3T20A

Crystal structure of pseudomonas aeruginosa occk5 (opdh)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
391
structure length
362
Chain Sequence
AGFLEDSKASLETRNFYMNRDFRKREEWAQGFILNLQSGYTQGTVGFGLDAMGMLGVKLDSPDTYSKLGLTAKVKVSQSELKVGTLIPKLPSVQPNNGRIFPQIFEGALLTSKEIKDLGFTAGRLEKTKIDSEDLALNDKNGRFAGVSADHFDLGGLDYKLTDQLTASYHYSNLQDVYRQHFVGLLHSWPIGPGELTSDLRFARSTDSGSAKAGGIDNKSLNGMFTYSLGNHAFGAAWQRMNGDDAFPYLEGSNPYLVNFVQVNDFAGPKERSWQLRYDYDFVGLGIPGLTFMTRYVKGDNVELAGQGEGREWERNTELQYVFQSGALKNLGIRWRNATFRSNFTRDIDENRLIVSYTLPIW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Specificity within a Family of Outer Membrane Carboxylate Channels.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
molecule keywords Cis-aconitate porin OpdH
total genus 95
structure length 362
sequence length 391
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3t20A01
2Y0KA 4LSEA 3HWBA 4D65A 2XG6A 3SZVA 4JFBA 2ODJA 3UU2A 5FVNA 2Y0HA 1GFNA 4FRXA 4FSPA 2J4UP 1BH3A 2O4VA 1OPFA 3PRNA 3PORA 4RJWA 3VZWX 2PRNA 4RJXA 3FYXA 3VZTX 3T0SA 4GCQA 7PRNA 3EMNX 2Y2XA 1GFMA 3WI5A 3O0EA 4D5UA 1BT9A 4AUIA 3VY9X 3POUA 1PHOA 5DL6A 6PRNA 4KR8A 1GFQA 3HW9A 2QTKA 1GFOA 1HXUA 4LSIA 1H6S1 1HXTA 4LSHA 2K4TA 2XE5A 8PRNA 2XE3A 3UPGA 1MPFA 4KR4A 3NSGA 4FRTA 3WI4A 2FGRA 3T24A 4FT6A 5DL8A 2ZLDA 4KRAA 3VY8X 3POXA 3A2SX 2Y0LA 3T20A 3VZUX 3SY7A 5PRNA 3SYSA 2OMFA 5JDPA 1GFPA 4D64A 3POQA 1E54A 1HXXA 3SZDA 3SYBA 1OSMA 4GCPA 5DL7A 4BUMX 4C69X 2PORA 4FMSA 5DL5A 4LSFA 4FOZA 3JTYA 2XE2A 2FGQX 2XE1A 1PRNA 2ZFGA 4FSOA 3SY9A 2J1NA 3K19A 4GCSA
chains in the Genus database with same CATH superfamily
4QQ1A 2W81C 4N75A 1ZHXA 4FZNA 2Y0KA 4LSEA 4UB8O 4AYNA 2LHFA 5ADXL 3PF1A 2X27X 3HWBA 4GF4A 4D65A 1QJ8A 1BXWA 3AAAA 4O49A 3G7GA 2XG6A 2R88A 3SZVA 4XNLA 4JFBA 5G26A 3DZMA 3QRCA 3AAEB 4O3ZA 2ODJA 3A0HO 3LK2A 3PQSA 4RL9A 3HOLA 1T16A 5D5DA 1ZHWA 5FVNA 3KZIO 5TISO 2Y0HA 5GTHO 1GFNA 4RLCA 