3LK42

Crystal structure of capz bound to the uncapping motif from cd2ap
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
242
structure length
238
Chain Sequence
b'DQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQERTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-1
publication title Structural characterization of a capping protein interaction motif defines a family of actin filament regulators
doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 78
structure length 238
sequence length 242
chains with identical sequence 5, 8, B, E, H, K, N, Q, T, W, Z
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lk4201
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3lk4202
4AKRA 4AKRB 5AFUK 5ADXK 2KZ7A 2KZ7B 3AA6A 3AA6B 2KXPB 3LK3A 2KXPA 3LK3B 3AA1A 3AA1B 1IZNA 1IZNB 3AA0A 3AAAA 3AA0B 3AAAB 3LK42 5ADXL 3AAEA 3AAEB 5AFUL 3LK41 3AA7A 3LK2A 3AA7B 3LK2B
chains in the Genus database with same CATH superfamily
4LSFA 3B57A 3GA8A 4AKRA 3M3ZB 3A0BO 2V8SV 2FJBA 3ZC1A 1NAFA 2DWGA 3EDUA 5J0ZA 4D5UA 2UXXB 2IDOB 3MXZA 4DVDA 4KBMB 4EEDA 2LKGA 3M65A 4QH4A 4P1NA 2M07A 4PNIA 4JEUB 4AKHA 5FVNA 5BMVE 3T20A 2WWVA 4C69X 1KF6A 4I43B 5LHIB 4FZMA 3Q5XA 4H9QC 4ILUA 3ZT7A 5JDGA 1PRNA 4DR1T 2MNHA 3ZYLA 1SA0E 1YD8G 2XAHB 4RJXA 2CM0A 5ADXL 5C2TA 3ZCJA 2V5CA 4U7IA 1IBMT 4GIWA 1YS5A 1UX4A 5LBQB 1ZKEA 3HI2A 4C90A 1W0BA 5LXTE 5AQMB 1KFYA 3K19A 3P8CD 2WVPA 5LOVE 1S94A 3U3IA 2LT3A 3RX6A 3SFDA 2QTKA 4GKKT 3UU4A 1N34T 4I55E 5ETWA 3JC6D 2LHRA 3EABA 3RHWA 2HN1A 3CKDA 3AE3A 3NRYA 4K0UA 3VRAA 4BAYB 5AQVB 3PUXF 1YQ3A 4X1KE 4A56A 1ZHYA 3RYIE 1ZOYA 3F2EA 2EHOB 4PK4A 2DNXA 2CBIA 2KC0A 2A9UA 3BK9A 5EZYE 5TAOA 1VCTA 3TLTA 3KBUA 1HS7A 3PUAA 5PRNA 2CXDA 5HXCA 4JUYA 3K1SA 5M4YA 2K4TA 1JNZA 2NW7A 4LMJA 4LSIA 1N33T 3PUYF 4ZHQE 4D64A 4GK0E 3FYXA 2CWOA 3TZGA 4GKJT 1XMOT 4EIWA 4MFRA 1VRBA 4PUXA 5AQKB 1HXTA 4NUVA 5FXXA 5DL6A 1QLBA 3SFEA 2BBJA 4I4TE 4IDNA 2JQ9A 4JI5T 5C3JA 1W0AA 4L5GA 1OPFA 4CQIA 3VZTX 2ACZA 4IE7A 1HXXA 5KAIO 4H63V 5CA1E 4AKLA 2JPFA 4UV9B 4KI0F 3CX8B 2N2LA 1UUSA 3SZDA 2WZHA 4PK6A 2J1DG 5T5FA 5L4HA 2QA7A 4LFCT 2VVNA 2R4OA 4ZS3A 4BUMX 2OA5A 3VY8X 3QB5K 4B3ST 3MJXA 3QC9A 5JDMA 2ERVA 2F1CX 2WZIA 3UTKA 4QXCB 3PGRA 1T98A 2VKOA 3EAMA 4HTEA 2UXDT 2XPKA 2N1GA 1MPFA 4LF9T 3AA1B 1EZ3A 5HEJA 3QK6A 5JREA 3CQGB 3LDQB 2HPLA 3T0SA 3KV5A 3VE1A 4HFIA 2WDRA 4ISSA 4TWHA 1LKXA 1PHOA 3RRWA 1WYBA 2I0MA 3N2GE 3SY9A 1D0ZA 2LSGA 3LJCA 2XTLA 3ZEFB 2LFUA 1O3XA 5JDFA 5H6QB 3AA0B 4FOZA 4PAGA 3ZKRA 4G2AA 1WYCA 3P50A 4WNKA 3UAQA 1MIYA 4PJ0O 4RJWA 4KR4A 1HNZT 4AKRB 3PORA 3DZMA 2BS2A 3I1AA 3HOEA 5FY7A 3OPCA 4CN4A 2K48A 4AI6A 2KLQA 2FJAA 2FGRA 3H3AA 1W9RA 1OEDE 4U72A 1X79A 3NZQA 2Y0KA 2MOZA 4KX6A 2WS3A 5C8YE 2M06A 4O4LE 4CN6A 1THQA 4AFKA 1UGOA 2CWYA 1MNEA 4DV4T 3A5XA 2ODJA 4ZI3C 5A1LA 3U78A 2F4VT 2LHFA 2C5KT 3WAKA 2PTFA 3CMLA 3ZT5A 2YNKA 4KUMB 2Y2XA 3F31A 3A0HO 3AEAA 2VASA 3I0OA 3RGLA 5ABFA 5LA6E 4O3YA 4UVAB 1ZHXA 3AVRA 2OMFA 4DR3T 5JDHA 3UULA 4LF6T 4NXNT 2E9XD 3O4XE 3O9XA 2LRKA 4DV5T 4TNWA 3ANWA 4UV8B 3LK3A 2D9DA 1QUUA 2LE8A 2AE9A 1T16A 4F4BA 2HPJA 4YFSA 1BT9A 1S5LO 4GYSA 1ZHZA 2VVSA 2XZEA 1VCSA 3KV9A 2LRLA 2VL8A 1I6ZA 2E9XA 2XQ3A 2IMLA 3K3NA 3ZMSB 2YK0A 1KEYA 2IHR1 3VR9A 3BQKA 2UXCT 5HWXA 2JJ9A 1WCRA 3PJAA 2OLTA 5IUXA 1G8XA 5L3CB 1ORMA 1FMWA 4YHHT 4IL6O 3O0EA 1Z0PA 2BS3A 4HWHA 1E54A 4B3TT 2I6HA 5BR8T 5EE2A 4O3ZA 1J1JA 1HCIA 4YTNA 4EXTA 4YSZA 4N75A 5F8PA 3A8YC 4AYID 2XJ7A 2WB5A 4GYRA 3G7GA 1WR0A 2PBIA 3UUBA 2WBLA 3K8PC 1MM4A 4B61A 4UELA 3C98B 3O1IA 2EHOC 3GWHA 2BS4A 2XE3A 2ODVA 5F3JA 4DR2T 4GOUA 3WAJA 4AISA 8PRNA 4P09A 4OYKA 4AYMC 3HKCE 5FKYA 5AQIB 2YDRA 1D0YA 5KAFO 3JTYA 3UFEA 5AQSB 1E2AA 2W66A 5FXZA 2A72A 3KFWX 1H7CA 4QHOA 3MA9A 4U2ZA 1Q9FA 2NTYA 3H37A 2IW5B 4KP3C 3J7Yq 4O4JE 4FSPA 4HFHA 3DTOA 5E79O 4O4IE 3W15B 2CXLA 3JAEA 3FZKB 5H2FO 4JV5T 3DWNA 4KRAA 1FIOA 2V6XA 4TWFA 4H9OC 3PUSA 1LVFA 2LSIA 2J4GA 3L3PA 3JAFA 5FY0A 3OBVE 2YU1A 2N9DA 3RPUA 4X20E 4G75A 1UK5A 2M6BA 4P0AA 2X66A 4EZ4A 2CCQA 4XNKA 4O3XB 2XSBA 1CHUA 4UR9A 3ZT6A 1LRZA 1MMDA 2X51A 3LSVA 4X5TA 4HKAA 3LBXA 4C4VA 3RLFF 1KK7A 2ZM2A 2LJLA 3OVUA 2SPCA 4DR7T 3ZMZB 5CA0E 5LJNA 4EGWA 1XMQT 2ZM6T 2XQYA 2XTRA 3DA4A 1KNRA 3ZCIA 1IZNA 4LFAT 4Z91A 2V6YA 4Z90A 2Z6EA 2LKHA 2I59A 4O3WA 2XQ9A 3AE5A 2IC9A 1BH3A 4QH5A 4ILCA 3C4ZA 1QSDA 2X68A 4IE5A 4M1PA 4LFBT 2C0SA 2CBJA 2WWUA 3T1HT 3DWOX 5JRCA 4ZOLE 3QUJA 5L4EA 3PF1A 2DI4A 4GF4A 3RIUC 3AEBA 4OX9T 5JVDE 5J2TE 2Y0LA 1KNZA 2CA5A 2W80C 3I0QA 1JNRA 4CXYA 1YKHB 1N36T 3UUXB 5ABFB 4D65A 2RP4A 4AIUA 4BA9A 2W61A 4PK5A 1MMAA 2IUBA 3QOFA 3T24A 1NWMX 3RC3A 4YJ2E 3ANWB 2XE5A 4IDQA 3LK3B 3SY7A 5FY1A 5AQTB 3IA3A 1BR1A 3RQWA 3VR8A 3Q5DA 2CRBA 3FB2A 3V5SA 3CQCB 2FBWA 1T72A 3Q5WA 2E9XB 4IL9A 5JH7E 2KINB 3N9QA 4DMWA 5EK3A 4TWDA 2V26A 4DO0A 3HOLA 2WDVA 2W62A 4LMLA 4CN1A 2KNDA 3VE2A 4FRXA 3BQLA 4X65T 3AE9A 4XBFB 1BR0A 2H89A 1OWAA 2CPTA 3AE6A 2X67A 2LLYA 3VRBA 2BG9A 1R8IA 3ZMUB 4E1TA 2VURA 2L9QA 4H9PC 4HWDA 1Y01A 3UQ4A 4YSXA 2CEAA 4YTPA 4O49A 5LHHB 3WI4A 4WBOA 5FYMA 2VQET 2XAGB 4FT6A 4X1IE 4EOZB 3RKOA 2CLYB 1BR4A 5HXRA 4DR5T 2WU2A 2F1VA 4NXMT 3UT5E 3P4RA 2NOXA 1YQ4A 2A2FX 3ZC0A 2CHOA 1LVKA 3POUA 3I9WA 5FNVE 4WYVA 2BG9C 2XSAA 4ZZBA 3V5UA 3CX6B 5IWAT 1MM5A 2L8KA 2BKOA 4EYYR 1HX8A 1AJ3A 2WCAA 5JDLA 4N74A 3KVDD 2ZM0A 3N9LA 4H9NC 3NWIA 4EV6A 3ZYMA 3JC6C 1QJPA 3NBXX 2XAFB 2LOSA 4U33A 4JI0T 