3T20A

Crystal structure of pseudomonas aeruginosa occk5 (opdh)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
391
structure length
362
Chain Sequence
AGFLEDSKASLETRNFYMNRDFRKREEWAQGFILNLQSGYTQGTVGFGLDAMGMLGVKLDSPDTYSKLGLTAKVKVSQSELKVGTLIPKLPSVQPNNGRIFPQIFEGALLTSKEIKDLGFTAGRLEKTKIDSEDLALNDKNGRFAGVSADHFDLGGLDYKLTDQLTASYHYSNLQDVYRQHFVGLLHSWPIGPGELTSDLRFARSTDSGSAKAGGIDNKSLNGMFTYSLGNHAFGAAWQRMNGDDAFPYLEGSNPYLVNFVQVNDFAGPKERSWQLRYDYDFVGLGIPGLTFMTRYVKGDNVELAGQGEGREWERNTELQYVFQSGALKNLGIRWRNATFRSNFTRDIDENRLIVSYTLPIW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Specificity within a Family of Outer Membrane Carboxylate Channels.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
molecule keywords Cis-aconitate porin OpdH
total genus 95
structure length 362
sequence length 391
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3t20A01
3POXA 2J4UP 2J1NA 2OMFA 7PRNA 5JDPA 1PRNA 5DL7A 3T20A 3SYBA 3VZWX 2Y0KA 2ZLDA 1HXTA 4C69X 4KRAA 1H6S1 2XE2A 4GCSA 3SY9A 2FGQX 3POQA 4D5UA 4LSFA 3VZTX 4FSOA 2ZFGA 1GFNA 2ODJA 4KR4A 1BT9A 1GFQA 3VZUX 1E54A 1OPFA 3HW9A 2Y2XA 4FMSA 1OSMA 2XE5A 4D65A 2Y0LA 2O4VA 4LSHA 3SZDA 2PORA 1BH3A 3SY7A 3VY9X 3NSGA 4FSPA 3WI4A 4JFBA 3UU2A 4RJXA 2Y0HA 3T0SA 4GCPA 4LSIA 1GFOA 2XE3A 5DL6A 3SYSA 2XG6A 3O0EA 2XE1A 4BUMX 1GFMA 2PRNA 3PRNA 1PHOA 1HXUA 4FRTA 8PRNA 1GFPA 3VY8X 3FYXA 5PRNA 6PRNA 2QTKA 3T24A 5DL5A 3POUA 3A2SX 1HXXA 4FOZA 4AUIA 4RJWA 4KR8A 3K19A 3WI5A 2K4TA 3SZVA 1MPFA 3JTYA 5FVNA 4LSEA 3PORA 4D64A 2FGRA 4FT6A 4GCQA 5DL8A 3EMNX 4FRXA 3HWBA 3UPGA
chains in the Genus database with same CATH superfamily
2KXPB 1Q9GA 1IZNA 4AYDC 3POXA 3LK3B 2J4UP 3AA7A 3A0BO 5B5EO 2J1NA 2WJQA 1ZHXA 2OMFA 4G75A 3V8UA 5GV0A 2YPVA 2KZ7A 4FQEA 4GHBA 3QRAA 7PRNA 5JDPA 1PRNA 2AXTO 5DL7A 3T20A 5H2FO 3AA6B 3SYBA 3VZWX 2M07A 2Y0KA 4FZLA 5G3AA 2ZLDA 3DZMA 3LK2B 5KAFO 4C00A 1HXTA 1ZHZA 3C5OA 3VE1A 4C69X 4C4VB 