3AA1B 4O4UA 1QJ9A 4FRXA 4IL6O 2R8AA 2R4NA 4FSPA 2WJQA 4F4BA 4G76A 2KZ7B 2R4OA 2AXTO 2J4UP 5GV0A 1ZHYA 1BH3A 5EE2A 2O4VA 5G3AA 3A0BO 4K3BA 1OPFA 1P4TA 3PRNA 3PORA 4RJWA 3VZWX 4PR7A 2PRNA 5KAFO 4RJXA 4C4VB 1THQA 3VZTX 3T0SA 4O4XA 2KXPB 4GCQA 2R89A 3DA4A 3PGUA 4FZMA 4PJ0O 5GTIO 4AKRA 5B5EO 3EMNX 7PRNA 2WJRA 2Y2XA 1GFMA 3DA3A 3WI5A 5AFUL 5IYUA 2JQYA 3O0EA 5G39A 2KC0A 2KXPA 2YNKA 3AA0A 4FZLA 1S5LO 3AA7A 4D5UA 1BT9A 4N59A 2K0LA 3QRAA 4XNKA 3VY9X 3POUA 4O3XB 4AUIA 2XMXA 3LK3B 1T1LA 1PHOA 3BRZA 3PGRA 5DL6A 6PRNA 4KR8A 2W80C 5AFUK 5E79O 4GCSA 1ORMA 1GFQA 2ERVA 3AAEA 3HW9A 4Z3TA 2QTKA 4N58A 4RLBA 1GFOA 1HXUA 4LSIA 2N2LA 3VE2A 1H6S1 1HXTA 2Y7SA 4LSHA 3BS0A 2K4TA 2GE4A 2XE5A 8PRNA 2XE3A 2JMMA 1MPFA 3UPGA 4KR4A 1Q9FA 3AA6A 2IWVA 3BRYA 4C4VA 3NSGA 3LK42 1Q9GA 3LK3A 4FRTA 4JCHA 3WU2O 3WI4A 2FGRA 3T24A 4FT6A 5DL8A 2ZLDA 2R4LA 4GHBA 2XTRA 4KRAA 3TZGA 2XTQA 3C5OA 3UAQA 3VY8X 4O3YA 1IZNA 4CTDA 3POXA 3A2SX 4U9CA 4UB6O 4B61A 3LK41 3NJTA 2Y0LA 1ZHZA 2M06A 3AA6B 4AKMA 4AYID 2KDYA 3SY7A 4K3CA 2MHLA 3JCUO 5PRNA 4O3WA 3VZUX 3SYSA 4AZLA 2OMFA 3PQUA 5JDPA 2M07A 1QJPA 1GFPA 4D64A 4PUXA 5KAIO 3POQA 4C00A 2R4PA 3GP6A 1E54A 2LFUA 1HXXA 1MM5A 3SZDA 2WVPA 3UU2A 3VE1A 3KVDD 5ADXK 4G75A 3SYBA 1OSMA 4GCPA 4N74A 2F1CX 5DL7A 3V8UA 5T5FA 3LK2B 3RBHA 2YPVA 4AYDC 4BUMX 4C69X 5B66O 2PORA 4FESA 4AFKA 4AYEC 1MM4A 2F1VA 2N2MA 4FQEA 4FMSA 4FUVA 5DL5A 1YS5A 4LSFA 3DWOX 3AA1A 5G38A 5H2FO 4FOZA 4E1TA 3T20A 1G90A 4AKRB 3JTYA 2XE2A 3AAAB 2FGQX 3DWNA 2XE1A 3PGSA 2IWWA 1PRNA 2KZ7A 2ZFGA 3AA0B 1IZNB 4FSOA 3SY9A 2X9KA 2J1NA 2MNHA 1ZHTA 3AA7B 4E1SA 4AYMC 3HOEA 3K19A 3FYXA 2F1TA
chains in the Genus database with same CATH topology
