;  2F1V A;  2E9X C;  2NWB A;  3FZH B;  4YSX A;  3NKZ A;  3PGS A;  2KLQ A;  4LSI A;  1MMN A;  3ZT6 A;  4UV8 B;  5LNK A;  4J2C A;  2KXP B;  2NW8 A;  5ABH A;  3HR0 A;  4EZ4 A;  2WSS V;  5JDH A;  2C5J A;  4H9O C;  5HCM A;  2CCQ A;  3ZT5 A;  3DJB A;  3Q5D A;  3FXD B;  2HPJ A;  2XQ7 A;  5AQP B;  3FHN A;  4GCS A;  1UUS A;  2V8S V;  2H89 A;  3KBU A;  1D0Y A;  5DL7 A;  4JI4 T;  5T5F A;  4E7S A;  4L9I A;  5FVN A;  2AE9 A;  2CA5 A;  3N5L A;  4JI0 T;  4JI5 T;  4QXB B;  2X27 X;  4HWD A;  2UXB T;  1GFO A;  5HEO A;  5L3G B;  1ORM A;  3FYX A;  2JPF A;  4GK5 E;  4DBQ A;  3TLT A;  5LJN A;  4PJL A;  2MAW A;  4YHJ A;  3PU3 A;  4LF8 T;  4ILB A;  4C90 A;  4IDO A;  1PHO A;  2V7M A;  2LE8 A;  2WP9 A;  4FRT A;  4LMJ A;  2E5V A;  1HTJ F;  2DWK A;  2XE3 A;  1X79 A;  4RJX A;  5CGM A;  3ZMU B;  1I94 T;  3AA0 B;  1WYC A;  2Y0H A;  1QSD A;  4B3S T;  1KNR A;  1FJG T;  4YJ3 E;  3PUY F;  1T16 A;  2XHE B;  1G8X A;  5H6Q B;  3JTY A;  4JI8 T;  3R84 B;  4Z91 A;  2XQ6 A;  4DMV A;  2F1C X;  3X1D A;  5LMN T;  5LB7 B;  3HKB E;  3V8U A;  2Y48 B;  3HKE E;  2ODU A;  4EOZ B;  4CTD A;  5EZY E;  2X0Y A;  2W61 A;  2H7V C;  1JNR A;  2QTK A;  1US7 B;  4IE4 A;  4JUY A;  3SWH A;  2XSA A;  5JR9 A;  5FYM A;  3VZW X;  2JMH A;  4PNI A;  2VK9 A;  3PV0 F;  5H2F O;  2V7K A;  4G75 A;  2CHO A;  2R8A A;  4HKA A;  2N9D A;  3PUW F;  1YW0 A;  5JDP A;  3CWZ B;  2POR A;  2QVA A;  3KDS E;  3LDQ B;  4PW8 A;  4WYV A;  5LMU T;  3JCF A;  4P0A A;  4KUM B;  5LGT B;  4TX5 A;  5L3C B;  5HXS A;  3F31 A;  1OXZ A;  2E8I A;  2OV9 A;  5HXH A;  2BG9 E;  4TN7 B;  2VAS A;  4YTN A;  4P09 A;  2WMO A;  3AA7 A;  2A9U A;  2ZFG A;  4ZI3 D;  2YOE A;  3NBX X;  1T8B A;  2C0S A;  4TUY E;  2JQH A;  3N2G E;  1S35 A;  4U7Y A;  3K3Q C;  3VKG A;  1IZN B;  1S5L O;  2V7I A;  1LVK A;  4I50 E;  4TWF A;  3BQI A;  3MAC A;  4B3T T;  2HPL A;  1HFA A;  4TNW A;  2V6X A;  1N36 T;  4I0U A;  3RF1 A;  2VUR A;  3VY9 X;  3F2E A;  2CPT A;  2J47 A;  3DWO X;  4UVC B;  2DI4 A;  1E1H B;  4C69 X;  2WCA A;  2QA7 A;  2LKG A;  2WU5 A;  4HWH A;  3JAD A;  3UUX B;  4ASK A;  1AJ3 A;  3D0T A;  2BDE A;  2VKO A;  2XE5 A;  3RIU C;  4D5U A;  3N9Q A;  3P4Q A;  2W63 A;  2UUC T;  3K3O A;  4O4I E;  3C4W A;  4Z3T A;  2CHN A;  4X1K E;  2YU2 A;  1IAP A;  4LML A;  1W0A A;  3LBX B;  2M67 A;  1SUM B;  1NAF A;  3VHL A;  2R6G F;  2H3R A;  3P4W A;  5B66 O;  5FXZ A;  2BKP A;  2LSG A;  2D0T A;  3PUV F;  2V5C A;  3AAE A;  3PUQ A;  1QJ8 A;  1YXR A;  3FZK B;  1D1B A;  3N9M A;  4F4B A;  3BS0 A;  2YKS A;  3BRY A;  1MM4 A;  4AIS A;  3IEE A;  2LSY A;  2LHN A;  2ZLY A;  4EZH A;  2LEH A;  3N9O A;  3KV4 A;  4IIJ E;  4GOU A;  5L3D B;  2XAQ B;  2M06 A;  4AUI A;  2YEV C;  2GK9 A;  2XQ3 A;  3AAE B;  5J2T E;  3KV6 A;  2ZM0 A;  3IBP A;  2ZMA A;  2EHO D;  2CE7 A;  4MFR A;  3T0S A;  1UK5 A;  4JBW F;  4NIQ A;  3UFG A;  2VVS A;  1HXX A;  4DV2 T;  5JDL A;  2BG9 C;  3K3N A;  4MHC A;  4QX7 B;  4I4T E;  5AQK B;  2V6Y A;  3UUN A;  5HEG A;  4FZL A;  3KVB A;  1M7K A;  1QJ9 A;  3AXJ A;  3AE4 A;  3RH3 A;  5LGU B;  2EHO A;  2ZLD A;  2P9B A;  4O2A E;  4O4U A;  4DR3 T;  2V1D B;  3E08 A;  2UU9 T;  2WU2 A;  1ZHX A;  3QB5 K;  5E0O A;  3A8Y C;  2YN6 A;  4LF6 T;  4DV0 T;  5GTH O;  5HEU A;  1YQ4 A;  5DJQ C;  3C5O A;  4AQF C;  3TLS A;  1LKX A;  3AA1 B;  1WYB A;  1NEK A;  1T72 A;  3EVY A;  4HTE A;  1OED E;  4O3W A;  1MPF A;  3PRN A;  4FQE A;  2E9X B;  4G2A A;  4E7Z A;  3AA6 B;  3VU7 H;  3FB2 A;  2J1N A;  4O4J E;  3UT5 E;  4ZS3 A;  2JIW A;  3LBX A;  4IE7 A;  4Z8X A;  5LXT E;  2MNH A;  4LMK A;  3VR8 A;  5C8Y E;  5KDM C;  2LJL A;  3Q5E A;  3E0Z A;  3NVO A;  1GFM A;  3AEF A;  1XMQ T;  5LG3 A;  5JDM A;  4IRE A;  3ZC0 A;  3VRA A;  5AFU K;  1CUN A;  1XZY A;  5AQR B;  1KFY A;  3AED A;  3DP7 A;  4NUV A;  1H7C A;  4ANJ A;  3UQ4 A;  3HW9 A;  4UXN B;  4IE5 A;  1ZHT A;  3RYH E;  1BXW A;  3QOF A;  4JI7 T;  5AQL B;  3H37 A;  1D1A A;  2X9H A;  3PJA J;  2LHR A;  3VY8 X;  5FVK A;  2DWG A;  4ISS A;  2XAH B;  2L3L A;  4EXT A;  2JQY A;  4O2B E;  3UTK A;  4RLB A;  4YLH A;  3HKC E;  4CI1 B;  4A5X A;  5FY0 A;  4YJ2 E;  4HFH A;  1FMW A;  3FZM B;  2HN2 A;  3ZYK A;  5E79 O;  5FY1 A;  2KIN B;  1ZV4 X;  2R4L A;  3K8P C;  4GKJ T;  3DA4 A;  4U72 A;  2BG9 A;  4JLE A;  3O4X E;  3QUJ A;  1HNX T;  4HFD A;  2N2L A;  1T1L A;  5JDN A;  5EK2 A;  3J7Y q;  5CJ5 A;  2BVL A;  4AKM A;  2KSR A;  4O49 A;  3UUB A;  2VKH A;  4FZN A;  2XQY A;  4JI6 T;  5D5D A;  2W66 A;  2XAF B;  2VQE T;  4U2Z A;  2K48 A;  2KDY A;  4TZ4 C;  2WJR A;  4FT6 A;  2RPA A;  4BJM A;  3C64 A;  2R4O A;  1UUR A;  2XQ4 A;  4ZZC A;  3NSG A;  5HYA A;  3AVR A;  3TLW A;  2ZM8 A;  4DV1 T;  3A7M A;  2X0H A;  3OYX A;  4DND A;  4CQI A;  2CM0 A;  3SFE A;  4U74 A;  3ANW B;  2JRK A;  2VWA A;  1B7T A;  1GQE A;  2YPV A;  2NR4 A;  2H88 A;  2IC6 A;  3JAF A;  4KRA A;  2WJQ A;  3KBT A;  3L3P A;  3ZJ1 A;  4HFB A;  1QJP A;  3L09 A;  