3T20A

Crystal structure of pseudomonas aeruginosa occk5 (opdh)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
391
structure length
362
Chain Sequence
AGFLEDSKASLETRNFYMNRDFRKREEWAQGFILNLQSGYTQGTVGFGLDAMGMLGVKLDSPDTYSKLGLTAKVKVSQSELKVGTLIPKLPSVQPNNGRIFPQIFEGALLTSKEIKDLGFTAGRLEKTKIDSEDLALNDKNGRFAGVSADHFDLGGLDYKLTDQLTASYHYSNLQDVYRQHFVGLLHSWPIGPGELTSDLRFARSTDSGSAKAGGIDNKSLNGMFTYSLGNHAFGAAWQRMNGDDAFPYLEGSNPYLVNFVQVNDFAGPKERSWQLRYDYDFVGLGIPGLTFMTRYVKGDNVELAGQGEGREWERNTELQYVFQSGALKNLGIRWRNATFRSNFTRDIDENRLIVSYTLPIW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Cis-aconitate porin OpdH
publication title Substrate Specificity within a Family of Outer Membrane Carboxylate Channels.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 95
structure length 362
sequence length 391
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3t20A01
3JTYA 3PRNA 4LSFA 3T20A 3SYSA 3SYBA 2Y0KA 3VZTX 3VY9X 2PRNA 5FVNA 3VY8X 4GCPA 1E54A 4FMSA 3K19A 1GFQA 5DL5A 4LSIA 2XE2A 3NSGA 3WI5A 3PORA 4FRTA 2OMFA 2FGRA 1PHOA 1HXUA 3VZWX 1BT9A 4LSEA 4D5UA 2Y0LA 4FRXA 1GFOA 3UU2A 4BUMX 4KR8A 2O4VA 3POUA 2J1NA 3T0SA 6PRNA 3POQA 3SZVA 1MPFA 2XE1A 4D64A 4GCSA 1PRNA 3POXA 3VZUX 1OPFA 1GFNA 1HXXA 4FSPA 4RJXA 2XE3A 4FSOA 3SY7A 2Y0HA 3HW9A 4FT6A 4KR4A 4D65A 1OSMA 7PRNA 2ODJA 1H6S1 5JDPA 4RJWA 4JFBA 2FGQX 8PRNA 4AUIA 2XE5A 3HWBA 3WI4A 3EMNX 1GFMA 1HXTA 3SZDA 1BH3A 3A2SX 3T24A 2ZLDA 4C69X 2QTKA 2Y2XA 2PORA 3FYXA 3O0EA 4FOZA 4GCQA 5DL8A 3UPGA 2XG6A 3SY9A 5PRNA 2ZFGA 5DL7A 2K4TA 4KRAA 4LSHA 5DL6A 1GFPA 2J4UP
chains in the Genus database with same CATH superfamily
5KAFO 2M07A 3AA1A 4JCHA 3JTYA 4C4VB 1ZHWA 3PF1A 3PRNA 3AA6B 1IZNA 4LSFA 4PUXA 3SYSA 3T20A 2MNHA 3LK2B 3SYBA 5G39A 5ADXL 2Y0KA 3VZTX 4AZLA 3QRAA 3PGRA 2KXPA 3VY9X 3C5OA 2PRNA 1S5LO 1ORMA 4FESA 4AYDC 4FZNA 3DA4A 4Z3TA 1ZHXA 4C4VA 5FVNA 4N75A 3DA3A 4GCPA 3VY8X 6PRNA 2R4PA 1E54A 3AA6A 3BRYA 