3LK42

Crystal structure of capz bound to the uncapping motif from cd2ap
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
242
structure length
238
Chain Sequence
DQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQERTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
publication title Structural characterization of a capping protein interaction motif defines a family of actin filament regulators
doi rcsb
source organism Gallus gallus
total genus 78
structure length 238
sequence length 242
chains with identical sequence 5, 8, B, E, H, K, N, Q, T, W, Z
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lk4201
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3lk4202
2KXPB 4AKRB 2KZ7A 2KXPA 3AA7B 4AKRA 3AA7A 5AFUK 3AA6B 3LK3B 3LK3A 3AA6A 3LK41 3AAEB 3AAEA 3AA0B 5AFUL 3AAAB 3AAAA 5ADXK 3AA0A 1IZNB 3LK42 3LK2B 3AA1B 1IZNA 3LK2A 3AA1A 2KZ7B 5ADXL
chains in the Genus database with same CATH superfamily
1FMVA 1J5ET 2XAFB 2BKPA 3U78A 4AKRA 3NRXA 2LRLA 2UXNB 2YDRA 4PJ0O 4HEAA 3VY8X 4KI0F 2XASB 2YOEA 3SS1A 2Y0HA 3ZMTB 4RL9A 4EEDA 2CEAA 4DR7T 1QSDA 3RQWA 5CFBA 4DV0T 4DVDA 5FXZA 5HYAA 4CI3B 3NKZA 3LBXB 1HXXA 4YSXA 3P4SA 2YDQA 4ZI7E 1GFQA 2K48A 3Q9DA 2LM9A 3ZMZB 4X64T 3PV0F 2F1CX 1HS7A 4Z3TA 4HWFA 2CLYB 4B3RT 2IIUA 5ADXK 4TV8E 4ZI2D 5JVDE 4IE4A 2VK9A 4IDPA 1OWAA 3GP6A 2XM2A 2JMHA 2K4TA 2JPFA 2X9KA 2JQ9A 1IAPA 2R89A 3VY9X 2WJRA 3LK41 3VE2A 4ILCA 3NZQA 2R4PA 3EVYA 4L0RA 4FOZA 3SY7A 3ANWB 4RJWA 2Q9QD 3ZYMA 2CCQA 3Q5XA 3FZMB 3PUZF 3NJTA 3AA6B 4H9PC 1H7CA 2LKGA 4KHPT 1ZKEA 4BAYB 5JRCB 1JNZA 3J9X1 4EIWA 2WWVA 3V8UA 2ZM2A 2LOSA 5LCYA 5E79O 5HEOA 3RIAA 4OK0A 3WAKA 3H37A 3AE3A 4O4HE 3PJAJ 4NXMT 5L4EA 4ISTA 5KAFO 4H9QC 4JI7T 3MXZA 4U33A 2R8AA 2ODUA 3ZMSB 2BBJA 4YHJA 5HWYA 1MMGA 2V7KA 1MIYA 2UUAT 1QJ9A 3RIUA 5HEJA 3OJAA 3LG7A 4PFPA 2J4GA 2WM9A 1NEKA 2V5CA 4ZEYA 3VKHA 2WDRA 4O4XA 4XNLA 2H88A 4N78D 4O3WA 4AISA 1HG2A 2W00A 4X66T 2K3WA 2BZBA 4DV3T 4AYNA 5KXJA 2X27X 1US7B 1CUNA 2XM1A 3UU6A 3A2SX 3A5XA 4BUMX 3I9YA 3A0BO 4ILAA 2M6BA 1OPFA 1O3XA 2ACZA 5CJ5A 5JDNA 4KUMB 4JEUB 4TWDA 1OEDB 1R8IA 5KMGP 2JQHA 3UAQA 4ADZA 3C64A 3H3MA 4QH5A 3AA7A 2KMFA 5CA0E 4U3CA 7PRNA 2BKOA 2NW7A 1E7PA 4DV6T 4AI6A 3AE7A 3RIFA 3PUQA 2J62A 4CXWA 3J7Yq 4JI6T 5JR9A 1IZNB 2Y0KA 2JQKA 1G73A 4C90A 2OMFA 1ZHWA 3IBPA 2CM0A 2UU9T 4HE8A 5ABGA 2KZ7A 1HNZT 2DWGA 4HKAA 1XDOA 1S94A 3AEEA 3LK3A 2WMOA 2BDEA 4FT6A 1WR6A 5B5EO 2DL1A 1T72A 4E7SA 3AAAB 3DA4A 4TNWA 4IHJE 4HFDA 2XE3A 4CXYA 3P4RA 3M65A 4WZXA 2N2MA 2MPKA 5DL6A 3RC3A 1Y01A 2VKDA 5DQVA 5F8PA 3T24A 2KT9A 1SUMB 2VVNA 5ABFB 5H2FO 2YPVA 2BG9E 4P09A 2IC9A 1BR2A 1T8BA 4X5TA 4I0UA 2D2SA 1ZHCA 4EV6A 1Z0PA 1N34T 4DV7T 5KX5E 1X9BA 3O4XE 4AYID 4TZ4C 1ZHZA 4U9CA 3JAEA 3E0ZA 3KV6A 3PU8A 4FZMA 1GFNA 3ZCIA 3NWIA 4PJLA 4GK0E 4TN7B 5JDGA 3PQUA 3ZC1A 3L39A 3O1IA 5AQMB 3C4XA 2E5VA 3AE2A 2XQAA 2UXCT 3AEFA 2XQ8A 4AKHA 2WVPA 2MHLA 4ZZBA 4PK6A 4U2YA 3N9PA 3HR0A 5LG3A 4WBOA 5LP6E 3SZVA 3AB3B 1W0AA 1D0XA 4PW8A 2IAKA 4RJXA 4A98A 2CHNA 1UGOA 3AE1A 2KXPB 5GTHO 3OYXA 3EHZA 4PR7A 5JDPA 2KC0A 5HXSA 5T5FA 4J2CA 3GMIA 2B76A 2PTFA 4JI2T 3EAMA 3UFEA 6PRNA 2A9UA 4UF0B 1AJ3A 4DBRA 3KV9A 2XAJB 4JBWF 1BH3A 3AA1A 2E9XC 4LSFA 5IWAT 1YKEB 1WLXA 3ESLA 2LEHA 2AXTO 2QGSA 5AQOB 3ZEFB 3GWHA 2PFVA 3ZMVB 4EYUA 4PJMA 2CWOA 2XAQB 3ONLC 3N2GE 3HKDE 3TLTA 3ZN1B 4BJMA 1IBKT 3EMNX 3P4WA 2JQQA 3ANWA 3WAJA 4G63A 3LFMA 1E1HB 2KSRA 2AXDS 1MMDA 1T16A 2IC6A 1MMNA 2CBJA 5J1GA 1YW0A 5AQJB 1FMWA 5AQQB 4NUVA 3BQKA 4UB8O 3UUBA 2UXXB 1KF6A 4P0AA 4L9IA 2LRKA 3IA3A 2EHOB 2W0GA 3C98B 3HKEE 5HXRA 5LOVE 3UU8A 4QQ1A 3O1JA 4IE7A 1THQA 3CX6B 3TLUA 2LSJA 4LF8T 3AEBA 3UU4A 3KV5A 2W62A 3QB5A 3F57A 2F1TA 1UCUA 5HXCA 4U7IA 5F5WA 2XMXA 5JTGA 2VL8A 4O4IE 4IDNA 3ZT5A 2P9BA 2KLQA 5G39A 3N2KE 1WYCA 4AZLA 3QOFA 5LG4A 3FB2A 1UX5A 1LKXA 2ZM8A 3ONJA 5HCJA 5LBMA 3PTRB 4YT0A 2R6GF 1LVKA 1J5WA 4X1YE 2BBHA 4K0UA 1J1JA 2MAWA 1NENA 3ZSSA 3AA0A 4AKIA 5G38A 5HEUA 3R6NA 4A56A 2GK9A 4PFOA 2LM2A 2Y48B 3LK2B 1OEDA 2ZMAA 2MTQA 2CA5A 2OA5A 2LSIA 3VZUX 5B66O 4FRTA 1XMQT 5DJQC 4U72A 2ZLYA 2MBGA 2UXBT 1VCSA 3DWNA 2ERVA 2K0LA 3L09A 2W80C 2JRKA 4YTPA 2ZFGA 5L3BB 2AE9A 4YY3T 2A72A 1JNRA 3QRCA 3TLVA 2E5LT 2FJEA 5IHYA 4GYSA 1XZYA 3CPZA 8PRNA 4DR2T 3V5UA 2H7VC 1G90A 1B7TA 4O4LE 2LSYA 5GTIO 3AAAA 5FXXA 4H9SE 4NXNT 3VRBA 2YINA 3FZLB 4JLEA 3RF1A 3NRYA 5FP3A 3HOEA 3CQXC 4E7ZA 5GV0A 4GCQA 4JV5T 3RI5A 3NZPA 1ZV4X 4NIQA 5EK4A 5ABFA 3ZT7A 4C4VA 1GQEA 2BKNA 3WI5A 2J1DG 3RGLA 3RIUC 2QYWA 3ZN0B 3ETVA 3HKBE 3N9QA 1T1LA 2XAHB 4CN4A 1ZHXA 2ODVA 2MYSA 5LGUB 5HAXA 3C4ZA 3AE9A 1YXRA 3U3IA 2FBWA 4CXXA 4EZ4A 3IEEA 1VCTA 3T1YT 2ACXA 4O8SA 2X0LB 4YJ3E 4PUXA 2LSGA 4JI1T 4O3ZA 3N9MA 2J1NA 1XNRT 3O9XA 3SZDA 5FKYA 1YD8G 4B6XA 2X9WA 3PORA 1LVFA 5DQWA 3PGRA 2YK0A 5HEHA 5AQTB 3KV4A 2WBLA 3P8CD 4H9OC 4LF6T 2X9XA 4QX7B 5DL7A 3G06A 2FGQX 5EE2A 1N36T 3QC9A 3EI0A 2V6XA 4UF0A 5FVLA 3KDSE 3AE4A 4HGAA 1MNDA 2WDQA 3DA3A 3ZPOA 1VRBA 1UK5A 4F6RC 4B61A 4JI4T 1ZHTA 4CN6A 4AQFC 3OTOT 5DL5A 4ILUA 4ZHQE 4LFCT 2X67A 5JDFA 4LF4T 2CXFA 2OLTA 5LXTE 2ZM6T 4KRAA 4UELA 3RYFE 4IE5A 1BXWA 3T1HT 3GN5B 5E0OA 4LMKA 2M67A 3UUMA 3CWZB 2V1DB 4FUVA 1NWMX 2JJ9A 4PJJA 5L3EB 1LRZA 2QTKA 1XNQT 3Q5WA 4AIUA 4ERRA 3EABA 1MM4A 1HX8A 2LLYA 3PUVF 3TLWA 2EHOA 1W9RA 2WY2A 3Q5EA 4Z91A 3MJXA 4GF4A 1CHUA 3R84B 2Y8DA 3K8PC 4QKNA 1ORMA 1XMOT 4AKGA 2XQ4A 3UQ7A 4PNIA 5JDHA 4UVAB 