4X5T A;  1EZ3 A;  1XMO T;  2RP4 A;  5AQU B;  3VE1 A;  3WI5 A;  2XTL A;  4IHJ E;  2QYW A;  1CHU A;  3ZYM A;  5IUX A;  3OJA A;  3CVR A;  1V9D A;  3PUZ F;  2WVP A;  2K0L A;  4QH4 A;  3L39 A;  3L8R A;  2JMM A;  4PJ0 O;  4ZI3 C;  4UB6 O;  4X20 E;  1WFD A;  3MK7 C;  1SA0 E;  4COF A;  3MKD A;  1D1C A;  3C51 A;  4HN9 A;  4EEB A;  2X9K A;  3ZMS B;  4TV9 E;  1HX8 A;  2XQA A;  1IJ5 A;  3FZL B;  3OTO T;  3N2O A;  4EB6 E;  2I0M A;  5LHH B;  3H3A A;  2C5K T;  1MNE A;  4DR4 T;  5EK4 A;  4FI5 A;  4QWN B;  3AE9 A;  4KBM B;  4PR7 A;  4UF0 A;  4C00 A;  4AYE C;  4YSY A;  3Q2M A;  4JFB A;  1KNP A;  2CLY B;  4AXP A;  1KNZ A;  5F3J A;  2LOP A;  3SRZ A;  3RRC A;  3UUM A;  3C98 B;  3B5M A;  4MAL A;  4EAH A;  4FSP A;  4JEH B;  5BR8 T;  2J1D G;  5JVD E;  5L4H A;  3ONJ A;  3LG7 A;  4BAY B;  2WQY A;  4NPP A;  5HXC A;  4G76 A;  3NRX A;  3UU6 A;  5FXW A;  1KF6 A;  2VKD A;  4CN4 A;  3U78 A;  3DZM A;  3KV5 A;  3UU3 A;  5ABF B;  2A2F X;  4FES A;  5TIS O;  2WDQ A;  2YDQ A;  3QK6 A;  2K5B B;  2IHR 1;  4QH1 A;  4OK0 A;  4HE8 A;  4IL4 A;  4CN6 A;  3AE1 A;  4I55 E;  5JRE A;  5JDF A;  3TZG A;  5JH7 E;  4IE0 A;  4ILC A;  2YDS A;  4WBO A;  2R4P A;  2XAJ B;  4EIW A;  4HWI B;  1FEW A;  1QUU A;  3UPG A;  5HEH A;  4O8S A;  4H63 H;  3CML A;  1WR0 A;  3T8O A;  2WY2 A;  5LOV E;  1YS5 A;  4HWF A;  1G73 A;  4K3C A;  2ERV A;  5LHG B;  4QHO A;  3AVS A;  4OHF A;  4X62 T;  3OBV E;  2BG9 B;  3OVU A;  4IT4 A;  3SY7 A;  3AB3 B;  1HXU A;  3ABV A;  5KMG P;  1E2A A;  3Q5X A;  5J1G A;  3LFM A;  2NW9 A;  3IA3 A;  2F4V T;  3ZYL A;  2CRB A;  3CX6 B;  3EHZ A;  4O4X A;  1Y64 B;  4IST A;  4C4V A;  3F57 A;  2XAS B;  4DR1 T;  3NJT A;  2N2N A;  2IWW A;  4AI6 A;  1DU2 A;  2LSI A;  4ADZ A;  2XAG B;  3M3Z B;  4L0R A;  2A3D A;  5L3F B;  5DQW A;  1ZEE A;  6PRN A;  3DA3 A;  4DV3 T;  4DID B;  3ESL A;  3CX8 B;  2L8K A;  4AQG A;  4O3Z A;  3RLF F;  1Z8U A;  3VR9 A;  3AE8 A;  3AAA A;  3T24 A;  5LHI B;  2AXD S;  4XAX B;  3FXE B;  3RC8 A;  3ZEF B;  4PFP A;  5L2L A;  4LSE A;  2X66 A;  3DTO A;  5IWA T;  2ODJ A;  5LP6 E;  3C50 A;  5ADX L;  1H6S 1;  1Q9F A;  4G63 A;  3CK6 A;  2VKJ A;  3PUG A;  5FP3 A;  5CA0 E;  2DL1 A;  2OMF A;  4YXD A;  2V26 A;  4UR9 A;  5KX5 E;  4I43 B;  2FJE A;  2HHH T;  4X65 T;  1HNZ T;  4IDZ A;  4D64 A;  3RIA A;  5HXE A;  1LRZ A;  4DUZ T;  3O9X A;  3JC6 C;  4JCH A;  1R8I A;  2OLT A;  3Q5W A;  2BVM A;  2W67 A;  3LJC A;  5IYU A;  3RHW A;  1HX1 