3PQUA 3G06A 2MAWA 3AB3B 4EAHA 1GFNA 3PDYA 3FBZA 4H9RC 2ZLYA 2AXDS 3KV4A 3ZJ1A 4PFPA 2MBGA 4FZNA 4UEMA 1Q9GA 3N2OA 2XG6A 5AQFB 3C50A 3ZLIA 4UB8O 4AKIA 4DUZT 1D0XA 2UUBT 4CXWA 3VY9X 3VHLA 3T1YT 4NUUA 2D5UA 3SYBA 3NVOA 2YOEA 2MPKA 4KMCA 3HL6A 4DV0T 4BJMA 4LSHA 3FZHB 3RRCA 2UXBT 3QRAA 2IC6A 1U4QA 5HXSA 2NW8A 5J2UE 5LP6E 4Z8XA 2YDSA 2XQ4A 3FHNA 5E0OA 3NZPA 2K3WA 3ZJ2A 1WFDA 2JIWA 4P0BA 2E2AA 5FL1A 2K9AA 3LBXB 4CI2B 4C4VB 4ZI2D 2YINA 2E8IA 2ZM8A 2H7OA 3O1HA 3OYXA 3SWHA 5GTHO 2HHHT 3KZIO 3EVYA 1FEWA 3K3OA 2AXTO 5DJQC 4HFVA 5GTIO 3L39A 3QB5A 4HGAA 4B3MT 1IZNB 2V6YB 2HH7A 3RYFE 3OTOT 2IWVA 1MIVA 5B5EO 4TV8E 2C5JA 2L3LA 3ZMVB 3NKZA 5CGMA 4MBQA 1I94T 2YKSA 2DWKA 2XASB 3BRYA 2J62A 3IBPA 4UXNB 4X62T 5G3AA 3EI0A 5JRCB 5D5DA 2UUAT 2NP9A 3E08A 2FGQX 3IF8B 4G63A 3FBLA 4A97A 4HE8A 3C4XA 3VKGA 2XE1A 3KBTA 3V8UA 3RKGA 5HCJA 5AQRB 4ZEYA 2NTXA 4YXDA 2D0UA 3PUQA 5LB7B 4IREA 2BVMA 4DR4T 2VKHA 3MZKB 3AAEA 3HKBE 2WDQA 4NPPA 2BKPA 3CWZB 3BRZA 2M67A 3OJAA 4JI4T 1HR0T 4MALA 4O4UA 2JQKA 5FP3A 4LF7T 4ASKA 3GMIA 3C51A 2Q9QD 4QXBB 2IWWA 2XM1A 4U74A 4DV7T 2JMKA 2A3DA 3RYCE 2XHEB 1VOMA 3UFGA 4IDPA 1XNRT 5CFBA 1XDPA 4AQFA 4K3BA 4UB6O 4KHZF 4O2AE 4HWIB 2DL1A 4O4HE 4K3CA 2XQAA 5L3BB 4QX8B 2NWBA 1FJGT 3JCUO 3ZPOA 2DLRA 3AE7A 4H63H 4KR8A 2Q9QA 5AFUL 3I9YA 2YN6A 2BKNA 3GN5A 4QKNA 1NEKA 2ZMAA 4U3CA 4B3RT 4IDZA 2JQYA 2XAQB 5ABHA 2QGSA 2BG9B 4YLHA 4PJMA 1CUNA 1ZHCA 3A2SX 3KINB 1UCUA 2X0YA 3QRCA 2PRNA 3PTRB 2QVAA 2WSSV 3S4UA 3CPZA 2KT9A 4ILAA 1NENA 2VK9A 2D0TA 3NSGA 2E9XC 4FZLA 1L0VA 4JI3T 4DV2T 3E0ZA 1OXZA 4HFBA 4PJLA 3DA3A 1T7SA 4QWNB 5G38A 3IEEA 5KDMC 3HWBA 4DBRA 4FQEA 2JQQA 1HXUA 5LBMA 1US7B 3VKHA 4QX7B 3AE8A 3DJBA 3UUNA 2BDEA 2YDQA 5IYUA 2OV9A 2X9YA 2H7VC 2FJEA 4N58A 2RPAA 2BG9E 3CK6A 3AAIA 3RYHE 5B66O 2CLYC 3N9OA 3LK41 5KXJA 2WY2A 3AA7A 1G73A 3AVSA 2JMHA 3AE4A 4ZZCA 2X9KA 3BQIA 2PG8A 3RH3A 4HFDA 5AQUB 1BXWA 3EMNX 3T8OA 2WQYA 4OHFA 3LK42 1XNQT 3HW9A 5L2LA 3ZYKA 2KWIB 4ERRA 4RLCA 1ZEEA 1MMGA 2CHNA 3WI3A 4CI3B 2XY8B 2VL0A 4WZXA 4IGUA 4YHJA 5JR9A 3AE2A 4ILBA 2ES0A 1SE7A 3PUWF 2ACXA 2R4PA 5LG4A 4C00A 1GFQA 4TV9E 4DMVA 2IAKA 1BR2A 1OEDA 5EK4A 2W63A 5L3DB 2LSKA 5FL0A 4FRTA 1SUMB 2DCFA 2R4NA 5LG3A 2V7JA 3AA6A 3C64A 1MIWA 2E5VA 3IHRA 4O8SA 4PJNA 3KVBA 5G26A 3SOLA 2IIUA 5LYJE 4JCHA 3POXA 5JR9C 1ZHTA 2LEHA 4TX5A 1J5WA 4AQYT 2RA1A 3K3QC 3AEGA 4HWCA 1KNPA 3E22E 3KV6A 1T8BA 4TN7B 3ONLC 2R4LA 2V7KA 4QXHB 1UURA 1GFMA 5H6RB 2JQHA 2B1EA 4L9IA 2WAUA 3TLSA 5AQPB 3MACA 4JEHB 1MNDA 2W00A 3RI5A 2WJRA 2HN2A 5FVKA 1HX1B 2D2SA 2V7LA 3JADA 3AAEB 4HFCA 2KWHA 4AKMA 3D0TA 1XWMA 1HG5A 4U7YA 2VKDA 1IJ5A 4DV1T 7PRNA 2ZLDA 3UQ7A 4PFOA 3KVAA 1V9DA 4U2YA 5J1GA 3TLVA 2X9HA 4HN9A 3NJTA 4UF0A 3CX7B 4QH1A 1YW0A 4LF5T 2W67A 3RC8A 1T1LA 1HTJF 3RF1A 4AKGA 1J5ET 2W2UA 4JI6T 2YPVA 2K5BB 5GV0A 5DL8A 5DQVA 2K0LA 4U9CA 4I50E 2Q9QB 5FXVA 3GN5B 4IT4A 3GP6A 3UU5A 5L3FB 2KXPB 4UVBB 5CJ5A 2Y7SA 2VWAA 3OYZA 2LSYA 4YTMA 4KHPT 2X27X 2V1DB 3HR0A 2J47A 2FUPA 3PUZF 2VQFT 5HEOA 3FZLB 3QNUA 1GFOA 4YSYA 3VZWX 3PRNA 3PU3A 4ISTA 4K0KT 2X9WA 3WI5A 4RL9A 1YXRA 5HYAA 1HFAA 3C4WA 3HKEE 3Q9DA 3ZN1B 3JCFA 3R6NA 1SHZC 3CVRA 2NW9A 5GONE 4JI8T 4UIGA 4X66T 2H88A 5JQGE 3PU8A 5ADXK 3EHZA 4FMSA 4AYNA 4FUVA 5IHYA 5LJMA 4JLEA 4L0RA 4TZ4C 3ZSSA 3TLWA 4EZHA 3B5MA 3KDSE 3POQA 3P4WA 1QJ9A 5JDQA 2W81C 2V7MA 4YY3T 3MKDA 2VB6A 4EB6E 4A5XA 5LGNB 3AXJA 4CTDA 4OFZA 4WBNE 2XAJB 1IJ6A 1DU2A 3ETUA 4XAXB 4IE0A 2XQ6A 4I0UA 4O4XA 3NRXA 5HWYA 1Z8UA 2WMOA 1HNXT 5HEGA 3AA7B 4MHCA 4N59A 4LMKA 2JMMA 5DABA 2XQ8A 2LOPA 2XQ7A 4V1Av 3H3MA 4LF8T 2J1NA 5DL7A 3ZSTA 5DL5A 5AQGB 3UUMA 1M62A 3P4SA 3PUGA 3P4QA 5AQLB 4G76A 2WM9A 2KZ7A 5JR9B 3PE0A 5DQWA 1MMNA 4J2CA 2B76A 1M7KA 4XZCA 4GCSA 3EUHA 3CIRA 2XTQA 5AQQB 1OEDB 3HKDE 3RQUA 5FVLA 1D1AA 4LSEA 4GHBA 3PQSA 2P9BA 3LK2A 5HAXA 3UU8A 2W4XA 1W09A 3EDVA 3AA6B 3FZMB 1WLXA 2PJQA 3TLUA 4AYDC 1WR6A 4DR6T 4AUIA 3PGUA 1IBKT 4DV6T 2KMFA 4ZI3D 3VZUX 1WRDA 1G90A 2MTQA 1ZV4X 5LCYA 2JRKA 4GCPA 4X64T 3N9PA 3AECA 3SYSA 4JBWF 4QQ1A 3SS1A 1HF8A 3F57A 3Q5EA 3AEFA 4E7ZA 2UU9T 3SZVA 5LMNT 4JI2T 3LFMA 2QRXA 5AQNB 2FJDA 4DIDB 5FXWA 3N2KE 1X9BA 5ABEA 2C5IT 2UXNB 2XM2A 2MHLA 3UU2A 2XE2A 2X0LB 4OK0A 1B7TA 3AAAA 4YJ3E 4UF0B 2BBHA 4ZI2C 5L47A 4F6RC 3ZN0B 1S35A 5LMUT 2R88A 4X1YE 2R89A 2WMNA 1H6S1 2ODUA 4IE6A 2LSJA 3ZMTB 2XMXA 4O2BE 3J9X1 5TISO 2YEVC 3A7MA 2XQ5A 4XNLA 3X1DA 4Q25A 1E1HB 3RIFA 3PURA 3Q2MA 1FMVA 3PUVF 2XUEA 4U31A 2R6GF 4GCQA 2ZFGA 1ZP0A 5HEUA 4ZXLA 4JI1T 4TUYE 2NR4A 4GK5E 4HWFA 4C91A 2KSRA 3L09A 3ETVA 3RIAA 4A98A 3RBHA 4PJJA 4AZLA 2GE4A 5KMGP 4HEAA 4F8HA 2Y6XA 2LM2A 4AQGA 2KXPA 2WJQA 2UUCT 3ONJA 4B6XA 3PGSA 5JDPA 2E5LT 4AQFC 2GK9A 4JFBA 5G39A 4FI5A 5AQHB 3BS0A 4N78D 5AQOB 3TKLB 2K24A 4E1SA 2EHOD 2Y8DA 4MLKA 1OSMA 5FMNA 5AQJB 4E7SA 6PRNA 2O4VA 4DBQA 4DV3T 2Q9QC 2WU5A 4YT0A 5L3EB 4FSOA 2MYSA 2CE7A 5HCMA 5LHGB 2PFVA 3FXDB 4OYJA 3AXJB 1U5PA 5AFUK 1YKEB 4ANJA 5JDNA 4JI7T 5CB4E 2YU2A 2N2MA 4DNDA 2R8AA 2EHOA 4EYUA 3HA4A 2LM9A 3AEDA 5LNKA 3OKQA 1XDOA 4AXPA 4PR7A 5HXEA 3DP7A 4FESA 1GFPA 1D1BA 4COFA 3C5OA 3P7IA 3SRZA 4IL4A 3CQXC 2V7IA 3WU2O 3PV0F 3L8RA 1E7PA 3N9MA 2H3RA 3ONXA 2Y0HA 3PJAJ 4IDOA 3UPGA 3FZFB 2PORA 2CMRA 1Y64B 2M6IA 4JYAT 3O1JA 1UX5A 2KZ7B 5F5WA 3N9NA 1P4TA 1HG2A 4BJNA 2KDYA 5IYZE 2W0GA 3ABVA 3MK7C 3P4PA 3UU6A 4ADZA 4HFEA 4ZI7E 2DHRA 3N5LA 2BZBA 2VKJA 2X9XA 2X0HA 4IE4A 2G0UA 4TNVA 1XZYA 3LK2B 1N32T 2F1TA 4Z3TA 4UVCB 4WW0A 2J4UP 2Y48B 4H9SE 3VU7H 3UU3A 4EEBA 3FXEB 3LG7A 2LHNA 4RLBA 5EK2A 5HXHA 3ESLA 1GQEA 1D1CA 4CI1B 4CXXA 2QYWA 2V5DA 5LGTB 3AE1A 3R84B 4FJOA 3AA1A 3AEEA 4IHJE 1ZHWA 2CXFA 4PW8A 5ABGA 5KX5E 4AYEC 1HNWT 2N2NA 2BVLA 1QJ8A 5LGUB 1OEDC 5JTGA 2WP9A 1IBLT 4NIQA 5L3GB 4IIJE 4DUYT 3RIUA 4CZZB 3B13A 3AA0A 3AAAB 5HEHA 4LF4T 4ZS2A 1IAPA
