3T20A

Crystal structure of pseudomonas aeruginosa occk5 (opdh)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
391
structure length
362
Chain Sequence
b'AGFLEDSKASLETRNFYMNRDFRKREEWAQGFILNLQSGYTQGTVGFGLDAMGMLGVKLDSPDTYSKLGLTAKVKVSQSELKVGTLIPKLPSVQPNNGRIFPQIFEGALLTSKEIKDLGFTAGRLEKTKIDSEDLALNDKNGRFAGVSADHFDLGGLDYKLTDQLTASYHYSNLQDVYRQHFVGLLHSWPIGPGELTSDLRFARSTDSGSAKAGGIDNKSLNGMFTYSLGNHAFGAAWQRMNGDDAFPYLEGSNPYLVNFVQVNDFAGPKERSWQLRYDYDFVGLGIPGLTFMTRYVKGDNVELAGQGEGREWERNTELQYVFQSGALKNLGIRWRNATFRSNFTRDIDENRLIVSYTLPIW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cis-aconitate porin OpdH
publication title Substrate Specificity within a Family of Outer Membrane Carboxylate Channels.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
total genus 95
structure length 362
sequence length 391
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3t20A01
3A2SX 3UU2A 4LSIA 4LSHA 1OSMA 3UPGA 5JDPA 3VZTX 4GCSA 4FT6A 3HWBA 2Y0HA 4C69X 3PORA 5DL7A 1OPFA 2J1NA 1BT9A 4RJWA 3K19A 3SY9A 2PORA 7PRNA 1HXUA 4FSPA 3SYBA 1PHOA 2ZLDA 3SZDA 5PRNA 4LSFA 3SZVA 3T0SA 3POXA 3T24A 4GCPA 2Y2XA 2XE2A 1GFPA 1GFNA 3VY9X 2FGQX 3JTYA 5DL6A 3WI4A 4KRAA 5FVNA 3VZWX 4BUMX 4FMSA 4FOZA 2XE3A 2Y0KA 4FRTA 2O4VA 2ODJA 2QTKA 3POUA 3SY7A 2XG6A 1GFOA 2XE1A 1GFMA 3EMNX 3T20A 1GFQA 1HXXA 3HW9A 8PRNA 2K4TA 4LSEA 2XE5A 5DL8A 1BH3A 2FGRA 1E54A 3POQA 4FSOA 4FRXA 3FYXA 3NSGA 3VY8X 2J4UP 1MPFA 4GCQA 4KR8A 3WI5A 3O0EA 4KR4A 1PRNA 4D5UA 4RJXA 4AUIA 2Y0LA 1HXTA 3PRNA 3SYSA 4JFBA 1H6S1 3VZUX 5DL5A 2ZFGA 4D64A 4D65A 2PRNA 2OMFA 6PRNA
chains in the Genus database with same CATH superfamily