4KRAA 2W80C 4IL6O 4FZMA 4O4UA 5E79O 1ZHTA 1H6S1 2XE2A 1THQA 3HOLA 2YNKA 2JMMA 4GCSA 4U9CA 2JQYA 3SY9A 4AKMA 3AAEA 3VE2A 2FGQX 5TISO 3POQA 4D5UA 2LFUA 4LSFA 4FSOA 3VZTX 1Q9FA 3G7GA 5AFUL 2KXPA 2ZFGA 3JCUO 1IZNB 1GFNA 2ODJA 2R4LA 4O3ZA 3AA7B 3WU2O 4KR4A 1QJ8A 4XNKA 4AYNA 1BT9A 1GFQA 3VZUX 4E1TA 3AA1B 4Z3TA 1E54A 4RL9A 2KDYA 2R89A 5B66O 1OPFA 4K3BA 4RLCA 3HW9A 4JCHA 2R4NA 2Y2XA 3A0HO 4FMSA 5T5FA 3LK2A 1QJPA 3GP6A 3PGRA 1ZHYA 4C4VA 4AYID 1QJ9A 1OSMA 2MHLA 2XE5A 1P4TA 3AAAA 4O3WA 5G38A 3PF1A 4D65A 1BXWA 2Y0LA 4FESA 2O4VA 3TZGA 2XMXA 2N2LA 1ORMA 4LSHA 3SZDA 2PORA 1BH3A 3SY7A 4FZNA 4GF4A 2ERVA 3VY9X 3NSGA 2MNHA 2X9KA 3NJTA 2IWVA 3QRCA 4FSPA 3WI4A 4AFKA 3PQUA 5EE2A 4JFBA 3UU2A 4O3YA 1MM4A 2R4PA 2Y0HA 4RJXA 5G39A 1S5LO 2N2MA 4GCPA 4LSIA 1GFOA 3T0SA 4AKRA 4G76A 3AA1A 5AFUK 2XE3A 4N74A 2R88A 1YS5A 2F1CX 5DL6A 4B61A 2M06A 4XNLA 3HOEA 3DWOX 3SYSA 2XG6A 3O0EA 5GTHO 1ZHWA 2F1TA 2KC0A 2XE1A 5GTIO 4O4XA 5G26A 4BUMX 1GFMA 2PRNA 3PRNA 4FUVA 2Y7SA 5D5DA 1PHOA 4PR7A 2W81C 1HXUA 3AA0A 3AAAB 4FRTA 8PRNA 2F1VA 1GFPA 2LHFA 4UB6O 3UAQA 3VY8X 4N75A 3FYXA 2WVPA 5PRNA 4AKRB 6PRNA 2QTKA 2R4OA 4CTDA 3T24A 4N59A 5DL5A 4AYMC 3LK3A 5KAIO 3POUA 3A2SX 2K0LA 4K3CA 4F4BA 1HXXA 4PUXA 4FOZA 4AUIA 4RJWA 4KR8A 2XTQA 3PGUA 1MM5A 1T16A 3K19A 4RLBA 2KZ7B 3BS0A 4UB8O 2R8AA 3WI5A 2K4TA 3BRYA 1MPFA 3JTYA 4O49A 3SZVA 4E1SA 5FVNA 4AYEC 3AA6A 1T1LA 4LSEA 3LK41 3PGSA 3PORA 2IWWA 3KZIO 4D64A 2XTRA 2FGRA 1G90A 3DWNA 4FT6A 4GCQA 3RBHA 5IYUA 2WJRA 5DL8A 3DA3A 3LK42 3AA0B 3BRZA 3DA4A 3EMNX 3HWBA 4FRXA 4N58A 5ADXL 3UPGA 3PQSA 3AAEB 5ADXK 4AZLA 4PJ0O 2X27X 4O3XB 4QQ1A 3KVDD 2GE4A
chains in the Genus database with same CATH topology