chains in the Genus database with same CATH topology
3IF8B 4LSFA 3B57A 3GA8A 4OFZA 4AKRA 4G63A 3FBLA 4WBNE 2XAJB 1IJ6A 4AYID 4HE8A 3C4XA 3VKGA 4GYRA 2XE1A 3ETUA 3G7GA 4XAXB 2PBIA 3KBTA 4IE0A 3V8UA 2WBLA 3K8PC 2NTXA 2D0UA 1NAFA 3ZC1A 3PUQA 4O4XA 1MM4A 4B61A 2BVMA 2DWGA 3NRXA 4UELA 5HWYA 2VKHA 3MZKB 3AAEA 3HKBE 2WMOA 3EDUA 3C98B 3CWZB 3O1IA 3AA7B 4MHCA 2EHOC 3GWHA 2XE3A 2M67A 3OJAA 2ODVA 4N59A 4MALA 5F3JA 2JMMA 4O4UA 4D5UA 2UXXB 5DABA 2LOPA 5FP3A 3MXZA 4V1Av 4GOUA 3WAJA 4DVDA 4ASKA 3GMIA 4KBMB 3C51A 8PRNA 2Q9QD 4QXBB 2J1NA 5DL7A 4P09A 4OYKA 3M65A 5DL5A 4AYMC 3HKCE 2M07A 4PNIA 4JEUB 4U74A 3UUMA 3PUGA 4AKHA 5FVNA 2JMKA 5BMVE 1D0YA 2A3DA 3JTYA 3T20A 3RYCE 2XHEB 1VOMA 4C69X 3UFEA 4I43B 5LHIB 4FZMA 4AQFA 3Q5XA 4H9QC 4G76A 5FXZA 4ILUA 2A72A 3KFWX 1H7CA 2WM9A 4QHOA 3MA9A 2KZ7A 1Q9FA 5JR9B 2NTYA 3H37A 3PE0A 5DQWA 4KP3C 2IW5B 3J7Yq 1MMNA 4J2CA 4O4JE 5JDGA 4XZCA 4O2AE 1PRNA 4GCSA 4FSPA 4O4HE 3DTOA 3EUHA 2MNHA 4O4IE 3W15B 3ZYLA 2CXLA 5L3BB 2XTQA 1SA0E 1YD8G 3HKDE 2XAHB 2NWBA 4QX8B 1D1AA 4RJXA 4LSEA 3ZPOA 2DLRA 2CM0A 4GHBA 5ADXL 4KRAA 1FIOA 4H63H 3ZCJA 3PQSA 4KR8A 2Q9QA 5AFUL 3I9YA 4GIWA 3GN5A 3PUSA 2P9BA 4H9OC 4QKNA 1UX4A 5HAXA 1YS5A 1LVFA 2LSIA 3LK2A 5LBQB 3EDVA 1ZKEA 3HI2A 2ZMAA 3L3PA 5FY0A 3OBVE 4C90A 2YU1A 5LXTE 4IDZA 2N9DA 2XAQB 3AA6B 3RPUA 4X20E 4G75A 1WLXA 3K19A 2QGSA 2PJQA 3P8CD 4AYDC 1WR6A 4P0AA 4YLHA 2X66A 4EZ4A 5LOVE 1S94A 2CCQA 4AUIA 4PJMA 2LT3A 3RX6A 3U3IA 4XNKA 2QTKA 1CUNA 4O3XB 1ZHCA 3A2SX 1LRZA 4I55E 5ETWA 1MMDA 3JC6D 3KINB 2LHRA 2X51A 1UCUA 2KMFA 4HKAA 3QRCA 2PRNA 3LBXA 4ZI3D 3CKDA 3PTRB 3NRYA 2WSSV 3VZUX 1WRDA 2ZM2A 3CPZA 2LJLA 2SPCA 3S4UA 2KT9A 1G90A 2MTQA 4K0UA 1ZV4X 4BAYB 2VK9A 3ZMZB 5LCYA 2JRKA 5CA0E 4X1KE 4A56A 4GCPA 3N9PA 1ZHYA 3RYIE 5LJNA 3SYSA 4QQ1A 2D0TA 1HF8A 3SS1A 2XQYA 2XTRA 3F57A 3F2EA 3DA4A 2EHOB 4PK4A 2DNXA 4E7ZA 2KC0A 3ZCIA 3NSGA 2E9XC 3BK9A 5EZYE 1IZNA 4FZLA 3SZVA 5TAOA 3LFMA 1HS7A 3KBUA 2Z6EA 3E0ZA 1OXZA 3PUAA 2I59A 4PJLA 5PRNA 4O3WA 3DA3A 2CXDA 5HXCA 4JUYA 5FXWA 3N2KE 5M4YA 2K4TA 4QWNB 2C5IT 2IC9A 2NW7A 2UXNB 1BH3A 2MHLA 4LSIA 3UU2A 3IEEA 4ZHQE 5KDMC 3HWBA 2XE2A 4D64A 2X0LB 3C4ZA 4GK0E 4OK0A 1QSDA 2X68A 4IE5A 4DBRA 4M1PA 3FYXA 2CWOA 2JQQA 3TZGA 1B7TA 2C0SA 2WWUA 1HXUA 3AAAA 5LBMA 5JRCA 4ZOLE 3QUJA 4YJ3E 4EIWA 4MFRA 1VRBA 4UF0B 4PUXA 4ZI2C 1US7B 3VKHA 4F6RC 4QX7B 2DI4A 3ZN0B 1HXTA 4NUVA 5FXXA 5DL6A 3DJBA 1S35A 3UUNA 4GF4A 4I4TE 2BDEA 5JVDE 5J2TE 2Y0LA 4X1YE 1KNZA 2CA5A 2W80C 3I0QA 5IYUA 4CXYA 1YKHB 4L5GA 2WMNA 3UUXB 4D65A 2RP4A 2X9YA 1H6S1 1OPFA 2H7VC 4CQIA 4N58A 3VZTX 2ODUA 4BA9A 4IE6A 2W61A 4PK5A 1MMAA 2LSJA 3AAIA 4IE7A 3RYHE 3ZMTB 1HXXA 2XMXA 2CLYC 4O2BE 3J9X1 4H63V 3T24A 5CA1E 4AKLA 2YEVC 3N9OA 3LK41 4XNLA 2JPFA 3AA7A 4UV9B 1NWMX 1G73A 3AVSA 3CX8B 3RC3A 1E1HB 2N2LA 3PURA 3Q2MA 1FMVA 4YJ2E 3ANWB 3SZDA 2XE5A 2JMHA 4PK6A 2J1DG 5T5FA 3LK3B 3SY7A 2XUEA 2QA7A 5FY1A 3BQIA 4GCQA 2PG8A 3RH3A 2ZFGA 1BR1A 4ZS3A 4BUMX 1BXWA 3EMNX 2OA5A 3VY8X 3T8OA 4TUYE 4OHFA 3LK42 3HW9A 3MJXA 5L2LA 4GK5E 3ZYKA 3QC9A 2KWIB 3FB2A 3V5SA 3CQCB 4C91A 5JDMA 3L09A 2ERVA 3ETVA 1IAPA 4ERRA 4RLCA 1ZEEA 3Q5WA 4PJJA 3RBHA 1MMGA 3UTKA 4CI3B 4QXCB 3WI3A 4HEAA 5KMGP 2GE4A 2E9XB 1T98A 2VKOA 2Y6XA 4IGUA 2KINB 4YHJA 5JR9A 4AQGA 5JH7E 3N9QA 4DMWA 4HTEA 2ES0A 2KXPA 5EK3A 2ACXA 2N1GA 4B6XA 1MPFA 5LG4A 2V26A 4DO0A 3HOLA 1GFQA 5JDPA 4TV9E 4DMVA 2IAKA 3AA1B 4AQFC 1BR2A 5EK4A 2GK9A 1EZ3A 2W63A 2W62A 3QK6A 5L3DB 5JREA 2LSKA 4JFBA 4FI5A 2KNDA 3CQGB 2HPLA 3T0SA 3VE2A 4FRXA 3KV5A 3VE1A 4FRTA 4ISSA 3BQLA 4N78D 3TKLB 2K24A 2DCFA 4XBFB 4E1SA 1BR0A 2EHOD 1LKXA 1PHOA 3RRWA 2Y8DA 4MLKA 2V7JA 5FMNA 1OSMA 4E7SA 1WYBA 1OWAA 3C64A 3N2GE 2O4VA 3AA6A 3SY9A 4DBQA 6PRNA 1MIWA 1D0ZA 2X67A 3IHRA 2Q9QC 2LSGA 4O8SA 4PJNA 3LJCA 3KVBA 5G26A 3SOLA 5L3EB 3ZMUB 2XTLA 4E1TA 5LYJE 4FSOA 3ZEFB 4JCHA 2MYSA 2LFUA 3POXA 1O3XA 5JDFA 5H6QB 5JR9C 2L9QA 4H9PC 1ZHTA 2LEHA 3AA0B 2CE7A 4TX5A 4FOZA 4PAGA 2CEAA 2RA1A 1WYCA 3K3QC 4G2AA 4O49A 4WNKA 5LHGB 3UAQA 2PFVA 1MIYA 5LHHB 3FXDB 4OYJA 4RJWA 3WI4A 4WBOA 5FYMA 3E22E 4KR4A 2XAGB 3KV6A 4TN7B 4AKRB 1U5PA 3PORA 4FT6A 1YKEB 4ANJA 5JDNA 2V7KA 4X1IE 5AFUK 4QXHB 3I1AA 4EOZB 3RKOA 2CLYB 1GFMA 3HOEA 5H6RB 2YU2A 5FY7A 5CB4E 2N2MA 4DNDA 1BR4A 2B1EA 4L9IA 2WAUA 5HXRA 2K48A 4AI6A 2KLQA 2EHOA 2F1VA 3MACA 4JEHB 4EYUA 1MNDA 2FGRA 3H3AA 2W00A 3HA4A 3UT5E 2NOXA 2LM9A 3ZC0A 2A2FX 1LVKA 2D2SA 2V7LA 3POUA 3I9WA 5LNKA 5FNVE 3AAEB 4U72A 3OKQA 4AXPA 1X79A 2KWHA 3NZQA 5HXEA 3D0TA 3DP7A 4FESA 2Y0KA 4AKMA 1GFPA 2MOZA 3V5UA 5C8YE 2M06A 1D1BA 3C5OA 1HG5A 3CX6B 3P7IA 3SRZA 2L8KA 4O4LE 1MM5A 4EYYR 1HX8A 2VKDA 1AJ3A 1IJ5A 7PRNA 2ZLDA 3CQXC 1THQA 5JDLA 2V7IA 3KVDD 2ZM0A 3N9LA 4H9NC 4AFKA 2CWYA 3N9MA 4PFOA 3KVAA 1MNEA 3ZYMA 1V9DA 2H3RA 3A5XA 3JC6C 1QJPA 3NBXX 5J1GA 2ODJA 2X9HA 4HN9A 3ONXA 2Y0HA 4ZI3C 4UF0A 2XAFB 5A1LA 2LOSA 3U78A 3CX7B 3UPGA 3PQUA 2LHFA 3AB3B 2C5KT 3WAKA 4EAHA 1GFNA 2PORA 3CMLA 2CMRA 1YW0A 1Y64B 3PDYA 2YNKA 3O1JA 1UX5A 3FBZA 3RC8A 4H9RC 2ZLYA 2KZ7B 4KUMB 3KV4A 3ZJ1A 2Y2XA 4PFPA 1HTJF 2MBGA 4FZNA 