3LK42

Crystal structure of capz bound to the uncapping motif from cd2ap
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
242
structure length
238
Chain Sequence
DQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQERTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of a capping protein interaction motif defines a family of actin filament regulators
doi rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
total genus 78
structure length 238
sequence length 242
chains with identical sequence 5, 8, B, E, H, K, N, Q, T, W, Z
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lk4201
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3lk4202
2KXPA 3LK2B 3AA6A 3AA0A 5AFUK 3AAEB 3AA7B 3AAAA 4AKRA 3LK42 5ADXK 4AKRB 3LK41 3AA0B 3AAAB 3AA7A 2KZ7B 5ADXL 5AFUL 3AAEA 3LK3A 3AA6B 3LK3B 3LK2A 2KXPB 3AA1B 1IZNB 1IZNA 2KZ7A 3AA1A
chains in the Genus database with same CATH superfamily
3LK2B 2WQYA 2YEVC 1HXXA 2XQ5A 2AXTO 4DV4T 2JQQA 2R88A 3GN5B 3KDSE 3UU8A 2LFUA 4MBQA 4AISA 3MA9A 4WBNE 1YXRA 4F6RC 2ZMAA 2W80C 5DL8A 1S35A 4I43B 3ZN1B 3PJAJ 4F4BA 3DA3A 4B3TT 4X1YE 3DZMA 4K3BA 1E7PA 3KZIO 5LB7B 1U4QA 2C0SA 3LK3A 4TUYE 4O4HE 2MYSA 4KHZF 3WAKA 2MTQA 2YN6A 1CHUA 4CI1B 4PAGA 3F57A 2N2NA 3RF1A 4L5GA 4O2BE 2BG9E 1MM5A 5H6QB 4KR8A 4LFBT 5F8PA 2Q9QD 2UXBT 2IAKA 3AA1A 3M3ZB 5AQJB 3JC6C 4QX7B 3B57A 2XQ4A 3NSGA 4AKLA 3KV4A 3FZFB 2XQ9A 4L9IA 4O8SA 5JDFA 2W67A 2WMNA 4FUVA 3FBZA 1B7TA 2CM0A 5M4YA 3SYSA 3LFMA 2UXDT 2LM9A 3VKHA 1UGOA 3DWOX 3RRWA 4QH4A 1QUUA 5JDNA 2CWYA 1Y01A 4LFAT 2BKOA 5HXEA 3CX8B 4LFCT 4FRXA 2Y2XA 4H63V 4AYMC 3OPCA 2H7OA 5ADXL 3R84B 4LMJA 1VCSA 5FL1A 2Y8DA 3ETVA 5J2TE 2MAWA 2KNDA 3ZN0B 6PRNA 2X66A 4YJ3E 2R6GF 2XQ8A 3VZUX 3AVRA 4FZLA 5CB4E 4ILUA 2CLYB 3ZEFB 4DR4T 3UAQA 1J5ET 4GYSA 1W9RA 3SFDA 5AQFB 4HFDA 3RYIE 5HWXA 1T16A 1X9BA 3EDVA 3AEAA 4O3WA 3RYHE 3ABVA 3L39A 3CKDA 5LYJE 4JV5T 4OX9T 2WY2A 3EABA 4DR7T 2DWGA 5DL7A 4KP3C 2WDVA 3HOLA 5IYZE 1W09A 3PTRB 5JDMA 2XZEA 3SYBA 4HE8A 3U78A 5ABEA 4O3ZA 5FY7A 5E79O 5B5EO 4AKHA 4QQ1A 3AB3B 4FRTA 1UX4A 5L2LA 2XHEB 3P4SA 3P8CD 3A8YC 3FZHB 4LSHA 5HXHA 5LGTB 1KNPA 3VY9X 3MACA 3T24A 4B3MT 4HFVA 5LNKA 5AQIB 4QXCB 2XY8B 1WCRA 3KINB 4YY3T 4AI6A 2VL0A 4ZS3A 2XAFB 4KMCA 3AEFA 2L9QA 3LDQB 4DR6T 2VQFT 4O4XA 1T72A 1ZHCA 3OKQA 1GFPA 4I4TE 4ISTA 2GK9A 4ILBA 5FXWA 3CMLA 5T5FA 2G0UA 4CI2B 2LT3A 3KVAA 4TNVA 3QRAA 3WU2O 2SPCA 4CXXA 4BAYB 3WI4A 5AFUL 1QJPA 4NXMT 3K19A 4FQEA 3CQXC 1HF8A 3ONJA 2WWVA 2JMHA 4YT0A 5HWYA 4C90A 4FZMA 5IYUA 3WI5A 3UUNA 1P4TA 5EK2A 4DR3T 4UVBB 3IF8B 1FMVA 2E9XA 4PUXA 2LSYA 3A2SX 2NW7A 3NZQA 1GFNA 5AQOB 3AEBA 4JI5T 4B3RT 2IMLA 5DABA 3P4PA 1SUMB 3DWNA 2XQ6A 2EHOA 4KX6A 1U5PA 3OJAA 4LF4T 4U2YA 3H3MA 2F1VA 4P0AA 2XTLA 3P50A 4IGUA 4DV0T 4FT6A 1NWMX 4X1IE 4QHOA 5HEJA 4N59A 1IBMT 2LOPA 2IW5B 4IL6O 1WR6A 3EAMA 3PU8A 3UUBA 4HWCA 3A0HO 2WDQA 2K24A 5LOVE 2XSBA 2X68A 4YTNA 5DQVA 2BVLA 4AYDC 3A7MA 2W62A 5HEUA 1VOMA 3CX7B 4BJNA 4DR5T 4IT4A 4DNDA 2DNXA 4FJOA 4TNWA 3SY9A 1LVKA 2XE1A 2R4OA 2XTRA 4CTDA 2CRBA 4ADZA 1UK5A 1D0XA 1E2AA 4JUYA 2WZIA 2X9KA 2E8IA 5KMGP 3TLVA 4DIDB 2KC0A 4M1PA 3K3NA 4CI3B 2WP9A 4GIWA 3VZTX 1PHOA 5DL5A 1WYBA 1WYCA 2D0UA 5LMUT 5DQWA 2JMKA 8PRNA 4AKRB 2W61A 4IDNA 3KVDD 1G90A 4H9RC 1IZNB 3HI2A 3PGUA 3HKEE 5JR9A 4YSXA 4GYRA 1XDPA 2DWKA 5IHYA 1ZP0A 2W00A 2XMXA 5FY1A 4E7ZA 5G3AA 4FSPA 2IWVA 4UIGA 2I6HA 4QXHB 1OXZA 3AA7B 4E1TA 4AKRA 4PK6A 2XQ3A 5L3EB 3Q5WA 4HGAA 1WLXA 4AKIA 2CBIA 2B76A 4G63A 3SY7A 1OPFA 3FHNA 4IDQA 4AZLA 1SHZC 2WZHA 2YKSA 3UUXB 3N9OA 1ZV4X 4NXNT 4IE0A 2F4VT 2V7IA 3ZKRA 4HFEA 5LHIB 3B5MA 4XAXB 1YQ4A 4JI4T 1T1LA 3OBVE 1HNXT 1E1HB 5HEHA 2NW9A 3N2OA 1HCIA 3PUWF 4GHBA 1R8IA 1X79A 3I9WA 2Y0LA 3W15B 2JJ9A 3RIUC 3I0OA 4ZZCA 3FXEB 4TWHA 1OWAA 3DA4A 3H37A 2CWOA 3IBPA 5JRCA 3QUJA 1T7SA 4NIQA 1OSMA 5JDHA 5HXCA 3V8UA 4PFOA 5GTIO 3RC8A 5LHHB 1KF6A 2UUBT 2J62A 3PQUA 2IWWA 1BR2A 5HEOA 2A3DA 1BR1A 3IHRA 2FJDA 1US7B 1YQ3A 5F3JA 5FVKA 5FXZA 4AKMA 1EZ3A 2ZM8A 1YKEB 1Y64B 3K3OA 4EEDA 3EMNX 4HFHA 4OFZA 4HFCA 4GOUA 2ZM6T 2ZM0A 3PF1A 3Q5XA 2C5KT 2WMOA 3JADA 4IL4A 4MALA 3UU3A 3CWZB 4UF0B 5LJNA 2MNHA 1YW0A 3UQ4A 2WWUA 1AJ3A 1Z0PA 2LHRA 4JEUB 3ZCJA 2J4GA 3UU5A 2JRKA 4KI0F 4X65T 4CXWA 2KLQA 3FZKB 1YKHB 1Q9GA 1IBKT 3T0SA 5FP3A 4FOZA 2ZLYA 4ZZBA 4EAHA 1ZHWA 3CX6B 3DTOA 1LRZA 2W0GA 7PRNA 4HWDA 4EOZB 2NWBA 4DUZT 2YOEA 3AEEA 2I0MA 2IC9A 3KBUA 3WI3A 2VVNA 2Y7SA 5FMNA 2XAHB 4D64A 2IIUA 2M6BA 2CXFA 4QWNB 5EE2A 4OK0A 3BRZA 2DL1A 1NEKA 2W4XA 3UT5E 3O4XE 2LJLA 2BVMA 4I55E 3VHLA 5ADXK 3RQWA 3RRCA 4X64T 4X5TA 4B6XA 2RP4A 1ZHXA 2Y0KA 3RKOA 4O4LE 2F1TA 1MPFA 2WB5A 4U33A 2LRLA 3JC6D 3VRAA 2BKPA 5AQPB 5FNVE 1OEDA 4O49A 3AAEB 2ODUA 3ZT5A 2BG9A 4DMWA 3RQUA 2K48A 4U3CA 4HFIA 2X9YA 1FEWA 4U31A 5LMNT 5HCMA 3C64A 1J1JA 2QTKA 2XUEA 3VU7H 3LK3B 2JMMA 4RJWA 4DBQA 2UXNB 3VKGA 2W63A 4ZI3C 3OYZA 2Q9QA 2UXCT 4UVAB 4FESA 3PUYF 3ZYMA 3O1IA 4EV6A 2BZBA 3ZC1A 5AQRB 1E54A 1WRDA 4A56A 2LKGA 4Q25A 3TLUA 4P1NA 1GFOA 1HX8A 4LF9T 1T8BA 3O1JA 5C8YE 2IHR1 2IDOB 4DV1T 4DV2T 4AQFC 4JFBA 4GK5E 4HFBA 5EK3A 3ZT6A 1H7CA 5AQNB 3POQA 4EB6E 1V9DA 2H7VC 4C4VB 3UFGA 3CPZA 5D5DA 4AYEC 4LMLA 5LG3A 1ZHTA 2XQAA 3AE9A 1HG2A 3Q9DA 3UU2A 2EHOB 2QGSA 4ZHQE 4CQIA 2R8AA 2R4NA 5CA0E 2EHOD 5JR9B 5H6RB 4YXDA 3CIRA 3VY8X 3NBXX 2FJAA 3BQKA 5AQSB 3A0BO 3RIAA 2N9DA 5A1LA 3TLSA 2XSAA 4IE7A 3C5OA 3AE7A 2WS3A 3HL6A 3ONXA 3N2GE 3HWBA 