4FMSA 4N59A 3K19A 1GFQA 4O3WA 3G7GA 4LSIA 5DL5A 1Q9GA 2XE2A 2JMMA 5AFUK 3NSGA 4O49A 1ZHTA 3WI5A 4G76A 3AA0B 3AAAB 3PORA 2LFUA 4FRTA 2X27X 2XTRA 4UB6O 2OMFA 1YS5A 5EE2A 2IWVA 2FGRA 2XMXA 4K3BA 1QJ9A 4O3ZA 4FUVA 3JCUO 3PGSA 4PJ0O 1PHOA 1HXUA 1P4TA 5ADXK 3VZWX 1MM4A 1BXWA 4PR7A 3PGUA 4FZMA 1QJ8A 1BT9A 2WJRA 4O3YA 2IWWA 3BS0A 2K0LA 2KZ7A 2N2LA 3LK42 2M06A 4IL6O 4LSEA 4AKMA 2Y0LA 4D5UA 3AA0A 3AAAA 5IYUA 1T16A 4FRXA 1GFOA 3V8UA 3DWOX 3NJTA 2Y7SA 4O4UA 2W80C 4KR8A 4RLBA 3UU2A 4BUMX 2JQYA 2O4VA 3POUA 2J1NA 4RLCA 5G26A 4O4XA 3T0SA 3POQA 3RBHA 1MPFA 3SZVA 2W81C 2XE1A 4D64A 4E1TA 4XNLA 2N2MA 4GCSA 1PRNA 4AYMC 3QRCA 4AYNA 3LK2A 5TISO 3POXA 1T1LA 5G3AA 2R89A 3VZUX 1OPFA 1GFNA 3A0BO 3AA7B 1HXXA 2R4LA 4FSPA 4RJXA 2KC0A 2ERVA 2R4OA 2XE3A 4FZLA 5E79O 4FSOA 2R4NA 3PQUA 3HOLA 3SY7A 3LK3B 2YPVA 2Y0HA 2WJQA 5GTHO 3HW9A 2MHLA 4FT6A 5T5FA 5AFUL 5GV0A 4KR4A 4N74A 2AXTO 5B66O 2WVPA 3AA7A 1THQA 1OSMA 4D65A 5GTIO 2ODJA 1H6S1 2F1CX 7PRNA 2KDYA 5JDPA 3GP6A 4QQ1A 2R88A 4RJWA 3BRZA 5G38A 3A0HO 1ZHZA 4JFBA 3KVDD 4U9CA 1ZHYA 2FGQX 3LK3A 8PRNA 3DWNA 4GF4A 4AKRB 4UB8O 2XE5A 3HWBA 3WI4A 5KAIO 4AUIA 2F1VA 3EMNX 3AAEB 2KXPB 3PQSA 4RL9A 1GFMA 5B5EO 5D5DA 1Q9FA 1MM5A 4AYEC 2F1TA 1G90A 4B61A 2LHFA 3DZMA 4CTDA 1HXTA 3VE1A 3SZDA 3WU2O 4F4BA 4K3CA 2YNKA 4AKRA 1BH3A 3A2SX 4GHBA 4XNKA 3KZIO 2ZLDA 3T24A 3VE2A 3AAEA 4C69X 2QTKA 2Y2XA 4G75A 4E1SA 2PORA 3FYXA 3O0EA 4FOZA 4GCQA 5DL8A 4FQEA 3UPGA 2XG6A 4AYID 2XTQA 3LK41 5PRNA 3SY9A 2GE4A 3TZGA 4C00A 2R8AA 3AA1B 2ZFGA 5H2FO 1QJPA 5DL7A 2X9KA 2K4TA 4KRAA 2KZ7B 1IZNB 4LSHA 4O3XB 5DL6A 1GFPA 3UAQA 4N58A 2J4UP 3HOEA 4AFKA
chains in the Genus database with same CATH topology
2M07A 3AA1A 4JCHA 3JTYA 1ZHWA 3PRNA 3AA6B 1IZNA 4LSFA 4PUXA 3SYSA 3T20A 2MNHA 3LK2B 3SYBA 5ADXL 2Y0KA 3VZTX 3QRAA 2KXPA 3VY9X 3C5OA 2PRNA 1ORMA 4FESA 4AYDC 4FZNA 3DA4A 4Z3TA 1ZHXA 5FVNA 6PRNA 3DA3A 4GCPA 3VY8X 3AA6A 1E54A 4N59A 4FMSA 4AZLA 3K19A 1GFQA 4O3WA 3G7GA 4LSIA 5DL5A 1Q9GA 2XE2A 2JMMA 5AFUK 3NSGA 4O49A 1ZHTA 3WI5A 4G76A 3AA0B 3AAAB 3PORA 2LFUA 4FRTA 2X27X 2XTRA 5EE2A 2OMFA 1YS5A 2FGRA 2XMXA 1QJ9A 4O3ZA 4FUVA 1PHOA 1HXUA 1P4TA 5ADXK 3VZWX 1MM4A 1BXWA 4FZMA 1QJ8A 1BT9A 4O3YA 4LSEA 2K0LA 2KZ7A 2N2LA 3LK42 2M06A 4AKMA 4D5UA 2Y0LA 3AA0A 3AAAA 5IYUA 4FRXA 1GFOA 3V8UA 2Y7SA 4O4UA 2W80C 4KR8A 4RLBA 3UU2A 4BUMX 2O4VA 4RLCA 3POUA 2J1NA 5G26A 3T0SA 4O4XA 4E1TA 3POQA 3RBHA 1MPFA 3SZVA 2W81C 2XE1A 4D64A 4XNLA 2N2MA 4GCSA 1PRNA 4AYMC 3QRCA 4AYNA 3LK2A 3POXA 3VZUX 1OPFA 1GFNA 3AA7B 1HXXA 4FSPA 4RJXA 2KC0A 2ERVA 2XE3A 4FZLA 4FSOA 3PQUA 3HOLA 3SY7A 3LK3B 2YPVA 2Y0HA 3HW9A 2MHLA 4FT6A 5T5FA 5AFUL 5GV0A 4KR4A 3AA7A 1THQA 1OSMA 4D65A 7PRNA 2ODJA 1H6S1 2KDYA 5JDPA 3GP6A 4QQ1A 4RJWA 4JFBA 1ZHZA 4U9CA 3KVDD 1ZHYA 2FGQX 3LK3A 8PRNA 4GF4A 4AKRB 4AUIA 2XE5A 3HWBA 3WI4A 2F1VA 3EMNX 3AAEB 2KXPB 3PQSA 4RL9A 1GFMA 5D5DA 1Q9FA 1MM5A 4AYEC 2F1TA 1G90A 4B61A 2LHFA 1HXTA 3VE1A 3SZDA 4F4BA 2YNKA 4AKRA 1BH3A 3A2SX 4GHBA 4XNKA 3T24A 2ZLDA 3VE2A 3AAEA 4C69X 2QTKA 2Y2XA 4G75A 4E1SA 2PORA 3FYXA 3O0EA 4FOZA 4GCQA 5DL8A 3UPGA 2XG6A 4AYID 2XTQA 3LK41 5PRNA 3SY9A 2GE4A 3TZGA 3AA1B 2ZFGA 1QJPA 5DL7A 2K4TA 4KRAA 2KZ7B 1IZNB 4LSHA 4O3XB 5DL6A 1GFPA 3UAQA 4N58A 2J4UP 3HOEA 4AFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JTY A;  3PRN A;  4LSF A;  3T20 A;  3SYS A;  3SYB A;  2Y0K A;  3VZT X;  3VY9 X;  2PRN A;  5FVN A;  3VY8 X;  4GCP A;  1E54 A;  4FMS A;  3K19 A;  1GFQ A;  5DL5 A;  4LSI A;  2XE2 A;  3NSG A;  3WI5 A;  3POR A;  4FRT A;  2OMF A;  2FGR A;  1PHO A;  1HXU A;  3VZW X;  1BT9 A;  4LSE A;  4D5U A;  2Y0L A;  4FRX A;  1GFO A;  3UU2 A;  4BUM X;  4KR8 A;  2O4V A;  3POU A;  2J1N A;  3T0S A;  6PRN A;  3POQ A;  3SZV A;  1MPF A;  2XE1 A;  4D64 A;  4GCS A;  1PRN A;  3POX A;  3VZU X;  1OPF A;  1GFN A;  1HXX A;  4FSP A;  4RJX A;  2XE3 A;  4FSO A;  3SY7 A;  2Y0H A;  3HW9 A;  