3LK42

Crystal structure of capz bound to the uncapping motif from cd2ap
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
242
structure length
238
Chain Sequence
DQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQERTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-1
publication title Structural characterization of a capping protein interaction motif defines a family of actin filament regulators
doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 78
structure length 238
sequence length 242
chains with identical sequence 5, 8, B, E, H, K, N, Q, T, W, Z
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lk4201
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3lk4202
5ADXK 3LK3B 5AFUK 3LK41 3LK2A 3AA6A 4AKRA 3AA6B 3LK42 3LK2B 4AKRB 3AAEA 3AAEB 3AAAA 2KZ7A 3AAAB 3AA0A 2KXPA 2KZ7B 1IZNA 3AA0B 2KXPB 3AA1A 3AA7A 1IZNB 5ADXL 3AA1B 3AA7B 5AFUL 3LK3A
chains in the Genus database with same CATH superfamily
3VR8A 3IA3A 4RJXA 3L39A 2O4VA 4FT6A 3AAIA 2WU2A 5ABFA 4DR1T 2XSAA 5LMUT 4AI6A 1D0YA 1U4QA 2IAKA 1O3XA 3MZKB 2ODJA 3TLUA 2HPLA 4YTNA 3NWIA 2B1EA 2BKPA 3P4PA 2RPAA 3I0QA 1BR2A 1G73A 3CVRA 1SUMB 1FJGT 3Q5WA 4AKRA 3SYSA 2XQYA 4I50E 1NEKA 4PK4A 4ILUA 4K0KT 2XY8B 4FRXA 2FJDA 2I0MA 5FVKA 2JQYA 5G38A 3PGRA 5FXWA 2M6BA 3HKEE 4CXWA 3HOEA 3DP7A 2WP9A 4JLEA 2KINB 1MNDA 3SFEA 4NIQA 3U78A 4GIWA 4WBOA 1LVFA 3AA0A 3ANWB 3JC6D 4QQ1A 1WFDA 5CA1E 2WS3A 3N9NA 4ZOLE 4M1PA 2VKOA 2WVPA 1WYCA 2N2MA 3B5MA 5FXVA 4I4TE 4WZXA 4E7ZA 2EHOB 3NBXX 3RRWA 4NPPA 1I94T 1S35A 3IBPA 4CZZB 2M07A 2BG9B 4AKGA 3M65A 5G26A 4X1YE 1QLBA 3UQ7A 3SYBA 4CXYA 2X9XA 3AE4A 3OYZA 4GKKT 5KAFO 2KT9A 4F4BA 1OEDB 3RC8A 4IL6O 4HFEA 4AQYT 4JCHA 3QB5A 3AA1A 2KSRA 4YFSA 5ADXL 3RRCA 3SOLA 3ZJ2A 4D5UA 2YINA 4A5XA 1B7TA 5CB4E 2GK9A 3MACA 5JDPA 4QXCB 2K3WA 2BKNA 3U3IA 2ES0A 2XAGB 3ZT7A 2YK0A 1T98A 4DV3T 2V1DB 4Z91A 4B6XA 3QUJA 4EOZB 2Y6XA 4FSPA 1FMWA 1D0ZA 4JEHB 3P7IA 2XZEA 3L8RA 1T7SA 4DV4T 4B3TT 5JH7E 3PRNA 5J1GA 1XDPA 1G90A 1SA0E 5AQJB 1G8XA 3RIFA 2R4NA 2XE3A 5C2TA 2BVLA 4WBNE 4RLCA 3V5UA 4PJ0O 2DLRA 2QA7A 2CXFA 5HEJA 4DIDB 2ZM6T 4YSYA 2WU5A 2NR4A 1XMOT 1KF6A 3A8YC 2MNHA 2R8AA 4DMVA 3POUA 4QH4A 1QJPA 3BRYA 2Q9QC 2FUPA 3PQSA 5FY7A 4DR2T 2V6YA 4O49A 3P4RA 2R4PA 5CFBA 4X65T 1YQ3A 4BUMX 1ZV4X 2YDSA 2X0HA 4PK6A 4DBQA 4YTMA 4ZS2A 4PJMA 1W9RA 2QYWA 3KVBA 3OJAA 4ZI2C 4AZLA 2Y8DA 4AFKA 4KHZF 3RQWA 1Q9GA 1N33T 4KHPT 4UF0B 3PJAA 1SHZC 1IJ6A 1JNZA 1HF8A 2XAJB 2V26A 1KFYA 1HNZT 5LG4A 1HS7A 3LJCA 3PF1A 2H7OA 3UU2A 3AE1A 5HEHA 1KEYA 5KAIO 4UV9B 4FRTA 2VKDA 4MHCA 4X66T 2E5VA 4IDQA 3BRZA 1GFOA 4UR9A 2KDYA 2YU1A 3AVRA 2KZ7A 5JDFA 2XQ8A 1XNRT 4H9NC 4X64T 5FY0A 4U9CA 1EZ3A 4HWFA 2E2AA 3LSVA 5L4HA 1H7CA 2LHFA 4AKMA 4HTEA 2V7IA 1N36T 4WYVA 4IIJE 4N78D 4A98A 3VKHA 3VKGA 4PJNA 2RP4A 4F6RC 2EHOC 2VB6A 3POXA 2E9XD 5TISO 4FZLA 4UB8O 3RIUC 1MM5A 5H2FO 2C5JA 1MMDA 1J5WA 2BG9C 2BBHA 2YDQA 2R6GF 2XHEB 3PORA 1OPFA 2J47A 5LGTB 2J1DG 2OLTA 4ZZCA 3GP6A 2NWBA 5J2UE 3MJXA 4DNDA 3AAAB 4YJ2E 2DI4A 1OEDC 1Y01A 4MALA 4EXTA 1P4TA 3AE2A 1BR1A 3F57A 2UXDT 4LFBT 3PUVF 4AIUA 2AXTO 5HEUA 2K5BB 4HWHA 1XWMA 4C4VB 2VVNA 4TX5A 5EK2A 2DHRA 4QX7B 4LF8T 3P4WA 2H88A 4LSFA 3C4WA 3WI4A 4EV6A 4U7YA 3AA7A 4IE0A 4EIWA 4C69X 4GYSA 4L0RA 1US7B 3AA6B 3AAEA 2MPKA 3PTRB 4QX8B 3RYIE 2AXDS 1GFNA 5HXEA 2FGRA 4AKIA 5FL1A 1IZNA 4AYDC 4ISSA 4DMWA 3I0OA 2X9HA 5IWAT 4B3ST 4FMSA 4DR3T 2A72A 1BR4A 4IE5A 3KFWX 4PFPA 3AE9A 4QWNB 3UUXB 3O4XE 2I6HA 5L3DB 1MMNA 3FZLB 5C8YE 4N58A 2PFVA 5LNKA 5LXTE 2K48A 3RYFE 5LG3A 2V8SV 2V7JA 4JUYA 5CA0E 6PRNA 2YN6A 5EE2A 4HFBA 4DUZT 4BA9A 4QXHB 2E9XB 4LMLA 4ZI7E 3OPCA 2LT3A 5TAOA 3ZC0A 1QUUA 3K3OA 3UT5E 3C4XA 5H6QB 3N2KE 5EK4A 3PUYF 1E2AA 3RQUA 4EB6E 2UXXB 2XM1A 4PJJA 3N5LA 4CI2B 4KMCA 4P0AA 4LSEA 4UXNB 3ZMSB 4MBQA 1AJ3A 3C5OA 1Q9FA 2W61A 5AFUK 4LSIA 4FOZA 4LF5T 5B66O 1KK7A 4UVAB 4F8HA 4V1Av 4JI0T 3ZYMA 1W0BA 2VQFT 4IT4A 2NP9A 3ONLC 3AXJB 4AXPA 4PJLA 5HXHA 2XQ3A 3PUGA 2DWKA 3PU8A 5DQWA 5E0OA 3LG7A 2R4LA 3P4SA 4N74A 3A0BO 4G76A 2UXNB 2XQ7A 2W2UA 3O1JA 2QRXA 3PU3A 2JJ9A 3O1IA 1ZEEA 3MKDA 3NVOA 2Q9QA 4YY3T 1YW0A 5CJ5A 4GKJT 1ZHZA 3EMNX 3G7GA 5HEOA 2C0SA 2Y2XA 2R89A 1ZHXA 3QOFA 2IHR1 3CQGB 4TV8E 2UUAT 2PJQA 3VZTX 2E5LT 2ZLDA 3Q5EA 4HGAA 4LFCT 3ZN0B 1VCTA 4AKHA 2XG6A 4P1NA 2C5KT 4PFOA 2XSBA 2N2LA 4JI7T 2A3DA 3BK9A 2VWAA 2FJBA 3I1AA 4LMJA 3FB2A 2AE9A 2HN1A 5L47A 5JR9B 1MNEA 2D0UA 3T20A 5L2LA 2D2SA 3JCFA 5DQVA 5LHHB 5DL6A 4IGUA 4WW0A 2OMFA 3WU2O 4P0BA 1I6ZA 3M3ZB 2Y48B 3B57A 5FYMA 3WAKA 3ZN1B 4YHJA 1BXWA 2LSKA 2XAFB 2IC6A 4NUUA 3ZT6A 4MFRA 2PBIA 4AYID 5HAXA 5J0ZA 5DABA 4HN9A 2LSGA 4O3ZA 2VQET 2J4GA 4HFHA 3A7MA 2VL8A 3IF8B 3RLFF 3J7Yq 5LJMA 4GF4A 3PGSA 2L3LA 3DWOX 4U72A 2NOXA 5LGNB 3ANWA 3FZFB 3LBXB 1T8BA 3T1HT 3RBHA 1KNRA 2RA1A 4DV2T 1W0AA 3LFMA 1OXZA 2EHOA 3ZKRA 2JQ9A 4E1TA 2CHNA 3RIUA 1ZOYA 5F5WA 4X20E 4EGWA 3ETUA 1ZP0A 2BG9A 3ABVA 3AEEA 1HX1B 3AVSA 2IUBA 5AQFB 7PRNA 5DL7A 1D1CA 3D0TA 3VRAA 3ZMVB 1UURA 4KUMB 5AQUB 1XDOA 4L9IA 2BBJA 3CIRA 4O2BE 4EYYR 2E9XC 4O3XB 3BQIA 3FZHB 5HWYA 3V8UA 3KBUA 1KNPA 2NTYA 2LOPA 3ZMZB 3FBZA 1OEDA 3W15B 3TLVA 5HEGA 4QKNA 4HFIA 4L5GA 2IC9A 3UPGA 4TWDA 3L3PA 4YSZA 1MMAA 2X51A 2DWGA 1E7PA 2PTFA 2YU2A 4KI0F 3ZSSA 2X9KA 1FIOA 5BR8T 2IDOB 3QNUA 3UUBA 4YTPA 5L3CB 1GFMA 2W00A 3NJTA 5F8PA 3EI0A 2F1VA 2V7MA 3VU7H 3PUXF 3GN5B 3TKLB 2VK9A 3ZYLA 4ZI3D 1THQA 4AYNA 2OA5A 5L3GB 