B;  5ETW A;  3R6N A;  3HOL A;  3G06 A;  2FGQ X;  2BBJ A;  2LM9 A;  2KWI B;  4XZC A;  3POX A;  4GIW A;  3CKD A;  4P1N A;  4LF4 T;  2K3W A;  2PRN A;  1Q9G A;  3QRA A;  4GYR A;  2HN1 A;  1OSM A;  2KZ7 B;  2E2A A;  4ZS2 A;  3RQU A;  4UV9 B;  3AE7 A;  2M6I A;  2E5L T;  4PAG A;  2R89 A;  2NTX A;  5HCJ A;  4ZI2 C;  3GP6 A;  2E9X A;  3ZMV B;  3EUH A;  4AIU A;  1LVF A;  1N33 T;  5LG4 A;  5B5E O;  2Y8D A;  3A0B O;  2Y2X A;  1S94 A;  4JV5 T;  3RBH A;  3B57 A;  2MBG A;  2KC0 A;  2XQ9 A;  3EAM A;  2JMK A;  4JYA T;  5AQM B;  1UX4 A;  5FXV A;  3RYF E;  1HF8 A;  4X64 T;  4N59 A;  1YQ3 A;  3NRY A;  4C91 A;  1W0B A;  1ZKE A;  2MYS A;  1XDO A;  4DR5 T;  7PRN A;  1MMA A;  2W00 A;  1IBM T;  5ADX K;  2BZB A;  2IW5 B;  5ABG A;  3WI3 A;  3E22 E;  4DV4 T;  2LSK A;  3AEE A;  4BA9 A;  4DR2 T;  2ACZ A;  4U3C A;  2XE1 A;  4AKI A;  2WDV A;  3GWH A;  2LHF A;  4P0B A;  3PQU A;  4IDQ A;  3HA4 A;  1I6Z A;  2M6B A;  5ABF A;  4E1T A;  1J5E T;  3ZSS A;  4FJO A;  3SZD A;  5FL0 A;  3EMN X;  4KI0 F;  4K3B A;  3NZP A;  2XE2 A;  3BQK A;  4LSF A;  4QKN A;  3AE3 A;  3PUS A;  4HGA A;  4LF5 T;  3VE2 A;  3O1I A;  2R4N A;  3RC3 A;  1WR6 A;  2Y0L A;  4B61 A;  3G7G A;  5JTG A;  2BKN A;  3RIF A;  1THQ A;  3AE2 A;  1BT9 A;  4ILA A;  3CX7 B;  3A5X A;  4GYS A;  3RIU A;  1O3X A;  4ILU A;  5GV0 A;  1MM5 A;  2WWU A;  5F5W A;  3SS1 A;  2W80 C;  3LK2 A;  2YDR A;  3LK3 A;  1J5W A;  2KT9 A;  5HEJ A;  2B76 A;  3EAB A;  4UEL A;  2JJ9 A;  4XNK A;  4AQY T;  2KMF A;  4N74 A;  1J1J A;  4X66 T;  2CXL A;  3KVA A;  3K19 A;  3FZF B;  5L47 A;  2VB6 A;  2BS3 A;  5JR9 C;  4YSZ A;  4B6X A;  4PK4 A;  3ZST A;  3O1J A;  3PUA A;  2PBI A;  3AEA A;  3ZCJ A;  3MXZ A;  1BR4 A;  3AAI A;  3ZMZ B;  4ZI7 E;  4LFA T;  4AKH A;  2IUB A;  3GA8 A;  1UX5 A;  2XY8 B;  2YK0 A;  3KIN B;  2RA1 A;  4H9Q C;  3HI2 A;  3TKL B;  4A98 A;  4WW0 A;  2XTR A;  2J4U P;  2CLY C;  3VKH A;  3GMI A;  2BKO A;  3JCU O;  1OED B;  5FXX A;  1UCU A;  2NP9 A;  3V5S A;  4EED A;  2BS2 A;  5DL5 A;  2VQF T;  2Y6X A;  4KR4 A;  4K0K T;  4CZZ B;  1E54 A;  5AQH B;  2G0U A;  4A56 A;  3LSV A;  4YTP A;  5G39 A;  2UXC T;  1U5P A;  2FUP A;  2D2S A;  3CIR A;  4XBF B;  2WS3 A;  2Q9Q C;  4KMC A;  5KAI O;  2N2M A;  3KV9 A;  4OYJ A;  4RJW A;  5G38 A;  3ZN0 B;  5HXR A;  2Q9Q A;  2GE4 A;  5KXJ A;  3OYZ A;  2ZM6 T;  4OFZ A;  1HCI A;  3B13 A;  3RI5 A;  3N9L A;  4LF9 T;  4OYK A;  5JQG E;  2ODV A;  2K4T A; 