4QQ1A 2W81C 1ZHXA 4FZNA 2Y0KA 4LSEA 4AYNA 2LHFA 5ADXL 2X27X 3HWBA 4GF4A 4D65A 1QJ8A 1BXWA 3AAAA 4O49A 3G7GA 2XG6A 3SZVA 4XNLA 4JFBA 5G26A 3QRCA 3AAEB 4O3ZA 2ODJA 3PQSA 3LK2A 4RL9A 5D5DA 3HOLA 5FVNA 3UU2A 1ZHWA 2Y0HA 1GFNA 4RLCA 3AA1B 4O4UA 1QJ9A 4FRXA 4FSPA 4F4BA 4G76A 2KZ7B 2J4UP 5GV0A 1ZHYA 1BH3A 5EE2A 2O4VA 1OPFA 1P4TA 3PRNA 3PORA 4RJWA 3VZWX 2PRNA 4RJXA 1THQA 3VZTX 3T0SA 4O4XA 2KXPB 4GCQA 3DA4A 4FZMA 4AKRA 7PRNA 3EMNX 2Y2XA 3DA3A 1GFMA 3WI5A 5AFUL 5IYUA 3O0EA 2KC0A 2KXPA 2YNKA 3AA0A 4FZLA 3AA7A 4D5UA 1BT9A 4N59A 2K0LA 3QRAA 4XNKA 3VY9X 3POUA 4O3XB 4AUIA 2XMXA 3LK3B 1PHOA 5DL6A 6PRNA 4KR8A 2W80C 5AFUK 4GCSA 1ORMA 1GFQA 2ERVA 3AAEA 3HW9A 4Z3TA 2QTKA 4N58A 4RLBA 1GFOA 1HXUA 4LSIA 2N2LA 3VE2A 1H6S1 1HXTA 2Y7SA 4LSHA 2K4TA 2GE4A 2XE5A 8PRNA 2XE3A 2JMMA 1MPFA 3UPGA 4KR4A 1Q9FA 3AA6A 3NSGA 3LK42 1Q9GA 3LK3A 4FRTA 4JCHA 3WI4A 2FGRA 3T24A 4FT6A 5DL8A 2ZLDA 4GHBA 2XTRA 4KRAA 3TZGA 2XTQA 3C5OA 3UAQA 3VY8X 4O3YA 1IZNA 3POXA 3A2SX 4U9CA 4B61A 3LK41 4AYID 2Y0LA 1ZHZA 2M06A 3AA6B 4AKMA 3T20A 2KDYA 3SY7A 5PRNA 2MHLA 3VZUX 4AZLA 4O3WA 3SYSA 2OMFA 3PQUA 5JDPA 2M07A 1QJPA 1GFPA 4D64A 4PUXA 3POQA 3GP6A 1E54A 2LFUA 1HXXA 1MM5A 3SZDA 3VE1A 3KVDD 5ADXK 4G75A 3SYBA 1OSMA 4GCPA 3V8UA 5DL7A 5T5FA 3LK2B 3RBHA 2YPVA 4AYDC 4BUMX 4C69X 2PORA 4FESA 4AFKA 4AYEC 1MM4A 2F1VA 2N2MA 4FUVA 4FMSA 5DL5A 1YS5A 4LSFA 1G90A 3AA1A 4FOZA 4E1TA 4AKRB 3JTYA 2XE2A 3AAAB 2FGQX 2XE1A 1PRNA 2KZ7A 2ZFGA 3AA0B 1IZNB 4FSOA 3SY9A 2J1NA 2MNHA 1ZHTA 3AA7B 4E1SA 4AYMC 3HOEA 3K19A 3FYXA 2F1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0K A;  4LSE A;  3HWB A;  4D65 A;  2XG6 A;  3SZV A;  4JFB A;  2ODJ A;  3UU2 A;  5FVN A;  2Y0H A;  1GFN A;  4FRX A;  4FSP A;  2J4U P;  1BH3 A;  2O4V A;  1OPF A;  3PRN A;  3POR A;  4RJW A;  3VZW X;  2PRN A;  4RJX A;  3FYX A;  3VZT X;  3T0S A;  4GCQ A;  7PRN A;  3EMN X;  2Y2X A;  1GFM A;  3WI5 A;  3O0E A;  4D5U A;  1BT9 A;  4AUI A;  3VY9 X;  3POU A;  1PHO A;  5DL6 A;  6PRN A;  4KR8 A;  1GFQ A;  3HW9 A;  2QTK A;  1GFO A;  1HXU A;  4LSI A;  1H6S 1;  1HXT A;  4LSH A;  2K4T A;  2XE5 A;  8PRN A;  2XE3 A;  3UPG A;  1MPF A;  4KR4 A;  3NSG A;  4FRT A;  3WI4 A;  