2WSSV 2LSIA 4LFAT 3CX8B 2CBIA 4O4JE 3EDUA 3C98B 2BS3A 4LF7T 4CN4A 3RKOA 4JI1T 2QVAA 5HCMA 3VE1A 5B5EO 5LGUB 5AQMB 2YKSA 3OYXA 4B3RT 4UEMA 1X9BA 3GMIA 4CTDA 3P4QA 2J4UP 1CHUA 1YS5A 5HYAA 3E08A 3DTOA 3TZGA 2W63A 4LF6T 2WDQA 2PG8A 4JYAT 5ABHA 4DR6T 3O0EA 3LK2B 4JI8T 3CQCB 4IL4A 2V7KA 1JNRA 3ONJA 4JI6T 2ZM2A 3GA8A 1YXRA 2WMOA 1U5PA 2LRKA 4G63A 3N9MA 3PUQA 4HEAA 5IYZE 4FQEA 5FXXA 3ZMUB 3KV5A 4GYRA 1GFPA 2WM9A 3E22E 3K1SA 2KC0A 1D1AA 1WR6A 3NSGA 4UF0A 5L3BB 4TN7B 4LF9T 5JR9C 5JRCB 2SPCA 2V7LA 5LB7B 4B61A 4ILCA 1MPFA 5DL5A 4NUVA 3RI5A 3JCUO 4EZHA 3T1YT 1CUNA 1UX5A 2BVMA 3JADA 4XAXB 4GCSA 4QH1A 2X66A 2XE2A 4AKLA 4GOUA 4O4LE 5FY1A 3PJAJ 4KBMB 5F3JA 1ZHYA 5ETWA 2D9DA 5LOVE 2JQKA 5DL8A 3C64A 1KNZA 4Z90A 2F1TA 4UVBB 4NXMT 4WNKA 4DV5T 4DR4T 1HX8A 3PURA 1WR0A 3RYHE 5LBQB 3RHWA 5KX5E 4O8SA 2D5UA 3QC9A 1UX4A 3LK3B 3VRBA 3UAQA 2L9QA 3GWHA 2PORA 5E79O 4HWDA 2XAQB 3DWNA 3PV0F 4G75A 2I59A 4FESA 3H3MA 5JVDE 3FHNA 3EABA 2UUCT 3UQ4A 2YNKA 4ZEYA 1ZHWA 5H6RB 3NKZA 3DA3A 5AQOB 5KXJA 2XJ7A 5BMVE 4O4HE 8PRNA 4FZNA 4JBWF 4UB6O 4Z3TA 1IJ5A 3AEAA 2WWUA 3VY8X 4EYUA 2QGSA 4H9RC 3FXDB 4KP3C 1IAPA 4JEUB 4C4VA 4I43B 2CPTA 3KVAA 4U33A 5FVNA 2X27X 3O1HA 4X1KE 4TUYE 2W67A 3BS0A 3HR0A 3L09A 3BQKA 2ZMAA 4BJNA 4YSXA 3CPZA 3T8OA 3I9WA 4OYKA 4DUYT 4A97A 3MXZA 2XTQA 5GTIO 1WYBA 2B76A 4C00A 2WBLA 3SY7A 2MAWA 3ZSTA 2JMHA 5AQLB 4O3WA 2MYSA 2LJLA 2XQ9A 4ZZBA 2LLYA 2DNXA 3E0ZA 3N9QA 3SY9A 4O3YA 2JQHA 3T24A 4FI5A 2YOEA 2DL1A 3OVUA 3CX7B 2XTLA 2HHHT 2CEAA 3JAFA 5AFUL 2M06A 4DR7T 2X67A 1E1HB 2LSYA 1YQ4A 4PUXA 4DV1T 1BH3A 2XE5A 5KDMC 4IE6A 4JFBA 1FMVA 4GCQA 4ANJA 3POQA 2CXLA 5HWXA 3AE7A 5AQTB 4C91A 4QXBB 5AQQB 2NW7A 4RJWA 3AE5A 2ZM0A 3WAJA 4Q25A 4GHBA 4COFA 2Q9QD 3JC6C 2CXDA 2FBWA 3RPUA 3UU8A 4ZXLA 3A2SX 2NTXA 4PAGA 3CQXC 2E9XA 4U2ZA 4U3CA 3PE0A 4KRAA 4LSHA 3H3AA 5GONE 4IDOA 4CI1B 2WCAA 3CK6A 4D64A 3N9LA 4HWCA 4TNWA 3N2GE 4DO0A 4H9SE 4ZHQE 4ERRA 4LMKA 3HKCE 1HFAA 3Q5DA 3SWHA 3R6NA 3RH3A 3NZPA 1D1BA 2FJEA 3N9PA 4JI3T 2V5CA 2R4OA 4HFCA 5FKYA 1S94A 3KV9A 4ILAA 4FUVA 5AQNB 4K0UA 3S4UA 4CI3B 2H7VC 4TWFA 2M67A 2CRBA 3OKQA 3AXJA 5IUXA 3ONXA 1M7KA 3RKGA 4H9QC 4A56A 4ZI3C 1IBLT 3PUWF 4XNKA 1QJ8A 3N9OA 3VE2A 4EEBA 2P9BA 3CX6B 5IYUA 2KXPB 4RL9A 4IDZA 1LVKA 4YJ3E 2KNDA 1D0XA 3EVYA 5DJQC 3QRAA 4DV0T 4H63H 2EHOD 1UGOA 1MM4A 3VZWX 2XQ5A 3B13A 1Z8UA 2R88A 2UUBT 4YT0A 3C4ZA 2X9YA 3HKDE 3ZEFB 3VZUX 4DVDA 2D0TA 2XM2A 3ZMTB 5KMGP 2CWYA 3WI3A 4TNVA 2Y0KA 5L4EA 2VASA 1NAFA 2XAHB 5JDNA 2WJQA 2LRLA 2LM2A 2VKJA 2X9WA 2KWHA 4IHJE 1W09A 2NW8A 5JR9A 2JQQA 3EAMA 2LKGA 5G39A 4YXDA 1MIYA 4IDNA 3AE6A 3C51A 4J2CA 5LHGB 3UU5A 5ABFB 4UELA 1GQEA 4EEDA 3FXEB 2WDVA 1T16A 3AB3B 2L8KA 2F1CX 2WMNA 2V5DA 2ZLYA 5D5DA 5AQKB 4U74A 2BDEA 1ORMA 4AKRB 4JI2T 2C5IT 4O4XA 3LBXA 3OBVE 5IHYA 4O4UA 4UIGA 3EHZA 2VL0A 1N32T 2JMMA 1BR0A 3RYCE 5PRNA 4YHHT 4G2AA 2WY2A 3K19A 2LHRA 2DCFA 2XMXA 2HPJA 1HR0T 3PGUA 4N59A 3VHLA 4AQFC 4OHFA 3T0SA 5L3FB 5FXZA 2CE7A 3C50A 4JI4T 3AA0B 3SZVA 3EDVA 3TLWA 1PHOA 2WJRA 1E54A 4ISTA 3HKBE 3HI2A 4P09A 4TZ4C 3A0HO 1HG2A 3AEGA 2A9UA 3LK42 4OX9T 2K24A 2KMFA 2YEVC 1HG5A 3SRZA 4TWHA 3PUSA 1J5ET 2X0LB 3BQLA 3ETVA 2Y0LA 4XBFB 1VRBA 3HW9A 1Y64B 4QH5A 5T5FA 4PK5A 2IMLA 4OK0A 2BZBA 3PUAA 3QK6A 3TLTA 3GN5A 1LRZA 5JDLA 4JI5T 2XQ6A 3CWZB 4D65A 2ZFGA 3AA1B 3PDYA 2MHLA 3ZPOA 3I9YA 4OFZA 1ZHTA 2H89A 2Y7SA 4GCPA 4IDPA 5LA6E 2QTKA 4EZ4A 2HN2A 5JQGE 3ZYKA 2ODVA 4CQIA 4ASKA 3K3NA 5GV0A 3R84B 1QJ9A 1Z0PA 1OWAA 3DJBA 1R8IA 5JDQA 2WZHA 1GFQA 1XMQT 2JIWA 4PR7A 3FBLA 3UU4A 1MMGA 2CBJA 5GTHO 3LK2A 2CMRA 2XUEA 2ACXA 2CLYB 3OTOT 4NXNT 4AYEC 5FNVE 3P50A 2E8IA 2LE8A 3K3QC 4CN6A 4XZCA 5LYJE 1ZHCA 3UFEA 2IWVA 4RLBA 4X1IE 1SE7A 2CWOA 3HA4A 1NWMX 5AQGB 4HFDA 4IE4A 1YKHB 2FJAA 3MA9A 2BKOA 2UU9T 5CGMA 3VR9A 1BT9A 2V6YB 4QHOA 1IBMT 5JRCA 3CKDA 2WB5A 5ADXK 5FP3A 1T72A 4MLKA 3K8PC 2BG9E 2MBGA 3AEFA 4GK0E 3Q9DA 4CN1A 1MIVA 2ZM8A 2ERVA 2MTQA 3Q5XA 2VURA 5ABGA 1UCUA 1HCIA 1OEDE 1V9DA 2V6XA 2CM0A 1IBKT 4JV5T 2IIUA 2UXCT 2X0YA 2NW9A 3KV6A 3RF1A 3AE3A 2JMKA 5C3JA 2J1NA 4BJMA 5AQRB 2CCQA 3LK3A 3IEEA 5AQPB 1MIWA 2XQAA 3RIAA 2LEHA 3FZKB 3ZT5A 1YD8G 1WRDA 2K9AA 5EZYE 2LSJA 2IWWA 3KDSE 4FZMA 1LKXA 3UUMA 1DU2A 2KZ7B 2F4VT 3PUZF 1VOMA 2G0UA 2LFUA 2JPFA 4HWIB 1T1LA 3SS1A 4PW8A 4H9OC 3ESLA 2KLQA 3AEDA 5HCJA 3V5SA 4AYMC 5FL0A 5FVLA 4E7SA 1HNXT 3KBTA 3ZLIA 3AAAA 4H9PC 3UUNA 4KR8A 4O4IE 4K3CA 4AUIA 2LKHA 4H63V 3PQUA 3AECA 4IREA 2XQ4A 5AQIB 3RGLA 4YLHA 1WCRA 1VCSA 4IL9A 5JREA 2UXBT 5M4YA 3TLSA 2ACZA 3IHRA 2Z6EA 2ODUA 5JDHA 2BS4A 5HXRA 3SZDA 5JTGA 4DV6T 2JRKA 2CHOA 3DA4A 2LOSA 3AA6A 2BS2A 3NZQA 3QRCA 2J62A 4FSOA 5LCYA 5LJNA 4DR5T 5LHIB 4EAHA 2X68A 2VKHA 5G3AA 3UU3A 4UVCB 4I0UA 4GK5E 3ZCIA 3AA7B 5JDMA 2K4TA 1HXUA 2XE1A 5LBMA 3JTYA 4U2YA 4B3MT 3SFDA 2WDRA 1XNQT 1ZKEA 2WWVA 3AE8A 2GE4A 2WQYA 3AAEB 3JAEA 1NENA 2W66A 1HNWT 3WI5A 4IE7A 5HXCA 5AQVB 4HKAA 4HFVA 2A2FX 3UULA 1IZNB 2W80C 3N2OA 4E1SA 2CLYC 1X79A 5A1LA 2HH7A 3KV4A 4AQFA 3FYXA 4I55E 5LMNT 3X1DA 2WZIA 3KVDD 2KWIB 4UV8B 4U31A 1S5LO 1YKEB 3G06A 5EK3A 3HOLA 3FZMB 4OYJA 4C90A 2WAUA 5JDGA 3O9XA 2Y0HA 1FEWA 2LM9A 3ZCJA 4ZI2D 3UFGA 2N2NA 4BAYB 5LP6E 2N9DA 1N34T 2XTRA 3H37A 1H6S1 2W81C 4U7IA 4KR4A 5L3EB 2XASB 4X62T 2XPKA 2IW5B 4LF4T 4CXXA 4DBRA 4AQGA 1M62A 2PRNA 4K3BA 3J9X1 3MK7C 3F31A 2W62A 4N75A 1HXXA 4AISA 1PRNA 3CMLA 3RC3A 1WLXA 3P8CD 2VVSA 3UU6A 3QB5K 4X5TA 2W0GA 4KX6A 4TV9E 2LHNA 4ILBA 3KINB 2OV9A 1J1JA 1UK5A 3A5XA 4Z8XA 2KXPA 3EUHA 4XNLA 3LDQB 3Q2MA 1OSMA 3UTKA 1L0VA 3LK41 2MOZA 2YDRA 3NRXA 5AQSB 1QSDA 4HE8A 4ZS3A 4ADZA 3AEBA 5AQHB 3KZIO 5HXSA 1HXTA 2FGQX 1UUSA 4DV7T 3VY9X 3HL6A 2M6IA 3F2EA 3ZJ1A 5J2TE 2Q9QB 2K0LA 2H3RA 2W4XA 3DZMA 2YPVA 4PNIA 2N1GA 4FJOA 3NRYA 1XZYA 4O2AE 5ABEA 1HTJF 3RX6A 3HWBA 3ZC1A 5FMNA 2CA5A