4AZLA 4E1TA 3AAEA 3A2SX 5B5EO 3UU2A 4LSIA 3QRAA 4LSHA 4XNLA 4FZNA 3GP6A 4GF4A 1OSMA 2R4OA 4G75A 1Q9FA 2R88A 3UPGA 5JDPA 3VZTX 2M07A 2XMXA 5T5FA 2IWWA 3AA7B 1ZHWA 2KXPB 5AFUL 4GCSA 3BRYA 4G76A 2IWVA 1T1LA 4FT6A 5ADXL 2XTRA 3UAQA 3HWBA 2Y0HA 4O3YA 3AA7A 4C69X 3A0HO 1IZNB 2KXPA 3PORA 1OPFA 5DL7A 2J1NA 2JMMA 1QJ9A 4PR7A 4AYEC 1BT9A 4RJWA 3K19A 3SY9A 4C4VA 2WVPA 2JQYA 1S5LO 1IZNA 2PORA 7PRNA 1HXUA 4FSPA 3SYBA 1PHOA 2ZLDA 4O4XA 3C5OA 4PJ0O 4B61A 3SZDA 5PRNA 4F4BA 4LSFA 1ZHZA 2MNHA 3SZVA 3T0SA 3POXA 3T24A 4GCPA 3LK41 2Y2XA 2XE2A 4C4VB 2K0LA 2KZ7B 3DZMA 4N59A 4U9CA 1GFPA 1GFNA 5G38A 3NJTA 4O3XB 2Y7SA 2N2LA 5G39A 3VY9X 2FGQX 3JTYA 2WJRA 4FUVA 2KZ7A 3PGUA 3JCUO 5DL6A 5E79O 4K3BA 4KRAA 3WI4A 5FVNA 3VZWX 3HOEA 4BUMX 2F1VA 4FMSA 4FOZA 2F1CX 4AYNA 2XE3A 2Y0KA 4FESA 2R8AA 3DWNA 3PGSA 4FRTA 1ORMA 3LK2B 3KZIO 5TISO 1G90A 3AA6B 5IYUA 2W81C 1T16A 4UB6O 2O4VA 4JCHA 2MHLA 1YS5A 2LFUA 2ODJA 3BS0A 4AYDC 4AYID 2QTKA 3POUA 3SY7A 2GE4A 3LK2A 4FZLA 4O4UA 5GTIO 2N2MA 3AA6A 2XG6A 3LK42 3PQSA 1GFOA 2LHFA 2W80C 3BRZA 2ERVA 5GV0A 2WJQA 2XE1A 1GFMA 5G3AA 5KAFO 4O3WA 3EMNX 2YNKA 3PQUA 3VE1A 2R4NA 2KDYA 4K3CA 3DA4A 1GFQA 1HXXA 3HW9A 8PRNA 3T20A 2K4TA 3A0BO 4C00A 1P4TA 4LSEA 2XE5A 3KVDD 4GHBA 4XNKA 3WU2O 5DL8A 1BH3A 3V8UA 3AA0A 2FGRA 1E54A 3POQA 5B66O 2R89A 3RBHA 4AKMA 4FSOA 4FRXA 3AAAB 2X9KA 3FYXA 3NSGA 3VY8X 2J4UP 1MPFA 4GCQA 3QRCA 2XTQA 3O0EA 4KR8A 3WI5A 4FZMA 4KR4A 3G7GA 1PRNA 4D5UA 4RJXA 4AUIA 3LK3A 3VE2A 3AAAA 5KAIO 2Y0LA 3DWOX 1ZHTA 4N75A 4O3ZA 5G26A 1ZHXA 2M06A 1HXTA 3PRNA 3PF1A 5D5DA 3PGRA 3TZGA 1Q9GA 1BXWA 3SYSA 2X27X 4RLBA 4N58A 4JFBA 3AA0B 1THQA 5EE2A 1MM5A 4N74A 4Z3TA 3AA1B 5AFUK 4PUXA 1H6S1 1ZHYA 2YPVA 3DA3A 4FQEA 4RLCA 4CTDA 1QJPA 1QJ8A 2R4LA 4AKRB 5ADXK 4UB8O 3VZUX 4AFKA 5DL5A 2R4PA 2ZFGA 3HOLA 3AA1A 3AAEB 4D64A 4QQ1A 4O49A 3LK3B 2KC0A 4IL6O 5GTHO 4AYMC 4D65A 2F1TA 1MM4A 2PRNA 2AXTO 2OMFA 4RL9A 4AKRA 6PRNA 5H2FO 4E1SA
chains in the Genus database with same CATH topology