5AQTB 4KR4A 4UELA 2XG6A 3TLTA 3AEDA 3P4RA 3AE1A 2NOXA 4O4UA 2CXLA 2XQ7A 2VB6A 2B1EA 3RLFF 1J5WA 4JI3T 1KNRA 5HXSA 4BUMX 5ABGA 2X9HA 4EYYR 2N1GA 2YU1A 3MKDA 2Y48B 1MNDA 3ZMSB 3E0ZA 3L8RA 1GFMA 5AFUK 2ERVA 2D2SA 2WSSV 2BBHA 3DP7A 2A9UA 2KT9A 4AYNA 1N33T 2BG9B 2E5LT 2V6YB 2N2LA 5GTHO 4BA9A 4Z91A 3KBTA 2VVSA 4UV9B 1HXUA 2MHLA 3IA3A 5G39A 2WDRA 4IREA 3MJXA 2V7JA 3PE0A 2OMFA 2ES0A 1XNQT 2V7LA 3ETUA 3AA0B 4LSFA 3WAJA 3ZMZB 3ANWB 4IDOA 4A5XA 3UQ7A 4DUYT 2PFVA 4G2AA 4X20E 4H63H 3SOLA 1D0YA 2W81C 3EHZA 3S4UA 3N5LA 4FZNA 4LF7T 5KAFO 4WZXA 2KDYA 4YJ2E 3PUSA 2CLYC 4TZ4C 1W0BA 5J1GA 2VK9A 2JQ9A 5J2UE 2WM9A 1UX5A 4EYUA 4ANJA 4J2CA 2E9XD 1H6S1 5HYAA 2LSIA 3OTOT 1FMWA 1QLBA 3UULA 3UU6A 3T20A 3ZJ1A 3ZMUB 4U72A 5JDPA 3RIFA 4TN7B 2V1DB 3ZMVB 4GCSA 1Z8UA 5L3FB 3KVBA 4IL9A 1HR0T 3FBLA 3N9QA 3H3AA 1HNWT 1MM4A 2BS2A 2BS3A 1BR0A 3ZSTA 4LF8T 5KAIO 5CA1E 3AAEA 4IE6A 2M6IA 2KXPB 1SE7A 3RIUA 3PDYA 5J0ZA 2HHHT 3QNUA 4JI0T 3T1YT 2WVPA 4HWHA 4PK4A 4H9SE 1UUSA 5CJ5A 3CQGB 2YK0A 3ZYKA 5PRNA 3PU3A 2KSRA 5TISO 5JQGE 4AYID 4ZI2C 1IJ5A 2HH7A 2JQYA 4H9NC 3CK6A 4UVCB 4AQYT 2JQHA 4DR1T 4O3XB 2M67A 3AE3A 4K0UA 3SFEA 3D0TA 4HTEA 3PUQA 2RPAA 4UEMA 4ZI3D 5B66O 2X0LB 1QJ9A 4MHCA 3I9YA 2D0TA 3SZDA 3HOEA 1WFDA 4KUMB 1HG5A 3ZPOA 2XM1A 3LBXB 1UCUA 4RLCA 2BDEA 5LBMA 3O0EA 2QYWA 3MXZA 3RI5A 1BXWA 3FB2A 1IJ6A 4CN6A 4MLKA 5L3CB 5CGMA 3NJTA 3OVUA 3ONLC 5AQHB 2XQYA 4DR2T 5AQQB 4IE4A 1SA0E 1M62A 4V1Av 1MMDA 4DVDA 2E9XC 3U3IA 2V26A 3N9MA 2KZ7A 3AEGA 4YSZA 2LSGA 5JDLA 3POXA 5DL6A 1N34T 3FZMB 4DV7T 5LBQB 3KFWX 3A5XA 4IE5A 3HKCE 2XE3A 4EEBA 1NENA 3NWIA 3VZWX 5BR8T 1XNRT 1MIVA 3IEEA 2LEHA 4N78D 2VKOA 2CPTA 1D1AA 1XZYA 5JTGA 2NTXA 3SS1A 4H9OC 2NW8A 3MK7C 2N2MA 2BG9C 2W66A 5EZYE 4Z90A 2LKHA 1OEDE 2GE4A 3ESLA 1YS5A 1FJGT 3MZKB 4QX8B 3RGLA 3AA0A 4OYJA 4O3YA 5CFBA 3RPUA 4EZHA 2OLTA 2CHNA 4DV5T 4RL9A 1T98A 2ACXA 2RA1A 3LK41 3AAAB 4D5UA 2C5IT 1ZEEA 2K3WA 2A72A 2XTQA 5BMVE 5KXJA 4YFSA 5JDGA 4JYAT 3OYXA 3PGSA 5L3GB 3RX6A 4ERRA 2V6YA 1BH3A 5EK4A 2DLRA 2WU2A 4X1KE 4ZI7E 5LP6E 4IIJE 2CCQA 4N58A 2YU2A 3N9NA 4WBOA 3R6NA 2K5BB 4IHJE 4ZS2A 1HXTA 4H9QC 1OEDC 3GN5A 4HWFA 2PJQA 5AQUB 4Z3TA 5G26A 4LMKA 1M7KA 3E08A 3LK42 3K1SA 3ZMTB 3TLWA 4YTMA 1XDOA 2R89A 3LK2A 4XBFB 1HTJF 1ZHZA 5LHGB 2CMRA 5L3DB 3I1AA 4E7SA 1YD8G 4YHJA 2BS4A 4CZZB 2YDSA 2YDQA 2LRKA 4CN4A 2W2UA 4U2ZA 1OEDB 4OHFA 4UXNB 3CVRA 4JI2T 4JI7T 2X27X 3AA1B 4G76A 3HA4A 3LG7A 2OV9A 4YTPA 3AA6A 4JI6T 3HKDE 2CXDA 2KMFA 4U7IA 5TAOA 1HX1B 2MOZA 1MNEA 4G75A 3HKBE 5FVLA 2R4LA 3VRBA 3ZT7A 4AQGA 3NRYA 4QXBB 3POUA 4PNIA 4E1SA 2LE8A 4L0RA 3N9PA 1KNZA 3LBXA 4JI8T 3P4QA 2CEAA 4PW8A 3B13A 1S5LO 3C4WA 5FY0A 2LOSA 2XAQB 2JQKA 1THQA 5LGUB 4PJNA 3TZGA 3BS0A 3GWHA 2K0LA 2PBIA 2QVAA 2KZ7B 3LJCA 1MIYA 1NAFA 5C2TA 1KK7A 4DMVA 1D1CA 2JIWA 1QJ8A 1I6ZA 3L09A 4HN9A 3X1DA 4PFPA 2LM2A 4P0BA 2YNKA 2LSKA 5GV0A 4ILAA 2HPLA 2QA7A 2C5JA 3NRXA 2Y6XA 3N9LA 4JLEA 4YSYA 4EZ4A 2V5CA 5LCYA 3FZLB 1UURA 2E5VA 3JTYA 4TV9E 3UFEA 3K8PC 3SRZA 5G38A 3ZC0A 3SZVA 2WU5A 2VL8A 5ABHA 3CQCB 2LLYA 2CE7A 4DV3T 3PUZF 3JAEA 2NTYA 4KBMB 4CXYA 4D65A 2MPKA 4NUVA 3AE6A 4U7YA 1D0ZA 2FJBA 2KINB 2XAJB 2K4TA 4AFKA 4K3CA 3ZSSA 1XMQT 1BR4A 2CBJA 4GK0E 2YINA 4PJLA 2X9XA 5HEGA 4QKNA 5FXVA 5LG4A 2PG8A 3Q5EA 2VASA 2ODJA 3NVOA 2DI4A 4AQFA 1N36T 2WJRA 3QRCA 2WJQA 4TWFA 4ASKA 1ZHYA 1Q9FA 2CA5A 4XNLA 4EGWA 3VR8A 3AA7A 2XE2A 3RBHA 4A98A 4TWDA 2H88A 3RYCE 3PQSA 2X0YA 3AA6B 1O3XA 4PJMA 2L3LA 2FGRA 5HAXA 4RLBA 5FVNA 4U74A 5FYMA 5C3JA 3PV0F 4LSIA 2PORA 2F1CX 2VKDA 3PUAA 3N2KE 3UPGA 1BT9A 4TX5A 1VCTA 5FKYA 3RYFE 1N32T 1LKXA 4ZOLE 4X66T 3VE2A 4C4VA 4X62T 1QSDA 3Q5DA 1IZNA 4UB6O 3RKGA 4DO0A 5IWAT 3BQLA 4C69X 3RC3A 4IDPA 2PTFA 5AQKB 2K9AA 3G06A 4P09A 2QRXA 4HKAA 3AVSA 3BQIA 5FXXA 4NUUA 3ANWA 1G73A 5KX5E 3T8OA 3C50A 3G7GA 3NZPA 4C00A 4PJ0O 4WW0A 2VURA 3QC9A 4LSEA 4NPPA 3KV9A 2UXXB 3Q2MA 4QH1A 3AXJB 3J7Yq 3UTKA 4MFRA 5AQMB 4AUIA 2MBGA 4CN1A 3C4ZA 2V7KA 4YLHA 4AKGA 2XM2A 3F2EA 1GQEA 3EI0A 2AE9A 2CHOA 3AE2A 3O9XA 5LGNB 2M07A 3RHWA 3AXJA 3KV6A 2M06A 3PJAA 4DV6T 4KHPT 3L3PA 2V6XA 2XASB 2H3RA 3DJBA 3O1HA 4UR9A 4O2AE 2XPKA 2UUCT 3AAAA 3ZLIA 2H89A 3HW9A 3P4WA 2XAGB 2V7MA 2XE5A 4JBWF 3UU4A 4H9PC 5L4EA 3FYXA 3EVYA 2EHOC 3BRYA 2WBLA 1I94T 2KWHA 3BK9A 5F5WA 4LF6T 4O4JE 3GMIA 2AXDS 2HPJA 5LJMA 4YHHT 3C51A 4BJMA 2BKNA 3GA8A 4IDZA 3JAFA 2LSJA 2X67A 4JCHA 2VQET 2WAUA 1W0AA 3QOFA 4EIWA 4GF4A 2O4VA 3JCUO 2R4PA 1ORMA 2J47A 2VKJA 1IBLT 4UB8O 4U9CA 2Q9QB 4QH5A 3KV5A 3TKLB 1D1BA 2HN1A 4B3ST 5ABFA 5DJQC 1HFAA 2D9DA 3K3QC 2Z6EA 4PR7A 3F31A 1HNZT 2NP9A 3PURA 2NR4A 3PUGA 5FL0A 3HR0A 3SWHA 4WNKA 4XNKA 4PJJA 1PRNA 3GP6A 5JR9C 4GKJT 4HWIB 4GCQA 4O4IE 3E22E 5KDMC 1FIOA 2ODVA 2ZM2A 2X51A 3C98B 5JVDE 5IUXA 2Q9QC 1L0VA 2DCFA 3EDUA 1IAPA 2DHRA 4I0UA 4B61A 1DU2A 2VKHA 1XMOT 2A2FX 5E0OA 5JH7E 3AE8A 5ETWA 4N75A 5JREA 2BBJA 2P9BA 2UUAT 1HS7A 4N74A 3PUVF 3T1HT 2FGQX 2FJEA 2ZLDA 2KXPA 3ZCIA 4UV8B 4I50E 1MMAA 3C4XA 2X0HA 2J1DG 4KRAA 1S94A 2VWAA 5HCJA 4LF5T 4TV8E 2L8KA 4ILCA 1ZKEA 2Y0HA 3RH3A 3V5UA 3ZYLA 4FSOA 2D5UA 4FMSA 2FUPA 1KFYA 2ZFGA 5LXTE 2XJ7A 1ZOYA 3PGRA 3AECA 3VR9A 1JNRA 1MMGA 3VE1A 2V5DA 4C91A 4ZEYA 3AE5A 5HXRA 4A97A 2UU9T 3EUHA 4JEHB 4AXPA 1MMNA 4PK5A 3M65A 4Z8XA 2YDRA 3AE4A 5AQGB 4UF0A 2E9XB 4COFA 4GKKT 1MIWA 1G8XA 2J4UP 2PRNA 4AIUA 5JDQA 3JCFA 3P7IA 2HN2A 3QB5K 2IUBA 5L47A 1JNZA 4XZCA 2FBWA 3NKZA 3FXDB 5AQLB 4FI5A 2WCAA 2ACZA 3J9X1 4ISSA 3AAIA 3V5SA 1XWMA 2LHNA 2JPFA 2IC6A 3QK6A 5H2FO 5ABFB 2OA5A 3PUXF 4RJXA 2LHFA 2KWIB 4ZI2D 1LVFA 3I0QA 4DBRA 3PRNA 1VRBA 5LA6E 3PORA 5JRCB 3ZJ2A 4OYKA 2E2AA 4WYVA 4JI1T 5L4HA 4HEAA 4EXTA 1WR0A 2I59A 5AQVB 2J1NA 1CUNA 3UUMA 4ZXLA 2V8SV 4GCPA 5L3BB 4K0KT 1GFQA 5GONE 3QB5A 1KEYA 2X9WA 4F8HA 3LSVA 2YPVA