3F31A 4UEMA 1Q9GA 4AKGA 3N2OA 2XG6A 3N9NA 2VASA 3I0OA 1P4TA 1HG2A 4BJNA 3C50A 2KDYA 5LA6E 2YPVA 2K5BB 4UVAB 5IYZE 1ZHXA 4O3YA 3AVRA 2W0GA 3ZLIA 4AKIA 3MK7C 2OMFA 1D0XA 4ADZA 4ZI7E 5DL8A 2DHRA 5GV0A 5JDHA 3UULA 5DQVA 4CXWA 2E9XD 3VY9X 3VHLA 2K0LA 3N5LA 4NUUA 4I50E 4U9CA 2BZBA 2D5UA 2Q9QB 2VKJA 2X9XA 3O4XE 5FXVA 4IE4A 2G0UA 3SYBA 3O9XA 3GN5B 3LK2B 3GP6A 4KMCA 3HL6A 2F1TA 4Z3TA 4BJMA 5L3FB 3ANWA 4UVCB 4UV8B 4LSHA 3RRCA 2KXPB 3LK3A 4UVBB 3QRAA 2IC6A 1U4QA 4WW0A 5HXSA 2J4UP 2Y7SA 2NW8A 5J2UE 2VWAA 5LP6E 4Z8XA 2Y48B 1QUUA 2LSYA 2LE8A 3OYZA 4H9SE 3FHNA 3VU7H 5E0OA 4AZLA 3NZPA 3ZJ2A 2X27X 3FXEB 4F4BA 2HPJA 3LG7A 2V1DB 4YFSA 3HR0A 1BT9A 4P0BA 2LHNA 4GYSA 4RLBA 5EK2A 5HXHA 2K9AA 3ESLA 3LBXB 4CI2B 1ZHZA 4ZI2D 2YINA 2E8IA 3KV9A 2ZM8A 2VL8A 2E9XA 2H7OA 3O1HA 3OYXA 3SWHA 1D1CA 4CI1B 1GFOA 3K3NA 4CXXA 3EVYA 3VZWX 3ZMSB 3PRNA 3PU3A 4ISTA 2X9WA 2YK0A 3WI5A 4RL9A 1FEWA 3BQKA 3K3OA 5HYAA 5LGTB 5DJQC 4HFVA 3R84B 5HWXA 4FJOA 3AA1A 2JJ9A 1HFAA 3C4WA 3HKEE 3Q9DA 1G8XA 4HGAA 4IHJE 3ZN1B 2CXFA 1IZNB 3R6NA 1ZHWA 1SHZC 2HH7A 3RYFE 3CVRA 2NW9A 4PW8A 5L3CB 5GONE 5KX5E 4UIGA 4AYEC 1ORMA 1FMWA 1MIVA 3O0EA 1Z0PA 2N2NA 2BVLA 4TV8E 2C5JA 1QJ8A 5JQGE 5LGUB 3PU8A 2L3LA 5ADXK 3ZMVB 4FMSA 1E54A 4MBQA 4AYNA 4FUVA 5IHYA 5LJMA 4JLEA 2DWKA 4L0RA 4TZ4C 5L3GB 2XASB 4IIJE 4EZHA 3IBPA 4CZZB 3KDSE 3B13A 4UXNB 3AA0A 3POQA 4O3ZA 5EE2A 3AAAB 1QJ9A 5JRCB 5D5DA 5JDQA 2W81C 1HCIA 2V7MA 2NP9A 3E08A 4EXTA 4ZS2A 3MKDA 2VB6A 4EB6E 5LGNB 2FGQX 5F8PA 1KK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AKR A;  4AKR B;  5AFU K;  5ADX K;  2KZ7 A;  2KZ7 B;  3AA6 A;  3AA6 B;  2KXP B;  3LK3 A;  2KXP A;  3LK3 B;  3AA1 A;  3AA1 B;  1IZN A;  1IZN B;  3AA0 A;  3AAA A;  3AA0 B;  3AAA B;  3LK4 2;  5ADX L;  3AAE A;  3AAE B;  5AFU L;  3LK4 1;  3AA7 A;  3LK2 A;  3AA7 B;  3LK2 B; 
#chains in the Genus database with same CATH topology
 4LSF A;  3B57 A;  3GA8 A;  4AKR A;  3M3Z B;  3A0B O;  2V8S V;  2FJB A;  3ZC1 A;  1NAF A;  2DWG A;  3EDU A;  5J0Z A;  4D5U A;  2UXX B;  2IDO B;  3MXZ A;  4DVD A;  4KBM B;  4EED A;  2LKG A;  3M65 A;  4QH4 A;  4P1N A;  2M07 A;  4PNI A;  4JEU B;  4AKH A;  5FVN A;  5BMV E;  3T20 A;  2WWV A;  4C69 X;  1KF6 A;  4I43 B;  5LHI B;  4FZM A;  3Q5X A;  4H9Q C;  4ILU A;  3ZT7 A;  5JDG A;  1PRN A;  4DR1 T;  2MNH A;  3ZYL A;  1SA0 E;  1YD8 G;  2XAH B;  4RJX A;  2CM0 A;  5ADX L;  5C2T A;  3ZCJ A;  2V5C A;  4U7I A;  1IBM T;  4GIW A;  1YS5 A;  1UX4 A;  5LBQ B;  1ZKE A;  3HI2 A;  4C90 A;  1W0B A;  5LXT E;  5AQM B;  1KFY A;  3K19 A;  3P8C D;  2WVP A;  5LOV E;  1S94 A;  3U3I A;  2LT3 A;  3RX6 A;  3SFD A;  2QTK A;  4GKK T;  3UU4 A;  1N34 T;  4I55 E;  5ETW A;  3JC6 D;  2LHR A;  3EAB A;  3RHW A;  2HN1 A;  3CKD A;  3AE3 A;  3NRY A;  4K0U A;  3VRA A;  4BAY B;  5AQV B;  3PUX F;  1YQ3 A;  4X1K E;  4A56 A;  1ZHY A;  3RYI E;  1ZOY A;  3F2E A;  2EHO B;  4PK4 A;  2DNX A;  2CBI A;  2KC0 A;  2A9U A;  3BK9 A;  5EZY E;  5TAO A;  1VCT A;  3TLT A;  3KBU A;  1HS7 A;  3PUA A;  5PRN A;  2CXD A;  5HXC A;  4JUY A;  3K1S A;  5M4Y A;  2K4T A;  1JNZ A;  2NW7 A;  4LMJ A;  4LSI A;  1N33 T;  3PUY F;  4ZHQ E;  4D64 A;  4GK0 E;  3FYX A;  2CWO A;  3TZG A;  4GKJ T;  1XMO T;  4EIW A;  4MFR A;  1VRB A;  4PUX A;  5AQK B;  1HXT A;  4NUV A;  5FXX A;  5DL6 A;  1QLB A;  3SFE A;  2BBJ A;  4I4T E;  4IDN A;  2JQ9 A;  4JI5 T;  5C3J A;  1W0A A;  4L5G A;  1OPF A;  4CQI A;  3VZT X;  2ACZ A;  4IE7 A;  1HXX A;  5KAI O;  4H63 V;  5CA1 E;  4AKL A;  2JPF A;  4UV9 B;  4KI0 F;  3CX8 B;  2N2L A;  1UUS A;  3SZD A;  2WZH A;  4PK6 A;  2J1D G;  5T5F A;  5L4H A;  2QA7 A;  4LFC T;  2VVN A;  2R4O A;  4ZS3 A;  4BUM X;  2OA5 A;  3VY8 X;  3QB5 K;  4B3S T;  3MJX A;  3QC9 A;  5JDM A;  2ERV A;  2F1C X;  2WZI A;  3UTK A;  4QXC B;  3PGR A;  1T98 A;  2VKO A;  3EAM A;  4HTE A;  2UXD T;  2XPK A;  2N1G A;  1MPF A;  4LF9 T;  3AA1 B;  1EZ3 A;  5HEJ A;  3QK6 A;  5JRE A;  3CQG B;  3LDQ B;  2HPL A;  3T0S A;  3KV5 A;  3VE1 A;  4HFI A;  2WDR A;  4ISS A;  4TWH A;  1LKX A;  1PHO A;  3RRW A;  1WYB A;  2I0M A;  3N2G E;  3SY9 A;  1D0Z A;  2LSG A;  3LJC A;  2XTL A;  3ZEF B;  2LFU A;  1O3X A;  5JDF A;  5H6Q B;  3AA0 B;  4FOZ A;  4PAG A;  3ZKR A;  4G2A A;  1WYC A;  3P50 A;  4WNK A;  3UAQ A;  1MIY A;  4PJ0 O;  4RJW A;  4KR4 A;  1HNZ T;  4AKR B;  3POR A;  3DZM A;  2BS2 A;  3I1A A;  3HOE A;  5FY7 A;  3OPC A;  4CN4 A;  2K48 A;  4AI6 A;  2KLQ A;  2FJA A;  2FGR A;  3H3A A;  1W9R A;  1OED E;  4U72 A;  1X79 A;  3NZQ A;  2Y0K A;  2MOZ A;  4KX6 A;  2WS3 A;  5C8Y E;  2M06 A;  4O4L E;  4CN6 A;  1THQ A;  4AFK A;  1UGO A;  2CWY A;  1MNE A;  4DV4 T;  3A5X A;  2ODJ A;  4ZI3 C;  5A1L A;  3U78 A;  2F4V T;  2LHF A;  2C5K T;  3WAK A;  2PTF A;  3CML A;  3ZT5 A;  2YNK A;  4KUM B;  2Y2X A;  3F31 A;  3A0H O;  3AEA A;  2VAS A;  3I0O A;  3RGL A;  5ABF A;  5LA6 E;  4O3Y A;  4UVA B;  1ZHX A;  3AVR A;  2OMF A;  4DR3 T;  5JDH A;  3UUL A;  4LF6 T;  4NXN T;  2E9X D;  3O4X E;  3O9X A;  2LRK A;  4DV5 T;  4TNW A;  3ANW A;  4UV8 B;  3LK3 A;  2D9D A;  1QUU A;  2LE8 A;  2AE9 A;  1T16 A;  4F4B A;  2HPJ A;  4YFS A;  1BT9 A;  1S5L O;  4GYS A;  1ZHZ A;  2VVS A;  2XZE A;  1VCS A;  3KV9 A;  2LRL A;  2VL8 A;  1I6Z A;  2E9X A;  2XQ3 A;  2IML A;  3K3N A;  3ZMS B;  2YK0 A;  1KEY A;  2IHR 1;  3VR9 A;  3BQK A;  2UXC T;  5HWX A;  2JJ9 A;  1WCR A;  3PJA A;  2OLT A;  5IUX A;  1G8X A;  5L3C B;  1ORM