4AZLA 4E1TA 3AAEA 3A2SX 3UU2A 4LSIA 3QRAA 4LSHA 4XNLA 4FZNA 3GP6A 4GF4A 1OSMA 4G75A 1Q9FA 3UPGA 5JDPA 3VZTX 2M07A 2XMXA 5T5FA 3AA7B 1ZHWA 2KXPB 5AFUL 4GCSA 4G76A 4FT6A 5ADXL 2XTRA 3UAQA 3HWBA 2Y0HA 4O3YA 3AA7A 4C69X 1IZNB 2KXPA 3PORA 1OPFA 5DL7A 2J1NA 2JMMA 1QJ9A 4AYEC 1BT9A 4RJWA 3K19A 3SY9A 1IZNA 2PORA 7PRNA 1HXUA 4FSPA 3SYBA 1PHOA 2ZLDA 4O4XA 3C5OA 4B61A 3SZDA 5PRNA 4F4BA 4LSFA 1ZHZA 2MNHA 3SZVA 3T0SA 3POXA 3T24A 4GCPA 3LK41 2Y2XA 2XE2A 2K0LA 2KZ7B 4N59A 4U9CA 1GFPA 1GFNA 4O3XB 2Y7SA 2N2LA 3VY9X 2FGQX 3JTYA 4FUVA 5DL6A 2KZ7A 3WI4A 4KRAA 5FVNA 3VZWX 3HOEA 4BUMX 2F1VA 4FMSA 4FOZA 4AYNA 2XE3A 2Y0KA 4FESA 4FRTA 1ORMA 3LK2B 1G90A 3AA6B 5IYUA 2W81C 2O4VA 4JCHA 2MHLA 1YS5A 2LFUA 2ODJA 4AYDC 4AYID 2QTKA 3POUA 3SY7A 2GE4A 3LK2A 4FZLA 4O4UA 2N2MA 3AA6A 2XG6A 3LK42 3PQSA 1GFOA 2LHFA 2W80C 2ERVA 5GV0A 2XE1A 1GFMA 4O3WA 3EMNX 2YNKA 3PQUA 3VE1A 2KDYA 3DA4A 1GFQA 1HXXA 3HW9A 8PRNA 3T20A 2K4TA 1P4TA 4LSEA 2XE5A 3KVDD 4GHBA 4XNKA 5DL8A 1BH3A 3V8UA 3AA0A 2FGRA 1E54A 3POQA 3RBHA 4AKMA 4FSOA 4FRXA 3AAAB 3FYXA 3NSGA 3VY8X 2J4UP 1MPFA 4GCQA 3QRCA 2XTQA 3O0EA 4KR8A 3WI5A 4FZMA 4KR4A 3G7GA 1PRNA 4D5UA 4RJXA 4AUIA 3LK3A 3VE2A 3AAAA 2Y0LA 1ZHTA 4O3ZA 5G26A 1ZHXA 2M06A 1HXTA 3PRNA 5D5DA 3TZGA 1Q9GA 1BXWA 3SYSA 2X27X 4RLBA 4N58A 4JFBA 3AA0B 1THQA 5EE2A 1MM5A 4Z3TA 3AA1B 5AFUK 4PUXA 1H6S1 1ZHYA 2YPVA 3DA3A 4RLCA 1QJPA 1QJ8A 4AKRB 5ADXK 3VZUX 4AFKA 5DL5A 2ZFGA 3HOLA 3AA1A 3AAEB 4D64A 4QQ1A 4O49A 3LK3B 2KC0A 4AYMC 4D65A 2F1TA 1MM4A 2PRNA 2OMFA 4RL9A 6PRNA 4AKRA 4E1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A2S X;  3UU2 A;  4LSI A;  4LSH A;  1OSM A;  3UPG A;  5JDP A;  3VZT X;  4GCS A;  4FT6 A;  3HWB A;  2Y0H A;  4C69 X;  3POR A;  5DL7 A;  1OPF A;  2J1N A;  1BT9 A;  4RJW A;  3K19 A;  3SY9 A;  2POR A;  7PRN A;  1HXU A;  4FSP A;  3SYB A;  1PHO A;  2ZLD A;  3SZD A;  5PRN A;  4LSF A;  3SZV A;  3T0S A;  3POX A;  3T24 A;  4GCP A;  2Y2X A;  2XE2 A;  1GFP A;  1GFN A;  3VY9 X;  2FGQ X;  3JTY A;  5DL6 A;  3WI4 A;  4KRA A;  5FVN A;  3VZW X;  4BUM X;  4FMS A;  4FOZ A;  2XE3 A;  2Y0K A;  4FRT A;  2O4V A;  2ODJ A;  2QTK A;  3POU A;  3SY7 A;  2XG6 A;  1GFO A;  2XE1 