#chains in the Genus database with same CATH homology
 4EIW A;  1T98 A;  1FEW A;  1QUU A;  3UPG A;  3D0T A;  2BDE A;  4ERR A;  2VKO A;  2XE5 A;  4O8S A;  4D5U A;  4H63 H;  3ZC1 A;  3CML A;  3N9Q A;  5G26 A;  5DAB A;  2W63 A;  3ANW A;  3T8O A;  1YD8 G;  5LOV E;  1YS5 A;  3HWB A;  2D0U A;  3K3O A;  1G73 A;  4O4I E;  2L9Q A;  3AA6 A;  1MIY A;  3C4W A;  3SZV A;  4Z3T A;  2ERV A;  4X1K E;  5LHG B;  2YU2 A;  4QHO A;  1IAP A;  2KND A;  2M67 A;  3LBX B;  3AVS A;  4M1P A;  4TV8 E;  2MTQ A;  4EYU A;  4OHF A;  1NAF A;  2EHO B;  5LCY A;  3VHL A;  3PUR A;  2O4V A;  1G90 A;  1MMG A;  1D0Z A;  2H3R A;  4DO0 A;  4L5G A;  2X9W A;  3OBV E;  5FXZ A;  4RL9 A;  1BR2 A;  2LSG A;  2D0T A;  2K24 A;  3SY7 A;  3AB3 B;  2MHL A;  3ETV A;  1HXU A;  4PJJ A;  4K0U A;  3AAE A;  3PUQ A;  1QJ8 A;  3CQX C;  5KMG P;  1D1B A;  2KWH A;  2OA5 A;  3N9P A;  3N9M A;  3Q5X A;  2CWY A;  1P4T A;  4FRX A;  3SYB A;  3CQG B;  4F4B A;  1MIW A;  4V1A v;  5J1G A;  3WAJ A;  1MM4 A;  5TAO A;  3IEE A;  3LFM A;  2NW9 A;  2WAU A;  2LSY A;  4AYM C;  2LHN A;  2ZLY A;  5HAX A;  3ONX A;  3GN5 A;  2PFV A;  4EZH A;  3ZYL A;  2LEH A;  3IF8 B;  3PQS A;  3CX6 B;  3N9O A;  3KV4 A;  4IIJ E;  2PJQ A;  4O4X A;  1Y64 B;  3M65 A;  4IST A;  4GOU A;  3SOL A;  3F57 A;  2XAS B;  4IE6 A;  2XAQ B;  2HH7 A;  5L3D B;  3LK4 2;  2M06 A;  2YEV C;  3LK2 B;  2GK9 A;  3RYI E;  4AUI A;  1FMV A;  3AAE B;  3SY9 A;  5J2T E;  2N2N A;  3KV6 A;  4PJN A;  4AI6 A;  2H7O A;  3C4X A;  1VRB A;  2Z6E A;  2ZM0 A;  2LSI A;  2XAG B;  3IBP A;  2ZMA A;  2EHO D;  4L0R A;  4ADZ A;  2A3D A;  5L3F B;  4GCQ A;  2CE7 A;  4MFR A;  1BR1 A;  3T0S A;  5DQW A;  1ZEE A;  3AAA B;  6PRN A;  3DA3 A;  4WNK A;  3ESL A;  3RPU A;  3CX8 B;  2L8K A;  2X68 A;  4AQG A;  3UUX B;  4N58 A;  4O3Z A;  3O1H A;  2DHR A;  2IAK A;  2YNK A;  1HXX A;  3ZLI A;  2X0L B;  5JDL A;  4F6R C;  3K3N A;  2NTY A;  2LFU A;  1MMD A;  4MHC A;  4QX7 B;  3QRC A;  3I1A A;  4I4T E;  3AAA A;  3T24 A;  4CI2 B;  5LHI B;  2E9X D;  3WAK A;  5JDQ A;  4XAX B;  3UUN A;  3FXE B;  3RC8 A;  1IZN A;  2KZ7 A;  4FZL A;  3KVB A;  3ZEF B;  1GFP A;  4PFP A;  4FMS A;  1QJ9 A;  5L2L A;  4HFV A;  3KFW X;  2X66 A;  4DMW A;  4FOZ A;  2D5U A;  4LSE A;  3DTO A;  2V7L A;  1WLX A;  2ODJ A;  5LP6 E;  3C50 A;  3PTR B;  5ADX L;  1H6S 1;  1Q9F A;  4G63 A;  2WBL A;  3W15 B;  4FSO A;  3RH3 A;  5LGU B;  3A2S X;  2Y7S A;  2VKJ A;  5DQV A;  2EHO A;  3PUG A;  2ZLD A;  5FP3 