4ZI2C 3QUJA 4COFA 4IDQA 1E54A 5LA6E 4YJ2E 2I59A 1ZP0A 4V1Av 1KFYA 4QX8B 3PE0A 2X0HA 2JQYA 4GKKT 4HFBA 3NSGA 3RYHE 2G0UA 4U2ZA 3JC6D 3EUHA 4CI1B 2SPCA 2Q9QC 4P1NA 1Q9GA 4C00A 4BJNA 2E9XB 1MIVA 3Q2MA 4AYEC 3RRWA 1D0ZA 4FQEA 2VASA 1H6S1 3JCUO 3A8YC 1ZOYA 5AQGB 4N59A 2N1GA 4CTDA 4YHHT 4OYKA 2YEVC 4F4BA 1VOMA 4FSPA 4KBMB 4IL4A 2LSKA 3CMLA 4KR4A 2XQ3A 2DWKA 4YFSA 2W66A 4FZNA 2XTQA 2VVSA 4O2BE 2A3DA 1OEDE 3LSVA 4X20E 4EOZB 4U7YA 4KHZF 2WDVA 3ZJ2A 3G7GA 2XQ7A 1IBMT 1WRDA 2NP9A 3DJBA 3TLSA 2Y0LA 3SFDA 2XE5A 2UUCT 3HA4A 1HG5A 2N2NA 2XZEA 5LMUT 1WR0A 2F4VT 5J2TE 4D65A 2LOPA 3PUXF 4U31A 4DBQA 4XNKA 2DCFA 4O3YA 5L3DB 3ZKRA 4AKRB 5C3JA 3QB5K 2VWAA 4JYAT 1S5LO 4X1KE 3F2EA 3F31A 2XQ9A 2I6HA 3VZTX 3PURA 4LFAT 3AEDA 3AECA 2XHEB 3B13A 3I0OA 4DNDA 4GCSA 4UV9B 4GYRA 3PGSA 2CMRA 3UQ4A 5D5DA 3LBXA 3RRCA 3FZFB 5H6QB 3AVRA 2CWYA 5LMNT 3UPGA 2F1VA 2VKJA 2NWBA 2X9YA 3PRNA 3WI4A 3FBZA 1BR4A 2BS2A 4WYVA 2IWVA 3RLFF 2H89A 4UR9A 4AKLA 4HFEA 4I4TE 2NR4A 3K3NA 3HOLA 3MZKB 2BG9C 4C69X 2L9QA 5LJMA 3P50A 4A97A 3K3OA 4QWNB 5TAOA 4EEBA 5HWXA 3KBUA 1M62A 2V7MA 1UURA 4Z90A 1T7SA 1V9DA 5LHGB 3AA6A 3LDQB 4PK5A 2H3RA 5JRCA 4MFRA 2KWHA 4L5GA 3PUYF 4ZOLE 4P0BA 5L2LA 4PAGA 3BS0A 3PGUA 3GN5A 5FMNA 4GOUA 4DR1T 5ABHA 4WNKA 5FXWA 3ZCJA 4MHCA 4KP3C 5BR8T 2WS3A 4UV8B 4IIJE 4FZLA 2GE4A 3K19A 3CQCB 3ZYKA 3ZJ1A 3PQSA 3VRAA 2M06A 4DR4T 3X1DA 1GFPA 2XG6A 2VL0A 1U4QA 3S4UA 2ODJA 4PJNA 3ETUA 4YTNA 3OBVE 2N2LA 4ILBA 3AE6A 4B3TT 2D0UA 4LF5T 2RPAA 2ES0A 1HNXT 2UUBT 2WMNA 1D1AA 2EHOD 1S35A 3AE5A 4LFBT 2DHRA 4FESA 5HXEA 3FXEB 4N58A 4B3ST 4ZS2A 3VU7H 3UT5E 4DR6T 5FXVA 3TZGA 3HKCE 4CN1A 1HFAA 2OV9A 3CX7B 3PUGA 2YN6A 5CB4E 3C51A 1OSMA 2LE8A 3RHWA 1HCIA 2E9XA 2BVMA 2V26A 3TKLB 1IZNA 2Y6XA 4GHBA 4FJOA 2V7JA 5AQSB 2XTLA 2KZ7B 4DV1T 4O3XB 3M3ZB 2DLRA 3HWBA 2XAGB 3T0SA 2KNDA 1HX1B 2HH7A 2BS4A 3BQIA 4X62T 4U74A 2PRNA 1MMAA 3SWHA 2E8IA 2WP9A 2PORA 5L3GB 2M07A 3LK42 5KAIO 4YTMA 3SYSA 4H9RC 3UU2A 2Z6EA 3DP7A 4EAHA 5LHIB 5TISO 1BR0A 2PG8A 3VHLA 2XJ7A 3AAEB 3LJCA 2HPJA 2V5DA 3OYZA 4O4JE 5LHHB 3B5MA 5ETWA 2PJQA 2VURA 4CZZB 2BS3A 2FJAA 4KR8A 5AQVB 1FJGT 2CHOA 2YNKA 4CI2B 2CXLA 1P4TA 3IF8B 1N33T 4YSYA 3L3PA 4RLBA 3POXA 4FI5A 2XE2A 2QRXA 3OPCA 2WSSV 2ZM0A 3IHRA 3WU2O 3CKDA 1BT9A 3K1SA 1UUSA 2XQYA 1Q9FA 4O4UA 1UX4A 5H6RB 2MNHA 2YKSA 3PUAA 4MLKA 1HNWT 4KX6A 4H63H 3RKOA 3BQLA 1Y64B 3AEAA 1MPFA 3RBHA 2Q9QB 2V7LA 3SFEA 4HTEA 4Q25A 3ZC0A 4QXBB 3D0TA 2KXPA 3DTOA 4PK4A 2W4XA 2X66A 3L8RA 2LKHA 3JTYA 4F8HA 2VKOA 3C4WA 2CBIA 2BVLA 3OKQA 2JMMA 3FYXA 2FUPA 4DR5T 2Y7SA 2X51A 3MA9A 5BMVE 5DL8A 4FRXA 3AA1B 1W09A 4AQGA 5JR9C 2E2AA 1SHZC 4YXDA 3RX6A 2X68A 4FSOA 2O4VA 4N75A 1ZEEA 2IW5B 3KBTA 2WZIA 2WJQA 5CGMA 4ZXLA 5C2TA 3T8OA 5L4HA 1HTJF 2CPTA 3VE1A 3PF1A 1MM5A 4HN9A 4HFVA 4IGUA 4KMCA 2DNXA 1D1CA 3EDVA 4QXCB 4LF7T 4AQYT 4ANJA 2V7IA 5AQUB 4ZS3A 1G8XA 1SE7A 2WU2A 2IUBA 3SY9A 4DIDB 2MOZA 5EK2A 1IJ6A 4JFBA 1QUUA 5FVNA 4IREA 2WAUA 3BRZA 5F3JA 4H63V 4HFHA 4UB6O 4E1TA 3O1HA 2IDOB 2LHFA 5AQPB 3VR9A 1WCRA 5LNKA 5HXHA 1FIOA 1N32T 4HWHA 5FY7A 5J0ZA 4H9NC 1KNZA 4YLHA 2XUEA 4UEMA 3RH3A 3QRAA 2W67A 3UU5A 5JDLA 4JI0T 3OVUA 2W61A 4G2AA 2M6IA 3W15B 4BA9A 3N9OA 4K3CA 3RKGA 5GONE 2NW8A 3C5OA 2W2UA 2QVAA 3SOLA 3UUXB 4UVCB 2XPKA 2FGRA 2VQFT 4LMJA 4DV5T 4D5UA 1W0BA 2LT3A 2XY8B 4EZHA 4HFIA 3KVAA 4AYDC 2QA7A 3AE8A 3PUWF 2K5BB 3HI2A 1I6ZA 4X65T 3N9LA 5ABEA 4IE0A 4JCHA 2WQYA 3BRYA 3Q5DA 2LHNA 3FZHB 1FEWA 1YQ4A 2YU2A 3P4QA 1NAFA 3ZMUB 3RYIE 3PJAA 3AA0B 2IWWA 4TUYE 2BG9B 3LK2A 4LSIA 5FY1A 2CLYC 2JMKA 4DUZT 4DUYT 5FL0A 5LGNB 2Y2XA 3ONXA 1ZHYA 1OXZA 4IL6O 5DABA 5C8YE 5J2UE 4K3BA 5AQFB 4D64A 2B1EA 5PRNA 5L3FB 2V6YB 3AVSA 2J4UP 4E1SA 4AQFA 3UFGA 2X0YA 5JQGE 1Z8UA 1WFDA 3AXJB 5HCMA 3NBXX 4UIGA 4ASKA 2E9XD 1PHOA 1WYBA 4AYMC 3WI3A 3KZIO 5LJNA 4TWFA 3RYCE 3FHNA 3QK6A 3DWOX 2L8KA 1YKHB 4JUYA 4GCPA 4ZI3D 5AQNB 2DI4A 3KVBA 2D0TA 2YDSA 4HWIB 1BR1A 2IMLA 3AAEA 4C4VB 4CQIA 2K9AA 2XTRA 2WB5A 4WW0A 3KINB 5LB7B 4AFKA 4OYJA 5AQIB 1DU2A 4QHOA 1KK7A 3VZWX 2XQ5A 3CIRA 4TWHA 1KNPA 3JC6C 3N2OA 3AEGA 1PRNA 4K0KT 3E22E 4IL9A 2NTXA 3N5LA 3ZT6A 3UTKA 2UXDT 2R4LA 4MALA 3RC8A 4Z8XA 4UVBB 5LBQB 2HN2A 4AUIA 4IT4A 2N9DA 3POUA 2VB6A 4G76A 2XE1A 4XZCA 3FXDB 2NW9A 4WBNE 2W81C 2CE7A 3VR8A 5JREA 3UU3A 4N74A 2ZLDA 2Q9QA 3QNUA 1XWMA 4I43B 5AQRB 3P4PA 3HW9A 3ABVA 1OEDC 4JI3T 1EZ3A 4AXPA 5IYUA 5IUXA 4EGWA 2D9DA 3ZYLA 4LSEA 5KDMC 5LYJE 3ZSTA 2HPLA 5AQLB 2CXDA 4HWCA 1MNEA 3I0QA 3K3QC 5FVKA 4QH4A 2RA1A 4HWDA 4NUUA 4I50E 5IYZE 4QH1A 3CK6A 1E2AA 4GKJT 3T20A 3MKDA 4TX5A 4ZI3C 1KEYA 5AFUL 3UULA 4UXNB 3I1AA 3MK7C 3VKGA 2L3LA 4DR3T 5HEGA 2XSAA 2WWUA 3SRZA 2K24A 3JCFA 4GIWA 4JI8T 4AKMA 3PDYA 4JEHB 1HXUA 1QJPA 4TV9E 1SA0E 3AAIA 2LJLA 2C5IT 2R4NA 2C5JA 2LFUA 3A7MA 1XDPA 5A1LA 1IBLT 5M4YA 1M7KA 4RLCA 5AFUK 4XBFB 1X79A 1MIWA 3EDUA 4XAXB 4TNVA 2A2FX 2X9HA 4OX9T 3CX8B 3SYBA 5G3AA 2YU1A 4O49A 2D5UA 1IJ5A 4IDOA 4O2AE 4DV4T 4DMWA 5JH7E 3NVOA 3HL6A 3POQA 1HF8A 4EXTA 4DV2T 5AQHB 1KNRA 3RPUA 3RQUA 2C0SA 2WU5A 2KINB 5FL1A 3V5SA 5EK3A 1T98A 1D1BA 3E08A 2R4OA 4LSHA 2J47A 4I55E 2VQET 3AA7B 4QXHB 4DO0A 2WZHA 4B3MT 2W63A 2IHR1 3JAFA 3A0HO 2WCAA 1GFMA 4M1PA 3PU3A 3ZLIA 4G75A 5G26A 5JR9B 2XQ6A 2NTYA 4OHFA 2BG9A 2V8SV 1L0VA 4A5XA 4OFZA 3B57A 2NOXA 1QLBA 4YSZA 3H3AA 3UUNA 3CQGB 3LK3B 4C91A 4IDZA 4EB6E 4ISSA 2CRBA 5FY0A 5L3CB 1GFOA 4LMLA 2JIWA 3FZKB 5JDQA 1HXTA 4NPPA 3P7IA 4EYYR 3BK9A 3KVDD 4IE6A 2V6YA 2PBIA 1U5PA 2R88A 5CA1E 2KWIB 3PUSA 1QJ8A 2HHHT 3AXJA 2VKHA 4HFCA 4X1IE 2HN1A 2I0MA 2FJBA 1HR0T 3GA8A 2H7OA 3N9NA 4ZZCA 3FBLA 2RP4A 2LHRA 5FNVE 1D0YA 4DMVA 4LF9T 2C5KT 4MBQA 2KDYA 3C50A 5EZYE 3KFWX 5JDMA 3I9WA 1YS5A 2FJDA 3JADA 2EHOC 5LGTB 4JI5T 3CVRA 1YQ3A 3DZMA 5L47A 4GK5E 2XSBA 3O0EA 4FMSA 1I94T 5AQKB 5FYMA 3MACA 5ADXL