A;  1GFM A;  3EMN X;  3T20 A;  1GFQ A;  1HXX A;  3HW9 A;  8PRN A;  2K4T A;  4LSE A;  2XE5 A;  5DL8 A;  1BH3 A;  2FGR A;  1E54 A;  3POQ A;  4FSO A;  4FRX A;  3FYX A;  3NSG A;  3VY8 X;  2J4U P;  1MPF A;  4GCQ A;  4KR8 A;  3WI5 A;  3O0E A;  4KR4 A;  1PRN A;  4D5U A;  4RJX A;  4AUI A;  2Y0L A;  1HXT A;  3PRN A;  3SYS A;  4JFB A;  1H6S 1;  3VZU X;  5DL5 A;  2ZFG A;  4D64 A;  4D65 A;  2PRN A;  2OMF A;  6PRN A; 
#chains in the Genus database with same CATH topology
 4AZL A;  4E1T A;  3AAE A;  3A2S X;  5B5E O;  3UU2 A;  4LSI A;  3QRA A;  4LSH A;  4XNL A;  4FZN A;  3GP6 A;  4GF4 A;  1OSM A;  2R4O A;  4G75 A;  1Q9F A;  2R88 A;  3UPG A;  5JDP A;  3VZT X;  2M07 A;  2XMX A;  5T5F A;  2IWW A;  3AA7 B;  1ZHW A;  2KXP B;  5AFU L;  4GCS A;  3BRY A;  4G76 A;  2IWV A;  1T1L A;  4FT6 A;  5ADX L;  2XTR A;  3UAQ A;  3HWB A;  2Y0H A;  4O3Y A;  3AA7 A;  4C69 X;  3A0H O;  1IZN B;  2KXP A;  3POR A;  1OPF A;  5DL7 A;  2J1N A;  2JMM A;  1QJ9 A;  4PR7 A;  4AYE C;  1BT9 A;  4RJW A;  3K19 A;  3SY9 A;  4C4V A;  2WVP A;  2JQY A;  1S5L O;  1IZN A;  2POR A;  7PRN A;  1HXU A;  4FSP A;  3SYB A;  1PHO A;  2ZLD A;  4O4X A;  3C5O A;  4PJ0 O;  4B61 A;  3SZD A;  5PRN A;  4F4B A;  4LSF A;  1ZHZ A;  2MNH A;  3SZV A;  3T0S A;  3POX A;  3T24 A;  4GCP A;  3LK4 1;  2Y2X A;  2XE2 A;  4C4V B;  2K0L A;  2KZ7 B;  3DZM A;  4N59 A;  4U9C A;  1GFP A;  1GFN A;  5G38 A;  3NJT A;  4O3X B;  2Y7S A;  2N2L A;  5G39 A;  3VY9 X;  2FGQ X;  3JTY A;  2WJR A;  4FUV A;  2KZ7 A;  3PGU A;  3JCU O;  5DL6 A;  5E79 O;  4K3B A;  4KRA A;  3WI4 A;  5FVN A;  3VZW X;  3HOE A;  4BUM X;  2F1V A;  4FMS A;  4FOZ A;  2F1C X;  4AYN A;  2XE3 A;  2Y0K A;  4FES A;  2R8A A;  3DWN A;  3PGS A;  4FRT A;  1ORM A;  3LK2 B;  3KZI O;  5TIS O;  1G90 A;  3AA6 B;  5IYU A;  2W81 C;  1T16 A;  4UB6 O;  2O4V A;  4JCH A;  2MHL A;  1YS5 A;  2LFU A;  2ODJ A;  3BS0 A;  4AYD C;  4AYI D;  2QTK A;  3POU A;  3SY7 