chains in the Genus database with same CATH topology
2D5UA 3I9YA 3QC9A 4RJXA 1UX4A 3LK3B 2O4VA 4OFZA 1ZHTA 3UAQA 4FT6A 2Y7SA 3AAIA 2L9QA 2V7JA 3GWHA 4GCPA 2PORA 4JUYA 5LA6E 2QTKA 2XAQB 5CA0E 4EZ4A 4G75A 4AI6A 5JQGE 6PRNA 3ZYKA 2ODVA 5EE2A 2I59A 4FESA 1D0YA 1U4QA 2IAKA 4CQIA 4ASKA 3K3NA 4BA9A 5JVDE 3FHNA 4QXHB 2E9XB 1O3XA 5GV0A 3MZKB 3R84B 4ZI7E 1QJ9A 2ODJA 2YNKA 1Z0PA 2HPLA 1OWAA 3DJBA 2LT3A 5TAOA 2B1EA 1ZHWA 5JDQA 3ZC0A 3I0QA 5H6RB 1GFQA 1BR2A 1QUUA 3FBLA 1G73A 3CVRA 1MMGA 3K3OA 3UT5E 3C4XA 3Q5WA 5H6QB 3DA3A 3N2KE 3LK2A 4AKRA 2CMRA 5EK4A 5BMVE 3SYSA 2XQYA 3ZPOA 4I50E 4O4HE 4EB6E 4PK4A 8PRNA 4ILUA 4FZNA 2XUEA 2UXXB 4Z3TA 2ACXA 2CLYB 1IJ5A 4FRXA 4AYEC 4PJJA 4XZCA 2E8IA 2LE8A 2WWUA 3K3QC 3N5LA 4KMCA 5FNVE 4CI2B 5LYJE 4EYUA 4P0AA 2QGSA 4LSEA 4H9RC 1ZHCA 4UXNB 3UFEA 3ZMSB 4RLBA 4MBQA 4X1IE 3FXDB 4KP3C 1IAPA 4JEUB 5FXWA 2W61A 1AJ3A 1Q9FA 3C5OA 4I43B 3HKEE 4CXWA 2CWOA 3HOEA 4LSIA 3HA4A 4FOZA 3DP7A 3KVAA 4JLEA 2KINB 1MNDA 5FVNA 1NWMX 2X27X 3O1HA 4X1KE 1KK7A 4UVAB 4TUYE 4V1Av 3U78A 4GIWA 3HR0A 4IE4A 4WBOA 3L09A 1YKHB 3ZYMA 3MA9A 1LVFA 3AA0A 3BQKA 3ANWB 3JC6D 2NP9A 2ZMAA 1BT9A 4QQ1A 5CA1E 3N9NA 4AXPA 4BJNA 4ZOLE 3CPZA 3T8OA 4QHOA 3I9WA 4M1PA 4PJLA 2VKOA 5HXHA 4OYKA 3CKDA 5JRCA 3PUGA 2DWKA 5ADXK 5FP3A 3MXZA 1WYCA 2N2MA 2XTQA 1WYBA 4MLKA 5FXVA 4I4TE 3K8PC 4E7ZA 2WBLA 2EHOB 3PU8A 3NBXX 3SY7A 3RRWA 5DQWA 5E0OA 2MBGA 4GK0E 2JMHA 3LG7A 4O3WA 3Q9DA 2MYSA 1S35A 2LJLA 3IBPA 1MIVA 4CZZB 2M07A 2DNXA 4AKGA 3E0ZA 3N9QA 4G76A 2UXNB 2ZM8A 4O3YA 2ERVA 3SY9A 3T24A 3M65A 4FI5A 5G26A 3O1JA 2MTQA 3Q5XA 4X1YE 1UCUA 2JJ9A 3PU3A 3CX7B 1HCIA 2XTLA 1ZEEA 3O1IA 2CEAA 5AFUL 2M06A 3MKDA 2Q9QA 3SYBA 2X67A 4CXYA 1E1HB 2LSYA 2X9XA 1V9DA 1YW0A 2CM0A 3OYZA 2NW9A 4PUXA 1ZHZA 1BH3A 2KT9A 2XE5A 5KDMC 4IE6A 4F4BA 3KV6A 3EMNX 4JFBA 1FMVA 4GCQA 3G7GA 2C0SA 3RC8A 4ANJA 2Y2XA 1ZHXA 3POQA 2CXLA 5HWXA 4JCHA 3CQGB 4TV8E 2PJQA 2JMKA 2J1NA 4C91A 3VZTX 4QXBB 4BJMA 3AA1A 2NW7A 2ZLDA 4RJWA 4YFSA 2CCQA 5ADXL 2ZM0A 4HGAA 3WAJA 3ZN0B 3RRCA 3LK3A 4GHBA 3IEEA 2Q9QD 3SOLA 3ZJ2A 1MIWA 4AKHA 2YINA 2XG6A 3JC6C 4D5UA 2CXDA 2C5KT 4PFOA 1B7TA 2LEHA 5CB4E 3RPUA 2GK9A 2N2LA 3MACA 1YD8G 3A2SX 5JDPA 2NTXA 1WRDA 2A3DA 2K9AA 5EZYE 2MHLA 4PAGA 4QXCB 2LSJA 3U3IA 2ES0A 2XAGB 3BK9A 2VWAA 3I1AA 3CQXC 2YK0A 2E9XA 3KDSE 1T98A 3FB2A 4FZMA 1LKXA 3PE0A 3UUMA 2KZ7B 2V1DB 4KRAA 5JR9B 1MNEA 1VOMA 2D0UA 2G0UA 3T20A 5L2LA 4LSHA 2D2SA 4B6XA 2JPFA 2LFUA 3H3AA 5GONE 3QUJA 5DQVA 2Y6XA 4EOZB 5LHHB 4FSPA 1FMWA 4CI1B 5DL6A 4IGUA 4WW0A 2OMFA 1D0ZA 4JEHB 3SS1A 4P0BA 3P7IA 2Y48B 4H9OC 3ESLA 4PW8A 2KLQA 3B57A 4D64A 5FYMA 3WAKA 3N9LA 4YHJA 3V5SA 3ZN1B 4AYMC 1BXWA 3N2GE 4DO0A 5JH7E 3PRNA 5J1GA 4H9SE 4E7SA 2LSKA 3KBTA 3ZLIA 4ZHQE 1G90A 2XAFB 4ERRA 1SA0E 3AAAA 3HKCE 1G8XA 2IC6A 1HFAA 2XE3A 4H9PC 3UUNA 4NUUA 4KR8A 3SWHA 4O4IE 3R6NA 2BVLA 4WBNE 3RH3A 4RLCA 4MFRA 3NZPA 1D1BA 3N9PA 3V5UA 2PBIA 4AYID 5HAXA 4AUIA 5DABA 4HN9A 2DLRA 4H63V 2QA7A 2LSGA 2CXFA 4O3ZA 1S94A 3PQUA 3KV9A 4FUVA 4K0UA 2VL8A 3IF8B 3S4UA 4CI3B 4DMVA 2MNHA 4YLHA 2H7VC 3J7Yq 3POUA 5LJMA 4GF4A 1QJPA 2M67A 2Q9QC 5JREA 2L3LA 4U72A 2NOXA 3OKQA 3ANWA 5LGNB 5M4YA 5FY7A 3PQSA 4O49A 3LBXB 3IHRA 3RBHA 2Z6EA 2ODUA 2RA1A 5JDHA 3ONXA 4BUMX 5HXRA 1ZV4X 3SZDA 4H9QC 3LFMA 1OXZA 2EHOA 2JRKA 4ZI3C 4A56A 4XNKA 4PK6A 3DA4A 4E1TA 2LOSA 1QJ8A 4DBQA 3N9OA 3AA6A 4X20E 3NZQA 3QRCA 4ZS2A 4PJMA 3ETUA 4FSOA 3VE2A 5LCYA 5LJNA 3KVBA 3OJAA 5LHIB 2P9BA 4ZI2C 3AVSA 4LSFA 4AZLA 4EAHA 2X68A 7PRNA 5DL7A 2VKHA 2Y8DA 4AFKA 1D1CA 3CX6B 3D0TA 4UVCB 3ZMVB 5IYUA 2KXPB 4KUMB 4RL9A 4GK5E 4IDZA 1LVKA 4YJ3E 2KNDA 4L9IA 3ZCIA 1D0XA 3AA7B 5JDMA 1Q9GA 3EVYA 5DJQC 4O2BE 4EYYR 2E9XC 3QRAA 2K4TA 4UF0B 1HXUA 4O3XB 4H63H 1SHZC 2EHOD 2XE1A 1MM4A 5LBMA 3BQIA 1IJ6A 1HF8A 5HWYA 2XAJB 3JTYA 3B13A 3V8UA 3VZWX 3KBUA 2NTYA 2LOPA 2V26A 3ZMZB 3FBZA 1ZKEA 3W15B 3C4ZA 5LG4A 1HS7A 4QKNA 2GE4A 3LJCA 4L5GA 2H7OA 2IC9A 3AAEB 3UU2A 3UPGA 3L3PA 2X9YA 1MMAA 2X51A 2DWGA 3HKDE 3ZEFB 3VZUX 4DVDA 3WI5A 2D0TA 4IE7A 5HXCA 4HKAA 4HFVA 3ZMTB 2A2FX 2YU2A 3UULA 1IZNB 4UV9B 1FIOA 5KMGP 3N2OA 2CWYA 2W80C 3WI3A 4E1SA 5L3CB 2CLYC 2Y0KA 1X79A 5A1LA 1GFMA 2HH7A 3KV4A 4FRTA 4AQFA 2VASA 2VKDA 1NAFA 3FYXA 2XAHB 4MHCA 5JDNA 4I55E 2W00A 5F8PA 2VKJA 3KVDD 2KWIB 4UV8B 2F1VA 2V7MA 2X9WA 3VU7H 1GFOA 2KWHA 4IHJE 2KDYA 1YKEB 2YU1A 3GN5B 3TKLB 3AVRA 2KZ7A 5EK3A 5JDFA 2NW8A 3HOLA 2VK9A 5JR9A 4OYJA 3ZYLA 2JQQA 4C90A 4ZI3D 4H9NC 1THQA 2WAUA 4AYNA 2OA5A 5L3GB 5FY0A 5JDGA 1EZ3A 3O9XA 2WSSV 4U9CA 2Y0HA 2LSIA 1FEWA 3CX8B 4O4JE 3EDUA 1H7CA 2LHFA 4AKMA 2LM9A 3C98B 4HTEA 1MIYA 2V7IA 3ZCJA 4ZI2D 2N2NA 3C51A 4J2CA 5LHGB 4BAYB 5LP6E 3RKOA 2N9DA 4IIJE 4N78D 4UELA 2XTRA 3VKHA 3VKGA 4PJNA 3VE1A 2RP4A 4F6RC 2EHOC 5LGUB 2VB6A 3POXA 2E9XD 4FZLA 3OYXA 3FXEB 3H37A 1MM5A 4UEMA 1H6S1 2W81C 3AB3B 3GMIA 2L8KA 5L3EB 4KR4A 2C5JA 1MMDA 3VY8X 2WMNA 2ZLYA 2J4UP 1YS5A 2XASB 5HYAA 3E08A 2IW5B 5D5DA 3DTOA 4CXXA 4DBRA 2W63A 3TZGA 4AQGA 2XHEB 2PRNA 4U74A 2BDEA 2PG8A 3PORA 1OPFA 3J9X1 3O0EA 5LGTB 2J1DG 1ORMA 3MK7C 3F31A 3GP6A 2W62A 3LK2B 2NWBA 