chains in the Genus database with same CATH topology
3F57A 4UVCB 4AKRB 1UCUA 5HXCA 2F1TA 1FMVA 2FGRA 2XAFB 3U78A 4AKRA 2VWAA 2XMXA 3NRXA 4D5UA 2VL8A 4X1KE 3F2EA 2UXNB 2LT3A 3F31A 4O4IE 4EZHA 3KVAA 4HEAA 3VY8X 4AYDC 2QA7A 2P9BA 2KLQA 3VZTX 3N2KE 1WYCA 2K5BB 2XASB 3HI2A 3SS1A 2Y0HA 3PURA 3ZMTB 4RL9A 2CEAA 2XHEB 3B13A 3I0OA 4DNDA 1QSDA 4GCSA 4AZLA 4UV9B 4DVDA 3N9LA 5FXZA 5LG4A 5HYAA 3FB2A 1UX5A 1LKXA 2ZM8A 4IE0A 4CI3B 4GYRA 4JCHA 3LBXB 2CMRA 1HXXA 5D5DA 5LBMA 3LBXA 3PTRB 3RRCA 4ZI7E 1GFQA 5H6QB 3AVRA 1LVKA 2CWYA 2K48A 2LHNA 1FEWA 3UPGA 2F1VA 2YU2A 2LM9A 2VKJA 3Q9DA 3ZMZB 4X1YE 1NAFA 2NWBA 3ZMUB 3RYIE 4K0UA 2X9YA 1HS7A 4Z3TA 3AA0B 2CLYB 3PRNA 3WI4A 3FBZA 4TV8E 3AA0A 5ADXK 4AKIA 3R6NA 4A56A 2GK9A 4PFOA 4ZI2D 2Y48B 1BR4A 4TUYE 3LK2B 5JVDE 2ZMAA 2MTQA 4IE4A 3LK2A 2CA5A 4LSIA 5FY1A 2OA5A 2CLYC 2VK9A 2LSIA 4I4TE 4AKLA 3VZUX 2JMKA 3K3NA 1OWAA 3GP6A 4FRTA 3HOLA 5DJQC 3MZKB 2JMHA 5LGNB 2K4TA 4U72A 2ZLYA 2MBGA 2Y2XA 2JPFA 4C69X 3ONXA 1IAPA 1ZHYA 1OXZA 5DABA 2L9QA 5C8YE 5LJMA 5J2UE 3VY9X 3LK41 2ERVA 3VE2A 4D64A 2K0LA 2B1EA 3L09A 3NZQA 3K3OA 2W80C 2JRKA 4QWNB 5TAOA 2ZFGA 5PRNA 5L3BB 3EVYA 4L0RA 5L3FB 4FOZA 5HWXA 3SY7A 3ANWB 4RJWA 2A72A 2Q9QD 3ZYMA 3KBUA 2CCQA 3AVSA 3QRCA 4E1SA 2J4UP 2V7MA 4AQFA 3Q5XA 5JQGE 3AA6B 5IHYA 4H9PC 1V9DA 1H7CA 4GYSA 5LHGB 3AA6A 3CPZA 1ZKEA 8PRNA 3NBXX 4PK5A 4BAYB 3V5UA 2H7VC 5JRCB 3J9X1 4UIGA 2H3RA 4ASKA 1B7TA 4MFRA 2KWHA 4O4LE 4EIWA 2E9XD 2LSYA 5JRCA 1G90A 3V8UA 3AAAA 4L5GA 2ZM2A 5FXXA 2LOSA 1WYBA 4H9SE 5LCYA 1PHOA 4AYMC 2YINA 4ZOLE 3WI3A 4P0BA 5L2LA 5LJNA 4JLEA 3RYCE 3FHNA 3NRYA 3QK6A 2L8KA 4OK0A 5FP3A 1YKHB 3WAKA 3HOEA 3CQXC 3H37A 4E7ZA 4PAGA 4O4HE 5GV0A 4GCQA 3GN5A 5FMNA 4GOUA 4ISTA 4JUYA 4GCPA 4WNKA 5FXWA 4ZI3D 3ZCJA 4MHCA 4H9QC 3MXZA 4KP3C 3NZPA 1ZV4X 2DI4A 2ODUA 5EK4A 3KVBA 3ZMSB 2D0TA 4UV8B 1BR1A 4IIJE 4YHJA 4FZLA 2GE4A 3K19A 3AAEA 5HWYA 1MMGA 3CQCB 3ZYKA 4CQIA 2K9AA 2V7KA 1MIYA 3ZJ1A 2XTRA 3PQSA 1QJ9A 2M06A 3OJAA 3LG7A 4PFPA 4WW0A 3KINB 3WI5A 2J1DG 2WM9A 1GFPA 4OYJA 2XG6A 4AFKA 3VKHA 4O4XA 3ZN0B 1U4QA 4QHOA 1KK7A 4XNLA 4N78D 3S4UA 2ODJA 4PJNA 4O3WA 3VZWX 1HG2A 3ETUA 3ETVA 2W00A 3HKBE 3N9QA 3OBVE 2N2LA 2XAHB 3JC6C 3N2OA 2BZBA 1PRNA 4AYNA 1ZHXA 2ODVA 2X27X 1US7B 3E22E 1CUNA 2D0UA 2MYSA 2NTXA 3N5LA 3UTKA 5LGUB 5HAXA 3C4ZA 4MALA 2ES0A 3RC8A 4Z8XA 4UVBB 2WMNA 1D1AA 2EHOD 5LBQB 1S35A 3U3IA 3A2SX 3A5XA 4AUIA 4CXXA 4BUMX 3I9YA 2N9DA 3POUA 4EZ4A 2VB6A 4G76A 3IEEA 2XE1A 2DHRA 4XZCA 3FXDB 2ACXA 4FESA 1OPFA 5HXEA 2NW9A 1O3XA 3FXEB 4O8SA 4WBNE 2X0LB 2W81C 4YJ3E 2CE7A 4PUXA 5JDNA 2LSGA 4O3ZA 3N9MA 5JREA 4KUMB 4JEUB 2J1NA 4N58A 4ZS2A 3VU7H 3O9XA 5KMGP 3SZDA 1YD8G 4B6XA 3UAQA 2ZLDA 2X9WA 3PORA 2Q9QA 3UT5E 4I43B 4ADZA 1LVFA 5DQWA 2YK0A 3HW9A 5FXVA 3TZGA 3C64A 3HKCE 3KV4A 3AA7A 2KMFA 1HFAA 1EZ3A 4AXPA 2WBLA 3P8CD 5CA0E 3CX7B 3PUGA 7PRNA 4H9OC 5IYUA 5CB4E 2NW7A 2X9XA 4QX7B 3C51A 1OSMA 3ZYLA 2LE8A 4LSEA 5KDMC 5DL7A 5LYJE 4AI6A 1HCIA 3PUQA 2E9XA 2FGQX 2BVMA 4CXWA 5EE2A 2V26A 3QC9A 3J7Yq 4UF0A 5JR9A 1IZNB 2HPLA 3KDSE 2Y0KA 2CXDA 3TKLB 4HGAA 1IZNA 1G73A 1MNDA 2Y6XA 4C90A 4FJOA 4GHBA 2OMFA 1MNEA 2V7JA 3DA3A 3ZPOA 1ZHWA 1VRBA 3IBPA 2XTLA 2CM0A 3I0QA 2KZ7B 3K3QC 4HE8A 4F6RC 2RA1A 2KZ7A 4O3XB 2DLRA 4B61A 4NUUA 4I50E 2DWGA 4HKAA 5IYZE 2XAGB 3HWBA 3T0SA 1S94A 1ZHTA 3LK3A 2KNDA 3T20A 2WMOA 2HH7A 4AQFC 3MKDA 3BQIA 2BDEA 4FT6A 4TX5A 4U74A 4ZI3C 1WR6A 5DL5A 2PRNA 4ILUA 4ZHQE 1MMAA 3SWHA 4E7SA 5AFUL 3AAAB 2E8IA 3UULA 2X67A 5JDFA 4UXNB 2PORA 5L3GB 2CXFA 2M07A 3LK42 3I1AA 5LXTE 4KRAA 3MK7C 3DA4A 4UELA 3VKGA 4IHJE 3RYFE 4IE5A 3SYSA 1BXWA 2L3LA 2XE3A 4H9RC 4CXYA 3GN5B 3M65A 5E0OA 2N2MA 2M67A 3UUMA 5DL6A 3RC3A 2VKDA 5DQVA 3CWZB 5F8PA 3UU2A 2Z6EA 2WWUA 3DP7A 3SRZA 2K24A 4EAHA 2V1DB 5LHIB 3T24A 2KT9A 4GIWA 4FUVA 1BR0A 1NWMX 2JJ9A 4AKMA 2PG8A 3PDYA 4JEHB 4PJJA 5L3EB 1LRZA 1HXUA 3VHLA 1QJPA 2QTKA 3AAEB 2YPVA 4TV9E 1SA0E 3AAIA 2LJLA 2C5IT 3Q5WA 4ERRA 2C5JA 3LJCA 4P09A 2LFUA 2HPJA 3OYZA 4O4JE 2IC9A 5LHHB 1MM4A 1BR2A 1HX8A 5A1LA 5ETWA 2PJQA 4CZZB 2D2SA 1ZHCA 2EHOA 1Z0PA 5M4YA 4KR8A 4GF4A 3MJXA 2YNKA 4RLCA 4CI2B 2CXLA 1P4TA 5AFUK 3IF8B 3R84B 5KX5E 4XBFB 1X79A 1MIWA 3EDUA 3O4XE 4XAXB 2A2FX 2X9HA 4AYID 4TZ4C 1ZHZA 2Y8DA 3CX8B 3L3PA 3SYBA 4RLBA 4U9CA 3K8PC 4QKNA 3POXA 2YU1A 3E0ZA 3KV6A 1ORMA 4O49A 4FI5A 3PU8A 4FZMA 2XE2A 1GFNA 3ZCIA 2D5UA 2WSSV 4PJLA 2ZM0A 3IHRA 4AKGA 1IJ5A 4O2AE 4GK0E 4PNIA 5JDHA 3CKDA 1BT9A 4DMWA 4TN7B 5JH7E 3HL6A 5JDGA 3POQA 3PQUA 1HF8A 4UVAB 3ZC1A 2XQYA 4ZI2C 1Q9FA 3QUJA 4EXTA 4O4UA 1UX4A 5H6RB 3O1IA 2MNHA 1E54A 3C4XA 5LA6E 3PUAA 4MLKA 4YJ2E 2I59A 3RPUA 2C0SA 3UUXB 4AKHA 2MHLA 2KINB 3V5SA 4V1Av 4PK6A 4H63H 3N9PA 3HR0A 3RKOA 3BQLA 4QX8B 3PE0A 4WBOA 1Y64B 1MPFA 5LP6E 5EK3A 1T98A 1D1BA 3RBHA 3SZVA 3AB3B 2Q9QB 1D0XA 2V7LA 3E08A 4HTEA 4PW8A 3ZC0A 2IAKA 4QXBB 4RJXA 3NSGA 3D0TA 3RYHE 4LSHA 2KXPB 3OYXA 2G0UA 4I55E 3JC6D 2KXPA 3AA7B 3DTOA 4QXHB 4DO0A 3EUHA 4PK4A 2W63A 2X66A 4CI1B 2SPCA 5JDPA 2Q9QC 3JTYA 2KC0A 5HXSA 5T5FA 2VKOA 4J2CA 3C4WA 3GMIA 1GFMA 1Q9GA 4M1PA 3PU3A 3UFEA 3ZLIA 2BVLA 3OKQA 