2FGR A;  3T24 A;  4FT6 A;  5DL8 A;  2ZLD A;  4KRA A;  3VY8 X;  3POX A;  3A2S X;  2Y0L A;  3T20 A;  3VZU X;  3SY7 A;  5PRN A;  3SYS A;  2OMF A;  5JDP A;  1GFP A;  4D64 A;  3POQ A;  1E54 A;  1HXX A;  3SZD A;  3SYB A;  1OSM A;  4GCP A;  5DL7 A;  4BUM X;  4C69 X;  2POR A;  4FMS A;  5DL5 A;  4LSF A;  4FOZ A;  3JTY A;  2XE2 A;  2FGQ X;  2XE1 A;  1PRN A;  2ZFG A;  4FSO A;  3SY9 A;  2J1N A;  3K19 A;  4GCS A; 
#chains in the Genus database with same CATH topology
 4QQ1 A;  2W81 C;  4N75 A;  1ZHX A;  4FZN A;  2Y0K A;  4LSE A;  4UB8 O;  4AYN A;  2LHF A;  5ADX L;  3PF1 A;  2X27 X;  3HWB A;  4GF4 A;  4D65 A;  1QJ8 A;  1BXW A;  3AAA A;  4O49 A;  3G7G A;  2XG6 A;  2R88 A;  3SZV A;  4XNL A;  4JFB A;  5G26 A;  3DZM A;  3QRC A;  3AAE B;  4O3Z A;  2ODJ A;  3A0H O;  3LK2 A;  3PQS A;  4RL9 A;  3HOL A;  1T16 A;  5D5D A;  1ZHW A;  5FVN A;  3KZI O;  5TIS O;  2Y0H A;  5GTH O;  1GFN A;  4RLC A;  3AA1 B;  4O4U A;  1QJ9 A;  4FRX A;  4IL6 O;  2R8A A;  2R4N A;  4FSP A;  2WJQ A;  4F4B A;  4G76 A;  2KZ7 B;  2R4O A;  2AXT O;  2J4U P;  5GV0 A;  1ZHY A;  1BH3 A;  5EE2 A;  2O4V A;  5G3A A;  3A0B O;  4K3B A;  1OPF A;  1P4T A;  3PRN A;  3POR A;  4RJW A;  3VZW X;  4PR7 A;  2PRN A;  5KAF O;  4RJX A;  4C4V B;  1THQ A;  3VZT X;  3T0S A;  4O4X A;  2KXP B;  4GCQ A;  2R89 A;  3DA4 A;  3PGU A;  4FZM A;  4PJ0 O;  5GTI O;  4AKR A;  5B5E O;  3EMN X;  7PRN A;  2WJR A;  2Y2X A;  1GFM A;  3DA3 A;  3WI5 A;  5AFU L;  5IYU A;  2JQY A;  3O0E A;  5G39 A;  2KC0 A;  2KXP A;  2YNK A;  3AA0 A;  4FZL A;  1S5L O;  3AA7 A;  4D5U A;  1BT9 A;  4N59 A;  2K0L A;  3QRA A;  4XNK A;  3VY9 X;  3POU A;  4O3X B;  4AUI A;  2XMX A;  3LK3 B;  1T1L A;  1PHO A;  3BRZ A;  3PGR A;  5DL6 A;  6PRN A;  4KR8 A;  2W80 C;  5AFU K;  5E79 O;  4GCS A;  1ORM A;  1GFQ A;  2ERV A;  3AAE A;  3HW9 A;  4Z3T A;  2QTK A;  4N58 A;  4RLB A;  1GFO A;  1HXU A;  4LSI A;  2N2L A;  3VE2 A;  1H6S 1;  1HXT A;  