A;  1FMW A;  4YHH T;  4IL6 O;  3O0E A;  1Z0P A;  2BS3 A;  4HWH A;  1E54 A;  4B3T T;  2I6H A;  5BR8 T;  5EE2 A;  4O3Z A;  1J1J A;  1HCI A;  4YTN A;  4EXT A;  4YSZ A;  4N75 A;  5F8P A;  3A8Y C;  4AYI D;  2XJ7 A;  2WB5 A;  4GYR A;  3G7G A;  1WR0 A;  2PBI A;  3UUB A;  2WBL A;  3K8P C;  1MM4 A;  4B61 A;  4UEL A;  3C98 B;  3O1I A;  2EHO C;  3GWH A;  2BS4 A;  2XE3 A;  2ODV A;  5F3J A;  4DR2 T;  4GOU A;  3WAJ A;  4AIS A;  8PRN A;  4P09 A;  4OYK A;  4AYM C;  3HKC E;  5FKY A;  5AQI B;  2YDR A;  1D0Y A;  5KAF O;  3JTY A;  3UFE A;  5AQS B;  1E2A A;  2W66 A;  5FXZ A;  2A72 A;  3KFW X;  1H7C A;  4QHO A;  3MA9 A;  4U2Z A;  1Q9F A;  2NTY A;  3H37 A;  2IW5 B;  4KP3 C;  3J7Y q;  4O4J E;  4FSP A;  4HFH A;  3DTO A;  5E79 O;  4O4I E;  3W15 B;  2CXL A;  3JAE A;  3FZK B;  5H2F O;  4JV5 T;  3DWN A;  4KRA A;  1FIO A;  2V6X A;  4TWF A;  4H9O C;  3PUS A;  1LVF A;  2LSI A;  2J4G A;  3L3P A;  3JAF A;  5FY0 A;  3OBV E;  2YU1 A;  2N9D A;  3RPU A;  4X20 E;  4G75 A;  1UK5 A;  2M6B A;  4P0A A;  2X66 A;  4EZ4 A;  2CCQ A;  4XNK A;  4O3X B;  2XSB A;  1CHU A;  4UR9 A;  3ZT6 A;  1LRZ A;  1MMD A;  2X51 A;  3LSV A;  4X5T A;  4HKA A;  3LBX A;  4C4V A;  3RLF F;  1KK7 A;  2ZM2 A;  2LJL A;  3OVU A;  2SPC A;  4DR7 T;  3ZMZ B;  5CA0 E;  5LJN A;  4EGW A;  1XMQ T;  2ZM6 T;  2XQY A;  2XTR A;  3DA4 A;  1KNR A;  3ZCI A;  1IZN A;  4LFA T;  4Z91 A;  2V6Y A;  4Z90 A;  2Z6E A;  2LKH A;  2I59 A;  4O3W A;  2XQ9 A;  3AE5 A;  2IC9 A;  1BH3 A;  4QH5 A;  4ILC A;  3C4Z A;  1QSD A;  2X68 A;  4IE5 A;  4M1P A;  4LFB T;  2C0S A;  2CBJ A;  2WWU A;  3T1H T;  3DWO X;  5JRC A;  4ZOL E;  3QUJ A;  5L4E A;  3PF1 A;  2DI4 A;  4GF4 A;  3RIU C;  3AEB A;  4OX9 T;  5JVD E;  5J2T E;  2Y0L A;  1KNZ A;  2CA5 A;  2W80 C;  3I0Q A;  1JNR A;  4CXY A;  1YKH B;  1N36 T;  3UUX B;  5ABF B;  4D65 A;  2RP4 A;  4AIU A;  4BA9 A;  2W61 A;  4PK5 A;  1MMA A;  2IUB A;  3QOF A;  3T24 A;  1NWM X;  3RC3 A;  4YJ2 E;  3ANW B;  2XE5 A;  4IDQ A;  3LK3 B;  3SY7 A;  5FY1 A;  5AQT B;  3IA3 A;  1BR1 A;  3RQW A;  3VR8 A;  3Q5D A;  2CRB A;  3FB2 A;  3V5S A;  3CQC B;  2FBW A;  1T72 A;  3Q5W A;  2E9X B;  4IL9 A;  5JH7 E;  2KIN B;  3N9Q A;  4DMW A;  5EK3 A;  4TWD A;  2V26 A;  4DO0 A;  3HOL A;  2WDV A;  2W62 A;  4LML A;  4CN1 A;  2KND A;  3VE2 A;  4FRX A;  3BQL A;  4X65 T;  3AE9 A;  4XBF B;  1BR0 A;  2H89 A;  1OWA A;  2CPT A;  3AE6 A;  2X67 A;  2LLY A;  3VRB A;  2BG9 A;  1R8I A;  3ZMU B;  4E1T A;  2VUR A;  2L9Q A;  4H9P C;  4HWD A;  1Y01 A;  3UQ4 A;  4YSX A;  2CEA A;  4YTP A;  4O49 A;  5LHH B;  3WI4 A;  4WBO A;  5FYM A;  2VQE T;  2XAG B;  4FT6 A;  4X1I E;  4EOZ B;  3RKO A;  2CLY B;  1BR4 A;  5HXR A;  4DR5 T;  2WU2 A;  2F1V A;  4NXM T;  3UT5 E;  3P4R A;  2NOX A;  1YQ4 A;  2A2F X;  3ZC0 A;  2CHO A;  1LVK A;  3POU A;  3I9W A;  5FNV E;  4WYV A;  2BG9 C;  2XSA A;  4ZZB A;  3V5U A;  3CX6 B;  5IWA T;  1MM5 A;  2L8K A;  2BKO A;  4EYY R;  1HX8 A;  1AJ3 A;  2WCA A;  5JDL A;  4N74 A;  3KVD D;  2ZM0 A;  3N9L A;  4H9N C;  3NWI A;  4EV6 A;  3ZYM A;  3JC6 C;  1QJP A;  3NBX X;  2XAF B;  2LOS A;  4U33 A;  4JI0 T;  3PQU A;  3G06 A;  2MAW A;  3AB3 B;  4EAH A;  1GFN A;  3PDY A;  3FBZ A;  4H9R C;  2ZLY A;  2AXD S;  3KV4 A;  3ZJ1 A;  4PFP A;  2MBG A;  4FZN A;  4UEM A;  1Q9G A;  3N2O A;  2XG6 A;  5AQF B;  3C50 A;  3ZLI A;  4UB8 O;  4AKI A;  4DUZ T;  1D0X A;  2UUB T;  4CXW A;  3VY9 X;  3VHL A;  3T1Y T;  4NUU A;  2D5U A;  3SYB A;  3NVO A;  2YOE A;  2MPK A;  4KMC A;  3HL6 A;  4DV0 T;  4BJM A;  4LSH A;  3FZH B;  3RRC A;  2UXB T;  3QRA A;  2IC6 A;  1U4Q A;  5HXS A;  2NW8 A;  5J2U E;  5LP6 E;  4Z8X A;  2YDS A;  2XQ4 A;  3FHN A;  5E0O A;  3NZP A;  2K3W A;  3ZJ2 A;  1WFD A;  2JIW A;  4P0B A;  2E2A A;  5FL1 A;  2K9A A;  3LBX B;  4CI2 B;  4C4V B;  4ZI2 D;  2YIN A;  2E8I A;  2ZM8 A;  2H7O A;  3O1H A;  3OYX A;  3SWH A;  5GTH O;  2HHH T;  3KZI O;  3EVY A;  1FEW A;  3K3O A;  2AXT O;  5DJQ C;  4HFV A;  5GTI O;  3L39 A;  3QB5 A;  4HGA A;  4B3M T;  1IZN B;  2V6Y B;  2HH7 A;  3RYF E;  3OTO T;  2IWV A;  1MIV A;  5B5E O;  4TV8 E;  2C5J A;  2L3L A;  3ZMV B;  3NKZ A;  5CGM A;  4MBQ A;  1I94 T;  2YKS A;  2DWK A;  2XAS B;  3BRY A;  2J62 A;  3IBP A;  4UXN B;  4X62 T;  5G3A A;  3EI0 A;  5JRC B;  5D5D A;  2UUA T;  2NP9 A;  3E08 A;  2FGQ X;  3IF8 B;  4G63 A;  3FBL A;  4A97 A;  4HE8 A;  3C4X A;  3VKG A;  2XE1 A;  3KBT A;  3V8U A;  3RKG A;  5HCJ A;  5AQR B;  4ZEY A;  2NTX A;  4YXD A;  2D0U A;  3PUQ A;  5LB7 B;  4IRE A;  2BVM A;  4DR4 T;  2VKH A;  3MZK B;  3AAE A;  3HKB E;  2WDQ A;  4NPP A;  2BKP A;  3CWZ B;  3BRZ A;  2M67 A;  3OJA A;  4JI4 T;  1HR0 T;  4MAL A;  4O4U A;  2JQK A;  5FP3 A;  4LF7 T;  4ASK A;  3GMI A;  3C51 A;  2Q9Q D;  4QXB B;  2IWW A;  2XM1 A;  4U74 A;  4DV7 T;  2JMK A;  2A3D A;  3RYC E;  2XHE B;  1VOM A;  3UFG A;  4IDP A;  1XNR T;  5CFB A;  1XDP A;  4AQF A;  4K3B A;  4UB6 O;  4KHZ F;  4O2A E;  4HWI B;  2DL1 A;  4O4H E;  4K3C A;  2XQA A;  5L3B B;  4QX8 B;  2NWB A;  1FJG T;  3JCU O;  3ZPO A;  2DLR A;  3AE7 A;  4H63 H;  4KR8 A;  2Q9Q A;  5AFU L;  3I9Y A;  2YN6 A;  2BKN A;  3GN5 A;  4QKN A;  1NEK A;  2ZMA A;  4U3C A;  4B3R T;  4IDZ A;  2JQY A;  2XAQ B;  5ABH A;  2QGS A;  2BG9 B;  4YLH A;  4PJM A;  1CUN A;  1ZHC A;  3A2S X;  3KIN B;  1UCU A;  2X0Y A;  3QRC A;  2PRN A;  3PTR B;  2QVA A;  2WSS V;  3S4U A;  3CPZ A;  2KT9 A;  4ILA A;  1NEN A;  2VK9 A;  2D0T