4FT6 A;  4KR4 A;  4D65 A;  1OSM A;  7PRN A;  2ODJ A;  1H6S 1;  5JDP A;  4RJW A;  4JFB A;  2FGQ X;  8PRN A;  4AUI A;  2XE5 A;  3HWB A;  3WI4 A;  3EMN X;  1GFM A;  1HXT A;  3SZD A;  1BH3 A;  3A2S X;  3T24 A;  2ZLD A;  4C69 X;  2QTK A;  2Y2X A;  2POR A;  3FYX A;  3O0E A;  4FOZ A;  4GCQ A;  5DL8 A;  3UPG A;  2XG6 A;  3SY9 A;  5PRN A;  2ZFG A;  5DL7 A;  2K4T A;  4KRA A;  4LSH A;  5DL6 A;  1GFP A;  2J4U P; 
#chains in the Genus database with same CATH topology
 5KAF O;  2M07 A;  3AA1 A;  4JCH A;  3JTY A;  4C4V B;  1ZHW A;  3PF1 A;  3PRN A;  3AA6 B;  1IZN A;  4LSF A;  4PUX A;  3SYS A;  3T20 A;  2MNH A;  3LK2 B;  3SYB A;  5G39 A;  5ADX L;  2Y0K A;  3VZT X;  4AZL A;  3QRA A;  3PGR A;  2KXP A;  3VY9 X;  3C5O A;  2PRN A;  1S5L O;  1ORM A;  4FES A;  4AYD C;  4FZN A;  3DA4 A;  4Z3T A;  1ZHX A;  4C4V A;  5FVN A;  4N75 A;  3DA3 A;  4GCP A;  3VY8 X;  6PRN A;  2R4P A;  1E54 A;  3AA6 A;  3BRY A;  4FMS A;  4N59 A;  3K19 A;  1GFQ A;  4O3W A;  3G7G A;  4LSI A;  5DL5 A;  1Q9G A;  2XE2 A;  2JMM A;  5AFU K;  3NSG A;  4O49 A;  1ZHT A;  3WI5 A;  4G76 A;  3AA0 B;  3AAA B;  3POR A;  2LFU A;  4FRT A;  2X27 X;  2XTR A;  4UB6 O;  2OMF A;  1YS5 A;  5EE2 A;  2IWV A;  2FGR A;  2XMX A;  4K3B A;  1QJ9 A;  4O3Z A;  4FUV A;  3JCU O;  3PGS A;  4PJ0 O;  1PHO A;  1HXU A;  1P4T A;  5ADX K;  3VZW X;  1MM4 A;  1BXW A;  4PR7 A;  3PGU A;  4FZM A;  1QJ8 A;  1BT9 A;  2WJR A;  4O3Y A;  2IWW A;  3BS0 A;  2K0L A;  2KZ7 A;  2N2L A;  3LK4 2;  2M06 A;  4IL6 O;  4LSE A;  4AKM A;  2Y0L A;  4D5U A;  3AA0 A;  3AAA A;  5IYU A;  1T16 A;  4FRX A;  1GFO A;  3V8U A;  3DWO X;  3NJT A;  2Y7S A;  4O4U A;  2W80 C;  4KR8 A;  4RLB A;  3UU2 A;  4BUM X;  2JQY A;  2O4V A;  3POU A;  2J1N A;  4RLC A;  5G26 A;  4O4X A;  3T0S A;  3POQ A;  3RBH A;  1MPF A;  3SZV A;  2W81 C;  2XE1 A;  4D64 A;  4E1T A;  4XNL A;  2N2M A;  4GCS A;  1PRN A;  4AYM C;  3QRC A;  4AYN A;  3LK2 A;  5TIS O;  