2Y7S A;  4LSH A;  3BS0 A;  2K4T A;  2GE4 A;  2XE5 A;  8PRN A;  2XE3 A;  2JMM A;  1MPF A;  3UPG A;  4KR4 A;  1Q9F A;  3AA6 A;  2IWV A;  3BRY A;  4C4V A;  3NSG A;  3LK4 2;  1Q9G A;  3LK3 A;  4FRT A;  4JCH A;  3WU2 O;  3WI4 A;  2FGR A;  3T24 A;  4FT6 A;  5DL8 A;  2ZLD A;  2R4L A;  4GHB A;  2XTR A;  4KRA A;  3TZG A;  2XTQ A;  3C5O A;  3UAQ A;  3VY8 X;  4O3Y A;  1IZN A;  4CTD A;  3POX A;  3A2S X;  4U9C A;  4UB6 O;  4B61 A;  3LK4 1;  3NJT A;  2Y0L A;  1ZHZ A;  2M06 A;  3AA6 B;  4AKM A;  4AYI D;  2KDY A;  3SY7 A;  4K3C A;  2MHL A;  3JCU O;  5PRN A;  4O3W A;  3VZU X;  3SYS A;  4AZL A;  2OMF A;  3PQU A;  5JDP A;  2M07 A;  1QJP A;  1GFP A;  4D64 A;  4PUX A;  5KAI O;  3POQ A;  4C00 A;  2R4P A;  3GP6 A;  1E54 A;  2LFU A;  1HXX A;  1MM5 A;  3SZD A;  2WVP A;  3UU2 A;  3VE1 A;  3KVD D;  5ADX K;  4G75 A;  3SYB A;  1OSM A;  4GCP A;  4N74 A;  2F1C X;  5DL7 A;  3V8U A;  5T5F A;  3LK2 B;  3RBH A;  2YPV A;  4AYD C;  4BUM X;  4C69 X;  5B66 O;  2POR A;  4FES A;  4AFK A;  4AYE C;  1MM4 A;  2F1V A;  2N2M A;  4FQE A;  4FMS A;  4FUV A;  5DL5 A;  1YS5 A;  4LSF A;  3DWO X;  3AA1 A;  5G38 A;  5H2F O;  4FOZ A;  4E1T A;  3T20 A;  1G90 A;  4AKR B;  3JTY A;  2XE2 A;  3AAA B;  2FGQ X;  3DWN A;  2XE1 A;  3PGS A;  2IWW A;  1PRN A;  2KZ7 A;  2ZFG A;  3AA0 B;  1IZN B;  4FSO A;  3SY9 A;  2X9K A;  2J1N A;  2MNH A;  1ZHT A;  3AA7 B;  4E1S A;  4AYM C;  3HOE A;  3K19 A;  3FYX A;  2F1T A; 
#chains in the Genus database with same CATH homology
 4QQ1 A;  2W81 C;  1ZHX A;  4FZN A;  2Y0K A;  4LSE A;  4AYN A;  2LHF A;  5ADX L;  2X27 X;  3HWB A;  4GF4 A;  4D65 A;  1QJ8 A;  1BXW A;  3AAA A;  4O49 A;  3G7G A;  2XG6 A;  3SZV A;  4XNL A;  4JFB A;  5G26 A;  3QRC A;  3AAE B;  4O3Z A;  2ODJ A;  3PQS A;  3LK2 A;  4RL9 A;  5D5D A;  3HOL A;  5FVN A;  3UU2 A;  1ZHW A;  2Y0H A;  1GFN A;  4RLC A;  3AA1 B;  4O4U A;  1QJ9 A;  4FRX A;  4FSP A;  4F4B A;  4G76 A;  2KZ7 