2KXPB 1Q9GA 1IZNA 3POXA 3LK3B 2J4UP 3AA7A 2J1NA 1ZHXA 2OMFA 4G75A 3V8UA 5GV0A 2YPVA 2KZ7A 4GHBA 3QRAA 7PRNA 5JDPA 1PRNA 5DL7A 3T20A 3AA6B 3SYBA 3VZWX 2M07A 2Y0KA 4FZLA 2ZLDA 3LK2B 1HXTA 1ZHZA 3C5OA 3VE1A 4C69X 4KRAA 2W80C 4AYDC 4FZMA 4O4UA 1ZHTA 1H6S1 2XE2A 1THQA 3HOLA 2YNKA 2JMMA 4GCSA 4U9CA 3SY9A 4AKMA 3AAEA 3VE2A 2FGQX 3POQA 4D5UA 2LFUA 4LSFA 4FSOA 3VZTX 1Q9FA 3G7GA 5AFUL 2KXPA 2ZFGA 1IZNB 1GFNA 2ODJA 4O3ZA 3AA7B 4KR4A 1QJ8A 4XNKA 4AYNA 1BT9A 1GFQA 3VZUX 4E1TA 3AA1B 4Z3TA 1E54A 4RL9A 2KDYA 1OPFA 4RLCA 3HW9A 4JCHA 2Y2XA 4FMSA 5T5FA 3LK2A 1QJPA 3GP6A 1ZHYA 4AYID 1QJ9A 1OSMA 2MHLA 2XE5A 1P4TA 3AAAA 4O3WA 4D65A 1BXWA 2Y0LA 4FESA 2O4VA 3TZGA 2XMXA 2N2LA 1ORMA 4LSHA 3SZDA 2PORA 1BH3A 3SY7A 4FZNA 4GF4A 2ERVA 3VY9X 3NSGA 2MNHA 4AKRA 3QRCA 4AFKA 4FSPA 3WI4A 3PQUA 5EE2A 4JFBA 3UU2A 4O3YA 1MM4A 4RJXA 2Y0HA 2N2MA 3T0SA 4GCPA 4LSIA 1GFOA 5AFUK 4G76A 3AA1A 2XE3A 1YS5A 5DL6A 4B61A 2M06A 4XNLA 3HOEA 3SYSA 2XG6A 3O0EA 1ZHWA 2F1TA 2KC0A 2XE1A 4O4XA 5G26A 4BUMX 1GFMA 2PRNA 3PRNA 4FUVA 2Y7SA 5D5DA 1PHOA 2W81C 1HXUA 3AA0A 3AAAB 4FRTA 8PRNA 2F1VA 1GFPA 2LHFA 3UAQA 3VY8X 3FYXA 5PRNA 4AKRB 6PRNA 2QTKA 3T24A 4N59A 5DL5A 4AYMC 3LK3A 3POUA 3A2SX 2K0LA 4F4BA 1HXXA 4PUXA 4FOZA 4AUIA 4RJWA 4KR8A 2XTQA 1MM5A 3K19A 4RLBA 2KZ7B 3WI5A 2K4TA 3SZVA 1MPFA 3JTYA 4O49A 4E1SA 5FVNA 4AYEC 3AA6A 4LSEA 3LK41 3PORA 4D64A 2XTRA 2FGRA 1G90A 4FT6A 4GCQA 3RBHA 5IYUA 5DL8A 3DA3A 3LK42 3AA0B 3DA4A 3EMNX 4FRXA 3HWBA 4N58A 5ADXL 3UPGA 3PQSA 3AAEB 5ADXK 4AZLA 2X27X 4O3XB 4QQ1A 3KVDD 2GE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3POX A;  2J4U P;  2J1N A;  2OMF A;  7PRN A;  5JDP A;  1PRN A;  5DL7 A;  3T20 A;  3SYB A;  3VZW X;  2Y0K A;  2ZLD A;  1HXT A;  4C69 X;  4KRA A;  1H6S 1;  2XE2 A;  4GCS A;  3SY9 A;  2FGQ X;  3POQ A;  4D5U A;  4LSF A;  3VZT X;  4FSO A;  2ZFG A;  1GFN A;  2ODJ A;  4KR4 A;  1BT9 A;  1GFQ A;  3VZU X;  1E54 A;  1OPF A;  3HW9 A;  2Y2X A;  4FMS A;  1OSM A;  2XE5 A;  4D65 A;  2Y0L A;  2O4V A;  4LSH A;  3SZD A;  2POR A;  1BH3 A;  3SY7 A;  3VY9 X;  3NSG A;  4FSP A;  3WI4 A;  4JFB A;  3UU2 A;  4RJX A;  2Y0H A;  3T0S A;  4GCP A;  4LSI A;  1GFO A;  2XE3 A;  5DL6 A;  