chains in the Genus database with same CATH topology
3LK2B 2KINB 2XAJB 4UIGA 2YEVC 2PFVA 1HXXA 4G2AA 4X20E 2K4TA 4AFKA 4H63H 3SOLA 1D0YA 2W81C 4QXHB 1OXZA 3AA7B 2JQQA 4E1TA 4AKRA 3S4UA 3N5LA 4PK6A 4FZNA 5L3EB 2KDYA 3Q5WA 4HGAA 1BR4A 4YJ2E 4GK0E 2YINA 1WLXA 3GN5B 4PJLA 4AKIA 2X9XA 3KDSE 2LFUA 3PUSA 4G63A 2CLYC 4MBQA 4QKNA 3SY7A 4TZ4C 1OPFA 5FXVA 5J1GA 2VK9A 3MA9A 3FHNA 4WBNE 5J2UE 2PG8A 2WM9A 5LG4A 2VASA 4AZLA 1UX5A 1SHZC 4F6RC 2ODJA 4EYUA 2ZMAA 2W80C 3UUXB 4ANJA 3N9OA 2DI4A 4AQFA 5DL8A 1S35A 1ZV4X 4J2CA 2E9XD 3QRCA 4I43B 5HYAA 1H6S1 3ZN1B 4IE0A 2V7IA 2LSIA 4ASKA 1ZHYA 1Q9FA 4F4BA 1FMWA 2CA5A 3DA3A 3UULA 3T20A 4X1YE 4XNLA 3ZJ1A 5LHIB 3ZMUB 4U72A 3AA7A 5JDPA 2XE2A 4TN7B 3RBHA 1U4QA 3RYCE 2V1DB 3ZMVB 4XAXB 3PQSA 2C0SA 4GCSA 3OBVE 3AA6B 3LK3A 1O3XA 4PJMA 4TUYE 1E1HB 2L3LA 5L3FB 3KVBA 3N2OA 4O4HE 2NW9A 1HCIA 2FGRA 2MYSA 5HAXA 4GHBA 4RLBA 1X79A 3FBLA 5FVNA 3WAKA 2MTQA 4U74A 3I9WA 5FYMA 2Y0LA 4LSIA 2PORA 4CI1B 4PAGA 3W15B 3F57A 3N9QA 2N2NA 2JJ9A 2VKDA 3H3AA 3N2KE 3PUAA 4L5GA 3I0OA 3UPGA 4O2BE 1BT9A 4TX5A 1MM4A 1MM5A 3RYFE 5H6QB 3FXEB 1BR0A 1LKXA 1OWAA 4KR8A 3DA4A 4ZOLE 3H37A 2CWOA 3IBPA 5CA1E 3AAEA 4IE6A 3VE2A 5F8PA 2Q9QD 5JRCA 2KXPB 1QSDA 3QUJA 1OSMA 5JDHA 2IAKA 1IZNA 5HXCA 4DO0A 3V8UA 3AA1A 3PDYA 3BQLA 4C69X 4PFOA 3RC3A 3JC6C 4QX7B 3RC8A 5LHHB 3B57A 2K9AA 3NSGA 4P09A 4AKLA 3PQUA 3KV4A 4HKAA 1BR2A 4L9IA 4PK4A 4O8SA 3AVSA 2A3DA 4H9SE 1BR1A 3CQGB 2WMNA 2YK0A 3IHRA 3BQIA 5JDFA 3ZYKA 4FUVA 5FXXA 5PRNA 3PU3A 1US7B 3FBZA 1B7TA 5F3JA 4NUUA 5JQGE 2CM0A 3ANWA 1G73A 5FXZA 4ZI2C 1IJ5A 5M4YA 4AKMA 4AYID 3SYSA 1EZ3A 2ZM8A 5KX5E 2HH7A 3LFMA 3T8OA 1YKEB 1Y64B 2LM9A 4H9NC 4UVCB 3VKHA 3K3OA 3C50A 3G7GA 3EMNX 4OFZA 3RRWA 1QUUA 4GOUA 5JDNA 4O3XB 2CWYA 3NZPA 2M67A 4K0UA 2ZM0A 3D0TA 5HXEA 3Q5XA 2C5KT 2WMOA 4HTEA 3CX8B 3PUQA 4UEMA 4FRXA 4ZI3D 2Y2XA 2X0LB 1QJ9A 4MHCA 3I9YA 2D0TA 4WW0A 3SZDA 4H63V 3HOEA 4AYMC 3QC9A 4KUMB 4LSEA 4MALA 2H7OA 1HG5A 3ZPOA 5ADXL 3R84B 3KV9A 2UXXB 3Q2MA 3CWZB 2Y8DA 3ETVA 3LBXB 4UF0B 2KNDA 5J2TE 1UCUA 5LJNA 2MNHA 4RLCA 3ZN0B 1YW0A 2WWUA 3J7Yq 2BDEA 4MFRA 3UTKA 5LBMA 1AJ3A 3O0EA 4AUIA 6PRNA 1Z0PA 2X66A 2MBGA 3MXZA 4YJ3E 1BXWA 2LHRA 4JEUB 3VZUX 3C4ZA 2V7KA 3FB2A 4YLHA 3ZCJA 4AKGA 3AVRA 1IJ6A 4MLKA 4FZLA 5L3CB 5CB4E 4ILUA 2CLYB 3F2EA 3ZEFB 3UAQA 2XQYA 2JRKA 3O9XA 4GYSA 5LGNB 2M07A 4IE4A 4CXWA 2KLQA 1YKHB 3RYIE 5HWXA 1Q9GA 1SA0E 4V1Av 1MMDA 3T0SA 5FP3A 3KV6A 4DVDA 2E9XC 3U3IA 4FOZA 2M06A 3EDVA 2V26A 3N9MA 2KZ7A 2ZLYA 3L3PA 2XASB 4EAHA 2H3RA 1ZHWA 3CX6B 3DTOA 4O3WA 3RYHE 3DJBA 3O1HA 1LRZA 2LSGA 2W0GA 5JDLA 4O2AE 3POXA 5LYJE 3CKDA 4E7ZA 5DL6A 3AAAA 3ZLIA 7PRNA 3HW9A 5LBQB 4EOZB 3KFWX 2NWBA 2DWGA 3A5XA 2XAGB 4IE5A 3HKCE 2V7MA 2XE3A 3KBUA 2IC9A 5DL7A 3WI3A 2XE5A 2Y7SA 4KP3C 3VZWX 5FMNA 4H9PC 3HOLA 5IYZE 2XAHB 4D64A 2CXFA 4QWNB 3FYXA 3EVYA 2EHOC 5EE2A 2WBLA 4OK0A 3PTRB 5JDMA 3SYBA 2KWHA 3BK9A 1MIVA 3IEEA 4HE8A 3U78A 4O3ZA 5FY7A 4O4JE 2LEHA 3GMIA 2VKOA 4N78D 3UT5E 3O4XE 2LJLA 4AKHA 2BVMA 2HPJA 4I55E 1D1AA 3VHLA 4QQ1A 5ADXK 5LJMA 3AB3B 3RRCA 4FRTA 2NTXA 3SS1A 1UX4A 4H9OC 2NW8A 2XHEB 3C51A 5L2LA 3MK7C 2N2MA 3P8CD 4BJMA 4B6XA 3GA8A 4IDZA 5EZYE 4LSHA 2LSJA 2RP4A 5HXHA 1ZHXA 3RKOA 4O4LE 5LGTB 2F1TA 3MACA 2X67A 1MPFA 2Y0KA 4JCHA 3T24A 3VY9X 2GE4A 3JC6D 4HFVA 5LNKA 3ESLA 1YS5A 2WAUA 4QXCB 3MZKB 4QX8B 3AA0A 5FNVE 4O49A 4EIWA 4GF4A 4OYJA 2O4VA 3AAEB 4O3YA 2ODUA 3KINB 3RPUA 4DMWA 1ORMA 4AI6A 2VKJA 2K48A 4EZHA 4ZS3A 2XAFB 2X9YA 1FEWA 1T98A 4RL9A 2ACXA 4KMCA 3C64A 2Q9QB 4U9CA 2L9QA 2RA1A 3LK41 4O4XA 3AAAB 4D5UA 2QTKA 2C5IT 3KV5A 1ZHCA 3OKQA 3TKLB 1GFPA 4I4TE 1D1BA 1ZEEA 2XUEA 4ISTA 3VU7H 2A72A 2XTQA 2GK9A 5BMVE 3LK3B 4YFSA 2JMMA 5JDGA 4RJWA 4DBQA 5FXWA 5DJQC 2UXNB 1HFAA 3CMLA 3OYXA 3K3QC 5T5FA 2G0UA 5L3GB 3RX6A 4CI2B 3VKGA 2Z6EA 4ERRA 2W63A 1BH3A 4ZI3C 3OYZA 3F31A 2LT3A 5EK4A 3KVAA 2NP9A 2DLRA 3PURA 3PUGA 4ZI7E 4X1KE 3HR0A 5LP6E 3SWHA 2Q9QA 4WNKA 3QRAA 4IIJE 4XNKA 4FESA 4PJJA 4UVAB 2CCQA 2SPCA 3ZYMA 4CXXA 1PRNA 4BAYB 2YU2A 3O1IA 3N9NA 4N58A 4WBOA 3WI4A 2BZBA 3ZC1A 3GP6A 5AFUL 1QJPA 3R6NA 5JR9C 1E54A 3K19A 1WRDA 4A56A 4GCQA 4O4IE 3CQXC 1HF8A 3E22E 5KDMC 2K5BB 1FIOA 4IHJE 4ZS2A 2ODVA 4H9QC 2ZM2A 1HXTA 2JMHA 2X51A 3C98B 5JVDE 2Q9QC 5HWYA 3GN5A 4C90A 4FZMA 5IYUA 3WI5A 2PJQA 2DCFA 1GFOA 1HX8A 3EDUA 1IAPA 2DHRA 4Z3TA 4B61A 5G26A 3UUNA 2VKHA 3O1JA 1P4TA 5EK2A 2A2FX 4UVBB 3E08A 5C8YE 3IF8B 5E0OA 1FMVA 5JH7E 3LK42 4AQFC 4JFBA 2E9XA 4PUXA 5ETWA 3ZMTB 4GK5E 2LSYA 5JREA 5EK3A 3A2SX 2NW7A 3NZQA 1GFNA 2P9BA 1H7CA 1HS7A 3LK2A 5DABA 3POQA 4EB6E 4XBFB 1HTJF 1ZHZA 2FGQX 5LHGB 2ZLDA 1V9DA 2KXPA 2H7VC 2CMRA 5L3DB 3CPZA 5D5DA 2EHOA 3ZCIA 1U5PA 3OJAA 4AYEC 1ZHTA 3I1AA 4UV8B 4I50E 4E7SA 1YD8G 4YHJA 4CZZB 1MMAA 3C4XA 1HG2A 3Q9DA 3UU2A 2F1VA 2EHOB 2QGSA 4P0AA 4ZHQE 4OHFA 4CQIA 2J1DG 2XTLA 4UXNB 4KRAA 1S94A 2VWAA 3CVRA 4IGUA 4FT6A 4TV8E 1NWMX 2L8KA 5CA0E 4X1IE 2X27X 2EHOD 1ZKEA 4QHOA 5JR9B 5H6RB 3AA1B 2Y0HA 4G76A 3RH3A 3HA4A 4N59A 3LG7A 2LOPA 3V5UA 3AA6A 3ZYLA 4FSOA 2D5UA 3HKDE 4FMSA 2IW5B 1WR6A 2CXDA 2KMFA 3NBXX 3PU8A 5LXTE 5TAOA 2ZFGA 