4AKRB 1HXXA 1PRNA 3CQCB 3CMLA 3RC3A 5J2UE 2C5IT 3MJXA 4DNDA 1WLXA 4O4XA 2V7KA 3LBXA 3AAAB 3OBVE 5IHYA 4YJ2E 4O4UA 4UIGA 3P8CD 2DI4A 4MALA 4EXTA 1P4TA 1BR1A 2JMMA 3F57A 1BR0A 2W0GA 3RYCE 2ZM2A 5PRNA 3GA8A 4G2AA 2WMOA 4TV9E 1U5PA 4G63A 3N9MA 2K5BB 3PUQA 4TX5A 3K19A 2LHRA 2DCFA 2LHNA 5EK2A 2XMXA 2HPJA 3KINB 4HEAA 2DHRA 5IYZE 4N59A 3VHLA 4QX7B 4AQFC 5FXXA 3ZMUB 3KV5A 4GYRA 3A5XA 4OHFA 3T0SA 4Z8XA 2WM9A 3E22E 2CE7A 3C50A 5FXZA 3C4WA 5L3FB 1GFPA 2KXPA 2KC0A 3HWBA 1D1AA 3WI4A 3AA0B 3EUHA 3SZVA 3EDVA 4IE0A 1PHOA 3AA7A 4XNLA 1WR6A 4EIWA 3NSGA 4UF0A 3Q2MA 1E54A 5L3BB 4C69X 1OSMA 4ISTA 3HKBE 4TN7B 3UTKA 5JR9C 5JRCB 2SPCA 2V7LA 4B61A 3HI2A 4P09A 4TZ4C 1MPFA 4GYSA 3LK41 2MOZA 3NRXA 4L0RA 1HG2A 5DL5A 1US7B 4NUVA 3AA6B 3LK42 3AAEA 3PTRB 2K24A 4QX8B 3RYIE 4EZHA 1QSDA 2KMFA 1GFNA 4HE8A 2YEVC 1CUNA 1UX5A 2BVMA 4ZS3A 4ADZA 5HXEA 4AKIA 1HG5A 2FGRA 3SRZA 5HXSA 1HXTA 2FGQX 3PUSA 4XAXB 4GCSA 1IZNA 2X66A 2X0LB 4AYDC 3BQLA 2XE2A 3VY9X 3ETVA 3HL6A 4ISSA 4AKLA 2Y0LA 3F2EA 4GOUA 4DMWA 4XBFB 4O4LE 5FY1A 1VRBA 3I0OA 3ZJ1A 2X9HA 3HW9A 4FMSA 4KBMB 5J2TE 1Y64B 2A72A 5F3JA 1BR4A 2Q9QB 4IE5A 1ZHYA 4PK5A 2H3RA 5ETWA 2K0LA 3KFWX 5T5FA 5AFUK 4PFPA 5LOVE 4OK0A 4QWNB 3UUXB 2BZBA 3PUAA 3QK6A 3C64A 4PNIA 1KNZA 2YPVA 5DL8A 2N1GA 3O4XE 3GN5A 4FJOA 1LRZA 3NRYA 5JDLA 5L3DB 1MMNA 2F1TA 4UVBB 5C8YE 4WNKA 4N58A 4O2AE 1HX8A 2PFVA 3PURA 5LNKA 3CWZB 3RYHE 4D65A 5LXTE 2K48A 1HTJF 5LBQB 3RX6A 3RYFE 3AA1B 2ZFGA 3PDYA 3ZC1A 5FMNA 5KX5E 4O8SA 2CA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ADX K;  3LK3 B;  5AFU K;  3LK4 1;  3LK2 A;  3AA6 A;  4AKR A;  3AA6 B;  3LK4 2;  3LK2 B;  4AKR B;  3AAE A;  3AAE B;  3AAA A;  2KZ7 A;  3AAA B;  3AA0 A;  2KXP A;  2KZ7 B;  1IZN A;  3AA0 B;  2KXP B;  3AA1 A;  3AA7 A;  1IZN B;  5ADX L;  3AA1 B;  3AA7 B;  5AFU L;  3LK3 A; 
#chains in the Genus database with same CATH topology
 3VR8 A;  3IA3 A;  4RJX A;  3L39 A;  2O4V A;  4FT6 A;  3AAI A;  2WU2 A;  5ABF A;  4DR1 T;  2XSA A;  5LMU T;  4AI6 A;  1D0Y A;  1U4Q A;  2IAK A;  1O3X A;  3MZK B;  2ODJ A;  3TLU A;  2HPL A;  4YTN A;  3NWI A;  2B1E A;  2BKP A;  3P4P A;  2RPA A;  3I0Q A;  1BR2 A;  1G73 A;  3CVR A;  1SUM B;  1FJG T;  3Q5W A;  4AKR A;  3SYS A;  2XQY A;  4I50 E;  1NEK A;  4PK4 A;  4ILU A;  4K0K T;  2XY8 B;  4FRX A;  2FJD A;  2I0M A;  5FVK A;  2JQY A;  5G38 A;  3PGR A;  5FXW A;  2M6B A;  3HKE E;  4CXW A;  3HOE A;  3DP7 A;  2WP9 A;  4JLE A;  2KIN B;  1MND A;  3SFE A;  4NIQ A;  3U78 A;  4GIW A;  4WBO A;  1LVF A;  3AA0 A;  3ANW B;  3JC6 D;  4QQ1 A;  1WFD A;  5CA1 E;  2WS3 A;  3N9N A;  4ZOL E;  4M1P A;  2VKO A;  2WVP A;  1WYC A;  2N2M A;  3B5M A;  5FXV A;  4I4T E;  4WZX A;  4E7Z A;  2EHO B;  3NBX X;  3RRW A;  4NPP A;  1I94 T;  1S35 A;  3IBP A;  4CZZ B;  2M07 A;  2BG9 B;  4AKG A;  3M65 A;  5G26 A;  4X1Y E;  1QLB A;  3UQ7 A;  3SYB A;  4CXY A;  2X9X A;  3AE4 A;  3OYZ A;  4GKK T;  5KAF O;  2KT9 A;  4F4B A;  1OED B;  3RC8 A;  4IL6 O;  4HFE A;  4AQY T;  4JCH A;  3QB5 A;  3AA1 A;  2KSR A;  4YFS A;  5ADX L;  3RRC A;  3SOL A;  3ZJ2 A;  4D5U A;  2YIN A;  4A5X A;  1B7T A;  5CB4 E;  2GK9 A;  3MAC A;  5JDP A;  4QXC B;  2K3W A;  2BKN A;  3U3I A;  2ES0 A;  2XAG B;  3ZT7 A;  2YK0 A;  1T98 A;  4DV3 T;  2V1D B;  4Z91 A;  4B6X A;  3QUJ A;  4EOZ B;  2Y6X A;  4FSP A;  1FMW A;  1D0Z A;  4JEH B;  3P7I A;  2XZE A;  3L8R A;  1T7S A;  4DV4 T;  4B3T T;  5JH7 E;  3PRN A;  5J1G A;  1XDP A;  1G90 A;  1SA0 E;  5AQJ B;  1G8X A;  3RIF A;  2R4N A;  2XE3 A;  5C2T A;  2BVL A;  4WBN E;  4RLC A;  3V5U A;  4PJ0 O;  2DLR A;  2QA7 A;  2CXF A;  5HEJ A;  4DID B;  2ZM6 T;  4YSY A;  2WU5 A;  2NR4 A;  1XMO T;  1KF6 A;  3A8Y C;  2MNH A;  2R8A A;  4DMV A;  3POU A;  4QH4 A;  1QJP A;  3BRY A;  2Q9Q C;  2FUP A;  3PQS A;  5FY7 A;  4DR2 T;  2V6Y A;  4O49 A;  3P4R A;  2R4P A;  5CFB A;  4X65 T;  1YQ3 A;  4BUM X;  1ZV4 X;  2YDS A;  2X0H A;  4PK6 A;  4DBQ A;  4YTM A;  4ZS2 A;  4PJM A;  1W9R A;  2QYW A;  3KVB A;  3OJA A;  4ZI2 C;  4AZL A;  2Y8D A;  4AFK A;  4KHZ F;  3RQW A;  1Q9G A;  1N33 T;  4KHP T;  4UF0 B;  3PJA A;  1SHZ C;  1IJ6 A;  1JNZ A;  1HF8 A;  2XAJ B;  2V26 A;  1KFY A;  1HNZ T;  5LG4 A;  1HS7 A;  3LJC A;  3PF1 A;  2H7O A;  3UU2 A;  3AE1 A;  5HEH A;  1KEY A;  5KAI O;  4UV9 B;  4FRT A;  2VKD A;  4MHC A;  4X66 T;  2E5V A;  4IDQ A;  3BRZ A;  1GFO A;  4UR9 A;  2KDY A;  2YU1 A;  3AVR A;  2KZ7 A;  5JDF A;  2XQ8 A;  1XNR T;  4H9N C;  4X64 T;  5FY0 A;  4U9C A;  1EZ3 A;  4HWF A;  2E2A A;  3LSV A;  5L4H A;  1H7C A;  2LHF A;  4AKM A;  4HTE A;  2V7I A;  1N36 T;  4WYV A;  4IIJ E;  4N78 D;  4A98 A;  3VKH A;  3VKG A;  4PJN A;  2RP4 A;  4F6R C;  2EHO C;  2VB6 A;  3POX A;  2E9X D;  5TIS O;  4FZL A;  4UB8 O;  3RIU C;  1MM5 A;  5H2F O;  2C5J A;  1MMD A;  1J5W A;  2BG9 C;  2BBH A;  2YDQ A;  2R6G F;  2XHE B;  3POR A;  1OPF A;  2J47 A;  5LGT B;  2J1D G;  2OLT A;  4ZZC A;  3GP6 A;  2NWB A;  5J2U E;  3MJX A;  4DND A;  3AAA B;  4YJ2 E;  2DI4 A;  1OED C;  1Y01 A;  4MAL A;  4EXT A;  1P4T A;  3AE2 A;  1BR1 A;  3F57 A;  2UXD T;  4LFB T;  3PUV F;  4AIU A;  2AXT O;  5HEU A;  2K5B B;  4HWH A;  1XWM A;  4C4V B;  2VVN A;  4TX5 A;  5EK2 A;  2DHR A;  4QX7 B;  4LF8 T;  3P4W A;  2H88 A;  4LSF A;  3C4W A;  3WI4 A;  4EV6 A;  4U7Y A;  3AA7 A;  4IE0 A;  4EIW A;  4C69 X;  4GYS A;  4L0R A;  1US7 B;  3AA6 B;  3AAE A;  2MPK A;  3PTR B;  4QX8 B;  3RYI E;  2AXD