6PRNA 2JMMA 3FYXA 4BJNA 2E9XB 1MIVA 3Q2MA 2Y7SA 4G75A 3RRWA 5G26A 4AYEC 4UF0B 1AJ3A 2X51A 3MA9A 1D0ZA 4DBRA 5BMVE 5JR9B 5DL8A 3KV9A 2NTYA 2XAJB 2VASA 4OHFA 3AA1B 1H6S1 4FRXA 1BH3A 3AA1A 2E9XC 4LSFA 4OFZA 3B57A 1YKEB 2NOXA 1WLXA 2N1GA 4AQGA 5JR9C 4N59A 3ESLA 1SHZC 2LEHA 3RX6A 2X68A 3H3AA 3UUNA 4FSOA 3CQGB 3LK3B 2QGSA 2O4VA 4C91A 4IDZA 4OYKA 1ZEEA 3ZEFB 2YEVC 3GWHA 2PFVA 3KBTA 2IW5B 4F4BA 3ZMVB 4EYUA 4EB6E 1VOMA 4ISSA 4KBMB 4PJMA 4FSPA 2CWOA 3T8OA 2XAQB 2LSKA 1HTJF 3CMLA 3N2GE 5FY0A 5L3CB 1GFOA 4KR4A 3VE1A 3HKDE 3ZN1B 4BJMA 4HN9A 1MM5A 4HFVA 5JDQA 4IGUA 1HXTA 3EMNX 3P7IA 4EYYR 3BK9A 2JQQA 4IE6A 3KVDD 2PBIA 3ANWA 1U5PA 2DNXA 1D1CA 3EDVA 4KMCA 4QXCB 4G63A 3WAJA 2DWKA 4ANJA 2V7IA 5CA1E 4YFSA 2KWIB 3PUSA 4ZS3A 1QJ8A 3LFMA 1G8XA 1E1HB 4FZNA 2XTQA 3SY9A 2MOZA 5EK2A 1IJ6A 1MMDA 4JFBA 1QUUA 5FVNA 4O2BE 2A3DA 2IC6A 2VKHA 2WAUA 5F3JA 4H63V 1MMNA 4X1IE 4E1TA 5J1GA 1YW0A 3O1HA 2LHFA 3GA8A 2H7OA 3N9NA 1FMWA 3FBLA 4X20E 2RP4A 2LHRA 4EOZB 4NUVA 5FNVE 1D0YA 3BQKA 2UXXB 3ZJ2A 4P0AA 4L9IA 4DMVA 2C5KT 5HXHA 1FIOA 5LNKA 4MBQA 3G7GA 2KDYA 2EHOB 2W0GA 3C50A 5EZYE 3C98B 1WRDA 3KFWX 5JDMA 5FY7A 3HKEE 2NP9A 3DJBA 4H9NC 3I9WA 5HXRA 2Y0LA 1YS5A 1KNZA 4YLHA 2XE5A 2XUEA 4UEMA 3RH3A 3HA4A 2EHOC 1HG5A 2N2NA 5LGTB 3QRAA 5LOVE 5JDLA 4QQ1A 2W61A 4G2AA 3CVRA 3O1JA 4IE7A 3W15B 1THQA 3CX6B 4BA9A 5J2TE 3N9OA 4GK5E 3O0EA 4D65A 2LOPA 4FMSA 2LSJA 5GONE 4DBQA 2NW8A 3KV5A 2DCFA 4XNKA 3C5OA 4O3YA 2W62A 5FYMA 5L3DB 3SOLA 3MACA 5ADXL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KXP B;  4AKR B;  2KZ7 A;  2KXP A;  3AA7 B;  4AKR A;  3AA7 A;  5AFU K;  3AA6 B;  3LK3 B;  3LK3 A;  3AA6 A;  3LK4 1;  3AAE B;  3AAE A;  3AA0 B;  5AFU L;  3AAA B;  3AAA A;  5ADX K;  3AA0 A;  1IZN B;  3LK4 2;  3LK2 B;  3AA1 B;  1IZN A;  3LK2 A;  3AA1 A;  2KZ7 B;  5ADX L; 
#chains in the Genus database with same CATH topology
 1FMV A;  1J5E T;  2XAF B;  2BKP A;  3U78 A;  4AKR A;  3NRX A;  2LRL A;  2UXN B;  2YDR A;  4PJ0 O;  4HEA A;  3VY8 X;  4KI0 F;  2XAS B;  2YOE A;  3SS1 A;  2Y0H A;  3ZMT B;  4RL9 A;  4EED A;  2CEA A;  4DR7 T;  1QSD A;  3RQW A;  5CFB A;  4DV0 T;  4DVD A;  5FXZ A;  5HYA A;  4CI3 B;  3NKZ A;  3LBX B;  1HXX A;  4YSX A;  3P4S A;  2YDQ A;  4ZI7 E;  1GFQ A;  2K48 A;  3Q9D A;  2LM9 A;  3ZMZ B;  4X64 T;  3PV0 F;  2F1C X;  1HS7 A;  4Z3T A;  4HWF A;  2CLY B;  4B3R T;  2IIU A;  5ADX K;  4TV8 E;  4ZI2 D;  5JVD E;  4IE4 A;  2VK9 A;  4IDP A;  1OWA A;  3GP6 A;  2XM2 A;  2JMH A;  2K4T A;  2JPF A;  2X9K A;  2JQ9 A;  1IAP A;  2R89 A;  3VY9 X;  2WJR A;  3LK4 1;  3VE2 A;  4ILC A;  3NZQ A;  2R4P A;  3EVY A;  4L0R A;  4FOZ A;  3SY7 A;  3ANW B;  4RJW A;  2Q9Q D;  3ZYM A;  2CCQ A;  3Q5X A;  3FZM B;  3PUZ F;  3NJT A;  3AA6 B;  4H9P C;  1H7C A;  2LKG A;  4KHP T;  1ZKE A;  4BAY B;  5JRC B;  1JNZ A;  3J9X 1;  4EIW A;  2WWV A;  3V8U A;  2ZM2 A;  2LOS A;  5LCY A;  5E79 O;  5HEO A;  3RIA A;  4OK0 A;  3WAK A;  3H37 A;  3AE3 A;  4O4H E;  3PJA J;  4NXM T;  5L4E A;  4IST A;  5KAF O;  4H9Q C;  4JI7 T;  3MXZ A;  4U33 A;  2R8A A;  2ODU A;  3ZMS B;  2BBJ A;  4YHJ A;  5HWY A;  1MMG A;  2V7K A;  1MIY A;  2UUA T;  1QJ9 A;  3RIU A;  5HEJ A;  3OJA A;  3LG7 A;  4PFP A;  2J4G A;  2WM9 A;  1NEK A;  2V5C A;  4ZEY A;  3VKH A;  2WDR A;  4O4X A;  4XNL A;  2H88 A;  4N78 D;  4O3W A;  4AIS A;  1HG2 A;  2W00 A;  4X66 T;  2K3W A;  2BZB A;  4DV3 T;  4AYN A;  5KXJ A;  2X27 X;  1US7 B;  1CUN A;  2XM1 A;  3UU6 A;  3A2S X;  3A5X A;  4BUM X;  3I9Y A;  3A0B O;  4ILA A;  2M6B A;  1OPF A;  1O3X A;  2ACZ A;  5CJ5 A;  5JDN A;  4KUM B;  4JEU B;  4TWD A;  1OED B;  1R8I A;  5KMG P;  2JQH A;  3UAQ A;  4ADZ A;  3C64 A;  3H3M A;  4QH5 A;  3AA7 A;  2KMF A;  5CA0 E;  4U3C A;  7PRN A;  2BKO A;  2NW7 A;  1E7P A;  4DV6 T;  4AI6 A;  3AE7 A;  3RIF A;  3PUQ A;  2J62 A;  4CXW A;  3J7Y q;  4JI6 T;  5JR9 A;  1IZN B;  2Y0K A;  2JQK A;  1G73 A;  4C90 A;  2OMF A;  1ZHW A;  3IBP A;  2CM0 A;  2UU9 T;  4HE8 A;  5ABG A;  2KZ7 A;  1HNZ T;  2DWG A;  4HKA A;  1XDO A;  1S94 A;  3AEE A;  3LK3 A;  2WMO A;  2BDE A;  4FT6 A;  1WR6 A;  5B5E O;  2DL1 A;  1T72 A;  4E7S A;  3AAA B;  3DA4 A;  4TNW A;  4IHJ E;  4HFD A;  2XE3 A;  4CXY A;  3P4R A;  3M65 A;  4WZX A;  2N2M A;  2MPK A;  5DL6 A;  3RC3 A;  1Y01 A;  2VKD A;  5DQV A;  5F8P A;  3T24 A;  2KT9 A;  1SUM B;  2VVN A;  5ABF B;  5H2F O;  2YPV A;  2BG9 E;  4P09 A;  2IC9 A;  1BR2 A;  1T8B A;  4X5T A;  4I0U A;  2D2S A;  1ZHC A;  4EV6 A;  1Z0P A;  1N34 T;  4DV7 T;  5KX5 E;  1X9B A;  3O4X E;  4AYI D;  4TZ4 C;  1ZHZ A;  4U9C A;  3JAE A;  3E0Z A;  3KV6 A;  3PU8 A;  4FZM A;  1GFN A;  3ZCI A;  3NWI A;  4PJL A;  4GK0 E;  4TN7 B;  5JDG A;  3PQU A;  3ZC1 A;  3L39 A;  3O1I A;  5AQM B;  3C4X A;  2E5V A;  3AE2 A;  2XQA A;  2UXC T;  3AEF A;  2XQ8 A;  4AKH A;  2WVP A;  2MHL A;  4ZZB A;  4PK6 A;  4U2Y A;  3N9P A;  3HR0 A;  5LG3 A;  4WBO A;  5LP6 E;  3SZV A;  3AB3 B;  1W0A A;  1D0X A;  4PW8 A;  2IAK A;  4RJX A;  4A98 A;  2CHN A;  1UGO A;  3AE1 A;  2KXP B;  5GTH O;  3OYX A;  3EHZ A;  4PR7 A;  5JDP A;  2KC0 A;  5HXS A;  5T5F A;  4J2C A;  3GMI A;  2B76 A;  2PTF A;  4JI2 T;  3EAM A;  3UFE A;  6PRN A;  2A9U A;  4UF0 B;  1AJ3 A;  4DBR A;  3KV9 A;  2XAJ B;  4JBW F;  1BH3 A;  3AA1 A;  2E9X C;  4LSF A;  5IWA T;  1YKE B;  1WLX A;  3ESL A;  2LEH A;  2AXT O;  2QGS A;  5AQO B;  3ZEF B;  3GWH A;  2PFV A;  3ZMV B;  4EYU A;  4PJM A;  