A;  3NSG A;  2E9X C;  4FZL A;  1L0V A;  4JI3 T;  4DV2 T;  3E0Z A;  1OXZ A;  4HFB A;  4PJL A;  3DA3 A;  1T7S A;  4QWN B;  5G38 A;  3IEE A;  5KDM C;  3HWB A;  4DBR A;  4FQE A;  2JQQ A;  1HXU A;  5LBM A;  1US7 B;  3VKH A;  4QX7 B;  3AE8 A;  3DJB A;  3UUN A;  2BDE A;  2YDQ A;  5IYU A;  2OV9 A;  2X9Y A;  2H7V C;  2FJE A;  4N58 A;  2RPA A;  2BG9 E;  3CK6 A;  3AAI A;  3RYH E;  5B66 O;  2CLY C;  3N9O A;  3LK4 1;  5KXJ A;  2WY2 A;  3AA7 A;  1G73 A;  3AVS A;  2JMH A;  3AE4 A;  4ZZC A;  2X9K A;  3BQI A;  2PG8 A;  3RH3 A;  4HFD A;  5AQU B;  1BXW A;  3EMN X;  3T8O A;  2WQY A;  4OHF A;  3LK4 2;  1XNQ T;  3HW9 A;  5L2L A;  3ZYK A;  2KWI B;  4ERR A;  4RLC A;  1ZEE A;  1MMG A;  2CHN A;  3WI3 A;  4CI3 B;  2XY8 B;  2VL0 A;  4WZX A;  4IGU A;  4YHJ A;  5JR9 A;  3AE2 A;  4ILB A;  2ES0 A;  1SE7 A;  3PUW F;  2ACX A;  2R4P A;  5LG4 A;  4C00 A;  1GFQ A;  4TV9 E;  4DMV A;  2IAK A;  1BR2 A;  1OED A;  5EK4 A;  2W63 A;  5L3D B;  2LSK A;  5FL0 A;  4FRT A;  1SUM B;  2DCF A;  2R4N A;  5LG3 A;  2V7J A;  3AA6 A;  3C64 A;  1MIW A;  2E5V A;  3IHR A;  4O8S A;  4PJN A;  3KVB A;  5G26 A;  3SOL A;  2IIU A;  5LYJ E;  4JCH A;  3POX A;  5JR9 C;  1ZHT A;  2LEH A;  4TX5 A;  1J5W A;  4AQY T;  2RA1 A;  3K3Q C;  3AEG A;  4HWC A;  1KNP A;  3E22 E;  3KV6 A;  1T8B A;  4TN7 B;  3ONL C;  2R4L A;  2V7K A;  4QXH B;  1UUR A;  1GFM A;  5H6R B;  2JQH A;  2B1E A;  4L9I A;  2WAU A;  3TLS A;  5AQP B;  3MAC A;  4JEH B;  1MND A;  2W00 A;  3RI5 A;  2WJR A;  2HN2 A;  5FVK A;  1HX1 B;  2D2S A;  2V7L A;  3JAD A;  3AAE B;  4HFC A;  2KWH A;  4AKM A;  3D0T A;  1XWM A;  1HG5 A;  4U7Y A;  2VKD A;  1IJ5 A;  4DV1 T;  7PRN A;  2ZLD A;  3UQ7 A;  4PFO A;  3KVA A;  1V9D A;  4U2Y A;  5J1G A;  3TLV A;  2X9H A;  4HN9 A;  3NJT A;  4UF0 A;  3CX7 B;  4QH1 A;  1YW0 A;  4LF5 T;  2W67 A;  3RC8 A;  1T1L A;  1HTJ F;  3RF1 A;  4AKG A;  1J5E T;  2W2U A;  4JI6 T;  2YPV A;  2K5B B;  5GV0 A;  5DL8 A;  5DQV A;  2K0L A;  4U9C A;  4I50 E;  2Q9Q B;  5FXV A;  3GN5 B;  4IT4 A;  3GP6 A;  3UU5 A;  5L3F B;  2KXP B;  4UVB B;  5CJ5 A;  2Y7S A;  2VWA A;  3OYZ A;  2LSY A;  4YTM A;  4KHP T;  2X27 X;  2V1D B;  3HR0 A;  2J47 A;  2FUP A;  3PUZ F;  2VQF T;  5HEO A;  3FZL B;  3QNU A;  1GFO A;  4YSY A;  3VZW X;  3PRN A;  3PU3 A;  4IST A;  4K0K T;  2X9W A;  3WI5 A;  4RL9 A;  1YXR A;  5HYA A;  1HFA A;  3C4W A;  3HKE E;  3Q9D A;  3ZN1 B;  3JCF A;  3R6N A;  1SHZ C;  3CVR A;  2NW9 A;  5GON E;  4JI8 T;  4UIG A;  4X66 T;  2H88 A;  5JQG E;  3PU8 A;  5ADX K;  3EHZ A;  4FMS A;  4AYN A;  4FUV A;  5IHY A;  5LJM A;  4JLE A;  4L0R A;  4TZ4 C;  3ZSS A;  3TLW A;  4EZH A;  3B5M A;  3KDS E;  3POQ A;  3P4W A;  1QJ9 A;  5JDQ A;  2W81 C;  2V7M A;  4YY3 T;  3MKD A;  2VB6 A;  4EB6 E;  4A5X A;  5LGN B;  3AXJ A;  4CTD A;  4OFZ A;  4WBN E;  2XAJ B;  1IJ6 A;  1DU2 A;  3ETU A;  4XAX B;  4IE0 A;  2XQ6 A;  4I0U A;  4O4X A;  3NRX A;  5HWY A;  1Z8U A;  2WMO A;  1HNX T;  5HEG A;  3AA7 B;  4MHC A;  4N59 A;  4LMK A;  2JMM A;  5DAB A;  2XQ8 A;  2LOP A;  2XQ7 A;  4V1A v;  3H3M A;  4LF8 T;  2J1N A;  5DL7 A;  3ZST A;  5DL5 A;  5AQG B;  3UUM A;  1M62 A;  3P4S A;  3PUG A;  3P4Q A;  5AQL B;  4G76 A;  2WM9 A;  2KZ7 A;  5JR9 B;  3PE0 A;  5DQW A;  1MMN A;  4J2C A;  2B76 A;  1M7K A;  4XZC A;  4GCS A;  3EUH A;  3CIR A;  2XTQ A;  5AQQ B;  1OED B;  3HKD E;  3RQU A;  5FVL A;  1D1A A;  4LSE A;  4GHB A;  3PQS A;  2P9B A;  3LK2 A;  5HAX A;  3UU8 A;  2W4X A;  1W09 A;  3EDV A;  3AA6 B;  3FZM B;  1WLX A;  2PJQ A;  3TLU A;  4AYD C;  1WR6 A;  4DR6 T;  4AUI A;  3PGU A;  1IBK T;  4DV6 T;  2KMF A;  4ZI3 D;  3VZU X;  1WRD A;  1G90 A;  2MTQ A;  1ZV4 X;  5LCY A;  2JRK A;  4GCP A;  4X64 T;  3N9P A;  3AEC A;  3SYS A;  4JBW F;  4QQ1 A;  3SS1 A;  1HF8 A;  3F57 A;  3Q5E A;  3AEF A;  4E7Z A;  2UU9 T;  3SZV A;  5LMN T;  4JI2 T;  3LFM A;  2QRX A;  5AQN B;  2FJD A;  4DID B;  5FXW A;  3N2K E;  1X9B A;  5ABE A;  2C5I T;  2UXN B;  2XM2 A;  2MHL A;  3UU2 A;  2XE2 A;  2X0L B;  4OK0 A;  1B7T A;  3AAA A;  4YJ3 E;  4UF0 B;  2BBH A;  4ZI2 C;  5L47 A;  4F6R C;  3ZN0 B;  1S35 A;  5LMU T;  2R88 A;  4X1Y E;  2R89 A;  2WMN A;  1H6S 1;  2ODU A;  4IE6 A;  2LSJ A;  3ZMT B;  2XMX A;  4O2B E;  3J9X 1;  5TIS O;  2YEV C;  3A7M A;  2XQ5 A;  4XNL A;  3X1D A;  4Q25 A;  1E1H B;  3RIF A;  3PUR A;  3Q2M A;  1FMV A;  3PUV F;  2XUE A;  4U31 A;  2R6G F;  4GCQ A;  2ZFG A;  1ZP0 A;  5HEU A;  4ZXL A;  4JI1 T;  4TUY E;  2NR4 A;  4GK5 E;  4HWF A;  4C91 A;  2KSR A;  3L09 A;  3ETV A;  3RIA A;  4A98 A;  3RBH A;  4PJJ A;  4AZL A;  2GE4 A;  5KMG P;  4HEA A;  4F8H A;  2Y6X A;  2LM2 A;  4AQG A;  2KXP A;  2WJQ A;  2UUC T;  3ONJ A;  4B6X A;  3PGS A;  5JDP A;  2E5L T;  4AQF C;  2GK9 A;  4JFB A;  5G39 A;  4FI5 A;  5AQH B;  3BS0 A;  4N78 D;  5AQO B;  3TKL B;  2K24 A;  4E1S A;  2EHO D;  2Y8D A;  4MLK A;  1OSM A;  5FMN A;  5AQJ B;  4E7S A;  6PRN A;  2O4V A;  4DBQ A;  4DV3 T;  2Q9Q C;  2WU5 A;  4YT0 A;  5L3E B;  4FSO A;  2MYS A;  2CE7 A;  5HCM A;  5LHG B;  2PFV A;  3FXD B;  4OYJ A;  3AXJ B;  1U5P A;  5AFU K;  1YKE B;  4ANJ A;  5JDN A;  4JI7 T;  5CB4 E;  2YU2 A;  2N2M A;  4DND A;  2R8A A;  2EHO A;  4EYU A;  3HA4 A;  2LM9 A;  3AED A;  5LNK A;  3OKQ A;  1XDO A;  4AXP A;  4PR7 A;  5HXE A;  3DP7 A;  4FES A;  1GFP A;  1D1B A;  4COF A;  3C5O A;  3P7I A;  3SRZ A;  4IL4 A;  3CQX C;  2V7I A;  3WU2 O;  3PV0 F;  3L8R A;  1E7P A;  3N9M A;  