S;  1GFN A;  5HXE A;  2FGR A;  4AKI A;  5FL1 A;  1IZN A;  4AYD C;  4ISS A;  4DMW A;  3I0O A;  2X9H A;  5IWA T;  4B3S T;  4FMS A;  4DR3 T;  2A72 A;  1BR4 A;  4IE5 A;  3KFW X;  4PFP A;  3AE9 A;  4QWN B;  3UUX B;  3O4X E;  2I6H A;  5L3D B;  1MMN A;  3FZL B;  5C8Y E;  4N58 A;  2PFV A;  5LNK A;  5LXT E;  2K48 A;  3RYF E;  5LG3 A;  2V8S V;  2V7J A;  4JUY A;  5CA0 E;  6PRN A;  2YN6 A;  5EE2 A;  4HFB A;  4DUZ T;  4BA9 A;  4QXH B;  2E9X B;  4LML A;  4ZI7 E;  3OPC A;  2LT3 A;  5TAO A;  3ZC0 A;  1QUU A;  3K3O A;  3UT5 E;  3C4X A;  5H6Q B;  3N2K E;  5EK4 A;  3PUY F;  1E2A A;  3RQU A;  4EB6 E;  2UXX B;  2XM1 A;  4PJJ A;  3N5L A;  4CI2 B;  4KMC A;  4P0A A;  4LSE A;  4UXN B;  3ZMS B;  4MBQ A;  1AJ3 A;  3C5O A;  1Q9F A;  2W61 A;  5AFU K;  4LSI A;  4FOZ A;  4LF5 T;  5B66 O;  1KK7 A;  4UVA B;  4F8H A;  4V1A v;  4JI0 T;  3ZYM A;  1W0B A;  2VQF T;  4IT4 A;  2NP9 A;  3ONL C;  3AXJ B;  4AXP A;  4PJL A;  5HXH A;  2XQ3 A;  3PUG A;  2DWK A;  3PU8 A;  5DQW A;  5E0O A;  3LG7 A;  2R4L A;  3P4S A;  4N74 A;  3A0B O;  4G76 A;  2UXN B;  2XQ7 A;  2W2U A;  3O1J A;  2QRX A;  3PU3 A;  2JJ9 A;  3O1I A;  1ZEE A;  3MKD A;  3NVO A;  2Q9Q A;  4YY3 T;  1YW0 A;  5CJ5 A;  4GKJ T;  1ZHZ A;  3EMN X;  3G7G A;  5HEO A;  2C0S A;  2Y2X A;  2R89 A;  1ZHX A;  3QOF A;  2IHR 1;  3CQG B;  4TV8 E;  2UUA T;  2PJQ A;  3VZT X;  2E5L T;  2ZLD A;  3Q5E A;  4HGA A;  4LFC T;  3ZN0 B;  1VCT A;  4AKH A;  2XG6 A;  4P1N A;  2C5K T;  4PFO A;  2XSB A;  2N2L A;  4JI7 T;  2A3D A;  3BK9 A;  2VWA A;  2FJB A;  3I1A A;  4LMJ A;  3FB2 A;  2AE9 A;  2HN1 A;  5L47 A;  5JR9 B;  1MNE A;  2D0U A;  3T20 A;  5L2L A;  2D2S A;  3JCF A;  5DQV A;  5LHH B;  5DL6 A;  4IGU A;  4WW0 A;  2OMF A;  3WU2 O;  4P0B A;  1I6Z A;  3M3Z B;  2Y48 B;  3B57 A;  5FYM A;  3WAK A;  3ZN1 B;  4YHJ A;  1BXW A;  2LSK A;  2XAF B;  2IC6 A;  4NUU A;  3ZT6 A;  4MFR A;  2PBI A;  4AYI D;  5HAX A;  5J0Z A;  5DAB A;  4HN9 A;  2LSG A;  4O3Z A;  2VQE T;  2J4G A;  4HFH A;  3A7M A;  2VL8 A;  3IF8 B;  3RLF F;  3J7Y q;  5LJM A;  4GF4 A;  3PGS A;  2L3L A;  3DWO X;  4U72 A;  2NOX A;  5LGN B;  3ANW A;  3FZF B;  3LBX B;  1T8B A;  3T1H T;  3RBH A;  1KNR A;  2RA1 A;  4DV2 T;  1W0A A;  3LFM A;  1OXZ A;  2EHO A;  3ZKR A;  2JQ9 A;  4E1T A;  2CHN A;  3RIU A;  1ZOY A;  5F5W A;  4X20 E;  4EGW A;  3ETU A;  1ZP0 A;  2BG9 A;  3ABV A;  3AEE A;  1HX1 B;  3AVS A;  2IUB A;  5AQF B;  7PRN A;  5DL7 A;  1D1C A;  3D0T A;  3VRA A;  3ZMV B;  1UUR A;  4KUM B;  5AQU B;  1XDO A;  4L9I A;  2BBJ A;  3CIR A;  4O2B E;  4EYY R;  2E9X C;  4O3X B;  3BQI A;  3FZH B;  5HWY A;  3V8U A;  3KBU A;  1KNP A;  2NTY A;  2LOP A;  3ZMZ B;  3FBZ A;  1OED A;  3W15 B;  3TLV A;  5HEG A;  4QKN A;  4HFI A;  4L5G A;  2IC9 A;  3UPG A;  4TWD A;  3L3P A;  4YSZ A;  1MMA A;  2X51 A;  2DWG A;  1E7P A;  2PTF A;  2YU2 A;  4KI0 F;  3ZSS A;  2X9K A;  1FIO A;  5BR8 T;  2IDO B;  3QNU A;  3UUB A;  4YTP A;  5L3C B;  1GFM A;  2W00 A;  3NJT A;  5F8P A;  3EI0 A;  2F1V A;  2V7M A;  3VU7 H;  3PUX F;  3GN5 B;  3TKL B;  2VK9 A;  3ZYL A;  4ZI3 D;  1THQ A;  4AYN A;  2OA5 A;  5L3G B;  2WSS V;  2LSI A;  4LFA T;  3CX8 B;  2CBI A;  4O4J E;  3EDU A;  3C98 B;  2BS3 A;  4LF7 T;  4CN4 A;  3RKO A;  4JI1 T;  2QVA A;  5HCM A;  3VE1 A;  5B5E O;  5LGU B;  5AQM B;  2YKS A;  3OYX A;  4B3R T;  4UEM A;  1X9B A;  3GMI A;  4CTD A;  3P4Q A;  2J4U P;  1CHU A;  1YS5 A;  5HYA A;  3E08 A;  3DTO A;  3TZG A;  2W63 A;  4LF6 T;  2WDQ A;  2PG8 A;  4JYA T;  5ABH A;  4DR6 T;  3O0E A;  3LK2 B;  4JI8 T;  3CQC B;  4IL4 A;  2V7K A;  1JNR A;  3ONJ A;  4JI6 T;  2ZM2 A;  3GA8 A;  1YXR A;  2WMO A;  1U5P A;  2LRK A;  4G63 A;  3N9M A;  3PUQ A;  4HEA A;  5IYZ E;  4FQE A;  5FXX A;  3ZMU B;  3KV5 A;  4GYR A;  1GFP A;  2WM9 A;  3E22 E;  3K1S A;  2KC0 A;  1D1A A;  1WR6 A;  3NSG A;  4UF0 A;  5L3B B;  4TN7 B;  4LF9 T;  5JR9 C;  5JRC B;  2SPC A;  2V7L A;  5LB7 B;  4B61 A;  4ILC A;  1MPF A;  5DL5 A;  4NUV A;  3RI5 A;  3JCU O;  4EZH A;  3T1Y T;  1CUN A;  1UX5 A;  2BVM A;  3JAD A;  4XAX B;  4GCS A;  4QH1 A;  2X66 A;  2XE2 A;  4AKL A;  4GOU A;  4O4L E;  5FY1 A;  3PJA J;  4KBM B;  5F3J A;  1ZHY A;  5ETW A;  2D9D A;  5LOV E;  2JQK A;  5DL8 A;  3C64 A;  1KNZ A;  4Z90 A;  2F1T A;  4UVB B;  4NXM T;  4WNK A;  4DV5 T;  4DR4 T;  1HX8 A;  3PUR A;  1WR0 A;  3RYH E;  5LBQ B;  3RHW A;  5KX5 E;  4O8S A;  2D5U A;  3QC9 A;  1UX4 A;  3LK3 B;  3VRB A;  3UAQ A;  2L9Q A;  3GWH A;  2POR A;  5E79 O;  4HWD A;  2XAQ B;  3DWN A;  3PV0 F;  4G75 A;  2I59 A;  4FES A;  3H3M A;  5JVD E;  3FHN A;  3EAB A;  2UUC T;  3UQ4 A;  2YNK A;  4ZEY A;  1ZHW A;  5H6R B;  3NKZ A;  3DA3 A;  5AQO B;  5KXJ A;  2XJ7 A;  5BMV E;  4O4H E;  8PRN A;  4FZN A;  4JBW F;  4UB6 O;  4Z3T A;  1IJ5 A;  3AEA A;  2WWU A;  3VY8 X;  4EYU A;  2QGS A;  4H9R C;  3FXD B;  4KP3 C;  1IAP A;  4JEU B;  4C4V A;  4I43 B;  2CPT A;  3KVA A;  4U33 A;  5FVN A;  2X27 X;  3O1H A;  4X1K E;  4TUY E;  2W67 A;  3BS0 A;  3HR0 A;  3L09 A;  3BQK A;  2ZMA A;  4BJN A;  4YSX A;  3CPZ A;  3T8O A;  3I9W A;  4OYK A;  4DUY T;  4A97 A;  3MXZ A;  2XTQ A;  5GTI O;  1WYB A;  2B76 A;  4C00 A;  2WBL A;  3SY7 A;  2MAW A;  3ZST A;  2JMH A;  5AQL B;  4O3W A;  2MYS A;  2LJL A;  2XQ9 A;  4ZZB A;  2LLY A;  2DNX A;  3E0Z A;  3N9Q A;  3SY9 A;  4O3Y A;  2JQH A;  3T24 A;  4FI5 A;  2YOE A;  2DL1 A;  3OVU A;  3CX7 B;  2XTL A;  2HHH T;  2CEA A;  3JAF A;  5AFU