3POX A;  1T1L A;  5G3A A;  2R89 A;  3VZU X;  1OPF A;  1GFN A;  3A0B O;  3AA7 B;  1HXX A;  2R4L A;  4FSP A;  4RJX A;  2KC0 A;  2ERV A;  2R4O A;  2XE3 A;  4FZL A;  5E79 O;  4FSO A;  2R4N A;  3PQU A;  3HOL A;  3SY7 A;  3LK3 B;  2YPV A;  2Y0H A;  2WJQ A;  5GTH O;  3HW9 A;  2MHL A;  4FT6 A;  5T5F A;  5AFU L;  5GV0 A;  4KR4 A;  4N74 A;  2AXT O;  5B66 O;  2WVP A;  3AA7 A;  1THQ A;  1OSM A;  4D65 A;  5GTI O;  2ODJ A;  1H6S 1;  2F1C X;  7PRN A;  2KDY A;  5JDP A;  3GP6 A;  4QQ1 A;  2R88 A;  4RJW A;  3BRZ A;  5G38 A;  3A0H O;  1ZHZ A;  4JFB A;  3KVD D;  4U9C A;  1ZHY A;  2FGQ X;  3LK3 A;  8PRN A;  3DWN A;  4GF4 A;  4AKR B;  4UB8 O;  2XE5 A;  3HWB A;  3WI4 A;  5KAI O;  4AUI A;  2F1V A;  3EMN X;  3AAE B;  2KXP B;  3PQS A;  4RL9 A;  1GFM A;  5B5E O;  5D5D A;  1Q9F A;  1MM5 A;  4AYE C;  2F1T A;  1G90 A;  4B61 A;  2LHF A;  3DZM A;  4CTD A;  1HXT A;  3VE1 A;  3SZD A;  3WU2 O;  4F4B A;  4K3C A;  2YNK A;  4AKR A;  1BH3 A;  3A2S X;  4GHB A;  4XNK A;  3KZI O;  2ZLD A;  3T24 A;  3VE2 A;  3AAE A;  4C69 X;  2QTK A;  2Y2X A;  4G75 A;  4E1S A;  2POR A;  3FYX A;  3O0E A;  4FOZ A;  4GCQ A;  5DL8 A;  4FQE A;  3UPG A;  2XG6 A;  4AYI D;  2XTQ A;  3LK4 1;  5PRN A;  3SY9 A;  2GE4 A;  3TZG A;  4C00 A;  2R8A A;  3AA1 B;  2ZFG A;  5H2F O;  1QJP A;  5DL7 A;  2X9K A;  2K4T A;  4KRA A;  2KZ7 B;  1IZN B;  4LSH A;  4O3X B;  5DL6 A;  1GFP A;  3UAQ A;  4N58 A;  2J4U P;  3HOE A;  4AFK A; 
#chains in the Genus database with same CATH homology
 2M07 A;  3AA1 A;  4JCH A;  3JTY A;  1ZHW A;  3PRN A;  3AA6 B;  1IZN A;  4LSF A;  4PUX A;  3SYS A;  3T20 A;  2MNH A;  3LK2 B;  3SYB A;  5ADX L;  2Y0K A;  3VZT X;  3QRA A;  2KXP A;  3VY9 X;  3C5O A;  2PRN A;  1ORM A;  4FES A;  4AYD C;  4FZN A;  3DA4 A;  4Z3T A;  1ZHX A;  5FVN A;  6PRN A;  3DA3 A;  4GCP A;  3VY8 X;  3AA6 A;  1E54 A;  4N59 A;  4FMS A;  4AZL A;  3K19 A;  1GFQ A;  4O3W A;  3G7G A;  4LSI A;  5DL5 