3SYS A;  2XG6 A;  3O0E A;  2XE1 A;  4BUM X;  1GFM A;  2PRN A;  3PRN A;  1PHO A;  1HXU A;  4FRT A;  8PRN A;  1GFP A;  3VY8 X;  3FYX A;  5PRN A;  6PRN A;  2QTK A;  3T24 A;  5DL5 A;  3POU A;  3A2S X;  1HXX A;  4FOZ A;  4AUI A;  4RJW A;  4KR8 A;  3K19 A;  3WI5 A;  2K4T A;  3SZV A;  1MPF A;  3JTY A;  5FVN A;  4LSE A;  3POR A;  4D64 A;  2FGR A;  4FT6 A;  4GCQ A;  5DL8 A;  3EMN X;  4FRX A;  3HWB A;  3UPG A; 
#chains in the Genus database with same CATH topology
 2KXP B;  1Q9G A;  1IZN A;  4AYD C;  3POX A;  3LK3 B;  2J4U P;  3AA7 A;  3A0B O;  5B5E O;  2J1N A;  2WJQ A;  1ZHX A;  2OMF A;  4G75 A;  3V8U A;  5GV0 A;  2YPV A;  2KZ7 A;  4FQE A;  4GHB A;  3QRA A;  7PRN A;  5JDP A;  1PRN A;  2AXT O;  5DL7 A;  3T20 A;  5H2F O;  3AA6 B;  3SYB A;  3VZW X;  2M07 A;  2Y0K A;  4FZL A;  5G3A A;  2ZLD A;  3DZM A;  3LK2 B;  5KAF O;  4C00 A;  1HXT A;  1ZHZ A;  3C5O A;  3VE1 A;  4C69 X;  4C4V B;  4KRA A;  2W80 C;  4IL6 O;  4FZM A;  4O4U A;  5E79 O;  1ZHT A;  1H6S 1;  2XE2 A;  1THQ A;  3HOL A;  2YNK A;  2JMM A;  4GCS A;  4U9C A;  2JQY A;  3SY9 A;  4AKM A;  3AAE A;  3VE2 A;  2FGQ X;  5TIS O;  3POQ A;  4D5U A;  2LFU A;  4LSF A;  4FSO A;  3VZT X;  1Q9F A;  3G7G A;  5AFU L;  2KXP A;  2ZFG A;  3JCU O;  1IZN B;  1GFN A;  2ODJ A;  2R4L A;  4O3Z A;  3AA7 B;  3WU2 O;  4KR4 A;  1QJ8 A;  4XNK A;  4AYN A;  1BT9 A;  1GFQ A;  3VZU X;  4E1T A;  3AA1 B;  4Z3T A;  1E54 A;  4RL9 A;  2KDY A;  2R89 A;  5B66 O;  1OPF A;  4K3B A;  4RLC A;  3HW9 A;  4JCH A;  2R4N A;  2Y2X A;  3A0H O;  4FMS A;  5T5F A;  3LK2 A;  1QJP A;  3GP6 A;  3PGR A;  1ZHY A;  4C4V A;  4AYI D;  1QJ9 A;  1OSM A;  2MHL A;  2XE5 A;  1P4T A;  3AAA A;  4O3W A;  5G38 A;  3PF1 A;  4D65 A;  1BXW A;  2Y0L A;  4FES A;  2O4V A;  3TZG A;  2XMX A;  2N2L A;  1ORM A;  4LSH A;  3SZD A;  2POR A;  1BH3 A;  3SY7 A;  4FZN A;  4GF4 A;  2ERV A;  3VY9 X;  3NSG A;  2MNH A;  2X9K A;  3NJT A;  2IWV A;  3QRC A;  