B;  2J4U P;  5GV0 A;  1ZHY A;  1BH3 A;  5EE2 A;  2O4V A;  1OPF A;  1P4T A;  3PRN A;  3POR A;  4RJW A;  3VZW X;  2PRN A;  4RJX A;  1THQ A;  3VZT X;  3T0S A;  4O4X A;  2KXP B;  4GCQ A;  3DA4 A;  4FZM A;  4AKR A;  7PRN A;  3EMN X;  2Y2X A;  3DA3 A;  1GFM A;  3WI5 A;  5AFU L;  5IYU A;  3O0E A;  2KC0 A;  2KXP A;  2YNK A;  3AA0 A;  4FZL A;  3AA7 A;  4D5U A;  1BT9 A;  4N59 A;  2K0L A;  3QRA A;  4XNK A;  3VY9 X;  3POU A;  4O3X B;  4AUI A;  2XMX A;  3LK3 B;  1PHO A;  5DL6 A;  6PRN A;  4KR8 A;  2W80 C;  5AFU K;  4GCS A;  1ORM A;  1GFQ A;  2ERV A;  3AAE A;  3HW9 A;  4Z3T A;  2QTK A;  4N58 A;  4RLB A;  1GFO A;  1HXU A;  4LSI A;  2N2L A;  3VE2 A;  1H6S 1;  1HXT A;  2Y7S A;  4LSH A;  2K4T A;  2GE4 A;  2XE5 A;  8PRN A;  2XE3 A;  2JMM A;  1MPF A;  3UPG A;  4KR4 A;  1Q9F A;  3AA6 A;  3NSG A;  3LK4 2;  1Q9G A;  3LK3 A;  4FRT A;  4JCH A;  3WI4 A;  2FGR A;  3T24 A;  4FT6 A;  5DL8 A;  2ZLD A;  4GHB A;  2XTR A;  4KRA A;  3TZG A;  2XTQ A;  3C5O A;  3UAQ A;  3VY8 X;  4O3Y A;  1IZN A;  3POX A;  3A2S X;  4U9C A;  4B61 A;  3LK4 1;  4AYI D;  2Y0L A;  1ZHZ A;  2M06 A;  3AA6 B;  4AKM A;  3T20 A;  2KDY A;  3SY7 A;  5PRN A;  2MHL A;  3VZU X;  4AZL A;  4O3W A;  3SYS A;  2OMF A;  3PQU A;  5JDP A;  2M07 A;  1QJP A;  1GFP A;  4D64 A;  4PUX A;  3POQ A;  3GP6 A;  1E54 A;  2LFU A;  1HXX A;  1MM5 A;  3SZD A;  3VE1 A;  3KVD D;  5ADX K;  4G75 A;  3SYB A;  1OSM A;  4GCP A;  3V8U A;  5DL7 A;  5T5F A;  3LK2 B;  3RBH A;  2YPV A;  4AYD C;  4BUM X;  4C69 X;  2POR A;  4FES A;  4AFK A;  4AYE C;  1MM4 A;  2F1V A;  2N2M A;  4FUV A;  4FMS A;  5DL5 A;  1YS5 A;  4LSF A;  1G90 A;  3AA1 A;  4FOZ A;  4E1T A;  4AKR B;  3JTY A;  2XE2 A;  3AAA B;  2FGQ X;  2XE1 A;  1PRN A;  2KZ7 A;  2ZFG A;  3AA0 B;  1IZN B;  4FSO A;  3SY9 A;  2J1N A;  2MNH A;  1ZHT A;  3AA7 B;  4E1S A;  4AYM C;  3HOE A;  3K19 A;  3FYX A;  2F1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...