2CWO A;  2XAQ B;  3ONL C;  3N2G E;  3HKD E;  3TLT A;  3ZN1 B;  4BJM A;  1IBK T;  3EMN X;  3P4W A;  2JQQ A;  3ANW A;  3WAJ A;  4G63 A;  3LFM A;  1E1H B;  2KSR A;  2AXD S;  1MMD A;  1T16 A;  2IC6 A;  1MMN A;  2CBJ A;  5J1G A;  1YW0 A;  5AQJ B;  1FMW A;  5AQQ B;  4NUV A;  3BQK A;  4UB8 O;  3UUB A;  2UXX B;  1KF6 A;  4P0A A;  4L9I A;  2LRK A;  3IA3 A;  2EHO B;  2W0G A;  3C98 B;  3HKE E;  5HXR A;  5LOV E;  3UU8 A;  4QQ1 A;  3O1J A;  4IE7 A;  1THQ A;  3CX6 B;  3TLU A;  2LSJ A;  4LF8 T;  3AEB A;  3UU4 A;  3KV5 A;  2W62 A;  3QB5 A;  3F57 A;  2F1T A;  1UCU A;  5HXC A;  4U7I A;  5F5W A;  2XMX A;  5JTG A;  2VL8 A;  4O4I E;  4IDN A;  3ZT5 A;  2P9B A;  2KLQ A;  5G39 A;  3N2K E;  1WYC A;  4AZL A;  3QOF A;  5LG4 A;  3FB2 A;  1UX5 A;  1LKX A;  2ZM8 A;  3ONJ A;  5HCJ A;  5LBM A;  3PTR B;  4YT0 A;  2R6G F;  1LVK A;  1J5W A;  4X1Y E;  2BBH A;  4K0U A;  1J1J A;  2MAW A;  1NEN A;  3ZSS A;  3AA0 A;  4AKI A;  5G38 A;  5HEU A;  3R6N A;  4A56 A;  2GK9 A;  4PFO A;  2LM2 A;  2Y48 B;  3LK2 B;  1OED A;  2ZMA A;  2MTQ A;  2CA5 A;  2OA5 A;  2LSI A;  3VZU X;  5B66 O;  4FRT A;  1XMQ T;  5DJQ C;  4U72 A;  2ZLY A;  2MBG A;  2UXB T;  1VCS A;  3DWN A;  2ERV A;  2K0L A;  3L09 A;  2W80 C;  2JRK A;  4YTP A;  2ZFG A;  5L3B B;  2AE9 A;  4YY3 T;  2A72 A;  1JNR A;  3QRC A;  3TLV A;  2E5L T;  2FJE A;  5IHY A;  4GYS A;  1XZY A;  3CPZ A;  8PRN A;  4DR2 T;  3V5U A;  2H7V C;  1G90 A;  1B7T A;  4O4L E;  2LSY A;  5GTI O;  3AAA A;  5FXX A;  4H9S E;  4NXN T;  3VRB A;  2YIN A;  3FZL B;  4JLE A;  3RF1 A;  3NRY A;  5FP3 A;  3HOE A;  3CQX C;  4E7Z A;  5GV0 A;  4GCQ A;  4JV5 T;  3RI5 A;  3NZP A;  1ZV4 X;  4NIQ A;  5EK4 A;  5ABF A;  3ZT7 A;  4C4V A;  1GQE A;  2BKN A;  3WI5 A;  2J1D G;  3RGL A;  3RIU C;  2QYW A;  3ZN0 B;  3ETV A;  3HKB E;  3N9Q A;  1T1L A;  2XAH B;  4CN4 A;  1ZHX A;  2ODV A;  2MYS A;  5LGU B;  5HAX A;  3C4Z A;  3AE9 A;  1YXR A;  3U3I A;  2FBW A;  4CXX A;  4EZ4 A;  3IEE A;  1VCT A;  3T1Y T;  2ACX A;  4O8S A;  2X0L B;  4YJ3 E;  4PUX A;  2LSG A;  4JI1 T;  4O3Z A;  3N9M A;  2J1N A;  1XNR T;  3O9X A;  3SZD A;  5FKY A;  1YD8 G;  4B6X A;  2X9W A;  3POR A;  1LVF A;  5DQW A;  3PGR A;  2YK0 A;  5HEH A;  5AQT B;  3KV4 A;  2WBL A;  3P8C D;  4H9O C;  4LF6 T;  2X9X A;  4QX7 B;  5DL7 A;  3G06 A;  2FGQ X;  5EE2 A;  1N36 T;  3QC9 A;  3EI0 A;  2V6X A;  4UF0 A;  5FVL A;  3KDS E;  3AE4 A;  4HGA A;  1MND A;  2WDQ A;  3DA3 A;  3ZPO A;  1VRB A;  1UK5 A;  4F6R C;  4B61 A;  4JI4 T;  1ZHT A;  4CN6 A;  4AQF C;  3OTO T;  5DL5 A;  4ILU A;  4ZHQ E;  4LFC T;  2X67 A;  5JDF A;  4LF4 T;  2CXF A;  2OLT A;  5LXT E;  2ZM6 T;  4KRA A;  4UEL A;  3RYF E;  4IE5 A;  1BXW A;  3T1H T;  3GN5 B;  5E0O A;  4LMK A;  2M67 A;  3UUM A;  3CWZ B;  2V1D B;  4FUV A;  1NWM X;  2JJ9 A;  4PJJ A;  5L3E B;  1LRZ A;  2QTK A;  1XNQ T;  3Q5W A;  4AIU A;  4ERR A;  3EAB A;  1MM4 A;  1HX8 A;  2LLY A;  3PUV F;  3TLW A;  2EHO A;  1W9R A;  2WY2 A;  3Q5E A;  4Z91 A;  3MJX A;  4GF4 A;  1CHU A;  3R84 B;  2Y8D A;  3K8P C;  4QKN A;  1ORM A;  1XMO T;  4AKG A;  2XQ4 A;  3UQ7 A;  4PNI A;  5JDH A;  4UVA B;  4ZI2 C;  3QUJ A;  4COF A;  4IDQ A;  1E54 A;  5LA6 E;  4YJ2 E;  2I59 A;  1ZP0 A;  4V1A v;  1KFY A;  4QX8 B;  3PE0 A;  2X0H A;  2JQY A;  4GKK T;  4HFB A;  3NSG A;  3RYH E;  2G0U A;  4U2Z A;  3JC6 D;  3EUH A;  4CI1 B;  2SPC A;  2Q9Q C;  4P1N A;  1Q9G A;  4C00 A;  4BJN A;  2E9X B;  1MIV A;  3Q2M A;  4AYE C;  3RRW A;  1D0Z A;  4FQE A;  2VAS A;  1H6S 1;  3JCU O;  3A8Y C;  1ZOY A;  5AQG B;  4N59 A;  2N1G A;  4CTD A;  4YHH T;  4OYK A;  2YEV C;  4F4B A;  1VOM A;  4FSP A;  4KBM B;  4IL4 A;  2LSK A;  3CML A;  4KR4 A;  2XQ3 A;  2DWK A;  4YFS A;  2W66 A;  4FZN A;  2XTQ A;  2VVS A;  4O2B E;  2A3D A;  1OED E;  3LSV A;  4X20 E;  4EOZ B;  4U7Y A;  4KHZ F;  2WDV A;  3ZJ2 A;  3G7G A;  2XQ7 A;  1IBM T;  1WRD A;  2NP9 A;  3DJB A;  3TLS A;  2Y0L A;  3SFD A;  2XE5 A;  2UUC T;  3HA4 A;  1HG5 A;  2N2N A;  2XZE A;  5LMU T;  1WR0 A;  2F4V T;  5J2T E;  4D65 A;  2LOP A;  3PUX F;  4U31 A;  4DBQ A;  4XNK A;  2DCF A;  4O3Y A;  5L3D B;  3ZKR A;  4AKR B;  5C3J A;  3QB5 K;  2VWA A;  4JYA T;  1S5L O;  4X1K E;  3F2E A;  3F31 A;  2XQ9 A;  2I6H A;  3VZT X;  3PUR A;  4LFA T;  3AED A;  3AEC A;  2XHE B;  3B13 A;  3I0O A;  4DND A;  4GCS A;  4UV9 B;  4GYR A;  3PGS A;  2CMR A;  3UQ4 A;  5D5D A;  3LBX A;  3RRC A;  3FZF B;  5H6Q B;  3AVR A;  2CWY A;  5LMN T;  3UPG A;  2F1V A;  2VKJ A;  2NWB A;  2X9Y A;  3PRN A;  3WI4 A;  3FBZ A;  1BR4 A;  2BS2 A;  4WYV A;  2IWV A;  3RLF F;  2H89 A;  4UR9 A;  4AKL A;  4HFE A;  4I4T E;  2NR4 A;  3K3N A;  3HOL A;  3MZK B;  2BG9 C;  4C69 X;  2L9Q A;  5LJM A;  3P50 A;  4A97 A;  3K3O A;  4QWN B;  5TAO A;  4EEB A;  5HWX A;  3KBU A;  1M62 A;  2V7M A;  1UUR A;  4Z90 A;  1T7S A;  1V9D A;  5LHG B;  3AA6 A;  3LDQ B;  4PK5 A;  2H3R A;  5JRC A;  4MFR A;  2KWH A;  4L5G A;  3PUY F;  4ZOL E;  4P0B A;  5L2L A;  4PAG A;  3BS0 A;  3PGU A;  3GN5 A;  5FMN A;  4GOU A;  4DR1 T;  5ABH A;  4WNK A;  5FXW A;  3ZCJ A;  4MHC A;  4KP3 C;  5BR8 T;  2WS3 A;  4UV8 B;  4IIJ E;  4FZL A;  2GE4 A;  3K19 A;  3CQC B;  3ZYK A;  3ZJ1 A;  3PQS A;  3VRA A;  2M06 A;  4DR4 T;  3X1D A;  1GFP A;  2XG6 A;  2VL0 A;  1U4Q A;  3S4U A;  2ODJ A;  4PJN A;  3ETU A;  4YTN A;  3OBV E;  2N2L A;  4ILB A;  3AE6 A;  4B3T T;  2D0U A;  4LF5 T;  2RPA A;  2ES0 A;  1HNX T;  2UUB T;  2WMN A;  