3VY8X 2MOZA 3BQKA 1MNEA 4G75A 3HKBE 2N9DA 2K24A 5A1LA 1MMGA 5LOVE 2X68A 3VE1A 4IE7A 5DQVA 2BVLA 4AQGA 4C91A 3NRYA 4AYDC 5HXRA 4QXBB 3POUA 2W62A 4PNIA 4E1SA 1VOMA 3CX7B 3EUHA 4JEHB 4AXPA 1MMNA 4PK5A 4BJNA 2LE8A 3M65A 4Z8XA 3C5OA 4L0RA 3N9PA 3HL6A 1KNZA 3ONXA 3LBXA 2E9XB 4UF0A 4DNDA 2CEAA 3N2GE 2DNXA 3B13A 4PW8A 3HWBA 4KR4A 3C4WA 4UELA 5FY0A 2XG6A 4FJOA 1MIWA 2LOSA 2XAQB 3SY9A 1LVKA 2XE1A 2NOXA 1THQA 2CXLA 2XTRA 1G8XA 4O4UA 2J4UP 2PRNA 5LGUB 4PJNA 3TZGA 2VB6A 2B1EA 3GWHA 5JDQA 2K0LA 3P7IA 2PBIA 4ADZA 2KZ7B 4BUMX 1D0XA 5HXSA 4JUYA 3LJCA 1MIYA 1NAFA 1KK7A 2E8IA 1D1CA 4XZCA 4DMVA 5KMGP 1QJ8A 2X9HA 3MKDA 2N1GA 2YU1A 4M1PA 3L09A 4EYYR 2Y48B 4HN9A 2KC0A 3FXDB 3K3NA 1MNDA 4PFPA 4CI3B 3ZMSB 3E0ZA 4FI5A 1GFMA 5AFUK 4P0BA 2YNKA 3J9X1 2D2SA 2ERVA 2WSSV 4GIWA 4ISSA 3VZTX 1PHOA 2LSKA 3DP7A 5DL5A 5GV0A 1WYBA 2KT9A 4AYNA 3AAIA 2HPLA 2QA7A 1WYCA 2D0UA 2C5JA 3NRXA 3V5SA 2Y6XA 3N9LA 4JLEA 5DQWA 2JMKA 2LHNA 2N2LA 4AKRB 2JPFA 4BA9A 4EZ4A 8PRNA 3KBTA 5LCYA 2W61A 3KVDD 1G90A 4UV9B 2IC6A 3QK6A 2OA5A 1HXUA 3JTYA 4H9RC 4TV9E 2LHFA 2MHLA 4RJXA 2KWIB 1IZNB 3HI2A 4ZI2D 1LVFA 3I0QA 4DBRA 3PRNA 1VRBA 5LA6E 3UFEA 3K8PC 3HKEE 3PORA 3SRZA 5JRCB 3ZJ2A 5JR9A 4OYKA 3ZC0A 3SZVA 3MJXA 4HEAA 4EXTA 2V7JA 3PE0A 2VL8A 2I59A 3CQCB 2J1NA 2OMFA 2ES0A 4GYRA 1CUNA 2V7LA 3UUMA 2DWKA 2CE7A 3ETUA 3AA0B 5IHYA 4GCPA 5L3BB 1GFQA 2NTYA 5GONE 4LSFA 4KBMB 3WAJA 4CXYA 2W00A 4D65A 2XMXA 4NUVA 3ZMZB 2X9WA 3ANWB 5FY1A 1D0ZA 2YPVA 4FSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KXP A;  3LK2 B;  3AA6 A;  3AA0 A;  5AFU K;  3AAE B;  3AA7 B;  3AAA A;  4AKR A;  3LK4 2;  5ADX K;  4AKR B;  3LK4 1;  3AA0 B;  3AAA B;  3AA7 A;  2KZ7 B;  5ADX L;  5AFU L;  3AAE A;  3LK3 A;  3AA6 B;  3LK3 B;  3LK2 A;  2KXP B;  3AA1 B;  1IZN B;  1IZN A;  2KZ7 A;  3AA1 A; 
#chains in the Genus database with same CATH topology
 3LK2 B;  2WQY A;  2YEV C;  1HXX A;  2XQ5 A;  2AXT O;  4DV4 T;  2JQQ A;  2R88 A;  3GN5 B;  3KDS E;  3UU8 A;  2LFU A;  4MBQ A;  4AIS A;  3MA9 A;  4WBN E;  1YXR A;  4F6R C;  2ZMA A;  2W80 C;  5DL8 A;  1S35 A;  4I43 B;  3ZN1 B;  3PJA J;  4F4B A;  3DA3 A;  4B3T T;  4X1Y E;  3DZM A;  4K3B A;  1E7P A;  3KZI O;  5LB7 B;  1U4Q A;  2C0S A;  3LK3 A;  4TUY E;  4O4H E;  2MYS A;  4KHZ F;  3WAK A;  2MTQ A;  2YN6 A;  1CHU A;  4CI1 B;  4PAG A;  3F57 A;  2N2N A;  3RF1 A;  4L5G A;  4O2B E;  2BG9 E;  1MM5 A;  5H6Q B;  4KR8 A;  4LFB T;  5F8P A;  2Q9Q D;  2UXB T;  2IAK A;  3AA1 A;  3M3Z B;  5AQJ B;  3JC6 C;  4QX7 B;  3B57 A;  2XQ4 A;  3NSG A;  4AKL A;  3KV4 A;  3FZF B;  2XQ9 A;  4L9I A;  4O8S A;  5JDF A;  2W67 A;  2WMN A;  4FUV A;  3FBZ A;  1B7T A;  2CM0 A;  5M4Y A;  3SYS A;  3LFM A;  2UXD T;  2LM9 A;  3VKH A;  1UGO A;  3DWO X;  3RRW A;  4QH4 A;  1QUU A;  5JDN A;  2CWY A;  1Y01 A;  4LFA T;  2BKO A;  5HXE A;  3CX8 B;  4LFC T;  4FRX A;  2Y2X A;  4H63 V;  4AYM C;  3OPC A;  2H7O A;  5ADX L;  3R84 B;  4LMJ A;  1VCS A;  5FL1 A;  2Y8D A;  3ETV A;  5J2T E;  2MAW A;  2KND A;  3ZN0 B;  6PRN A;  2X66 A;  4YJ3 E;  2R6G F;  2XQ8 A;  3VZU X;  3AVR A;  4FZL A;  5CB4 E;  4ILU A;  2CLY B;  3ZEF B;  4DR4 T;  3UAQ A;  1J5E T;  4GYS A;  1W9R A;  3SFD A;  5AQF B;  4HFD A;  3RYI E;  5HWX A;  1T16 A;  1X9B A;  3EDV A;  3AEA A;  4O3W A;  3RYH E;  3ABV A;  3L39 A;  3CKD A;  5LYJ E;  4JV5 T;  4OX9 T;  2WY2 A;  3EAB A;  4DR7 T;  2DWG A;  5DL7 A;  4KP3 C;  2WDV A;  3HOL A;  5IYZ E;  1W09 A;  3PTR B;  5JDM A;  2XZE A;  3SYB A;  4HE8 A;  3U78 A;  5ABE A;  4O3Z A;  5FY7 A;  5E79 O;  5B5E O;  4AKH A;  4QQ1 A;  3AB3 B;  4FRT A;  1UX4 A;  5L2L A;  2XHE B;  3P4S A;  3P8C D;  3A8Y C;  3FZH B;  4LSH A;  5HXH A;  5LGT B;  1KNP A;  3VY9 X;  3MAC A;  3T24 A;  4B3M T;  4HFV A;  5LNK A;  5AQI B;  4QXC B;  2XY8 B;  1WCR A;  3KIN B;  4YY3 T;  4AI6 A;  2VL0 A;  4ZS3 A;  2XAF B;  4KMC A;  3AEF A;  2L9Q A;  3LDQ B;  4DR6 T;  2VQF T;  4O4X A;  1T72 A;  1ZHC A;  3OKQ A;  1GFP A;  4I4T E;  4IST A;  2GK9 A;  4ILB A;  5FXW A;  3CML A;  5T5F A;  2G0U A;  4CI2 B;  2LT3 A;  3KVA A;  4TNV A;  3QRA A;  3WU2 O;  2SPC A;  4CXX A;  4BAY B;  3WI4 A;  5AFU L;  1QJP A;  4NXM T;  3K19 A;  4FQE A;  3CQX C;  1HF8 A;  3ONJ A;  2WWV A;  2JMH A;  4YT0 A;  5HWY A;  4C90 A;  4FZM A;  5IYU A;  3WI5 A;  3UUN A;  1P4T A;  5EK2 A;  4DR3 T;  4UVB B;  3IF8 B;  1FMV A;  2E9X A;  4PUX A;  2LSY A;  3A2S X;  2NW7 A;  3NZQ A;  1GFN A;  5AQO B;  3AEB A;  4JI5 T;  4B3R T;  2IML A;  5DAB A;  3P4P A;  1SUM B;  3DWN A;  2XQ6 A;  2EHO A;  4KX6 A;  1U5P A;  3OJA A;  4LF4 T;  4U2Y A;  3H3M A;  2F1V A;  4P0A A;  2XTL A;  3P50 A;  4IGU A;  4DV0 T;  4FT6 A;  1NWM X;  4X1I E;  4QHO A;  5HEJ A;  4N59 A;  1IBM T;  2LOP A;  2IW5 B;  4IL6 O;  1WR6 A;  3EAM A;  3PU8 A;  3UUB A;  4HWC A;  3A0H O;  2WDQ A;  2K24 A;  5LOV E;  2XSB A;  2X68 A;  4YTN A;  5DQV A;  2BVL A;  4AYD C;  3A7M A;  2W62 A;  5HEU A;  1VOM A;  3CX7 B;  4BJN A;  4DR5 T;  4IT4 A;  4DND A;  2DNX A;  4FJO A;  4TNW A;  3SY9 A;  1LVK A;  2XE1 A;  2R4O A;  2XTR A;  4CTD A;  2CRB A;  4ADZ A;  1UK5 A;  1D0X A;  1E2A A;  4JUY A;  2WZI A;  2X9K A;  2E8I A;  5KMG P;  3TLV A;  4DID B;  2KC0 A;  4M1P A;  3K3N A;  4CI3 B;  2WP9 A;  4GIW A;  3VZT X;  1PHO A;  5DL5 A;  1WYB A;  1WYC A;  2D0U A;  5LMU T;  5DQW A;  2JMK A;  8PRN A;  4AKR B;  2W61 A;  4IDN A;  3KVD D;  1G90 A;  4H9R C;  1IZN B;  3HI2 A;  3PGU A;  3HKE E;  5JR9 