A;  1Q9G A;  2XE2 A;  2JMM A;  5AFU K;  3NSG A;  4O49 A;  1ZHT A;  3WI5 A;  4G76 A;  3AA0 B;  3AAA B;  3POR A;  2LFU A;  4FRT A;  2X27 X;  2XTR A;  5EE2 A;  2OMF A;  1YS5 A;  2FGR A;  2XMX A;  1QJ9 A;  4O3Z A;  4FUV A;  1PHO A;  1HXU A;  1P4T A;  5ADX K;  3VZW X;  1MM4 A;  1BXW A;  4FZM A;  1QJ8 A;  1BT9 A;  4O3Y A;  4LSE A;  2K0L A;  2KZ7 A;  2N2L A;  3LK4 2;  2M06 A;  4AKM A;  4D5U A;  2Y0L A;  3AA0 A;  3AAA A;  5IYU A;  4FRX A;  1GFO A;  3V8U A;  2Y7S A;  4O4U A;  2W80 C;  4KR8 A;  4RLB A;  3UU2 A;  4BUM X;  2O4V A;  4RLC A;  3POU A;  2J1N A;  5G26 A;  3T0S A;  4O4X A;  4E1T A;  3POQ A;  3RBH A;  1MPF A;  3SZV A;  2W81 C;  2XE1 A;  4D64 A;  4XNL A;  2N2M A;  4GCS A;  1PRN A;  4AYM C;  3QRC A;  4AYN A;  3LK2 A;  3POX A;  3VZU X;  1OPF A;  1GFN A;  3AA7 B;  1HXX A;  4FSP A;  4RJX A;  2KC0 A;  2ERV A;  2XE3 A;  4FZL A;  4FSO A;  3PQU A;  3HOL A;  3SY7 A;  3LK3 B;  2YPV A;  2Y0H A;  3HW9 A;  2MHL A;  4FT6 A;  5T5F A;  5AFU L;  5GV0 A;  4KR4 A;  3AA7 A;  1THQ A;  1OSM A;  4D65 A;  7PRN A;  2ODJ A;  1H6S 1;  2KDY A;  5JDP A;  3GP6 A;  4QQ1 A;  4RJW A;  4JFB A;  1ZHZ A;  4U9C A;  3KVD D;  1ZHY A;  2FGQ X;  3LK3 A;  8PRN A;  4GF4 A;  4AKR B;  4AUI A;  2XE5 A;  3HWB A;  3WI4 A;  2F1V A;  3EMN X;  3AAE B;  2KXP B;  3PQS A;  4RL9 A;  1GFM A;  5D5D A;  1Q9F A;  1MM5 A;  4AYE C;  2F1T A;  1G90 A;  4B61 A;  2LHF A;  1HXT A;  3VE1 A;  3SZD A;  4F4B A;  2YNK A;  4AKR A;  1BH3 A;  3A2S X;  4GHB A;  4XNK A;  3T24 A;  2ZLD A;  3VE2 A;  3AAE A;  4C69 X;  2QTK A;  2Y2X A;  4G75 A;  4E1S A;  2POR A;  3FYX A;  3O0E A;  4FOZ A;  4GCQ A;  5DL8 A;  3UPG A;  2XG6 A;  4AYI D;  2XTQ A;  3LK4 1;  5PRN A;  3SY9 A;  2GE4 A;  3TZG A;  3AA1 B;  2ZFG A;  1QJP A;  5DL7 A;  2K4T A;  4KRA A;  2KZ7 B;  1IZN B;  4LSH A;  4O3X B;  5DL6 A;  1GFP A;  3UAQ A;  4N58 A;  2J4U P;  3HOE A;  4AFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...