1D1A A;  2EHO D;  1S35 A;  3AE5 A;  4LFB T;  2DHR A;  4FES A;  5HXE A;  3FXE B;  4N58 A;  4B3S T;  4ZS2 A;  3VU7 H;  3UT5 E;  4DR6 T;  5FXV A;  3TZG A;  3HKC E;  4CN1 A;  1HFA A;  2OV9 A;  3CX7 B;  3PUG A;  2YN6 A;  5CB4 E;  3C51 A;  1OSM A;  2LE8 A;  3RHW A;  1HCI A;  2E9X A;  2BVM A;  2V26 A;  3TKL B;  1IZN A;  2Y6X A;  4GHB A;  4FJO A;  2V7J A;  5AQS B;  2XTL A;  2KZ7 B;  4DV1 T;  4O3X B;  3M3Z B;  2DLR A;  3HWB A;  2XAG B;  3T0S A;  2KND A;  1HX1 B;  2HH7 A;  2BS4 A;  3BQI A;  4X62 T;  4U74 A;  2PRN A;  1MMA A;  3SWH A;  2E8I A;  2WP9 A;  2POR A;  5L3G B;  2M07 A;  3LK4 2;  5KAI O;  4YTM A;  3SYS A;  4H9R C;  3UU2 A;  2Z6E A;  3DP7 A;  4EAH A;  5LHI B;  5TIS O;  1BR0 A;  2PG8 A;  3VHL A;  2XJ7 A;  3AAE B;  3LJC A;  2HPJ A;  2V5D A;  3OYZ A;  4O4J E;  5LHH B;  3B5M A;  5ETW A;  2PJQ A;  2VUR A;  4CZZ B;  2BS3 A;  2FJA A;  4KR8 A;  5AQV B;  1FJG T;  2CHO A;  2YNK A;  4CI2 B;  2CXL A;  1P4T A;  3IF8 B;  1N33 T;  4YSY A;  3L3P A;  4RLB A;  3POX A;  4FI5 A;  2XE2 A;  2QRX A;  3OPC A;  2WSS V;  2ZM0 A;  3IHR A;  3WU2 O;  3CKD A;  1BT9 A;  3K1S A;  1UUS A;  2XQY A;  1Q9F A;  4O4U A;  1UX4 A;  5H6R B;  2MNH A;  2YKS A;  3PUA A;  4MLK A;  1HNW T;  4KX6 A;  4H63 H;  3RKO A;  3BQL A;  1Y64 B;  3AEA A;  1MPF A;  3RBH A;  2Q9Q B;  2V7L A;  3SFE A;  4HTE A;  4Q25 A;  3ZC0 A;  4QXB B;  3D0T A;  2KXP A;  3DTO A;  4PK4 A;  2W4X A;  2X66 A;  3L8R A;  2LKH A;  3JTY A;  4F8H A;  2VKO A;  3C4W A;  2CBI A;  2BVL A;  3OKQ A;  2JMM A;  3FYX A;  2FUP A;  4DR5 T;  2Y7S A;  2X51 A;  3MA9 A;  5BMV E;  5DL8 A;  4FRX A;  3AA1 B;  1W09 A;  4AQG A;  5JR9 C;  2E2A A;  1SHZ C;  4YXD A;  3RX6 A;  2X68 A;  4FSO A;  2O4V A;  4N75 A;  1ZEE A;  2IW5 B;  3KBT A;  2WZI A;  2WJQ A;  5CGM A;  4ZXL A;  5C2T A;  3T8O A;  5L4H A;  1HTJ F;  2CPT A;  3VE1 A;  3PF1 A;  1MM5 A;  4HN9 A;  4HFV A;  4IGU A;  4KMC A;  2DNX A;  1D1C A;  3EDV A;  4QXC B;  4LF7 T;  4AQY T;  4ANJ A;  2V7I A;  5AQU B;  4ZS3 A;  1G8X A;  1SE7 A;  2WU2 A;  2IUB A;  3SY9 A;  4DID B;  2MOZ A;  5EK2 A;  1IJ6 A;  4JFB A;  1QUU A;  5FVN A;  4IRE A;  2WAU A;  3BRZ A;  5F3J A;  4H63 V;  4HFH A;  4UB6 O;  4E1T A;  3O1H A;  2IDO B;  2LHF A;  5AQP B;  3VR9 A;  1WCR A;  5LNK A;  5HXH A;  1FIO A;  1N32 T;  4HWH A;  5FY7 A;  5J0Z A;  4H9N C;  1KNZ A;  4YLH A;  2XUE A;  4UEM A;  3RH3 A;  3QRA A;  2W67 A;  3UU5 A;  5JDL A;  4JI0 T;  3OVU A;  2W61 A;  4G2A A;  2M6I A;  3W15 B;  4BA9 A;  3N9O A;  4K3C A;  3RKG A;  5GON E;  2NW8 A;  3C5O A;  2W2U A;  2QVA A;  3SOL A;  3UUX B;  4UVC B;  2XPK A;  2FGR A;  2VQF T;  4LMJ A;  4DV5 T;  4D5U A;  1W0B A;  2LT3 A;  2XY8 B;  4EZH A;  4HFI A;  3KVA A;  4AYD C;  2QA7 A;  3AE8 A;  3PUW F;  2K5B B;  3HI2 A;  1I6Z A;  4X65 T;  3N9L A;  5ABE A;  4IE0 A;  4JCH A;  2WQY A;  3BRY A;  3Q5D A;  2LHN A;  3FZH B;  1FEW A;  1YQ4 A;  2YU2 A;  3P4Q A;  1NAF A;  3ZMU B;  3RYI E;  3PJA A;  3AA0 B;  2IWW A;  4TUY E;  2BG9 B;  3LK2 A;  4LSI A;  5FY1 A;  2CLY C;  2JMK A;  4DUZ T;  4DUY T;  5FL0 A;  5LGN B;  2Y2X A;  3ONX A;  1ZHY A;  1OXZ A;  4IL6 O;  5DAB A;  5C8Y E;  5J2U E;  4K3B A;  5AQF B;  4D64 A;  2B1E A;  5PRN A;  5L3F B;  2V6Y B;  3AVS A;  2J4U P;  4E1S A;  4AQF A;  3UFG A;  2X0Y A;  5JQG E;  1Z8U A;  1WFD A;  3AXJ B;  5HCM A;  3NBX X;  4UIG A;  4ASK A;  2E9X D;  1PHO A;  1WYB A;  4AYM C;  3WI3 A;  3KZI O;  5LJN A;  4TWF A;  3RYC E;  3FHN A;  3QK6 A;  3DWO X;  2L8K A;  1YKH B;  4JUY A;  4GCP A;  4ZI3 D;  5AQN B;  2DI4 A;  3KVB A;  2D0T A;  2YDS A;  4HWI B;  1BR1 A;  2IML A;  3AAE A;  4C4V B;  4CQI A;  2K9A A;  2XTR A;  2WB5 A;  4WW0 A;  3KIN B;  5LB7 B;  4AFK A;  4OYJ A;  5AQI B;  1DU2 A;  4QHO A;  1KK7 A;  3VZW X;  2XQ5 A;  3CIR A;  4TWH A;  1KNP A;  3JC6 C;  3N2O A;  3AEG A;  1PRN A;  4K0K T;  3E22 E;  4IL9 A;  2NTX A;  3N5L A;  3ZT6 A;  3UTK A;  2UXD T;  2R4L A;  4MAL A;  3RC8 A;  4Z8X A;  4UVB B;  5LBQ B;  2HN2 A;  4AUI A;  4IT4 A;  2N9D A;  3POU A;  2VB6 A;  4G76 A;  2XE1 A;  4XZC A;  3FXD B;  2NW9 A;  4WBN E;  2W81 C;  2CE7 A;  3VR8 A;  5JRE A;  3UU3 A;  4N74 A;  2ZLD A;  2Q9Q A;  3QNU A;  1XWM A;  4I43 B;  5AQR B;  3P4P A;  3HW9 A;  3ABV A;  1OED C;  4JI3 T;  1EZ3 A;  4AXP A;  5IYU A;  5IUX A;  4EGW A;  2D9D A;  3ZYL A;  4LSE A;  5KDM C;  5LYJ E;  3ZST A;  2HPL A;  5AQL B;  2CXD A;  4HWC A;  1MNE A;  3I0Q A;  3K3Q C;  5FVK A;  4QH4 A;  2RA1 A;  4HWD A;  4NUU A;  4I50 E;  5IYZ E;  4QH1 A;  3CK6 A;  1E2A A;  4GKJ T;  3T20 A;  3MKD A;  4TX5 A;  4ZI3 C;  1KEY A;  5AFU L;  3UUL A;  4UXN B;  3I1A A;  3MK7 C;  3VKG A;  2L3L A;  4DR3 T;  5HEG A;  2XSA A;  2WWU A;  3SRZ A;  2K24 A;  3JCF A;  4GIW A;  4JI8 T;  4AKM A;  3PDY A;  4JEH B;  1HXU A;  1QJP A;  4TV9 E;  1SA0 E;  3AAI A;  2LJL A;  2C5I T;  2R4N A;  2C5J A;  2LFU A;  3A7M A;  1XDP A;  5A1L A;  1IBL T;  5M4Y A;  1M7K A;  4RLC A;  5AFU K;  4XBF B;  1X79 A;  1MIW A;  3EDU A;  4XAX B;  4TNV A;  2A2F X;  2X9H A;  4OX9 T;  3CX8 B;  3SYB A;  5G3A A;  2YU1 A;  4O49 A;  2D5U A;  1IJ5 A;  4IDO A;  4O2A E;  4DV4 T;  4DMW A;  5JH7 E;  3NVO A;  3HL6 A;  3POQ A;  1HF8 A;  4EXT A;  4DV2 T;  5AQH B;  1KNR A;  3RPU A;  3RQU A;  2C0S A;  2WU5 A;  2KIN B;  5FL1 A;  3V5S A;  5EK3 A;  1T98 A;  1D1B A;  3E08 A;  2R4O A;  4LSH A;  2J47 A;  4I55 E;  2VQE T;  3AA7 B;  4QXH B;  4DO0 A;  2WZH A;  4B3M T;  2W63 A;  2IHR 1;  3JAF