A;  5CA0 E;  2OMF A;  2P9B A;  4O2A E;  4O4U A;  3UFE A;  2V26 A;  2ACX A;  2V1D B;  2K9A A;  4D65 A;  3ZPO A;  5KX5 E;  3E08 A;  4ZOL E;  5BMV E;  1FIO A;  4I43 B;  3V5U A;  4CXW A;  1ZHX A;  3PU8 A;  5LYJ E;  3QC9 A;  4IDZ A;  5E0O A;  3LK4 1;  4D64 A;  3FBZ A;  3UU2 A;  5HXE A;  5DJQ C;  3C5O A;  4AQF C;  1LRZ A;  1VOM A;  1LKX A;  5GON E;  3AA1 B;  1WYB A;  3O9X A;  3EVY A;  5LJM A;  3JC6 C;  4HTE A;  4O3W A;  2XMX A;  5FMN A;  1GFN A;  1MPF A;  4JCH A;  2W62 A;  2W81 C;  1YKE B;  2YU1 A;  2XTQ A;  3PRN A;  4PUX A;  2CEA A;  1D0X A;  2E9X B;  1NWM X;  2QGS A;  2UXN B;  2CWO A;  2DCF A;  4G2A A;  4DVD A;  3Q5W A;  4GK0 E;  5LA6 E;  4E7Z A;  2A72 A;  3AA6 B;  3VU7 H;  3FB2 A;  4FZM A;  4O4J E;  4N78 D;  2BVM A;  3UT5 E;  3BK9 A;  3LJC A;  4ZS3 A;  2J1N A;  4AYI D;  5IYU A;  2M07 A;  2X9Y A;  4PFO A;  3LBX A;  5ETW A;  2V7J A;  2I59 A;  3R6N A;  5L3E B;  2KXP A;  4IE7 A;  4Z8X A;  3HOL A;  5JDG A;  3MJX A;  5LXT E;  3VZT X;  2FGQ X;  2MNH A;  4QX8 B;  3T20 A;  3GN5 B;  5EK3 A;  3C4Z A;  2LM9 A;  3PE0 A;  2NOX A;  2KWI B;  3MA9 A;  4XZC A;  3ZN1 B;  3POX A;  3JC6 D;  4E1S A;  5C8Y E;  3NZQ A;  4GIW A;  2PG8 A;  5CB4 E;  3CKD A;  4H9R C;  5KDM C;  2LJL A;  2F1T A;  2FGR A;  2NW7 A;  3E0Z A;  4ZHQ E;  4AYN A;  2WMN A;  3S4U A;  2PRN A;  4PK5 A;  1Q9G A;  1GFM A;  5IHY A;  2ZM2 A;  1ZHW A;  5HWX A;  3QRA A;  3AA1 A;  4GYR A;  3J9X 1;  5JDM A;  4QXH B;  3ZCI A;  5M4Y A;  3EDU A;  3ZC0 A;  4JEU B;  3AA7 B;  5AFU K;  5JR9 B;  1OSM A;  2KZ7 B;  4ZI2 D;  2Q9Q B;  1CUN A;  2YIN A;  4ZS2 A;  4MBQ A;  3KVD D;  4UV9 B;  3DP7 A;  4NUV A;  2X9X A;  4PAG A;  1H7C A;  4ANJ A;  4GCP A;  2C5I T;  4AKL A;  2NTX A;  3HW9 A;  5FY7 A;  3N9N A;  4UXN B;  4IE5 A;  3HL6 A;  4CXX A;  4AYD C;  4ZI2 C;  3GP6 A;  2E9X A;  3RYC E;  2Q9Q D;  1ZHT A;  4O4L E;  3RYH E;  4NUU A;  1BXW A;  3UUL A;  2WM9 A;  3ZMV B;  3EUH A;  4AKR B;  4UF0 B;  2IC9 A;  3I9Y A;  4BUM X;  3CQC B;  3SYS A;  4UVB B;  3H37 A;  1LVF A;  4RLC A;  1D1A A;  2VL8 A;  3U3I A;  5IYZ E;  1OWA A;  2XUE A;  5JH7 E;  5LG4 A;  2X9H A;  1BR0 A;  2LHR A;  4UIG A;  3VY8 X;  2LOS A;  2Y8D A;  5F8P A;  4BJN A;  1YKH B;  2F1V A;  2Y2X A;  1S94 A;  2DWG A;  2E9X C;  2XAH B;  4ISS A;  3RBH A;  2NWB A;  2L3L A;  2B1E A;  4WBN E;  3B57 A;  3BQL A;  4EXT A;  2MBG A;  2KLQ A;  5JRC B;  4LSI A;  4O2B E;  3UTK A;  2KC0 A;  1MMN A;  2Y0K A;  4UV8 B;  3I0Q A;  5LNK