L;  2M06 A;  4DR7 T;  2X67 A;  1E1H B;  2LSY A;  1YQ4 A;  4PUX A;  4DV1 T;  1BH3 A;  2XE5 A;  5KDM C;  4IE6 A;  4JFB A;  1FMV A;  4GCQ A;  4ANJ A;  3POQ A;  2CXL A;  5HWX A;  3AE7 A;  5AQT B;  4C91 A;  4QXB B;  5AQQ B;  2NW7 A;  4RJW A;  3AE5 A;  2ZM0 A;  3WAJ A;  4Q25 A;  4GHB A;  4COF A;  2Q9Q D;  3JC6 C;  2CXD A;  2FBW A;  3RPU A;  3UU8 A;  4ZXL A;  3A2S X;  2NTX A;  4PAG A;  3CQX C;  2E9X A;  4U2Z A;  4U3C A;  3PE0 A;  4KRA A;  4LSH A;  3H3A A;  5GON E;  4IDO A;  4CI1 B;  2WCA A;  3CK6 A;  4D64 A;  3N9L A;  4HWC A;  4TNW A;  3N2G E;  4DO0 A;  4H9S E;  4ZHQ E;  4ERR A;  4LMK A;  3HKC E;  1HFA A;  3Q5D A;  3SWH A;  3R6N A;  3RH3 A;  3NZP A;  1D1B A;  2FJE A;  3N9P A;  4JI3 T;  2V5C A;  2R4O A;  4HFC A;  5FKY A;  1S94 A;  3KV9 A;  4ILA A;  4FUV A;  5AQN B;  4K0U A;  3S4U A;  4CI3 B;  2H7V C;  4TWF A;  2M67 A;  2CRB A;  3OKQ A;  3AXJ A;  5IUX A;  3ONX A;  1M7K A;  3RKG A;  4H9Q C;  4A56 A;  4ZI3 C;  1IBL T;  3PUW F;  4XNK A;  1QJ8 A;  3N9O A;  3VE2 A;  4EEB A;  2P9B A;  3CX6 B;  5IYU A;  2KXP B;  4RL9 A;  4IDZ A;  1LVK A;  4YJ3 E;  2KND A;  1D0X A;  3EVY A;  5DJQ C;  3QRA A;  4DV0 T;  4H63 H;  2EHO D;  1UGO A;  1MM4 A;  3VZW X;  2XQ5 A;  3B13 A;  1Z8U A;  2R88 A;  2UUB T;  4YT0 A;  3C4Z A;  2X9Y A;  3HKD E;  3ZEF B;  3VZU X;  4DVD A;  2D0T A;  2XM2 A;  3ZMT B;  5KMG P;  2CWY A;  3WI3 A;  4TNV A;  2Y0K A;  5L4E A;  2VAS A;  1NAF A;  2XAH B;  5JDN A;  2WJQ A;  2LRL A;  2LM2 A;  2VKJ A;  2X9W A;  2KWH A;  4IHJ E;  1W09 A;  2NW8 A;  5JR9 A;  2JQQ A;  3EAM A;  2LKG A;  5G39 A;  4YXD A;  1MIY A;  4IDN A;  3AE6 A;  3C51 A;  4J2C A;  5LHG B;  3UU5 A;  5ABF B;  4UEL A;  1GQE A;  4EED A;  3FXE B;  2WDV A;  1T16 A;  3AB3 B;  2L8K A;  2F1C X;  2WMN A;  2V5D A;  2ZLY A;  5D5D A;  5AQK B;  4U74 A;  2BDE A;  1ORM A;  4AKR B;  4JI2 T;  2C5I T;  4O4X A;  3LBX A;  3OBV E;  5IHY A;  4O4U A;  4UIG A;  3EHZ A;  2VL0 A;  1N32 T;  2JMM A;  1BR0 A;  3RYC E;  5PRN A;  4YHH T;  4G2A A;  2WY2 A;  3K19 A;  2LHR A;  2DCF A;  2XMX A;  2HPJ A;  1HR0 T;  3PGU A;  4N59 A;  3VHL A;  4AQF C;  4OHF A;  3T0S A;  5L3F B;  5FXZ A;  2CE7 A;  3C50 A;  4JI4 T;  3AA0 B;  3SZV A;  3EDV A;  3TLW A;  1PHO A;  2WJR A;  1E54 A;  4IST A;  3HKB E;  3HI2 A;  4P09 A;  4TZ4 C;  3A0H O;  1HG2 A;  3AEG A;  2A9U A;  3LK4 2;  4OX9 T;  2K24 A;  2KMF A;  2YEV C;  1HG5 A;  3SRZ A;  4TWH A;  3PUS A;  1J5E T;  2X0L B;  3BQL A;  3ETV A;  2Y0L A;  4XBF B;  1VRB A;  3HW9 A;  1Y64 B;  4QH5 A;  5T5F A;  4PK5 A;  2IML A;  4OK0 A;  2BZB A;  3PUA A;  3QK6 A;  3TLT A;  3GN5 A;  1LRZ A;  5JDL A;  4JI5 T;  2XQ6 A;  3CWZ B;  4D65 A;  2ZFG A;  3AA1 B;  3PDY A;  2MHL A;  3ZPO A;  3I9Y A;  4OFZ A;  1ZHT A;  2H89 A;  2Y7S A;  4GCP A;  4IDP A;  5LA6 E;  2QTK A;  4EZ4 A;  2HN2 A;  5JQG E;  3ZYK A;  2ODV A;  4CQI A;  4ASK A;  3K3N A;  5GV0 A;  3R84 B;  1QJ9 A;  1Z0P A;  1OWA A;  3DJB A;  1R8I A;  5JDQ A;  2WZH A;  1GFQ A;  1XMQ T;  2JIW A;  4PR7 A;  3FBL A;  3UU4 A;  1MMG A;  2CBJ A;  5GTH O;  3LK2 A;  2CMR A;  2XUE A;  2ACX A;  2CLY B;  3OTO T;  4NXN T;  4AYE C;  5FNV E;  3P50 A;  2E8I A;  2LE8 A;  3K3Q C;  4CN6 A;  4XZC A;  5LYJ E;  1ZHC A;  3UFE A;  2IWV A;  4RLB A;  4X1I E;  1SE7 A;  2CWO A;  3HA4 A;  1NWM X;  5AQG B;  4HFD A;  4IE4 A;  1YKH B;  2FJA A;  3MA9 A;  2BKO A;  2UU9 T;  5CGM A;  3VR9 A;  1BT9 A;  2V6Y B;  4QHO A;  1IBM T;  5JRC A;  3CKD A;  2WB5 A;  5ADX K;  5FP3 A;  1T72 A;  4MLK A;  3K8P C;  2BG9 E;  2MBG A;  3AEF A;  4GK0 E;  3Q9D A;  4CN1 A;  1MIV A;  2ZM8 A;  2ERV A;  2MTQ A;  3Q5X A;  2VUR A;  5ABG A;  1UCU A;  1HCI A;  1OED E;  1V9D A;  2V6X A;  2CM0 A;  1IBK T;  4JV5 T;  2IIU A;  2UXC T;  2X0Y A;  2NW9 A;  3KV6 A;  3RF1 A;  3AE3 A;  2JMK A;  5C3J A;  2J1N A;  4BJM A;  5AQR B;  2CCQ A;  3LK3 A;  3IEE A;  5AQP B;  1MIW A;  2XQA A;  3RIA A;  2LEH A;  3FZK B;  3ZT5 A;  1YD8 G;  1WRD A;  2K9A A;  5EZY E;  2LSJ A;  2IWW A;  3KDS E;  4FZM A;  1LKX A;  3UUM A;  1DU2 A;  2KZ7 B;  2F4V T;  3PUZ F;  1VOM A;  2G0U A;  2LFU A;  2JPF A;  4HWI B;  1T1L A;  3SS1 A;  4PW8 A;  4H9O C;  3ESL A;  2KLQ A;  3AED A;  5HCJ A;  3V5S A;  4AYM C;  5FL0 A;  5FVL A;  4E7S A;  1HNX T;  3KBT A;  3ZLI A;  3AAA A;  4H9P C;  3UUN A;  4KR8 A;  4O4I E;  4K3C A;  4AUI A;  2LKH A;  4H63 V;  3PQU A;  3AEC A;  4IRE A;  2XQ4 A;  5AQI B;  3RGL A;  4YLH A;  1WCR A;  1VCS A;  4IL9 A;  5JRE A;  2UXB T;  5M4Y A;  3TLS A;  2ACZ A;  3IHR A;  2Z6E A;  2ODU A;  5JDH A;  2BS4 A;  5HXR A;  3SZD A;  5JTG A;  4DV6 T;  2JRK A;  2CHO A;  3DA4 A;  2LOS A;  3AA6 A;  2BS2 A;  3NZQ A;  3QRC A;  2J62 A;  4FSO A;  5LCY A;  5LJN A;  4DR5 T;  5LHI B;  4EAH A;  2X68 A;  2VKH A;  5G3A A;  3UU3 A;  4UVC B;  4I0U A;  4GK5 E;  3ZCI A;  3AA7 B;  5JDM A;  2K4T A;  1HXU A;  2XE1 A;  5LBM A;  3JTY A;  4U2Y A;  4B3M T;  3SFD A;  2WDR A;  1XNQ T;  1ZKE A;  2WWV A;  3AE8 A;  2GE4 A;  2WQY A;  3AAE B;  3JAE A;  1NEN A;  2W66 A;  1HNW T;  3WI5 A;  4IE7 A;  5HXC A;  5AQV B;  4HKA A;  4HFV A;  2A2F X;  3UUL A;  1IZN B;  2W80 C;  3N2O A;  4E1S A;  2CLY C;  1X79 A;  5A1L A;  2HH7 A;  3KV4 A;  4AQF A;  3FYX A;  4I55 E;  5LMN T;  3X1D A;  2WZI A;  3KVD D;  2KWI B;  4UV8 B;  4U31 A;  1S5L O;  1YKE B;  3G06 A;  5EK3 A;  3HOL A;  3FZM B;  4OYJ A;  4C90 A;  2WAU A;  5JDG A;  3O9X A;  2Y0H A;  1FEW A;  2LM9 A;  3ZCJ A;  4ZI2 D;  3UFG A;  