4FSP A;  3WI4 A;  4AFK A;  3PQU A;  5EE2 A;  4JFB A;  3UU2 A;  4O3Y A;  1MM4 A;  2R4P A;  2Y0H A;  4RJX A;  5G39 A;  1S5L O;  2N2M A;  4GCP A;  4LSI A;  1GFO A;  3T0S A;  4AKR A;  4G76 A;  3AA1 A;  5AFU K;  2XE3 A;  4N74 A;  2R88 A;  1YS5 A;  2F1C X;  5DL6 A;  4B61 A;  2M06 A;  4XNL A;  3HOE A;  3DWO X;  3SYS A;  2XG6 A;  3O0E A;  5GTH O;  1ZHW A;  2F1T A;  2KC0 A;  2XE1 A;  5GTI O;  4O4X A;  5G26 A;  4BUM X;  1GFM A;  2PRN A;  3PRN A;  4FUV A;  2Y7S A;  5D5D A;  1PHO A;  4PR7 A;  2W81 C;  1HXU A;  3AA0 A;  3AAA B;  4FRT A;  8PRN A;  2F1V A;  1GFP A;  2LHF A;  4UB6 O;  3UAQ A;  3VY8 X;  4N75 A;  3FYX A;  2WVP A;  5PRN A;  4AKR B;  6PRN A;  2QTK A;  2R4O A;  4CTD A;  3T24 A;  4N59 A;  5DL5 A;  4AYM C;  3LK3 A;  5KAI O;  3POU A;  3A2S X;  2K0L A;  4K3C A;  4F4B A;  1HXX A;  4PUX A;  4FOZ A;  4AUI A;  4RJW A;  4KR8 A;  2XTQ A;  3PGU A;  1MM5 A;  1T16 A;  3K19 A;  4RLB A;  2KZ7 B;  3BS0 A;  4UB8 O;  2R8A A;  3WI5 A;  2K4T A;  3BRY A;  1MPF A;  3JTY A;  4O49 A;  3SZV A;  4E1S A;  5FVN A;  4AYE C;  3AA6 A;  1T1L A;  4LSE A;  3LK4 1;  3PGS A;  3POR A;  2IWW A;  3KZI O;  4D64 A;  2XTR A;  2FGR A;  1G90 A;  3DWN A;  4FT6 A;  4GCQ A;  3RBH A;  5IYU A;  2WJR A;  5DL8 A;  3DA3 A;  3LK4 2;  3AA0 B;  3BRZ A;  3DA4 A;  3EMN X;  3HWB A;  4FRX A;  4N58 A;  5ADX L;  3UPG A;  3PQS A;  3AAE B;  5ADX K;  4AZL A;  4PJ0 O;  2X27 X;  4O3X B;  4QQ1 A;  3KVD D;  2GE4 A; 
#chains in the Genus database with same CATH homology
 2KXP B;  1Q9G A;  1IZN A;  3POX A;  3LK3 B;  2J4U P;  3AA7 A;  2J1N A;  1ZHX A;  2OMF A;  4G75 A;  3V8U A;  5GV0 A;  2YPV A;  2KZ7 A;  4GHB A;  3QRA A;  7PRN A;  5JDP A;  1PRN A;  5DL7 A;  3T20 A;  3AA6 B;  3SYB A;  3VZW X;  2M07 A;  2Y0K A;  4FZL A;  2ZLD A;  3LK2 B;  1HXT A;  1ZHZ A;  3C5O A;  3VE1 A;  4C69 X;  4KRA A;  2W80 C;  4AYD C;  4FZM A;  4O4U A;  1ZHT A;  1H6S 1;  2XE2 A;  1THQ A;  3HOL A;  2YNK