2H3R A;  3ONX A;  2Y0H A;  3PJA J;  4IDO A;  3UPG A;  3FZF B;  2POR A;  2CMR A;  1Y64 B;  2M6I A;  4JYA T;  3O1J A;  1UX5 A;  2KZ7 B;  5F5W A;  3N9N A;  1P4T A;  1HG2 A;  4BJN A;  2KDY A;  5IYZ E;  2W0G A;  3ABV A;  3MK7 C;  3P4P A;  3UU6 A;  4ADZ A;  4HFE A;  4ZI7 E;  2DHR A;  3N5L A;  2BZB A;  2VKJ A;  2X9X A;  2X0H A;  4IE4 A;  2G0U A;  4TNV A;  1XZY A;  3LK2 B;  1N32 T;  2F1T A;  4Z3T A;  4UVC B;  4WW0 A;  2J4U P;  2Y48 B;  4H9S E;  3VU7 H;  3UU3 A;  4EEB A;  3FXE B;  3LG7 A;  2LHN A;  4RLB A;  5EK2 A;  5HXH A;  3ESL A;  1GQE A;  1D1C A;  4CI1 B;  4CXX A;  2QYW A;  2V5D A;  5LGT B;  3AE1 A;  3R84 B;  4FJO A;  3AA1 A;  3AEE A;  4IHJ E;  1ZHW A;  2CXF A;  4PW8 A;  5ABG A;  5KX5 E;  4AYE C;  1HNW T;  2N2N A;  2BVL A;  1QJ8 A;  5LGU B;  1OED C;  5JTG A;  2WP9 A;  1IBL T;  4NIQ A;  5L3G B;  4IIJ E;  4DUY T;  3RIU A;  4CZZ B;  3B13 A;  3AA0 A;  3AAA B;  5HEH A;  4LF4 T;  4ZS2 A;  1IAP A; 
#chains in the Genus database with same CATH homology
 3IF8 B;  4LSF A;  3B57 A;  3GA8 A;  4OFZ A;  4AKR A;  4G63 A;  3FBL A;  4WBN E;  2XAJ B;  1IJ6 A;  4AYI D;  4HE8 A;  3C4X A;  3VKG A;  4GYR A;  2XE1 A;  3ETU A;  3G7G A;  4XAX B;  2PBI A;  3KBT A;  4IE0 A;  3V8U A;  2WBL A;  3K8P C;  2NTX A;  2D0U A;  1NAF A;  3ZC1 A;  3PUQ A;  4O4X A;  1MM4 A;  4B61 A;  2BVM A;  2DWG A;  3NRX A;  4UEL A;  5HWY A;  2VKH A;  3MZK B;  3AAE A;  3HKB E;  2WMO A;  3EDU A;  3C98 B;  3CWZ B;  3O1I A;  3AA7 B;  4MHC A;  2EHO C;  3GWH A;  2XE3 A;  2M67 A;  3OJA A;  2ODV A;  4N59 A;  4MAL A;  5F3J A;  2JMM A;  4O4U A;  4D5U A;  2UXX B;  5DAB A;  2LOP A;  5FP3 A;  3MXZ A;  4V1A v;  4GOU A;  3WAJ A;  4DVD A;  4ASK A;  3GMI A;  4KBM B;  3C51 A;  8PRN A;  2Q9Q D;  4QXB B;  2J1N A;  5DL7 A;  4P09 A;  4OYK A;  3M65 A;  5DL5 A;  4AYM C;  3HKC E;  2M07 A;  4PNI A;  4JEU B;  4U74 A;  3UUM A;  3PUG A;  4AKH A;  5FVN A;  2JMK A;  5BMV E;  1D0Y A;  2A3D A;  3JTY A;  3T20 A;  3RYC E;  2XHE B;  1VOM A;  4C69 X;  3UFE A;  4I43 B;  5LHI B;  4FZM A;  4AQF A;  3Q5X A;  4H9Q C;  4G76 A;  5FXZ A;  4ILU A;  2A72 A;  3KFW X;  1H7C A;  2WM9 A;  4QHO A;  3MA9 A;  2KZ7 A;  1Q9F A;  5JR9 B;  2NTY A;  3H37 A;  3PE0 A;  5DQW A;  4KP3 C;  2IW5 B;  3J7Y q;  1MMN A;  4J2C A;  4O4J E;  5JDG A;  4XZC A;  4O2A E;  1PRN A;  4GCS A;  4FSP A;  4O4H E;  3DTO A;  3EUH A;  2MNH A;  4O4I E;  3W15 B;  3ZYL A;  2CXL A;  5L3B B;  2XTQ A;  1SA0 E;  1YD8 G;  3HKD E;  2XAH B;  2NWB A;  4QX8 B;  1D1A A;  4RJX A;  4LSE A;  3ZPO A;  2DLR A;  2CM0 A;  4GHB A;  5ADX L;  4KRA A;  1FIO A;  4H63 H;  3ZCJ A;  3PQS A;  4KR8 A;  2Q9Q A;  5AFU L;  3I9Y A;  4GIW A;  3GN5 A;  3PUS A;  2P9B A;  4H9O C;  4QKN A;  1UX4 A;  5HAX A;  1YS5 A;  1LVF A;  2LSI A;  3LK2 A;  5LBQ B;  3EDV A;  1ZKE A;  3HI2 A;  2ZMA A;  3L3P A;  5FY0 A;  3OBV E;  4C90 A;  2YU1 A;  5LXT E;  4IDZ A;  2N9D A;  2XAQ B;  3AA6 B;  3RPU A;  4X20 E;  4G75 A;  1WLX A;  3K19 A;  2QGS A;  2PJQ A;  3P8C D;  4AYD C;  1WR6 A;  4P0A A;  4YLH A;  2X66 A;  4EZ4 A;  5LOV E;  1S94 A;  2CCQ A;  4AUI A;  4PJM A;  2LT3 A;  3RX6 A;  3U3I A;  4XNK A;  2QTK A;  1CUN A;  4O3X B;  1ZHC A;  3A2S X;  1LRZ A;  4I55 E;  5ETW A;  1MMD A;  3JC6 D;  3KIN B;  2LHR A;  2X51 A;  1UCU A;  2KMF A;  4HKA A;  3QRC A;  2PRN A;  3LBX A;  4ZI3 D;  3CKD A;  3PTR B;  3NRY A;  2WSS V;  3VZU X;  1WRD A;  2ZM2 A;  3CPZ A;  2LJL A;  2SPC A;  3S4U A;  2KT9 A;  1G90 A;  2MTQ A;  4K0U A;  1ZV4 X;  4BAY B;  2VK9 A;  3ZMZ B;  5LCY A;  2JRK A;  5CA0 E;  4X1K E;  4A56 A;  4GCP A;  3N9P A;  1ZHY A;  3RYI E;  5LJN A;  3SYS A;  4QQ1 A;  2D0T A;  1HF8 A;  3SS1 A;  2XQY A;  2XTR A;  3F57 A;  3F2E A;  3DA4 A;  2EHO B;  4PK4 A;  2DNX A;  4E7Z A;  2KC0 A;  3ZCI A;  3NSG A;  2E9X C;  3BK9 A;  5EZY E;  1IZN A;  4FZL A;  3SZV A;  5TAO A;  3LFM A;  1HS7 A;  3KBU A;  2Z6E A;  3E0Z A;  1OXZ A;  3PUA A;  2I59 A;  4PJL A;  5PRN A;  4O3W A;  3DA3 A;  2CXD A;  5HXC A;  4JUY A;  5FXW A;  3N2K E;  5M4Y A;  2K4T A;  4QWN B;  2C5I T;  2IC9 A;  2NW7 A;  2UXN B;  1BH3 A;  2MHL A;  4LSI A;  3UU2 A;  3IEE A;  4ZHQ E;  5KDM C;  3HWB A;  2XE2 A;  4D64 A;  2X0L B;  3C4Z A;  4GK0 E;  4OK0 A;  1QSD A;  2X68 A;  4IE5 A;  4DBR A;  4M1P A;  3FYX A;  2CWO A;  2JQQ A;  3TZG A;  1B7T A;  2C0S A;  2WWU A;  1HXU A;  3AAA A;  5LBM A;  5JRC A;  4ZOL E;  3QUJ A;  4YJ3 E;  4EIW A;  4MFR A;  1VRB A;  4UF0 B;  4PUX A;  4ZI2 C;  1US7 B;  3VKH A;  4F6R C;  4QX7 B;  2DI4 A;  3ZN0 B;  1HXT A;  4NUV A;  5FXX A;  5DL6 A;  3DJB A;  1S35 A;  3UUN A;  4GF4 A;  4I4T E;  2BDE A;  5JVD E;  5J2T E;  2Y0L A;  4X1Y E;  1KNZ A;  2CA5 A;  2W80 C;  3I0Q A;  5IYU A;  4CXY A;  1YKH B;  4L5G A;  2WMN A;  3UUX B;  4D65 A;  2RP4 A;  2X9Y A;  1H6S 1;  1OPF A;  2H7V C;  4CQI A;  4N58 A;  3VZT X;  2ODU A;  4BA9 A;  4IE6 A;  2W61 A;  4PK5 A;  1MMA A;  2LSJ A;  3AAI A;  4IE7 A;  3RYH E;  3ZMT B;  1HXX A;  2XMX A;  2CLY C;  4O2B E;  3J9X 1;  4H63 V;  3T24 A;  5CA1 E;  4AKL A;  2YEV C;  3N9O A;  3LK4 1;  4XNL A;  2JPF A;  3AA7 A;  4UV9 B;  1NWM X;  1G73 A;  3AVS A;  3CX8 B;  3RC3 A;  1E1H B;  2N2L A;  3PUR A;  3Q2M A;  1FMV A;  4YJ2 E;  3ANW B;  3SZD A;  2XE5 A;  2JMH A;  4PK6 A;  2J1D G;  5T5F A;  3LK3 B;  3SY7 A;  2XUE A;  2QA7 A;  5FY1 A;  3BQI A;  4GCQ A;  2PG8 A;  3RH3 A;  2ZFG A;  1BR1 A;  4ZS3 A;  4BUM X;  1BXW A;  3EMN X;  2OA5 A;  3VY8 X;  3T8O