2N2N A;  4BAY B;  5LP6 E;  2N9D A;  1N34 T;  2XTR A;  3H37 A;  1H6S 1;  2W81 C;  4U7I A;  4KR4 A;  5L3E B;  2XAS B;  4X62 T;  2XPK A;  2IW5 B;  4LF4 T;  4CXX A;  4DBR A;  4AQG A;  1M62 A;  2PRN A;  4K3B A;  3J9X 1;  3MK7 C;  3F31 A;  2W62 A;  4N75 A;  1HXX A;  4AIS A;  1PRN A;  3CML A;  3RC3 A;  1WLX A;  3P8C D;  2VVS A;  3UU6 A;  3QB5 K;  4X5T A;  2W0G A;  4KX6 A;  4TV9 E;  2LHN A;  4ILB A;  3KIN B;  2OV9 A;  1J1J A;  1UK5 A;  3A5X A;  4Z8X A;  2KXP A;  3EUH A;  4XNL A;  3LDQ B;  3Q2M A;  1OSM A;  3UTK A;  1L0V A;  3LK4 1;  2MOZ A;  2YDR A;  3NRX A;  5AQS B;  1QSD A;  4HE8 A;  4ZS3 A;  4ADZ A;  3AEB A;  5AQH B;  3KZI O;  5HXS A;  1HXT A;  2FGQ X;  1UUS A;  4DV7 T;  3VY9 X;  3HL6 A;  2M6I A;  3F2E A;  3ZJ1 A;  5J2T E;  2Q9Q B;  2K0L A;  2H3R A;  2W4X A;  3DZM A;  2YPV A;  4PNI A;  2N1G A;  4FJO A;  3NRY A;  1XZY A;  4O2A E;  5ABE A;  1HTJ F;  3RX6 A;  3HWB A;  3ZC1 A;  5FMN A;  2CA5 A; 
#chains in the Genus database with same CATH homology
 2D5U A;  3I9Y A;  3QC9 A;  4RJX A;  1UX4 A;  3LK3 B;  2O4V A;  4OFZ A;  1ZHT A;  3UAQ A;  4FT6 A;  2Y7S A;  3AAI A;  2L9Q A;  2V7J A;  3GWH A;  4GCP A;  2POR A;  4JUY A;  5LA6 E;  2QTK A;  2XAQ B;  5CA0 E;  4EZ4 A;  4G75 A;  4AI6 A;  5JQG E;  6PRN A;  3ZYK A;  2ODV A;  5EE2 A;  2I59 A;  4FES A;  1D0Y A;  1U4Q A;  2IAK A;  4CQI A;  4ASK A;  3K3N A;  4BA9 A;  5JVD E;  3FHN A;  4QXH B;  2E9X B;  1O3X A;  5GV0 A;  3MZK B;  3R84 B;  4ZI7 E;  1QJ9 A;  2ODJ A;  2YNK A;  1Z0P A;  2HPL A;  1OWA A;  3DJB A;  2LT3 A;  5TAO A;  2B1E A;  1ZHW A;  5JDQ A;  3ZC0 A;  3I0Q A;  5H6R B;  1GFQ A;  1BR2 A;  1QUU A;  3FBL A;  1G73 A;  3CVR A;  1MMG A;  3K3O A;  3UT5 E;  3C4X A;  3Q5W A;  5H6Q B;  3DA3 A;  3N2K E;  3LK2 A;  4AKR A;  2CMR A;  5EK4 A;  5BMV E;  3SYS A;  2XQY A;  3ZPO A;  4I50 E;  4O4H E;  4EB6 E;  4PK4 A;  8PRN A;  4ILU A;  4FZN A;  2XUE A;  2UXX B;  4Z3T A;  2ACX A;  2CLY B;  1IJ5 A;  4FRX A;  4AYE C;  4PJJ A;  4XZC A;  2E8I A;  2LE8 A;  2WWU A;  3K3Q C;  3N5L A;  4KMC A;  5FNV E;  4CI2 B;  5LYJ E;  4EYU A;  4P0A A;  2QGS A;  4LSE A;  4H9R C;  1ZHC A;  4UXN B;  3UFE A;  3ZMS B;  4RLB A;  4MBQ A;  4X1I E;  3FXD B;  4KP3 C;  1IAP A;  4JEU B;  5FXW A;  2W61 A;  1AJ3 A;  1Q9F A;  3C5O A;  4I43 B;  3HKE E;  4CXW A;  2CWO A;  3HOE A;  4LSI A;  3HA4 A;  4FOZ A;  3DP7 A;  3KVA A;  4JLE A;  2KIN B;  1MND A;  5FVN A;  1NWM X;  2X27 X;  3O1H A;  4X1K E;  1KK7 A;  4UVA B;  4TUY E;  4V1A v;  3U78 A;  4GIW A;  3HR0 A;  4IE4 A;  4WBO A;  3L09 A;  1YKH B;  3ZYM A;  3MA9 A;  1LVF A;  3AA0 A;  3BQK A;  3ANW B;  3JC6 D;  2NP9 A;  2ZMA A;  1BT9 A;  4QQ1 A;  5CA1 E;  3N9N A;  4AXP A;  4BJN A;  4ZOL E;  3CPZ A;  3T8O A;  4QHO A;  3I9W A;  4M1P A;  4PJL A;  2VKO A;  5HXH A;  4OYK A;  3CKD A;  5JRC A;  3PUG A;  2DWK A;  5ADX K;  5FP3 A;  3MXZ A;  1WYC A;  2N2M A;  2XTQ A;  1WYB A;  4MLK A;  5FXV A;  4I4T E;  3K8P C;  4E7Z A;  2WBL A;  2EHO B;  3PU8 A;  3NBX X;  3SY7 A;  3RRW A;  5DQW A;  5E0O A;  2MBG A;  4GK0 E;  2JMH A;  3LG7 A;  4O3W A;  3Q9D A;  2MYS A;  1S35 A;  2LJL A;  3IBP A;  1MIV A;  4CZZ B;  2M07 A;  2DNX A;  4AKG A;  3E0Z A;  3N9Q A;  4G76 A;  2UXN B;  2ZM8 A;  4O3Y A;  2ERV A;  3SY9 A;  3T24 A;  3M65 A;  4FI5 A;  5G26 A;  3O1J A;  2MTQ A;  3Q5X A;  4X1Y E;  1UCU A;  2JJ9 A;  3PU3 A;  3CX7 B;  1HCI A;  2XTL A;  1ZEE A;  3O1I A;  2CEA A;  5AFU L;  2M06 A;  3MKD A;  2Q9Q A;  3SYB A;  2X67 A;  4CXY A;  1E1H B;  2LSY A;  2X9X A;  1V9D A;  1YW0 A;  2CM0 A;  3OYZ A;  2NW9 A;  4PUX A;  1ZHZ A;  1BH3 A;  2KT9 A;  2XE5 A;  5KDM C;  4IE6 A;  4F4B A;  3KV6 A;  3EMN X;  4JFB A;  1FMV A;  4GCQ A;  3G7G A;  2C0S A;  3RC8 A;  4ANJ A;  2Y2X A;  1ZHX A;  3POQ A;  2CXL A;  5HWX A;  4JCH A;  3CQG B;  4TV8 E;  2PJQ A;  2JMK A;  2J1N A;  4C91 A;  3VZT X;  4QXB B;  4BJM A;  3AA1 A;  2NW7 A;  2ZLD A;  4RJW A;  4YFS A;  2CCQ A;  5ADX L;  2ZM0 A;  4HGA A;  3WAJ A;  3ZN0 B;  3RRC A;  3LK3 A;  4GHB A;  3IEE A;  2Q9Q D;  3SOL A;  3ZJ2 A;  1MIW A;  4AKH A;  2YIN A;  2XG6 A;  3JC6 C;  4D5U A;  2CXD A;  2C5K T;  4PFO A;  1B7T A;  2LEH A;  5CB4 E;  3RPU A;  2GK9 A;  2N2L A;  3MAC A;  1YD8 G;  3A2S X;  5JDP A;  2NTX A;  1WRD A;  2A3D A;  2K9A A;  5EZY E;  2MHL A;  4PAG A;  4QXC B;  2LSJ A;  3U3I A;  2ES0 A;  2XAG B;  3BK9 A;  2VWA A;  3I1A A;  3CQX C;  2YK0 A;  2E9X A;  3KDS E;  1T98 A;  3FB2 A;  4FZM A;  1LKX A;  3PE0 A;  3UUM A;  2KZ7 B;  2V1D B;  4KRA A;  5JR9 B;  1MNE A;  1VOM A;  2D0U A;  2G0U A;  3T20 A;  5L2L A;  4LSH A;  2D2S A;  4B6X A;  2JPF A;  2LFU A;  3H3A A;  5GON E;  3QUJ A;  5DQV A;  2Y6X A;  4EOZ B;  5LHH B;  4FSP A;  1FMW A;  4CI1 B;  5DL6 A;  4IGU A;  4WW0 A;  2OMF A;  1D0Z A;  4JEH B;  3SS1 A;  4P0B A;  3P7I A;  2Y48 B;  4H9O C;  3ESL A;  4PW8 A;  2KLQ A;  3B57 A;  4D64 A;  5FYM A;  3WAK A;  3N9L A;  4YHJ A;  3V5S A;  3ZN1 B;  4AYM C;  1BXW A;  3N2G E;  4DO0 A;  5JH7 E;  3PRN A;  5J1G A;  4H9S E;  4E7S A;  2LSK A;  3KBT A;  3ZLI A;  4ZHQ E;  1G90 A;  2XAF B;  4ERR A;  1SA0 E;  3AAA A;  3HKC E;  1G8X A;  2IC6 A;  1HFA A;  2XE3 A;  4H9P C;  3UUN A;  4NUU A;  4KR8 A;  3SWH A;  4O4I E;  3R6N A;  2BVL A;  4WBN E;  3RH3 A;  4RLC A;  4MFR A;  3NZP A;  1D1B A;  3N9P A;  3V5U A;  2PBI A;  4AYI D;  5HAX A;  4AUI A;  5DAB A;  4HN9 A;  2DLR A;  4H63 V;  2QA7 A;  2LSG A;  2CXF A;  4O3Z A;  1S94 A;  3PQU A;  