A;  4YSX A;  4GYR A;  1XDP A;  2DWK A;  5IHY A;  1ZP0 A;  2W00 A;  2XMX A;  5FY1 A;  4E7Z A;  5G3A A;  4FSP A;  2IWV A;  4UIG A;  2I6H A;  4QXH B;  1OXZ A;  3AA7 B;  4E1T A;  4AKR A;  4PK6 A;  2XQ3 A;  5L3E B;  3Q5W A;  4HGA A;  1WLX A;  4AKI A;  2CBI A;  2B76 A;  4G63 A;  3SY7 A;  1OPF A;  3FHN A;  4IDQ A;  4AZL A;  1SHZ C;  2WZH A;  2YKS A;  3UUX B;  3N9O A;  1ZV4 X;  4NXN T;  4IE0 A;  2F4V T;  2V7I A;  3ZKR A;  4HFE A;  5LHI B;  3B5M A;  4XAX B;  1YQ4 A;  4JI4 T;  1T1L A;  3OBV E;  1HNX T;  1E1H B;  5HEH A;  2NW9 A;  3N2O A;  1HCI A;  3PUW F;  4GHB A;  1R8I A;  1X79 A;  3I9W A;  2Y0L A;  3W15 B;  2JJ9 A;  3RIU C;  3I0O A;  4ZZC A;  3FXE B;  4TWH A;  1OWA A;  3DA4 A;  3H37 A;  2CWO A;  3IBP A;  5JRC A;  3QUJ A;  1T7S A;  4NIQ A;  1OSM A;  5JDH A;  5HXC A;  3V8U A;  4PFO A;  5GTI O;  3RC8 A;  5LHH B;  1KF6 A;  2UUB T;  2J62 A;  3PQU A;  2IWW A;  1BR2 A;  5HEO A;  2A3D A;  1BR1 A;  3IHR A;  2FJD A;  1US7 B;  1YQ3 A;  5F3J A;  5FVK A;  5FXZ A;  4AKM A;  1EZ3 A;  2ZM8 A;  1YKE B;  1Y64 B;  3K3O A;  4EED A;  3EMN X;  4HFH A;  4OFZ A;  4HFC A;  4GOU A;  2ZM6 T;  2ZM0 A;  3PF1 A;  3Q5X A;  2C5K T;  2WMO A;  3JAD A;  4IL4 A;  4MAL A;  3UU3 A;  3CWZ B;  4UF0 B;  5LJN A;  2MNH A;  1YW0 A;  3UQ4 A;  2WWU A;  1AJ3 A;  1Z0P A;  2LHR A;  4JEU B;  3ZCJ A;  2J4G A;  3UU5 A;  2JRK A;  4KI0 F;  4X65 T;  4CXW A;  2KLQ A;  3FZK B;  1YKH B;  1Q9G A;  1IBK T;  3T0S A;  5FP3 A;  4FOZ A;  2ZLY A;  4ZZB A;  4EAH A;  1ZHW A;  3CX6 B;  3DTO A;  1LRZ A;  2W0G A;  7PRN A;  4HWD A;  4EOZ B;  2NWB A;  4DUZ T;  2YOE A;  3AEE A;  2I0M A;  2IC9 A;  3KBU A;  3WI3 A;  2VVN A;  2Y7S A;  5FMN A;  2XAH B;  4D64 A;  2IIU A;  2M6B A;  2CXF A;  4QWN B;  5EE2 A;  4OK0 A;  3BRZ A;  2DL1 A;  1NEK A;  2W4X A;  3UT5 E;  3O4X E;  2LJL A;  2BVM A;  4I55 E;  3VHL A;  5ADX K;  3RQW A;  3RRC A;  4X64 T;  4X5T A;  4B6X A;  2RP4 A;  1ZHX A;  2Y0K A;  3RKO A;  4O4L E;  2F1T A;  1MPF A;  2WB5 A;  4U33 A;  2LRL A;  3JC6 D;  3VRA A;  2BKP A;  5AQP B;  5FNV E;  1OED A;  4O49 A;  3AAE B;  2ODU A;  3ZT5 A;  2BG9 A;  4DMW A;  3RQU A;  2K48 A;  4U3C A;  4HFI A;  2X9Y A;  1FEW A;  4U31 A;  5LMN T;  5HCM A;  3C64 A;  1J1J A;  2QTK A;  2XUE A;  3VU7 H;  3LK3 B;  2JMM A;  4RJW A;  4DBQ A;  2UXN B;  3VKG A;  2W63 A;  4ZI3 C;  3OYZ A;  2Q9Q A;  2UXC T;  4UVA B;  4FES A;  3PUY F;  3ZYM A;  3O1I A;  4EV6 A;  2BZB A;  3ZC1 A;  5AQR B;  1E54 A;  1WRD A;  4A56 A;  2LKG A;  4Q25 A;  3TLU A;  4P1N A;  1GFO A;  1HX8 A;  4LF9 T;  1T8B A;  3O1J A;  5C8Y E;  2IHR 1;  2IDO B;  4DV1 T;  4DV2 T;  4AQF C;  4JFB A;  4GK5 E;  4HFB A;  5EK3 A;  3ZT6 A;  1H7C A;  5AQN B;  3POQ A;  4EB6 E;  1V9D A;  2H7V C;  4C4V B;  3UFG A;  3CPZ A;  5D5D A;  4AYE C;  4LML A;  5LG3 A;  1ZHT A;  2XQA A;  3AE9 A;  1HG2 A;  3Q9D A;  3UU2 A;  2EHO B;  2QGS A;  4ZHQ E;  4CQI A;  2R8A A;  2R4N A;  5CA0 E;  2EHO D;  5JR9 B;  5H6R B;  4YXD A;  3CIR A;  3VY8 X;  3NBX X;  2FJA A;  3BQK A;  5AQS B;  3A0B O;  3RIA A;  2N9D A;  5A1L A;  3TLS A;  2XSA A;  4IE7 A;  3C5O A;  3AE7 A;  2WS3 A;  3HL6 A;  3ONX A;  3N2G E;  3HWB A;  5AQT B;  4KR4 A;  4UEL A;  2XG6 A;  3TLT A;  3AED A;  3P4R A;  3AE1 A;  2NOX A;  4O4U A;  2CXL A;  2XQ7 A;  2VB6 A;  2B1E A;  3RLF F;  1J5W A;  4JI3 T;  1KNR A;  5HXS A;  4BUM X;  5ABG A;  2X9H A;  4EYY R;  2N1G A;  2YU1 A;  3MKD A;  2Y48 B;  1MND A;  3ZMS B;  3E0Z A;  3L8R A;  1GFM A;  5AFU K;  2ERV A;  2D2S A;  2WSS V;  2BBH A;  3DP7 A;  2A9U A;  2KT9 A;  4AYN A;  1N33 T;  2BG9 B;  2E5L T;  2V6Y B;  2N2L A;  5GTH O;  4BA9 A;  4Z91 A;  3KBT A;  2VVS A;  4UV9 B;  1HXU A;  2MHL A;  3IA3 A;  5G39 A;  2WDR A;  4IRE A;  3MJX A;  2V7J A;  3PE0 A;  2OMF A;  2ES0 A;  1XNQ T;  2V7L A;  3ETU A;  3AA0 B;  4LSF A;  3WAJ A;  3ZMZ B;  3ANW B;  4IDO A;  4A5X A;  3UQ7 A;  4DUY T;  2PFV A;  4G2A A;  4X20 E;  4H63 H;  3SOL A;  1D0Y A;  2W81 C;  3EHZ A;  3S4U A;  3N5L A;  4FZN A;  4LF7 T;  5KAF O;  4WZX A;  2KDY A;  4YJ2 E;  3PUS A;  2CLY C;  4TZ4 C;  1W0B A;  5J1G A;  2VK9 A;  2JQ9 A;  5J2U E;  2WM9 A;  1UX5 A;  4EYU A;  4ANJ A;  4J2C A;  2E9X D;  1H6S 1;  5HYA A;  2LSI A;  3OTO T;  1FMW A;  1QLB A;  3UUL A;  3UU6 A;  3T20 A;  3ZJ1 A;  3ZMU B;  4U72 A;  5JDP A;  3RIF A;  4TN7 B;  2V1D B;  3ZMV B;  4GCS A;  1Z8U A;  5L3F B;  3KVB A;  4IL9 A;  1HR0 T;  3FBL A;  3N9Q A;  3H3A A;  1HNW T;  1MM4 A;  2BS2 A;  2BS3 A;  1BR0 A;  3ZST A;  4LF8 T;  5KAI O;  5CA1 E;  3AAE A;  4IE6 A;  2M6I A;  2KXP B;  1SE7 A;  3RIU A;  3PDY A;  5J0Z A;  2HHH T;  3QNU A;  4JI0 T;  3T1Y T;  2WVP A;  4HWH A;  4PK4 A;  4H9S E;  1UUS A;  5CJ5 A;  3CQG B;  2YK0 A;  3ZYK A;  5PRN A;  3PU3 A;  2KSR A;  5TIS O;  5JQG E;  4AYI D;  4ZI2 C;  1IJ5 A;  2HH7 A;  2JQY A;  4H9N C;  3CK6 A;  4UVC B;  4AQY T;  2JQH A;  4DR1 T;  4O3X B;  2M67 A;  3AE3 A;  4K0U A;  3SFE A;  3D0T A;  4HTE A;  3PUQ A;  2RPA A;  4UEM A;  4ZI3 D;  5B66 O;  2X0L B;  1QJ9 A;  4MHC A;  3I9Y A;  2D0T A;  3SZD A;  3HOE A;  1WFD A;  4KUM B;  1HG5 A;  3ZPO A;  2XM1 A;  3LBX B;  1UCU A;  4RLC A;  2BDE A;  5LBM A;  3O0E A;  2QYW A;  3MXZ A;  3RI5 A;  1BXW A;  3FB2 A;  1IJ6 A;  4CN6 A;  4MLK A;  5L3C B;  5CGM A;  3NJT A;  3OVU A;  3ONL C;  5AQH B;  2XQY A;  4DR2 T;  5AQQ B;  4IE4 A;  1SA0 E;  1M62 A;  4V1A v;  1MMD A;  4DVD A;  2E9X C;  3U3I A;  2V26 A;  3N9M A;  2KZ7 A;  3AEG A;  