A;  3A0H O;  2WCA A;  1GFM A;  4M1P A;  3PU3 A;  3ZLI A;  4G75 A;  5G26 A;  5JR9 B;  2XQ6 A;  2NTY A;  4OHF A;  2BG9 A;  2V8S V;  1L0V A;  4A5X A;  4OFZ A;  3B57 A;  2NOX A;  1QLB A;  4YSZ A;  3H3A A;  3UUN A;  3CQG B;  3LK3 B;  4C91 A;  4IDZ A;  4EB6 E;  4ISS A;  2CRB A;  5FY0 A;  5L3C B;  1GFO A;  4LML A;  2JIW A;  3FZK B;  5JDQ A;  1HXT A;  4NPP A;  3P7I A;  4EYY R;  3BK9 A;  3KVD D;  4IE6 A;  2V6Y A;  2PBI A;  1U5P A;  2R88 A;  5CA1 E;  2KWI B;  3PUS A;  1QJ8 A;  2HHH T;  3AXJ A;  2VKH A;  4HFC A;  4X1I E;  2HN1 A;  2I0M A;  2FJB A;  1HR0 T;  3GA8 A;  2H7O A;  3N9N A;  4ZZC A;  3FBL A;  2RP4 A;  2LHR A;  5FNV E;  1D0Y A;  4DMV A;  4LF9 T;  2C5K T;  4MBQ A;  2KDY A;  3C50 A;  5EZY E;  3KFW X;  5JDM A;  3I9W A;  1YS5 A;  2FJD A;  3JAD A;  2EHO C;  5LGT B;  4JI5 T;  3CVR A;  1YQ3 A;  3DZM A;  5L47 A;  4GK5 E;  2XSB A;  3O0E A;  4FMS A;  1I94 T;  5AQK B;  5FYM A;  3MAC A;  5ADX L; 
#chains in the Genus database with same CATH homology
 3F57 A;  4UVC B;  4AKR B;  1UCU A;  5HXC A;  2F1T A;  1FMV A;  2FGR A;  2XAF B;  3U78 A;  4AKR A;  2VWA A;  2XMX A;  3NRX A;  4D5U A;  2VL8 A;  4X1K E;  3F2E A;  2UXN B;  2LT3 A;  3F31 A;  4O4I E;  4EZH A;  3KVA A;  4HEA A;  3VY8 X;  4AYD C;  2QA7 A;  2P9B A;  2KLQ A;  3VZT X;  3N2K E;  1WYC A;  2K5B B;  2XAS B;  3HI2 A;  3SS1 A;  2Y0H A;  3PUR A;  3ZMT B;  4RL9 A;  2CEA A;  2XHE B;  3B13 A;  3I0O A;  4DND A;  1QSD A;  4GCS A;  4AZL A;  4UV9 B;  4DVD A;  3N9L A;  5FXZ A;  5LG4 A;  5HYA A;  3FB2 A;  1UX5 A;  1LKX A;  2ZM8 A;  4IE0 A;  4CI3 B;  4GYR A;  4JCH A;  3LBX B;  2CMR A;  1HXX A;  5D5D A;  5LBM A;  3LBX A;  3PTR B;  3RRC A;  4ZI7 E;  1GFQ A;  5H6Q B;  3AVR A;  1LVK A;  2CWY A;  2K48 A;  2LHN A;  1FEW A;  3UPG A;  2F1V A;  2YU2 A;  2LM9 A;  2VKJ A;  3Q9D A;  3ZMZ B;  4X1Y E;  1NAF A;  2NWB A;  3ZMU B;  3RYI E;  4K0U A;  2X9Y A;  1HS7 A;  4Z3T A;  3AA0 B;  2CLY B;  3PRN A;  3WI4 A;  3FBZ A;  4TV8 E;  3AA0 A;  5ADX K;  4AKI A;  3R6N A;  4A56 A;  2GK9 A;  4PFO A;  4ZI2 D;  2Y48 B;  1BR4 A;  4TUY E;  3LK2 B;  5JVD E;  2ZMA A;  2MTQ A;  4IE4 A;  3LK2 A;  2CA5 A;  4LSI A;  5FY1 A;  2OA5 A;  2CLY C;  2VK9 A;  2LSI A;  4I4T E;  4AKL A;  3VZU X;  2JMK A;  3K3N A;  1OWA A;  3GP6 A;  4FRT A;  3HOL A;  5DJQ C;  3MZK B;  2JMH A;  5LGN B;  2K4T A;  4U72 A;  2ZLY A;  2MBG A;  2Y2X A;  2JPF A;  4C69 X;  3ONX A;  1IAP A;  1ZHY A;  1OXZ A;  5DAB A;  2L9Q A;  5C8Y E;  5LJM A;  5J2U E;  3VY9 X;  3LK4 1;  2ERV A;  3VE2 A;  4D64 A;  2K0L A;  2B1E A;  3L09 A;  3NZQ A;  3K3O A;  2W80 C;  2JRK A;  4QWN B;  5TAO A;  2ZFG A;  5PRN A;  5L3B B;  3EVY A;  4L0R A;  5L3F B;  4FOZ A;  5HWX A;  3SY7 A;  3ANW B;  4RJW A;  2A72 A;  2Q9Q D;  3ZYM A;  3KBU A;  2CCQ A;  3AVS A;  3QRC A;  4E1S A;  2J4U P;  2V7M A;  4AQF A;  3Q5X A;  5JQG E;  3AA6 B;  5IHY A;  4H9P C;  1V9D A;  1H7C A;  4GYS A;  5LHG B;  3AA6 A;  3CPZ A;  1ZKE A;  8PRN A;  3NBX X;  4PK5 A;  4BAY B;  3V5U A;  2H7V C;  5JRC B;  3J9X 1;  4UIG A;  2H3R A;  4ASK A;  1B7T A;  4MFR A;  2KWH A;  4O4L E;  4EIW A;  2E9X D;  2LSY A;  5JRC A;  1G90 A;  3V8U A;  3AAA A;  4L5G A;  2ZM2 A;  5FXX A;  2LOS A;  1WYB A;  4H9S E;  5LCY A;  1PHO A;  4AYM C;  2YIN A;  4ZOL E;  3WI3 A;  4P0B A;  5L2L A;  5LJN A;  4JLE A;  3RYC E;  3FHN A;  3NRY A;  3QK6 A;  2L8K A;  4OK0 A;  5FP3 A;  1YKH B;  3WAK A;  3HOE A;  3CQX C;  3H37 A;  4E7Z A;  4PAG A;  4O4H E;  5GV0 A;  4GCQ A;  3GN5 A;  5FMN A;  4GOU A;  4IST A;  4JUY A;  4GCP A;  4WNK A;  5FXW A;  4ZI3 D;  3ZCJ A;  4MHC A;  4H9Q C;  3MXZ A;  4KP3 C;  3NZP A;  1ZV4 X;  2DI4 A;  2ODU A;  5EK4 A;  3KVB A;  3ZMS B;  2D0T A;  4UV8 B;  1BR1 A;  4IIJ E;  4YHJ A;  4FZL A;  2GE4 A;  3K19 A;  3AAE A;  5HWY A;  1MMG A;  3CQC B;  3ZYK A;  4CQI A;  2K9A A;  2V7K A;  1MIY A;  3ZJ1 A;  2XTR A;  3PQS A;  1QJ9 A;  2M06 A;  3OJA A;  3LG7 A;  4PFP A;  4WW0 A;  3KIN B;  3WI5 A;  2J1D G;  2WM9 A;  1GFP A;  4OYJ A;  2XG6 A;  4AFK A;  3VKH A;  4O4X A;  3ZN0 B;  1U4Q A;  4QHO A;  1KK7 A;  4XNL A;  4N78 D;  3S4U A;  2ODJ A;  4PJN A;  4O3W A;  3VZW X;  1HG2 A;  3ETU A;  3ETV A;  2W00 A;  3HKB E;  3N9Q A;  3OBV E;  2N2L A;  2XAH B;  3JC6 C;  3N2O A;  2BZB A;  1PRN A;  4AYN A;  1ZHX A;  2ODV A;  2X27 X;  1US7 B;  3E22 E;  1CUN A;  2D0U A;  2MYS A;  2NTX A;  3N5L A;  3UTK A;  5LGU B;  5HAX A;  3C4Z A;  4MAL A;  2ES0 A;  3RC8 A;  4Z8X A;  4UVB B;  2WMN A;  1D1A A;  2EHO D;  5LBQ B;  1S35 A;  3U3I A;  3A2S X;  3A5X A;  4AUI A;  4CXX A;  4BUM X;  3I9Y A;  2N9D A;  3POU A;  4EZ4 A;  2VB6 A;  4G76 A;  3IEE A;  2XE1 A;  2DHR A;  4XZC A;  3FXD B;  2ACX A;  4FES A;  1OPF A;  5HXE A;  2NW9 A;  1O3X A;  3FXE B;  4O8S A;  4WBN E;  2X0L B;  2W81 C;  4YJ3 E;  2CE7 A;  4PUX A;  5JDN A;  2LSG A;  4O3Z A;  3N9M A;  5JRE A;  4KUM B;  4JEU B;  2J1N A;  4N58 A;  4ZS2 A;  3VU7 H;  3O9X A;  5KMG P;  3SZD A;  1YD8 G;  4B6X A;  3UAQ A;  2ZLD A;  2X9W A;  3POR A;  2Q9Q A;  3UT5 E;  4I43 B;  4ADZ A;  1LVF A;  5DQW A;  2YK0 A;  3HW9 A;  5FXV A;  3TZG A;  3C64 A;  3HKC E;  3KV4 A;  3AA7 A;  2KMF A;  1HFA A;  1EZ3 A;  4AXP A;  2WBL A;  3P8C D;  5CA0 E;  3CX7 B;  3PUG A;  7PRN A;  4H9O C;  5IYU A;  5CB4 E;  2NW7 A;  2X9X A;  4QX7 B;  3C51 A;  1OSM A;  3ZYL A;  2LE8 A;  4LSE A;  5KDM C;  5DL7 A;  5LYJ E;  4AI6 A;  1HCI A;  3PUQ A;  2E9X A;  2FGQ X;  2BVM A;  4CXW A;  