3KV9 A;  4FUV A;  4K0U A;  2VL8 A;  3IF8 B;  3S4U A;  4CI3 B;  4DMV A;  2MNH A;  4YLH A;  2H7V C;  3J7Y q;  3POU A;  5LJM A;  4GF4 A;  1QJP A;  2M67 A;  2Q9Q C;  5JRE A;  2L3L A;  4U72 A;  2NOX A;  3OKQ A;  3ANW A;  5LGN B;  5M4Y A;  5FY7 A;  3PQS A;  4O49 A;  3LBX B;  3IHR A;  3RBH A;  2Z6E A;  2ODU A;  2RA1 A;  5JDH A;  3ONX A;  4BUM X;  5HXR A;  1ZV4 X;  3SZD A;  4H9Q C;  3LFM A;  1OXZ A;  2EHO A;  2JRK A;  4ZI3 C;  4A56 A;  4XNK A;  4PK6 A;  3DA4 A;  4E1T A;  2LOS A;  1QJ8 A;  4DBQ A;  3N9O A;  3AA6 A;  4X20 E;  3NZQ A;  3QRC A;  4ZS2 A;  4PJM A;  3ETU A;  4FSO A;  3VE2 A;  5LCY A;  5LJN A;  3KVB A;  3OJA A;  5LHI B;  2P9B A;  4ZI2 C;  3AVS A;  4LSF A;  4AZL A;  4EAH A;  2X68 A;  7PRN A;  5DL7 A;  2VKH A;  2Y8D A;  4AFK A;  1D1C A;  3CX6 B;  3D0T A;  4UVC B;  3ZMV B;  5IYU A;  2KXP B;  4KUM B;  4RL9 A;  4GK5 E;  4IDZ A;  1LVK A;  4YJ3 E;  2KND A;  4L9I A;  3ZCI A;  1D0X A;  3AA7 B;  5JDM A;  1Q9G A;  3EVY A;  5DJQ C;  4O2B E;  4EYY R;  2E9X C;  3QRA A;  2K4T A;  4UF0 B;  1HXU A;  4O3X B;  4H63 H;  1SHZ C;  2EHO D;  2XE1 A;  1MM4 A;  5LBM A;  3BQI A;  1IJ6 A;  1HF8 A;  5HWY A;  2XAJ B;  3JTY A;  3B13 A;  3V8U A;  3VZW X;  3KBU A;  2NTY A;  2LOP A;  2V26 A;  3ZMZ B;  3FBZ A;  1ZKE A;  3W15 B;  3C4Z A;  5LG4 A;  1HS7 A;  4QKN A;  2GE4 A;  3LJC A;  4L5G A;  2H7O A;  2IC9 A;  3AAE B;  3UU2 A;  3UPG A;  3L3P A;  2X9Y A;  1MMA A;  2X51 A;  2DWG A;  3HKD E;  3ZEF B;  3VZU X;  4DVD A;  3WI5 A;  2D0T A;  4IE7 A;  5HXC A;  4HKA A;  4HFV A;  3ZMT B;  2A2F X;  2YU2 A;  3UUL A;  1IZN B;  4UV9 B;  1FIO A;  5KMG P;  3N2O A;  2CWY A;  2W80 C;  3WI3 A;  4E1S A;  5L3C B;  2CLY C;  2Y0K A;  1X79 A;  5A1L A;  1GFM A;  2HH7 A;  3KV4 A;  4FRT A;  4AQF A;  2VAS A;  2VKD A;  1NAF A;  3FYX A;  2XAH B;  4MHC A;  5JDN A;  4I55 E;  2W00 A;  5F8P A;  2VKJ A;  3KVD D;  2KWI B;  4UV8 B;  2F1V A;  2V7M A;  2X9W A;  3VU7 H;  1GFO A;  2KWH A;  4IHJ E;  2KDY A;  1YKE B;  2YU1 A;  3GN5 B;  3TKL B;  3AVR A;  2KZ7 A;  5EK3 A;  5JDF A;  2NW8 A;  3HOL A;  2VK9 A;  5JR9 A;  4OYJ A;  3ZYL A;  2JQQ A;  4C90 A;  4ZI3 D;  4H9N C;  1THQ A;  2WAU A;  4AYN A;  2OA5 A;  5L3G B;  5FY0 A;  5JDG A;  1EZ3 A;  3O9X A;  2WSS V;  4U9C A;  2Y0H A;  2LSI A;  1FEW A;  3CX8 B;  4O4J E;  3EDU A;  1H7C A;  2LHF A;  4AKM A;  2LM9 A;  3C98 B;  4HTE A;  1MIY A;  2V7I A;  3ZCJ A;  4ZI2 D;  2N2N A;  3C51 A;  4J2C A;  5LHG B;  4BAY B;  5LP6 E;  3RKO A;  2N9D A;  4IIJ E;  4N78 D;  4UEL A;  2XTR A;  3VKH A;  3VKG A;  4PJN A;  3VE1 A;  2RP4 A;  4F6R C;  2EHO C;  5LGU B;  2VB6 A;  3POX A;  2E9X D;  4FZL A;  3OYX A;  3FXE B;  3H37 A;  1MM5 A;  4UEM A;  1H6S 1;  2W81 C;  3AB3 B;  3GMI A;  2L8K A;  5L3E B;  4KR4 A;  2C5J A;  1MMD A;  3VY8 X;  2WMN A;  2ZLY A;  2J4U P;  1YS5 A;  2XAS B;  5HYA A;  3E08 A;  2IW5 B;  5D5D A;  3DTO A;  4CXX A;  4DBR A;  2W63 A;  3TZG A;  4AQG A;  2XHE B;  2PRN A;  4U74 A;  2BDE A;  2PG8 A;  3POR A;  1OPF A;  3J9X 1;  3O0E A;  5LGT B;  2J1D G;  1ORM A;  3MK7 C;  3F31 A;  3GP6 A;  2W62 A;  3LK2 B;  2NWB A;  4AKR B;  1HXX A;  1PRN A;  3CQC B;  3CML A;  3RC3 A;  5J2U E;  2C5I T;  3MJX A;  4DND A;  1WLX A;  4O4X A;  2V7K A;  3LBX A;  3AAA B;  3OBV E;  5IHY A;  4YJ2 E;  4O4U A;  4UIG A;  3P8C D;  2DI4 A;  4MAL A;  4EXT A;  1P4T A;  1BR1 A;  2JMM A;  3F57 A;  1BR0 A;  2W0G A;  3RYC E;  2ZM2 A;  5PRN A;  3GA8 A;  4G2A A;  2WMO A;  4TV9 E;  1U5P A;  4G63 A;  3N9M A;  2K5B B;  3PUQ A;  4TX5 A;  3K19 A;  2LHR A;  2DCF A;  2LHN A;  5EK2 A;  2XMX A;  2HPJ A;  3KIN B;  4HEA A;  2DHR A;  5IYZ E;  4N59 A;  3VHL A;  4QX7 B;  4AQF C;  5FXX A;  3ZMU B;  3KV5 A;  4GYR A;  3A5X A;  4OHF A;  3T0S A;  4Z8X A;  2WM9 A;  3E22 E;  2CE7 A;  3C50 A;  5FXZ A;  3C4W A;  5L3F B;  1GFP A;  2KXP A;  2KC0 A;  3HWB A;  1D1A A;  3WI4 A;  3AA0 B;  3EUH A;  3SZV A;  3EDV A;  4IE0 A;  1PHO A;  3AA7 A;  4XNL A;  1WR6 A;  4EIW A;  3NSG A;  4UF0 A;  3Q2M A;  1E54 A;  5L3B B;  4C69 X;  1OSM A;  4IST A;  3HKB E;  4TN7 B;  3UTK A;  5JR9 C;  5JRC B;  2SPC A;  2V7L A;  4B61 A;  3HI2 A;  4P09 A;  4TZ4 C;  1MPF A;  4GYS A;  3LK4 1;  2MOZ A;  3NRX A;  4L0R A;  1HG2 A;  5DL5 A;  1US7 B;  4NUV A;  3AA6 B;  3LK4 2;  3AAE A;  3PTR B;  2K24 A;  4QX8 B;  3RYI E;  4EZH A;  1QSD A;  2KMF A;  1GFN A;  4HE8 A;  2YEV C;  1CUN A;  1UX5 A;  2BVM A;  4ZS3 A;  4ADZ A;  5HXE A;  4AKI A;  1HG5 A;  2FGR A;  3SRZ A;  5HXS A;  1HXT A;  2FGQ X;  3PUS A;  4XAX B;  4GCS A;  1IZN A;  2X66 A;  2X0L B;  4AYD C;  3BQL A;  2XE2 A;  3VY9 X;  3ETV A;  3HL6 A;  4ISS A;  4AKL A;  2Y0L A;  3F2E A;  4GOU A;  4DMW A;  4XBF B;  4O4L E;  5FY1 A;  1VRB A;  3I0O A;  3ZJ1 A;  2X9H A;  3HW9 A;  4FMS A;  4KBM B;  5J2T E;  1Y64 B;  2A72 A;  5F3J A;  1BR4 A;  2Q9Q B;  4IE5 A;  1ZHY A;  4PK5 A;  2H3R A;  5ETW A;  2K0L A;  3KFW X;  5T5F A;  5AFU K;  4PFP A;  5LOV E;  4OK0 A;  4QWN B;  3UUX B;  2BZB A;  3PUA A;  3QK6 A;  3C64 A;  4PNI A;  1KNZ A;  2YPV A;  5DL8 A;  2N1G A;  3O4X E;  3GN5 A;  4FJO A;  1LRZ A;  3NRY A;  5JDL A;  5L3D B;  1MMN A;  2F1T A;  4UVB B;  5C8Y E;  4WNK A;  4N58 A;  4O2A E;  1HX8 A;  2PFV A;  3PUR A;  5LNK A;  3CWZ B;  3RYH E;  4D65 A;  5LXT E;  2K48 A;  1HTJ F;  5LBQ B;  3RX6 A;  3RYF E;  3AA1 B;  2ZFG A;  3PDY A;  3ZC1 A;  5FMN A;  5KX5 E;  4O8S A;  2CA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...