A;  4J2C A;  2KXP B;  2JMK A;  2NW8 A;  3FBL A;  3HR0 A;  1UX4 A;  4YLH A;  4EZ4 A;  2WSS V;  3HKC E;  5FXV A;  4RLB A;  3P8C D;  3RYF E;  5JDH A;  1HF8 A;  2C5J A;  1WRD A;  4H9O C;  4CI1 B;  4N59 A;  3N2K E;  3NRY A;  4C91 A;  2CCQ A;  3WI4 A;  2X51 A;  3ETU A;  5FY0 A;  1ZKE A;  2MYS A;  4YJ2 E;  5JRC A;  3DJB A;  1FMW A;  4O4H E;  3ZYK A;  4AKG A;  5FY1 A;  3FXD B;  2HPJ A;  3Q9D A;  2KIN B;  4IGU A;  4U9C A;  7PRN A;  1ZV4 X;  4UEM A;  3K8P C;  3FHN A;  1MMA A;  3DA4 A;  2W00 A;  4U72 A;  4GCS A;  2CXF A;  5ADX K;  4AKR A;  4JLE A;  2DLR A;  3O4X E;  3QUJ A;  2BZB A;  2IW5 B;  3WI3 A;  3E22 E;  3KBU A;  4QXC B;  2N2L A;  3PDY A;  1D0Y A;  2LSK A;  3RKO A;  5DL7 A;  5JDN A;  5EK2 A;  5T5F A;  4BA9 A;  4E7S A;  8PRN A;  4L9I A;  3J7Y q;  2XE1 A;  2BVL A;  4AKI A;  3RX6 A;  5FVN A;  4AKM A;  2LHF A;  3GWH A;  4O49 A;  2MOZ A;  4P0B A;  2CA5 A;  3PQU A;  2VKH A;  3N5L A;  4FZN A;  2XQY A;  5D5D A;  3HA4 A;  4QXB B;  2X27 X;  4XNL A;  2EHO C;  4E1T A;  2XAF B;  1GFO A;  4FJO A;  3UAQ A;  2K48 A;  2KDY A;  3SZD A;  4TZ4 C;  3EMN X;  5L3G B;  5LBM A;  4FT6 A;  4O3X B;  1ORM A;  3ZMT B;  4BJM A;  3C64 A;  3FYX A;  1HG2 A;  2JPF A;  4GK5 E;  3NZP A;  2XE2 A;  3BQK A;  4DBQ A;  4LSF A;  5LJN A;  3NSG A;  4QKN A;  2W0G A;  4PJL A;  4X1Y E;  3PUS A;  4HGA A;  2XG6 A;  5HYA A;  3AVR A;  3VE2 A;  3O1I A;  4YHJ A;  3RC3 A;  4AQF A;  1WR6 A;  3PU3 A;  2ZM8 A;  4KR8 A;  4C90 A;  1Z0P A;  2LSJ A;  2Y0L A;  4B61 A;  1PHO A;  3OYX A;  3G7G A;  2V7M A;  2LE8 A;  4DND A;  4CQI A;  2CM0 A;  1THQ A;  1BT9 A;  4U74 A;  3ANW B;  4FRT A;  4FUV A;  1KK7 A;  2JRK A;  3VZU X;  2VWA A;  1HTJ F;  2DWK A;  1B7T A;  3CX7 B;  2XE3 A;  2YPV A;  1PRN A;  3A5X A;  1X79 A;  4RJX A;  2IC6 A;  4HEA A;  4KRA A;  3ZMU B;  1HS7 A;  1MIV A;  3LK3 B;  4GYS A;  3AA0 B;  1WYC A;  3KBT A;  3L3P A;  5PRN A;  1O3X A;  3ZJ1 A;  4AFK A;  2Y0H A;  4ILU A;  1QJP A;  3L09 A;  5GV0 A;  2SPC A;  4PK6 A;  1EZ3 A;  2X67 A;  1MM5 A;  1QSD A;  2WWU A;  2LT3 A;  4YJ3 E;  3SS1 A;  2W80 C;  2XHE B;  3LK2 A;  2RP4 A;  1G8X A;  3LK3 A;  2CXD A;  5H6Q B;  3JTY A;  2KT9 A;  1ZHZ A;  4LSH A;  3I9W A;  3R84 B;  3VE1 A;  3WI5 A;  2XTL A;  4IHJ E;  3IHR A;  4DMV A;  4UEL A;  2JJ9 A;  5CA1 E;  3P7I A;  4XNK A;  2KMF A;  3ZYM A;  1ZHC A;  2UXX B;  3OJA A;  3CVR A;  4UVA B;  3HKB E;  3V8U A;  2Y48 B;  1V9D A;  2CXL A;  5H6R B;  3KVA A;  3K19 A;  