5EE2 A;  2V26 A;  3QC9 A;  3J7Y q;  4UF0 A;  5JR9 A;  1IZN B;  2HPL A;  3KDS E;  2Y0K A;  2CXD A;  3TKL B;  4HGA A;  1IZN A;  1G73 A;  1MND A;  2Y6X A;  4C90 A;  4FJO A;  4GHB A;  2OMF A;  1MNE A;  2V7J A;  3DA3 A;  3ZPO A;  1ZHW A;  1VRB A;  3IBP A;  2XTL A;  2CM0 A;  3I0Q A;  2KZ7 B;  3K3Q C;  4HE8 A;  4F6R C;  2RA1 A;  2KZ7 A;  4O3X B;  2DLR A;  4B61 A;  4NUU A;  4I50 E;  2DWG A;  4HKA A;  5IYZ E;  2XAG B;  3HWB A;  3T0S A;  1S94 A;  1ZHT A;  3LK3 A;  2KND A;  3T20 A;  2WMO A;  2HH7 A;  4AQF C;  3MKD A;  3BQI A;  2BDE A;  4FT6 A;  4TX5 A;  4U74 A;  4ZI3 C;  1WR6 A;  5DL5 A;  2PRN A;  4ILU A;  4ZHQ E;  1MMA A;  3SWH A;  4E7S A;  5AFU L;  3AAA B;  2E8I A;  3UUL A;  2X67 A;  5JDF A;  4UXN B;  2POR A;  5L3G B;  2CXF A;  2M07 A;  3LK4 2;  3I1A A;  5LXT E;  4KRA A;  3MK7 C;  3DA4 A;  4UEL A;  3VKG A;  4IHJ E;  3RYF E;  4IE5 A;  3SYS A;  1BXW A;  2L3L A;  2XE3 A;  4H9R C;  4CXY A;  3GN5 B;  3M65 A;  5E0O A;  2N2M A;  2M67 A;  3UUM A;  5DL6 A;  3RC3 A;  2VKD A;  5DQV A;  3CWZ B;  5F8P A;  3UU2 A;  2Z6E A;  2WWU A;  3DP7 A;  3SRZ A;  2K24 A;  4EAH A;  2V1D B;  5LHI B;  3T24 A;  2KT9 A;  4GIW A;  4FUV A;  1BR0 A;  1NWM X;  2JJ9 A;  4AKM A;  2PG8 A;  3PDY A;  4JEH B;  4PJJ A;  5L3E B;  1LRZ A;  1HXU A;  3VHL A;  1QJP A;  2QTK A;  3AAE B;  2YPV A;  4TV9 E;  1SA0 E;  3AAI A;  2LJL A;  2C5I T;  3Q5W A;  4ERR A;  2C5J A;  3LJC A;  4P09 A;  2LFU A;  2HPJ A;  3OYZ A;  4O4J E;  2IC9 A;  5LHH B;  1MM4 A;  1BR2 A;  1HX8 A;  5A1L A;  5ETW A;  2PJQ A;  4CZZ B;  2D2S A;  1ZHC A;  2EHO A;  1Z0P A;  5M4Y A;  4KR8 A;  4GF4 A;  3MJX A;  2YNK A;  4RLC A;  4CI2 B;  2CXL A;  1P4T A;  5AFU K;  3IF8 B;  3R84 B;  5KX5 E;  4XBF B;  1X79 A;  1MIW A;  3EDU A;  3O4X E;  4XAX B;  2A2F X;  2X9H A;  4AYI D;  4TZ4 C;  1ZHZ A;  2Y8D A;  3CX8 B;  3L3P A;  3SYB A;  4RLB A;  4U9C A;  3K8P C;  4QKN A;  3POX A;  2YU1 A;  3E0Z A;  3KV6 A;  1ORM A;  4O49 A;  4FI5 A;  3PU8 A;  4FZM A;  2XE2 A;  1GFN A;  3ZCI A;  2D5U A;  2WSS V;  4PJL A;  2ZM0 A;  3IHR A;  4AKG A;  1IJ5 A;  4O2A E;  4GK0 E;  4PNI A;  5JDH A;  3CKD A;  1BT9 A;  4DMW A;  4TN7 B;  5JH7 E;  3HL6 A;  5JDG A;  3POQ A;  3PQU A;  1HF8 A;  4UVA B;  3ZC1 A;  2XQY A;  4ZI2 C;  1Q9F A;  3QUJ A;  4EXT A;  4O4U A;  1UX4 A;  5H6R B;  3O1I A;  2MNH A;  1E54 A;  3C4X A;  5LA6 E;  3PUA A;  4MLK A;  4YJ2 E;  2I59 A;  3RPU A;  2C0S A;  3UUX B;  4AKH A;  2MHL A;  2KIN B;  3V5S A;  4V1A v;  4PK6 A;  4H63 H;  3N9P A;  3HR0 A;  3RKO A;  3BQL A;  4QX8 B;  3PE0 A;  4WBO A;  1Y64 B;  1MPF A;  5LP6 E;  5EK3 A;  1T98 A;  1D1B A;  3RBH A;  3SZV A;  3AB3 B;  2Q9Q B;  1D0X A;  2V7L A;  3E08 A;  4HTE A;  4PW8 A;  3ZC0 A;  2IAK A;  4QXB B;  4RJX A;  3NSG A;  3D0T A;  3RYH E;  4LSH A;  2KXP B;  3OYX A;  2G0U A;  4I55 E;  3JC6 D;  2KXP A;  3AA7 B;  3DTO A;  4QXH B;  4DO0 A;  3EUH A;  4PK4 A;  2W63 A;  2X66 A;  4CI1 B;  2SPC A;  5JDP A;  2Q9Q C;  3JTY A;  2KC0 A;  5HXS A;  5T5F A;  2VKO A;  4J2C A;  3C4W A;  3GMI A;  1GFM A;  1Q9G A;  4M1P A;  3PU3 A;  3UFE A;  3ZLI A;  2BVL A;  3OKQ A;  6PRN A;  2JMM A;  3FYX A;  4BJN A;  2E9X B;  1MIV A;  3Q2M A;  2Y7S A;  4G75 A;  3RRW A;  5G26 A;  4AYE C;  4UF0 B;  1AJ3 A;  2X51 A;  3MA9 A;  1D0Z A;  4DBR A;  5BMV E;  5JR9 B;  5DL8 A;  3KV9 A;  2NTY A;  2XAJ B;  2VAS A;  4OHF A;  3AA1 B;  1H6S 1;  4FRX A;  1BH3 A;  3AA1 A;  2E9X C;  4LSF A;  4OFZ A;  3B57 A;  1YKE B;  2NOX A;  1WLX A;  2N1G A;  4AQG A;  5JR9 C;  4N59 A;  3ESL A;  1SHZ C;  2LEH A;  3RX6 A;  2X68 A;  3H3A A;  3UUN A;  4FSO A;  3CQG B;  3LK3 B;  2QGS A;  2O4V A;  4C91 A;  4IDZ A;  4OYK A;  1ZEE A;  3ZEF B;  2YEV C;  3GWH A;  2PFV A;  3KBT A;  2IW5 B;  4F4B A;  3ZMV B;  4EYU A;  4EB6 E;  1VOM A;  4ISS A;  4KBM B;  4PJM A;  4FSP A;  2CWO A;  3T8O A;  2XAQ B;  2LSK A;  1HTJ F;  3CML A;  3N2G E;  5FY0 A;  5L3C B;  1GFO A;  4KR4 A;  3VE1 A;  3HKD E;  3ZN1 B;  4BJM A;  4HN9 A;  1MM5 A;  4HFV A;  5JDQ A;  4IGU A;  1HXT A;  3EMN X;  3P7I A;  4EYY R;  3BK9 A;  2JQQ A;  4IE6 A;  3KVD D;  2PBI A;  3ANW A;  1U5P A;  2DNX A;  1D1C A;  3EDV A;  4KMC A;  4QXC B;  4G63 A;  3WAJ A;  2DWK A;  4ANJ A;  2V7I A;  5CA1 E;  4YFS A;  2KWI B;  3PUS A;  4ZS3 A;  1QJ8 A;  3LFM A;  1G8X A;  1E1H B;  4FZN A;  2XTQ A;  3SY9 A;  2MOZ A;  5EK2 A;  1IJ6 A;  1MMD A;  4JFB A;  1QUU A;  5FVN A;  4O2B E;  2A3D A;  2IC6 A;  2VKH A;  2WAU A;  5F3J A;  4H63 V;  1MMN A;  4X1I E;  4E1T A;  5J1G A;  1YW0 A;  3O1H A;  2LHF A;  3GA8 A;  2H7O A;  3N9N A;  1FMW A;  3FBL A;  4X20 E;  2RP4 A;  2LHR A;  4EOZ B;  4NUV A;  5FNV E;  1D0Y A;  3BQK A;  2UXX B;  3ZJ2 A;  4P0A A;  4L9I A;  4DMV A;  2C5K T;  5HXH A;  1FIO A;  5LNK A;  4MBQ A;  3G7G A;  2KDY A;  2EHO B;  2W0G A;  3C50 A;  5EZY E;  3C98 B;  1WRD A;  3KFW X;  5JDM A;  5FY7 A;  3HKE E;  2NP9 A;  3DJB A;  4H9N C;  3I9W A;  5HXR A;  2Y0L A;  1YS5 A;  1KNZ A;  4YLH A;  2XE5 A;  2XUE A;  4UEM A;  3RH3 A;  3HA4 A;  2EHO C;  1HG5 A;  2N2N A;  5LGT B;  3QRA A;  5LOV E;  5JDL A;  4QQ1 A;  2W61 A;  4G2A A;  3CVR A;  3O1J A;  4IE7 A;  3W15 B;  1THQ A;  3CX6 B;  4BA9 A;  5J2T E;  3N9O A;  4GK5 E;  3O0E A;  4D65 A;  2LOP A;  4FMS A;  2LSJ A;  5GON E;  4DBQ A;  2NW8 A;  3KV5 A;  2DCF A;  4XNK A;  3C5O A;  4O3Y A;  2W62 A;  5FYM A;  5L3D B;  3SOL A;  3MAC A;  5ADX L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...