A;  2JMM A;  4GCS A;  4U9C A;  3SY9 A;  4AKM A;  3AAE A;  3VE2 A;  2FGQ X;  3POQ A;  4D5U A;  2LFU A;  4LSF A;  4FSO A;  3VZT X;  1Q9F A;  3G7G A;  5AFU L;  2KXP A;  2ZFG A;  1IZN B;  1GFN A;  2ODJ A;  4O3Z A;  3AA7 B;  4KR4 A;  1QJ8 A;  4XNK A;  4AYN A;  1BT9 A;  1GFQ A;  3VZU X;  4E1T A;  3AA1 B;  4Z3T A;  1E54 A;  4RL9 A;  2KDY A;  1OPF A;  4RLC A;  3HW9 A;  4JCH A;  2Y2X A;  4FMS A;  5T5F A;  3LK2 A;  1QJP A;  3GP6 A;  1ZHY A;  4AYI D;  1QJ9 A;  1OSM A;  2MHL A;  2XE5 A;  1P4T A;  3AAA A;  4O3W A;  4D65 A;  1BXW A;  2Y0L A;  4FES A;  2O4V A;  3TZG A;  2XMX A;  2N2L A;  1ORM A;  4LSH A;  3SZD A;  2POR A;  1BH3 A;  3SY7 A;  4FZN A;  4GF4 A;  2ERV A;  3VY9 X;  3NSG A;  2MNH A;  4AKR A;  3QRC A;  4AFK A;  4FSP A;  3WI4 A;  3PQU A;  5EE2 A;  4JFB A;  3UU2 A;  4O3Y A;  1MM4 A;  4RJX A;  2Y0H A;  2N2M A;  3T0S A;  4GCP A;  4LSI A;  1GFO A;  5AFU K;  4G76 A;  3AA1 A;  2XE3 A;  1YS5 A;  5DL6 A;  4B61 A;  2M06 A;  4XNL A;  3HOE A;  3SYS A;  2XG6 A;  3O0E A;  1ZHW A;  2F1T A;  2KC0 A;  2XE1 A;  4O4X A;  5G26 A;  4BUM X;  1GFM A;  2PRN A;  3PRN A;  4FUV A;  2Y7S A;  5D5D A;  1PHO A;  2W81 C;  1HXU A;  3AA0 A;  3AAA B;  4FRT A;  8PRN A;  2F1V A;  1GFP A;  2LHF A;  3UAQ A;  3VY8 X;  3FYX A;  5PRN A;  4AKR B;  6PRN A;  2QTK A;  3T24 A;  4N59 A;  5DL5 A;  4AYM C;  3LK3 A;  3POU A;  3A2S X;  2K0L A;  4F4B A;  1HXX A;  4PUX A;  4FOZ A;  4AUI A;  4RJW A;  4KR8 A;  2XTQ A;  1MM5 A;  3K19 A;  4RLB A;  2KZ7 B;  3WI5 A;  2K4T A;  3SZV A;  1MPF A;  3JTY A;  4O49 A;  4E1S A;  5FVN A;  4AYE C;  3AA6 A;  4LSE A;  3LK4 1;  3POR A;  4D64 A;  2XTR A;  2FGR A;  1G90 A;  4FT6 A;  4GCQ A;  3RBH A;  5IYU A;  5DL8 A;  3DA3 A;  3LK4 2;  3AA0 B;  3DA4 A;  3EMN X;  4FRX A;  3HWB A;  4N58 A;  5ADX L;  3UPG A;  3PQS A;  3AAE B;  5ADX K;  4AZL A;  2X27 X;  4O3X B;  4QQ1 A;  3KVD D;  2GE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...