A;  4TUY E;  4OHF A;  3LK4 2;  3HW9 A;  3MJX A;  5L2L A;  4GK5 E;  3ZYK A;  3QC9 A;  2KWI B;  3FB2 A;  3V5S A;  3CQC B;  4C91 A;  5JDM A;  3L09 A;  2ERV A;  3ETV A;  1IAP A;  4ERR A;  4RLC A;  1ZEE A;  3Q5W A;  4PJJ A;  3RBH A;  1MMG A;  3UTK A;  4CI3 B;  4QXC B;  3WI3 A;  4HEA A;  5KMG P;  2GE4 A;  2E9X B;  1T98 A;  2VKO A;  2Y6X A;  4IGU A;  2KIN B;  4YHJ A;  5JR9 A;  4AQG A;  5JH7 E;  3N9Q A;  4DMW A;  4HTE A;  2ES0 A;  2KXP A;  5EK3 A;  2ACX A;  2N1G A;  4B6X A;  1MPF A;  5LG4 A;  2V26 A;  4DO0 A;  3HOL A;  1GFQ A;  5JDP A;  4TV9 E;  4DMV A;  2IAK A;  3AA1 B;  4AQF C;  1BR2 A;  5EK4 A;  2GK9 A;  1EZ3 A;  2W63 A;  2W62 A;  3QK6 A;  5L3D B;  5JRE A;  2LSK A;  4JFB A;  4FI5 A;  2KND A;  3CQG B;  2HPL A;  3T0S A;  3VE2 A;  4FRX A;  3KV5 A;  3VE1 A;  4FRT A;  4ISS A;  3BQL A;  4N78 D;  3TKL B;  2K24 A;  2DCF A;  4XBF B;  4E1S A;  1BR0 A;  2EHO D;  1LKX A;  1PHO A;  3RRW A;  2Y8D A;  4MLK A;  2V7J A;  5FMN A;  1OSM A;  4E7S A;  1WYB A;  1OWA A;  3C64 A;  3N2G E;  2O4V A;  3AA6 A;  3SY9 A;  4DBQ A;  6PRN A;  1MIW A;  1D0Z A;  2X67 A;  3IHR A;  2Q9Q C;  2LSG A;  4O8S A;  4PJN A;  3LJC A;  3KVB A;  5G26 A;  3SOL A;  5L3E B;  3ZMU B;  2XTL A;  4E1T A;  5LYJ E;  4FSO A;  3ZEF B;  4JCH A;  2MYS A;  2LFU A;  3POX A;  1O3X A;  5JDF A;  5H6Q B;  5JR9 C;  2L9Q A;  4H9P C;  1ZHT A;  2LEH A;  3AA0 B;  2CE7 A;  4TX5 A;  4FOZ A;  4PAG A;  2CEA A;  2RA1 A;  1WYC A;  3K3Q C;  4G2A A;  4O49 A;  4WNK A;  5LHG B;  3UAQ A;  2PFV A;  1MIY A;  5LHH B;  3FXD B;  4OYJ A;  4RJW A;  3WI4 A;  4WBO A;  5FYM A;  3E22 E;  4KR4 A;  2XAG B;  3KV6 A;  4TN7 B;  4AKR B;  1U5P A;  3POR A;  4FT6 A;  1YKE B;  4ANJ A;  5JDN A;  2V7K A;  4X1I E;  5AFU K;  4QXH B;  3I1A A;  4EOZ B;  3RKO A;  2CLY B;  1GFM A;  3HOE A;  5H6R B;  2YU2 A;  5FY7 A;  5CB4 E;  2N2M A;  4DND A;  1BR4 A;  2B1E A;  4L9I A;  2WAU A;  5HXR A;  2K48 A;  4AI6 A;  2KLQ A;  2EHO A;  2F1V A;  3MAC A;  4JEH B;  4EYU A;  1MND A;  2FGR A;  3H3A A;  2W00 A;  3HA4 A;  3UT5 E;  2NOX A;  2LM9 A;  3ZC0 A;  2A2F X;  1LVK A;  2D2S A;  2V7L A;  3POU A;  3I9W A;  5LNK A;  5FNV E;  3AAE B;  4U72 A;  3OKQ A;  4AXP A;  1X79 A;  2KWH A;  3NZQ A;  5HXE A;  3D0T A;  3DP7 A;  4FES A;  2Y0K A;  4AKM A;  1GFP A;  2MOZ A;  3V5U A;  5C8Y E;  2M06 A;  1D1B A;  3C5O A;  1HG5 A;  3CX6 B;  3P7I A;  3SRZ A;  2L8K A;  4O4L E;  1MM5 A;  4EYY R;  1HX8 A;  2VKD A;  1AJ3 A;  1IJ5 A;  7PRN A;  2ZLD A;  3CQX C;  1THQ A;  5JDL A;  2V7I A;  3KVD D;  2ZM0 A;  3N9L A;  4H9N C;  4AFK A;  2CWY A;  3N9M A;  4PFO A;  3KVA A;  1MNE A;  3ZYM A;  1V9D A;  2H3R A;  3A5X A;  3JC6 C;  1QJP A;  3NBX X;  5J1G A;  2ODJ A;  2X9H A;  4HN9 A;  3ONX A;  2Y0H A;  4ZI3 C;  4UF0 A;  2XAF B;  5A1L A;  2LOS A;  3U78 A;  3CX7 B;  3UPG A;  3PQU A;  2LHF A;  3AB3 B;  2C5K T;  3WAK A;  4EAH A;  1GFN A;  2POR A;  3CML A;  2CMR A;  1YW0 A;  1Y64 B;  3PDY A;  2YNK A;  3O1J A;  1UX5 A;  3FBZ A;  3RC8 A;  4H9R C;  2ZLY A;  2KZ7 B;  4KUM B;  3KV4 A;  3ZJ1 A;  2Y2X A;  4PFP A;  1HTJ F;  2MBG A;  4FZN A;  3F31 A;  4UEM A;  1Q9G A;  4AKG A;  3N2O A;  2XG6 A;  3N9N A;  2VAS A;  3I0O A;  1P4T A;  1HG2 A;  4BJN A;  3C50 A;  2KDY A;  5LA6 E;  2YPV A;  2K5B B;  4UVA B;  5IYZ E;  1ZHX A;  4O3Y A;  3AVR A;  2W0G A;  3ZLI A;  4AKI A;  3MK7 C;  2OMF A;  1D0X A;  4ADZ A;  4ZI7 E;  5DL8 A;  2DHR A;  5GV0 A;  5JDH A;  3UUL A;  5DQV A;  4CXW A;  2E9X D;  3VY9 X;  3VHL A;  2K0L A;  3N5L A;  4NUU A;  4I50 E;  4U9C A;  2BZB A;  2D5U A;  2Q9Q B;  2VKJ A;  2X9X A;  3O4X E;  5FXV A;  4IE4 A;  2G0U A;  3SYB A;  3O9X A;  3GN5 B;  3LK2 B;  3GP6 A;  4KMC A;  3HL6 A;  2F1T A;  4Z3T A;  4BJM A;  5L3F B;  3ANW A;  4UVC B;  4UV8 B;  4LSH A;  3RRC A;  2KXP B;  3LK3 A;  4UVB B;  3QRA A;  2IC6 A;  1U4Q A;  4WW0 A;  5HXS A;  2J4U P;  2Y7S A;  2NW8 A;  5J2U E;  2VWA A;  5LP6 E;  4Z8X A;  2Y48 B;  1QUU A;  2LSY A;  2LE8 A;  3OYZ A;  4H9S E;  3FHN A;  3VU7 H;  5E0O A;  4AZL A;  3NZP A;  3ZJ2 A;  2X27 X;  3FXE B;  4F4B A;  2HPJ A;  3LG7 A;  2V1D B;  4YFS A;  3HR0 A;  1BT9 A;  4P0B A;  2LHN A;  4GYS A;  4RLB A;  5EK2 A;  5HXH A;  2K9A A;  3ESL A;  3LBX B;  4CI2 B;  1ZHZ A;  4ZI2 D;  2YIN A;  2E8I A;  3KV9 A;  2ZM8 A;  2VL8 A;  2E9X A;  2H7O A;  3O1H A;  3OYX A;  3SWH A;  1D1C A;  4CI1 B;  1GFO A;  3K3N A;  4CXX A;  3EVY A;  3VZW X;  3ZMS B;  3PRN A;  3PU3 A;  4IST A;  2X9W A;  2YK0 A;  3WI5 A;  4RL9 A;  1FEW A;  3BQK A;  3K3O A;  5HYA A;  5LGT B;  5DJQ C;  4HFV A;  3R84 B;  5HWX A;  4FJO A;  3AA1 A;  2JJ9 A;  1HFA A;  3C4W A;  3HKE E;  3Q9D A;  1G8X A;  4HGA A;  4IHJ E;  3ZN1 B;  2CXF A;  1IZN B;  3R6N A;  1ZHW A;  1SHZ C;  2HH7 A;  3RYF E;  3CVR A;  2NW9 A;  4PW8 A;  5L3C B;  5GON E;  5KX5 E;  4UIG A;  4AYE C;  1ORM A;  1FMW A;  1MIV A;  3O0E A;  1Z0P A;  2N2N A;  2BVL A;  4TV8 E;  2C5J A;  1QJ8 A;  5JQG E;  5LGU B;  3PU8 A;  2L3L A;  5ADX K;  3ZMV B;  4FMS A;  1E54 A;  4MBQ A;  4AYN A;  4FUV A;  5IHY A;  5LJM A;  4JLE A;  2DWK A;  4L0R A;  4TZ4 C;  5L3G B;  2XAS B;  4IIJ E;  4EZH A;  3IBP A;  4CZZ B;  3KDS E;  3B13 A;  4UXN B;  3AA0 A;  3POQ A;  4O3Z A;  5EE2 A;  3AAA B;  1QJ9 A;  5JRC B;  5D5D A;  5JDQ A;  2W81 C;  1HCI A;  2V7M A;  2NP9 A;  3E08 A;  4EXT A;  4ZS2 A;  3MKD A;  2VB6 A;  4EB6 E;  5LGN B;  2FGQ X;  5F8P A;  1KK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...