4YSZ A;  2LSG A;  5JDL A;  3POX A;  5DL6 A;  1N34 T;  3FZM B;  4DV7 T;  5LBQ B;  3KFW X;  3A5X A;  4IE5 A;  3HKC E;  2XE3 A;  4EEB A;  1NEN A;  3NWI A;  3VZW X;  5BR8 T;  1XNR T;  1MIV A;  3IEE A;  2LEH A;  4N78 D;  2VKO A;  2CPT A;  1D1A A;  1XZY A;  5JTG A;  2NTX A;  3SS1 A;  4H9O C;  2NW8 A;  3MK7 C;  2N2M A;  2BG9 C;  2W66 A;  5EZY E;  4Z90 A;  2LKH A;  1OED E;  2GE4 A;  3ESL A;  1YS5 A;  1FJG T;  3MZK B;  4QX8 B;  3RGL A;  3AA0 A;  4OYJ A;  4O3Y A;  5CFB A;  3RPU A;  4EZH A;  2OLT A;  2CHN A;  4DV5 T;  4RL9 A;  1T98 A;  2ACX A;  2RA1 A;  3LK4 1;  3AAA B;  4D5U A;  2C5I T;  1ZEE A;  2K3W A;  2A72 A;  2XTQ A;  5BMV E;  5KXJ A;  4YFS A;  5JDG A;  4JYA T;  3OYX A;  3PGS A;  5L3G B;  3RX6 A;  4ERR A;  2V6Y A;  1BH3 A;  5EK4 A;  2DLR A;  2WU2 A;  4X1K E;  4ZI7 E;  5LP6 E;  4IIJ E;  2CCQ A;  4N58 A;  2YU2 A;  3N9N A;  4WBO A;  3R6N A;  2K5B B;  4IHJ E;  4ZS2 A;  1HXT A;  4H9Q C;  1OED C;  3GN5 A;  4HWF A;  2PJQ A;  5AQU B;  4Z3T A;  5G26 A;  4LMK A;  1M7K A;  3E08 A;  3LK4 2;  3K1S A;  3ZMT B;  3TLW A;  4YTM A;  1XDO A;  2R89 A;  3LK2 A;  4XBF B;  1HTJ F;  1ZHZ A;  5LHG B;  2CMR A;  5L3D B;  3I1A A;  4E7S A;  1YD8 G;  4YHJ A;  2BS4 A;  4CZZ B;  2YDS A;  2YDQ A;  2LRK A;  4CN4 A;  2W2U A;  4U2Z A;  1OED B;  4OHF A;  4UXN B;  3CVR A;  4JI2 T;  4JI7 T;  2X27 X;  3AA1 B;  4G76 A;  3HA4 A;  3LG7 A;  2OV9 A;  4YTP A;  3AA6 A;  4JI6 T;  3HKD E;  2CXD A;  2KMF A;  4U7I A;  5TAO A;  1HX1 B;  2MOZ A;  1MNE A;  4G75 A;  3HKB E;  5FVL A;  2R4L A;  3VRB A;  3ZT7 A;  4AQG A;  3NRY A;  4QXB B;  3POU A;  4PNI A;  4E1S A;  2LE8 A;  4L0R A;  3N9P A;  1KNZ A;  3LBX A;  4JI8 T;  3P4Q A;  2CEA A;  4PW8 A;  3B13 A;  1S5L O;  3C4W A;  5FY0 A;  2LOS A;  2XAQ B;  2JQK A;  1THQ A;  5LGU B;  4PJN A;  3TZG A;  3BS0 A;  3GWH A;  2K0L A;  2PBI A;  2QVA A;  2KZ7 B;  3LJC A;  1MIY A;  1NAF A;  5C2T A;  1KK7 A;  4DMV A;  1D1C A;  2JIW A;  1QJ8 A;  1I6Z A;  3L09 A;  4HN9 A;  3X1D A;  4PFP A;  2LM2 A;  4P0B A;  2YNK A;  2LSK A;  5GV0 A;  4ILA A;  2HPL A;  2QA7 A;  2C5J A;  3NRX A;  2Y6X A;  3N9L A;  4JLE A;  4YSY A;  4EZ4 A;  2V5C A;  5LCY A;  3FZL B;  1UUR A;  2E5V A;  3JTY A;  4TV9 E;  3UFE A;  3K8P C;  3SRZ A;  5G38 A;  3ZC0 A;  3SZV A;  2WU5 A;  2VL8 A;  5ABH A;  3CQC B;  2LLY A;  2CE7 A;  4DV3 T;  3PUZ F;  3JAE A;  2NTY A;  4KBM B;  4CXY A;  4D65 A;  2MPK A;  4NUV A;  3AE6 A;  4U7Y A;  1D0Z A;  2FJB A;  2KIN B;  2XAJ B;  2K4T A;  4AFK A;  4K3C A;  3ZSS A;  1XMQ T;  1BR4 A;  2CBJ A;  4GK0 E;  2YIN A;  4PJL A;  2X9X A;  5HEG A;  4QKN A;  5FXV A;  5LG4 A;  2PG8 A;  3Q5E A;  2VAS A;  2ODJ A;  3NVO A;  2DI4 A;  4AQF A;  1N36 T;  2WJR A;  3QRC A;  2WJQ A;  4TWF A;  4ASK A;  1ZHY A;  1Q9F A;  2CA5 A;  4XNL A;  4EGW A;  3VR8 A;  3AA7 A;  2XE2 A;  3RBH A;  4A98 A;  4TWD A;  2H88 A;  3RYC E;  3PQS A;  2X0Y A;  3AA6 B;  1O3X A;  4PJM A;  2L3L A;  2FGR A;  5HAX A;  4RLB A;  5FVN A;  4U74 A;  5FYM A;  5C3J A;  3PV0 F;  4LSI A;  2POR A;  2F1C X;  2VKD A;  3PUA A;  3N2K E;  3UPG A;  1BT9 A;  4TX5 A;  1VCT A;  5FKY A;  3RYF E;  1N32 T;  1LKX A;  4ZOL E;  4X66 T;  3VE2 A;  4C4V A;  4X62 T;  1QSD A;  3Q5D A;  1IZN A;  4UB6 O;  3RKG A;  4DO0 A;  5IWA T;  3BQL A;  4C69 X;  3RC3 A;  4IDP A;  2PTF A;  5AQK B;  2K9A A;  3G06 A;  4P09 A;  2QRX A;  4HKA A;  3AVS A;  3BQI A;  5FXX A;  4NUU A;  3ANW A;  1G73 A;  5KX5 E;  3T8O A;  3C50 A;  3G7G A;  3NZP A;  4C00 A;  4PJ0 O;  4WW0 A;  2VUR A;  3QC9 A;  4LSE A;  4NPP A;  3KV9 A;  2UXX B;  3Q2M A;  4QH1 A;  3AXJ B;  3J7Y q;  3UTK A;  4MFR A;  5AQM B;  4AUI A;  2MBG A;  4CN1 A;  3C4Z A;  2V7K A;  4YLH A;  4AKG A;  2XM2 A;  3F2E A;  1GQE A;  3EI0 A;  2AE9 A;  2CHO A;  3AE2 A;  3O9X A;  5LGN B;  2M07 A;  3RHW A;  3AXJ A;  3KV6 A;  2M06 A;  3PJA A;  4DV6 T;  4KHP T;  3L3P A;  2V6X A;  2XAS B;  2H3R A;  3DJB A;  3O1H A;  4UR9 A;  4O2A E;  2XPK A;  2UUC T;  3AAA A;  3ZLI A;  2H89 A;  3HW9 A;  3P4W A;  2XAG B;  2V7M A;  2XE5 A;  4JBW F;  3UU4 A;  4H9P C;  5L4E A;  3FYX A;  3EVY A;  2EHO C;  3BRY A;  2WBL A;  1I94 T;  2KWH A;  3BK9 A;  5F5W A;  4LF6 T;  4O4J E;  3GMI A;  2AXD S;  2HPJ A;  5LJM A;  4YHH T;  3C51 A;  4BJM A;  2BKN A;  3GA8 A;  4IDZ A;  3JAF A;  2LSJ A;  2X67 A;  4JCH A;  2VQE T;  2WAU A;  1W0A A;  3QOF A;  4EIW A;  4GF4 A;  2O4V A;  3JCU O;  2R4P A;  1ORM A;  2J47 A;  2VKJ A;  1IBL T;  4UB8 O;  4U9C A;  2Q9Q B;  4QH5 A;  3KV5 A;  3TKL B;  1D1B A;  2HN1 A;  4B3S T;  5ABF A;  5DJQ C;  1HFA A;  2D9D A;  3K3Q C;  2Z6E A;  4PR7 A;  3F31 A;  1HNZ T;  2NP9 A;  3PUR A;  2NR4 A;  3PUG A;  5FL0 A;  3HR0 A;  3SWH A;  4WNK A;  4XNK A;  4PJJ A;  1PRN A;  3GP6 A;  5JR9 C;  4GKJ T;  4HWI B;  4GCQ A;  4O4I E;  3E22 E;  5KDM C;  1FIO A;  2ODV A;  2ZM2 A;  2X51 A;  3C98 B;  5JVD E;  5IUX A;  2Q9Q C;  1L0V A;  2DCF A;  3EDU A;  1IAP A;  2DHR A;  4I0U A;  4B61 A;  1DU2 A;  2VKH A;  1XMO T;  2A2F X;  5E0O A;  5JH7 E;  3AE8 A;  5ETW A;  4N75 A;  5JRE A;  2BBJ A;  2P9B A;  2UUA T;  1HS7 A;  4N74 A;  3PUV F;  3T1H T;  2FGQ X;  2FJE A;  2ZLD A;  2KXP A;  3ZCI A;  4UV8 B;  4I50 E;  1MMA A;  3C4X A;  2X0H A;  2J1D G;  4KRA A;  1S94 A;  2VWA A;  5HCJ A;  4LF5 T;  4TV8 E;  2L8K A;  4ILC A;  1ZKE A;  2Y0H A;  3RH3 A;  3V5U A;  3ZYL A;  4FSO A;  2D5U A;  4FMS A;  2FUP A;  1KFY A;  2ZFG A;  5LXT E;  2XJ7 A;  1ZOY A;  3PGR A;  