A;  2GE4 A;  3LK2 A;  4FZL A;  4O4U A;  5GTI O;  2N2M A;  3AA6 A;  2XG6 A;  3LK4 2;  3PQS A;  1GFO A;  2LHF A;  2W80 C;  3BRZ A;  2ERV A;  5GV0 A;  2WJQ A;  2XE1 A;  1GFM A;  5G3A A;  5KAF O;  4O3W A;  3EMN X;  2YNK A;  3PQU A;  3VE1 A;  2R4N A;  2KDY A;  4K3C A;  3DA4 A;  1GFQ A;  1HXX A;  3HW9 A;  8PRN A;  3T20 A;  2K4T A;  3A0B O;  4C00 A;  1P4T A;  4LSE A;  2XE5 A;  3KVD D;  4GHB A;  4XNK A;  3WU2 O;  5DL8 A;  1BH3 A;  3V8U A;  3AA0 A;  2FGR A;  1E54 A;  3POQ A;  5B66 O;  2R89 A;  3RBH A;  4AKM A;  4FSO A;  4FRX A;  3AAA B;  2X9K A;  3FYX A;  3NSG A;  3VY8 X;  2J4U P;  1MPF A;  4GCQ A;  3QRC A;  2XTQ A;  3O0E A;  4KR8 A;  3WI5 A;  4FZM A;  4KR4 A;  3G7G A;  1PRN A;  4D5U A;  4RJX A;  4AUI A;  3LK3 A;  3VE2 A;  3AAA A;  5KAI O;  2Y0L A;  3DWO X;  1ZHT A;  4N75 A;  4O3Z A;  5G26 A;  1ZHX A;  2M06 A;  1HXT A;  3PRN A;  3PF1 A;  5D5D A;  3PGR A;  3TZG A;  1Q9G A;  1BXW A;  3SYS A;  2X27 X;  4RLB A;  4N58 A;  4JFB A;  3AA0 B;  1THQ A;  5EE2 A;  1MM5 A;  4N74 A;  4Z3T A;  3AA1 B;  5AFU K;  4PUX A;  1H6S 1;  1ZHY A;  2YPV A;  3DA3 A;  4FQE A;  4RLC A;  4CTD A;  1QJP A;  1QJ8 A;  2R4L A;  4AKR B;  5ADX K;  4UB8 O;  3VZU X;  4AFK A;  5DL5 A;  2R4P A;  2ZFG A;  3HOL A;  3AA1 A;  3AAE B;  4D64 A;  4QQ1 A;  4O49 A;  3LK3 B;  2KC0 A;  4IL6 O;  5GTH O;  4AYM C;  4D65 A;  2F1T A;  1MM4 A;  2PRN A;  2AXT O;  2OMF A;  4RL9 A;  4AKR A;  6PRN A;  5H2F O;  4E1S A; 
#chains in the Genus database with same CATH homology
 4AZL A;  4E1T A;  3AAE A;  3A2S X;  3UU2 A;  4LSI A;  3QRA A;  4LSH A;  4XNL A;  4FZN A;  3GP6 A;  4GF4 A;  1OSM A;  4G75 A;  1Q9F A;  3UPG A;  5JDP A;  3VZT X;  2M07 A;  2XMX A;  5T5F A;  3AA7 B;  1ZHW A;  2KXP B;  5AFU L;  4GCS A;  4G76 A;  4FT6 A;  5ADX L;  2XTR A;  3UAQ A;  3HWB A;  2Y0H A;  4O3Y A;  3AA7 A;  4C69 X;  1IZN B;  2KXP A;  3POR A;  1OPF A;  5DL7 A;  2J1N A;  2JMM A;  1QJ9 A;  4AYE C;  1BT9 