3HKE E;  2ODU A;  2K0L A;  4GHB A;  4EOZ B;  4H9S E;  5EZY E;  2W61 A;  2VB6 A;  2H7V C;  2JMM A;  5JR9 C;  4ZI3 C;  4B6X A;  4X20 E;  4PK4 A;  5HWY A;  3O1J A;  5FNV E;  3I0O A;  3MK7 C;  3PUA A;  2PBI A;  1SA0 E;  3POQ A;  3HOE A;  3MKD A;  1D1C A;  3C51 A;  3ZCJ A;  4DBR A;  3MXZ A;  1BR4 A;  1BH3 A;  4HN9 A;  3AAI A;  3ZMZ B;  4ZI7 E;  1ZHY A;  2QTK A;  1U4Q A;  1US7 B;  4IE4 A;  4JUY A;  3SWH A;  4H9P C;  5JR9 A;  4AKH A;  5FYM A;  5A1L A;  3VZW X;  2JMH A;  1UX5 A;  3GA8 A;  3EDV A;  4PNI A;  2YK0 A;  3ZMS B;  1AJ3 A;  2VK9 A;  3KIN B;  4TV9 E;  1HX8 A;  2RA1 A;  4H9Q C;  3RRW A;  2CMR A;  5AFU L;  2V7K A;  4G75 A;  1IJ5 A;  3HI2 A;  3TKL B;  4WW0 A;  2XTR A;  5LGN B;  3N2O A;  4EB6 E;  5LHH B;  3H3A A;  4AZL A;  2C5K T;  2J4U P;  2CLY C;  3VKH A;  1MNE A;  3CPZ A;  5EK4 A;  4FI5 A;  4HKA A;  5EE2 A;  2N1G A;  2N9D A;  4H9N C;  1YW0 A;  4QWN B;  3O0E A;  3GMI A;  5J2U E;  5JDP A;  4KBM B;  1OPF A;  1IJ6 A;  4UF0 A;  4X1I E;  3CWZ B;  2POR A;  4AYE C;  3KDS E;  4PW8 A;  5FXX A;  3OKQ A;  3AA0 A;  1UCU A;  2NP9 A;  3Q2M A;  3V5S A;  5DL6 A;  4JFB A;  2CLY B;  4AXP A;  4P0A A;  5DL5 A;  4KUM B;  5LGT B;  4TX5 A;  5L3C B;  5HXS A;  2Y6X A;  3F31 A;  4KR4 A;  1OXZ A;  5F3J A;  2LOP A;  2E8I A;  1KNZ A;  3ZJ2 A;  3SRZ A;  2K4T A;  2ES0 A;  3RRC A;  2JQQ A;  3UUM A;  5HXH A;  3C98 B;  4CZZ B;  1SHZ C;  4TN7 B;  2VAS A;  4MAL A;  4EAH A;  1E54 A;  4P09 A;  2G0U A;  4FSP A;  4A56 A;  4JEH B;  2WMO A;  3AA7 A;  3MZK B;  2J1D G;  5JVD E;  4PJM A;  2ZFG A;  3HKD E;  4ZI3 D;  3NBX X;  5L3B B;  4O3Y A;  1U5P A;  3LG7 A;  4BAY B;  2C0S A;  5HXC A;  4H63 V;  4GF4 A;  2D2S A;  4XBF B;  4TUY E;  4G76 A;  3N2G E;  1S35 A;  3NRX A;  1MND A;  5FXW A;  3K3Q C;  4CXY A;  2Q9Q C;  4KMC A;  2N2M A;  3KV9 A;  3VKG A;  2VKD A;  1IZN B;  4OYJ A;  4EYY R;  4RJW A;  2V7I A;  1LVK A;  4I50 E;  4KP3 C;  3U78 A;  3ZN0 B;  1HG5 A;  3POU A;  3KV5 A;  3BQI A;  3MAC A;  2A2F X;  1HFA A;  2HPL A;  2DNX A;  4FES A;  5HXR A;  4CI3 B;  2Q9Q A;  2GE4 A;  3OYZ A;  3VY9 X;  3QK6 A;  5LBQ B;  2K5B B;  3F2E A;  1HXT A;  3POR A;  4OFZ A;  1HCI A;  3B13 A;  1GFQ A;  4OK0 A;  3N9L A;  4YFS A;  4HE8 A;  4OYK A;  5JQG E;  4UVC B;  4QQ1 A;  2DI4 A;  1E1H B;  4C69 X;  4I55 E;  2QA7 A;  4MLK A;  5JRE A;  5JDF A;  5DL8 A;  3TZG A;  4IE0 A;  2ODV A;  4WBO A;  4ASK A;  2XAJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...