3AEC A;  3VR9 A;  1JNR A;  1MMG A;  3VE1 A;  2V5D A;  4C91 A;  4ZEY A;  3AE5 A;  5HXR A;  4A97 A;  2UU9 T;  3EUH A;  4JEH B;  4AXP A;  1MMN A;  4PK5 A;  3M65 A;  4Z8X A;  2YDR A;  3AE4 A;  5AQG B;  4UF0 A;  2E9X B;  4COF A;  4GKK T;  1MIW A;  1G8X A;  2J4U P;  2PRN A;  4AIU A;  5JDQ A;  3JCF A;  3P7I A;  2HN2 A;  3QB5 K;  2IUB A;  5L47 A;  1JNZ A;  4XZC A;  2FBW A;  3NKZ A;  3FXD B;  5AQL B;  4FI5 A;  2WCA A;  2ACZ A;  3J9X 1;  4ISS A;  3AAI A;  3V5S A;  1XWM A;  2LHN A;  2JPF A;  2IC6 A;  3QK6 A;  5H2F O;  5ABF B;  2OA5 A;  3PUX F;  4RJX A;  2LHF A;  2KWI B;  4ZI2 D;  1LVF A;  3I0Q A;  4DBR A;  3PRN A;  1VRB A;  5LA6 E;  3POR A;  5JRC B;  3ZJ2 A;  4OYK A;  2E2A A;  4WYV A;  4JI1 T;  5L4H A;  4HEA A;  4EXT A;  1WR0 A;  2I59 A;  5AQV B;  2J1N A;  1CUN A;  3UUM A;  4ZXL A;  2V8S V;  4GCP A;  5L3B B;  4K0K T;  1GFQ A;  5GON E;  3QB5 A;  1KEY A;  2X9W A;  4F8H A;  3LSV A;  2YPV A; 
#chains in the Genus database with same CATH homology
 3LK2 B;  2KIN B;  2XAJ B;  4UIG A;  2YEV C;  2PFV A;  1HXX A;  4G2A A;  4X20 E;  2K4T A;  4AFK A;  4H63 H;  3SOL A;  1D0Y A;  2W81 C;  4QXH B;  1OXZ A;  3AA7 B;  2JQQ A;  4E1T A;  4AKR A;  3S4U A;  3N5L A;  4PK6 A;  4FZN A;  5L3E B;  2KDY A;  3Q5W A;  4HGA A;  1BR4 A;  4YJ2 E;  4GK0 E;  2YIN A;  1WLX A;  3GN5 B;  4PJL A;  4AKI A;  2X9X A;  3KDS E;  2LFU A;  3PUS A;  4G63 A;  2CLY C;  4MBQ A;  4QKN A;  3SY7 A;  4TZ4 C;  1OPF A;  5FXV A;  5J1G A;  2VK9 A;  3MA9 A;  3FHN A;  4WBN E;  5J2U E;  2PG8 A;  2WM9 A;  5LG4 A;  2VAS A;  4AZL A;  1UX5 A;  1SHZ C;  4F6R C;  2ODJ A;  4EYU A;  2ZMA A;  2W80 C;  3UUX B;  4ANJ A;  3N9O A;  2DI4 A;  4AQF A;  5DL8 A;  1S35 A;  1ZV4 X;  4J2C A;  2E9X D;  3QRC A;  4I43 B;  5HYA A;  1H6S 1;  3ZN1 B;  4IE0 A;  2V7I A;  2LSI A;  4ASK A;  1ZHY A;  1Q9F A;  4F4B A;  1FMW A;  2CA5 A;  3DA3 A;  3UUL A;  3T20 A;  4X1Y E;  4XNL A;  3ZJ1 A;  5LHI B;  3ZMU B;  4U72 A;  3AA7 A;  5JDP A;  2XE2 A;  4TN7 B;  3RBH A;  1U4Q A;  3RYC E;  2V1D B;  3ZMV B;  4XAX B;  3PQS A;  2C0S A;  4GCS A;  3OBV E;  3AA6 B;  3LK3 A;  1O3X A;  4PJM A;  4TUY E;  1E1H B;  2L3L A;  5L3F B;  3KVB A;  3N2O A;  4O4H E;  2NW9 A;  1HCI A;  2FGR A;  2MYS A;  5HAX A;  4GHB A;  4RLB A;  1X79 A;  3FBL A;  5FVN A;  3WAK A;  2MTQ A;  4U74 A;  3I9W A;  5FYM A;  2Y0L A;  4LSI A;  2POR A;  4CI1 B;  4PAG A;  3W15 B;  3F57 A;  3N9Q A;  2N2N A;  2JJ9 A;  2VKD A;  3H3A A;  3N2K E;  3PUA A;  4L5G A;  3I0O A;  3UPG A;  4O2B E;  1BT9 A;  4TX5 A;  1MM4 A;  1MM5 A;  3RYF E;  5H6Q B;  3FXE B;  1BR0 A;  1LKX A;  1OWA A;  4KR8 A;  3DA4 A;  4ZOL E;  3H37 A;  2CWO A;  3IBP A;  5CA1 E;  3AAE A;  4IE6 A;  3VE2 A;  5F8P A;  2Q9Q D;  5JRC A;  2KXP B;  1QSD A;  3QUJ A;  1OSM A;  5JDH A;  2IAK A;  1IZN A;  5HXC A;  4DO0 A;  3V8U A;  3AA1 A;  3PDY A;  3BQL A;  4C69 X;  4PFO A;  3RC3 A;  3JC6 C;  4QX7 B;  3RC8 A;  5LHH B;  3B57 A;  2K9A A;  3NSG A;  4P09 A;  4AKL A;  3PQU A;  3KV4 A;  4HKA A;  1BR2 A;  4L9I A;  4PK4 A;  4O8S A;  3AVS A;  2A3D A;  4H9S E;  1BR1 A;  3CQG B;  2WMN A;  2YK0 A;  3IHR A;  3BQI A;  5JDF A;  3ZYK A;  4FUV A;  5FXX A;  5PRN A;  3PU3 A;  1US7 B;  3FBZ A;  1B7T A;  5F3J A;  4NUU A;  5JQG E;  2CM0 A;  3ANW A;  1G73 A;  5FXZ A;  4ZI2 C;  1IJ5 A;  5M4Y A;  4AKM A;  4AYI D;  3SYS A;  1EZ3 A;  2ZM8 A;  5KX5 E;  2HH7 A;  3LFM A;  3T8O A;  1YKE B;  1Y64 B;  2LM9 A;  4H9N C;  4UVC B;  3VKH A;  3K3O A;  3C50 A;  3G7G A;  3EMN X;  4OFZ A;  3RRW A;  1QUU A;  4GOU A;  5JDN A;  4O3X B;  2CWY A;  3NZP A;  2M67 A;  4K0U A;  2ZM0 A;  3D0T A;  5HXE A;  3Q5X A;  2C5K T;  2WMO A;  4HTE A;  3CX8 B;  3PUQ A;  4UEM A;  4FRX A;  4ZI3 D;  2Y2X A;  2X0L B;  1QJ9 A;  4MHC A;  3I9Y A;  2D0T A;  4WW0 A;  3SZD A;  4H63 V;  3HOE A;  4AYM C;  3QC9 A;  4KUM B;  4LSE A;  4MAL A;  2H7O A;  1HG5 A;  3ZPO A;  5ADX L;  3R84 B;  3KV9 A;  2UXX B;  3Q2M A;  3CWZ B;  2Y8D A;  3ETV A;  3LBX B;  4UF0 B;  2KND A;  5J2T E;  1UCU A;  5LJN A;  2MNH A;  4RLC A;  3ZN0 B;  1YW0 A;  2WWU A;  3J7Y q;  2BDE A;  4MFR A;  3UTK A;  5LBM A;  1AJ3 A;  3O0E A;  4AUI A;  6PRN A;  1Z0P A;  2X66 A;  2MBG A;  3MXZ A;  4YJ3 E;  1BXW A;  2LHR A;  4JEU B;  3VZU X;  3C4Z A;  2V7K A;  3FB2 A;  4YLH A;  3ZCJ A;  4AKG A;  3AVR A;  1IJ6 A;  4MLK A;  4FZL A;  5L3C B;  5CB4 E;  4ILU A;  2CLY B;  3F2E A;  3ZEF B;  3UAQ A;  2XQY A;  2JRK A;  3O9X A;  4GYS A;  5LGN B;  2M07 A;  4IE4 A;  4CXW A;  2KLQ A;  1YKH B;  3RYI E;  5HWX A;  1Q9G A;  1SA0 E;  4V1A v;  1MMD A;  3T0S A;  5FP3 A;  3KV6 A;  4DVD A;  2E9X C;  3U3I A;  4FOZ A;  2M06 A;  3EDV A;  2V26 A;  3N9M A;  2KZ7 A;  2ZLY A;  3L3P A;  2XAS B;  4EAH A;  2H3R A;  1ZHW A;  3CX6 B;  3DTO A;  4O3W A;  3RYH E;  3DJB A;  3O1H A;  1LRZ A;  2LSG A;  2W0G A;  5JDL A;  4O2A E;  3POX A;  5LYJ E;  3CKD A;  4E7Z A;  5DL6 A;  3AAA A;  3ZLI A;  7PRN A;  3HW9 A;  5LBQ B;  4EOZ B;  3KFW X;  2NWB A;  2DWG A;  3A5X A;  2XAG B;  4IE5 A;  3HKC E;  2V7M A;  2XE3 A;  3KBU A;  2IC9 A;  5DL7 A;  3WI3 A;  2XE5 A;  2Y7S A;  4KP3 C;  3VZW X;  5FMN A;  4H9P C;  3HOL A;  5IYZ E;  2XAH B;  4D64 A;  2CXF A;  4QWN B;  3FYX A;  3EVY A;  2EHO C;  5EE2 A;  2WBL A;  4OK0 A;  3PTR B;  5JDM A;  3SYB A;  2KWH A;  3BK9 A;  1MIV A;  3IEE A;  4HE8 A;  3U78 A;  4O3Z A;  5FY7 A;  4O4J E;  2LEH A;  3GMI A;  2VKO A;  4N78 D;  3UT5 E;  3O4X E;  2LJL A;  