A;  4RJW A;  3K19 A;  3SY9 A;  1IZN A;  2POR A;  7PRN A;  1HXU A;  4FSP A;  3SYB A;  1PHO A;  2ZLD A;  4O4X A;  3C5O A;  4B61 A;  3SZD A;  5PRN A;  4F4B A;  4LSF A;  1ZHZ A;  2MNH A;  3SZV A;  3T0S A;  3POX A;  3T24 A;  4GCP A;  3LK4 1;  2Y2X A;  2XE2 A;  2K0L A;  2KZ7 B;  4N59 A;  4U9C A;  1GFP A;  1GFN A;  4O3X B;  2Y7S A;  2N2L A;  3VY9 X;  2FGQ X;  3JTY A;  4FUV A;  5DL6 A;  2KZ7 A;  3WI4 A;  4KRA A;  5FVN A;  3VZW X;  3HOE A;  4BUM X;  2F1V A;  4FMS A;  4FOZ A;  4AYN A;  2XE3 A;  2Y0K A;  4FES A;  4FRT A;  1ORM A;  3LK2 B;  1G90 A;  3AA6 B;  5IYU A;  2W81 C;  2O4V A;  4JCH A;  2MHL A;  1YS5 A;  2LFU A;  2ODJ A;  4AYD C;  4AYI D;  2QTK A;  3POU A;  3SY7 A;  2GE4 A;  3LK2 A;  4FZL A;  4O4U A;  2N2M A;  3AA6 A;  2XG6 A;  3LK4 2;  3PQS A;  1GFO A;  2LHF A;  2W80 C;  2ERV A;  5GV0 A;  2XE1 A;  1GFM A;  4O3W A;  3EMN X;  2YNK A;  3PQU A;  3VE1 A;  2KDY A;  3DA4 A;  1GFQ A;  1HXX A;  3HW9 A;  8PRN A;  3T20 A;  2K4T A;  1P4T A;  4LSE A;  2XE5 A;  3KVD D;  4GHB A;  4XNK A;  5DL8 A;  1BH3 A;  3V8U A;  3AA0 A;  2FGR A;  1E54 A;  3POQ A;  3RBH A;  4AKM A;  4FSO A;  4FRX A;  3AAA B;  3FYX A;  3NSG A;  3VY8 X;  2J4U P;  1MPF A;  4GCQ A;  3QRC A;  2XTQ A;  3O0E A;  4KR8 A;  3WI5 A;  4FZM A;  4KR4 A;  3G7G A;  1PRN A;  4D5U A;  4RJX A;  4AUI A;  3LK3 A;  3VE2 A;  3AAA A;  2Y0L A;  1ZHT A;  4O3Z A;  5G26 A;  1ZHX A;  2M06 A;  1HXT A;  3PRN A;  5D5D A;  3TZG A;  1Q9G A;  1BXW A;  3SYS A;  2X27 X;  4RLB A;  4N58 A;  4JFB A;  3AA0 B;  1THQ A;  5EE2 A;  1MM5 A;  4Z3T A;  3AA1 B;  5AFU K;  4PUX A;  1H6S 1;  1ZHY A;  2YPV A;  3DA3 A;  4RLC A;  1QJP A;  1QJ8 A;  4AKR B;  5ADX K;  3VZU X;  4AFK A;  5DL5 A;  2ZFG A;  3HOL A;  3AA1 A;  3AAE B;  4D64 A;  4QQ1 A;  4O49 A;  3LK3 B;  2KC0 A;  4AYM C;  4D65 A;  2F1T A;  1MM4 A;  2PRN A;  2OMF A;  4RL9 A;  6PRN A;  4AKR A;  4E1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...