4AKH A;  2BVM A;  2HPJ A;  4I55 E;  1D1A A;  3VHL A;  4QQ1 A;  5ADX K;  5LJM A;  3AB3 B;  3RRC A;  4FRT A;  2NTX A;  3SS1 A;  1UX4 A;  4H9O C;  2NW8 A;  2XHE B;  3C51 A;  5L2L A;  3MK7 C;  2N2M A;  3P8C D;  4BJM A;  4B6X A;  3GA8 A;  4IDZ A;  5EZY E;  4LSH A;  2LSJ A;  2RP4 A;  5HXH A;  1ZHX A;  3RKO A;  4O4L E;  5LGT B;  2F1T A;  3MAC A;  2X67 A;  1MPF A;  2Y0K A;  4JCH A;  3T24 A;  3VY9 X;  2GE4 A;  3JC6 D;  4HFV A;  5LNK A;  3ESL A;  1YS5 A;  2WAU A;  4QXC B;  3MZK B;  4QX8 B;  3AA0 A;  5FNV E;  4O49 A;  4EIW A;  4GF4 A;  4OYJ A;  2O4V A;  3AAE B;  4O3Y A;  2ODU A;  3KIN B;  3RPU A;  4DMW A;  1ORM A;  4AI6 A;  2VKJ A;  2K48 A;  4EZH A;  4ZS3 A;  2XAF B;  2X9Y A;  1FEW A;  1T98 A;  4RL9 A;  2ACX A;  4KMC A;  3C64 A;  2Q9Q B;  4U9C A;  2L9Q A;  2RA1 A;  3LK4 1;  4O4X A;  3AAA B;  4D5U A;  2QTK A;  2C5I T;  3KV5 A;  1ZHC A;  3OKQ A;  3TKL B;  1GFP A;  4I4T E;  1D1B A;  1ZEE A;  2XUE A;  4IST A;  3VU7 H;  2A72 A;  2XTQ A;  2GK9 A;  5BMV E;  3LK3 B;  4YFS A;  2JMM A;  5JDG A;  4RJW A;  4DBQ A;  5FXW A;  5DJQ C;  2UXN B;  1HFA A;  3CML A;  3OYX A;  3K3Q C;  5T5F A;  2G0U A;  5L3G B;  3RX6 A;  4CI2 B;  3VKG A;  2Z6E A;  4ERR A;  2W63 A;  1BH3 A;  4ZI3 C;  3OYZ A;  3F31 A;  2LT3 A;  5EK4 A;  3KVA A;  2NP9 A;  2DLR A;  3PUR A;  3PUG A;  4ZI7 E;  4X1K E;  3HR0 A;  5LP6 E;  3SWH A;  2Q9Q A;  4WNK A;  3QRA A;  4IIJ E;  4XNK A;  4FES A;  4PJJ A;  4UVA B;  2CCQ A;  2SPC A;  3ZYM A;  4CXX A;  1PRN A;  4BAY B;  2YU2 A;  3O1I A;  3N9N A;  4N58 A;  4WBO A;  3WI4 A;  2BZB A;  3ZC1 A;  3GP6 A;  5AFU L;  1QJP A;  3R6N A;  5JR9 C;  1E54 A;  3K19 A;  1WRD A;  4A56 A;  4GCQ A;  4O4I E;  3CQX C;  1HF8 A;  3E22 E;  5KDM C;  2K5B B;  1FIO A;  4IHJ E;  4ZS2 A;  2ODV A;  4H9Q C;  2ZM2 A;  1HXT A;  2JMH A;  2X51 A;  3C98 B;  5JVD E;  2Q9Q C;  5HWY A;  3GN5 A;  4C90 A;  4FZM A;  5IYU A;  3WI5 A;  2PJQ A;  2DCF A;  1GFO A;  1HX8 A;  3EDU A;  1IAP A;  2DHR A;  4Z3T A;  4B61 A;  5G26 A;  3UUN A;  2VKH A;  3O1J A;  1P4T A;  5EK2 A;  2A2F X;  4UVB B;  3E08 A;  5C8Y E;  3IF8 B;  5E0O A;  1FMV A;  5JH7 E;  3LK4 2;  4AQF C;  4JFB A;  2E9X A;  4PUX A;  5ETW A;  3ZMT B;  4GK5 E;  2LSY A;  5JRE A;  5EK3 A;  3A2S X;  2NW7 A;  3NZQ A;  1GFN A;  2P9B A;  1H7C A;  1HS7 A;  3LK2 A;  5DAB A;  3POQ A;  4EB6 E;  4XBF B;  1HTJ F;  1ZHZ A;  2FGQ X;  5LHG B;  2ZLD A;  1V9D A;  2KXP A;  2H7V C;  2CMR A;  5L3D B;  3CPZ A;  5D5D A;  2EHO A;  3ZCI A;  1U5P A;  3OJA A;  4AYE C;  1ZHT A;  3I1A A;  4UV8 B;  4I50 E;  4E7S A;  1YD8 G;  4YHJ A;  4CZZ B;  1MMA A;  3C4X A;  1HG2 A;  3Q9D A;  3UU2 A;  2F1V A;  2EHO B;  2QGS A;  4P0A A;  4ZHQ E;  4OHF A;  4CQI A;  2J1D G;  2XTL A;  4UXN B;  4KRA A;  1S94 A;  2VWA A;  3CVR A;  4IGU A;  4FT6 A;  4TV8 E;  1NWM X;  2L8K A;  5CA0 E;  4X1I E;  2X27 X;  2EHO D;  1ZKE A;  4QHO A;  5JR9 B;  5H6R B;  3AA1 B;  2Y0H A;  4G76 A;  3RH3 A;  3HA4 A;  4N59 A;  3LG7 A;  2LOP A;  3V5U A;  3AA6 A;  3ZYL A;  4FSO A;  2D5U A;  3HKD E;  4FMS A;  2IW5 B;  1WR6 A;  2CXD A;  2KMF A;  3NBX X;  3PU8 A;  5LXT E;  5TAO A;  2ZFG A;  3VY8 X;  2MOZ A;  3BQK A;  1MNE A;  4G75 A;  3HKB E;  2N9D A;  2K24 A;  5A1L A;  1MMG A;  5LOV E;  2X68 A;  3VE1 A;  4IE7 A;  5DQV A;  2BVL A;  4AQG A;  4C91 A;  3NRY A;  4AYD C;  5HXR A;  4QXB B;  3POU A;  2W62 A;  4PNI A;  4E1S A;  1VOM A;  3CX7 B;  3EUH A;  4JEH B;  4AXP A;  1MMN A;  4PK5 A;  4BJN A;  2LE8 A;  3M65 A;  4Z8X A;  3C5O A;  4L0R A;  3N9P A;  3HL6 A;  1KNZ A;  3ONX A;  3LBX A;  2E9X B;  4UF0 A;  4DND A;  2CEA A;  3N2G E;  2DNX A;  3B13 A;  4PW8 A;  3HWB A;  4KR4 A;  3C4W A;  4UEL A;  5FY0 A;  2XG6 A;  4FJO A;  1MIW A;  2LOS A;  2XAQ B;  3SY9 A;  1LVK A;  2XE1 A;  2NOX A;  1THQ A;  2CXL A;  2XTR A;  1G8X A;  4O4U A;  2J4U P;  2PRN A;  5LGU B;  4PJN A;  3TZG A;  2VB6 A;  2B1E A;  3GWH A;  5JDQ A;  2K0L A;  3P7I A;  2PBI A;  4ADZ A;  2KZ7 B;  4BUM X;  1D0X A;  5HXS A;  4JUY A;  3LJC A;  1MIY A;  1NAF A;  1KK7 A;  2E8I A;  1D1C A;  4XZC A;  4DMV A;  5KMG P;  1QJ8 A;  2X9H A;  3MKD A;  2N1G A;  2YU1 A;  4M1P A;  3L09 A;  4EYY R;  2Y48 B;  4HN9 A;  2KC0 A;  3FXD B;  3K3N A;  1MND A;  4PFP A;  4CI3 B;  3ZMS B;  3E0Z A;  4FI5 A;  1GFM A;  5AFU K;  4P0B A;  2YNK A;  3J9X 1;  2D2S A;  2ERV A;  2WSS V;  4GIW A;  4ISS A;  3VZT X;  1PHO A;  2LSK A;  3DP7 A;  5DL5 A;  5GV0 A;  1WYB A;  2KT9 A;  4AYN A;  3AAI A;  2HPL A;  2QA7 A;  1WYC A;  2D0U A;  2C5J A;  3NRX A;  3V5S A;  2Y6X A;  3N9L A;  4JLE A;  5DQW A;  2JMK A;  2LHN A;  2N2L A;  4AKR B;  2JPF A;  4BA9 A;  4EZ4 A;  8PRN A;  3KBT A;  5LCY A;  2W61 A;  3KVD D;  1G90 A;  4UV9 B;  2IC6 A;  3QK6 A;  2OA5 A;  1HXU A;  3JTY A;  4H9R C;  4TV9 E;  2LHF A;  2MHL A;  4RJX A;  2KWI B;  1IZN B;  3HI2 A;  4ZI2 D;  1LVF A;  3I0Q A;  4DBR A;  3PRN A;  1VRB A;  5LA6 E;  3UFE A;  3K8P C;  3HKE E;  3POR A;  3SRZ A;  5JRC B;  3ZJ2 A;  5JR9 A;  4OYK A;  3ZC0 A;  3SZV A;  3MJX A;  4HEA A;  4EXT A;  2V7J A;  3PE0 A;  2VL8 A;  2I59 A;  3CQC B;  2J1N A;  2OMF A;  2ES0 A;  4GYR A;  1CUN A;  2V7L A;  3UUM A;  2DWK A;  2CE7 A;  3ETU A;  3AA0 B;  5IHY A;  4GCP A;  5L3B B;  1GFQ A;  2NTY A;  5GON E;  4LSF A;  4KBM B;  3WAJ A;  4CXY A;  2W00 A;  4D65 A;  2XMX A;  4NUV A;  3ZMZ B;  2X9W A;  3ANW B;  5FY1 A;  1D0Z A;  2YPV A;  4FSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...