3T20A

Crystal structure of pseudomonas aeruginosa occk5 (opdh)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
391
structure length
362
Chain Sequence
AGFLEDSKASLETRNFYMNRDFRKREEWAQGFILNLQSGYTQGTVGFGLDAMGMLGVKLDSPDTYSKLGLTAKVKVSQSELKVGTLIPKLPSVQPNNGRIFPQIFEGALLTSKEIKDLGFTAGRLEKTKIDSEDLALNDKNGRFAGVSADHFDLGGLDYKLTDQLTASYHYSNLQDVYRQHFVGLLHSWPIGPGELTSDLRFARSTDSGSAKAGGIDNKSLNGMFTYSLGNHAFGAAWQRMNGDDAFPYLEGSNPYLVNFVQVNDFAGPKERSWQLRYDYDFVGLGIPGLTFMTRYVKGDNVELAGQGEGREWERNTELQYVFQSGALKNLGIRWRNATFRSNFTRDIDENRLIVSYTLPIW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cis-aconitate porin OpdH
publication title Substrate Specificity within a Family of Outer Membrane Carboxylate Channels.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
total genus 95
structure length 362
sequence length 391
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3t20A01
4D65A 4LSHA 1E54A 1HXUA 2XE3A 5DL7A 4FRTA 1OSMA 1GFPA 3SYBA 2PORA 3SY7A 5JDPA 3PRNA 1GFOA 2Y0LA 3SYSA 4FMSA 3JTYA 3SZDA 2ODJA 4LSEA 4LSIA 3WI4A 4FOZA 2PRNA 2XE1A 3POXA 2K4TA 2J4UP 4FSPA 2XG6A 2Y2XA 3NSGA 2ZFGA 5DL5A 4C69X 5DL6A 1PHOA 2XE5A 4RJXA 8PRNA 1MPFA 4RJWA 3T24A 4BUMX 3T20A 2FGQX 3POQA 4KRAA 2QTKA 4FRXA 4AUIA 1GFNA 5FVNA 3A2SX 3VZWX 3VZTX 4GCQA 5PRNA 3K19A 4GCPA 3UPGA 1HXTA 2FGRA 3VY8X 4D64A 2Y0KA 3FYXA 2Y0HA 3POUA 3WI5A 4LSFA 6PRNA 2ZLDA 3HWBA 3T0SA 1H6S1 4FT6A 5DL8A 1BT9A 4GCSA 2XE2A 2J1NA 4D5UA 1GFQA 1PRNA 3EMNX 3VY9X 3PORA 7PRNA 1GFMA 3O0EA 4KR4A 4FSOA 3VZUX 3HW9A 2O4VA 1BH3A 1HXXA 3SY9A 2OMFA 1OPFA 4JFBA 3SZVA 3UU2A 4KR8A
chains in the Genus database with same CATH superfamily
3C5OA 4FZLA 2WVPA 2N2LA 4LSHA 4AYID 4D65A 1E54A 4Z3TA 2WJRA 1HXUA 3KVDD 4O3ZA 4RLBA 5GTIO 2XE3A 4O49A 5DL7A 4FRTA 2R8AA 5D5DA 5KAFO 4C00A 4FQEA 1OSMA 3JCUO 1QJ8A 3AA0B 4AFKA 1GFPA 1QJPA 2MHLA 3SYBA 3KZIO 4AKRB 4AKMA 3LK3A 3AA6B 2PORA 4AYMC 4GHBA 3SY7A 3DWOX 2YNKA 3QRAA 2YPVA 5JDPA 4K3CA 4F4BA 3PRNA 1GFOA 2Y0LA 3VE1A 5B66O 4RL9A 3V8UA 2K0LA 3SYSA 4FMSA 4FESA 3AAAA 3A0HO 3DA4A 3JTYA 3PQSA 3QRCA 4O4XA 2ODJA 4LSEA 3SZDA 1MM5A 3AA1B 1ZHWA 4PUXA 1ZHTA 4LSIA 3LK2A 4UB6O 3VE2A 3WI4A 4FOZA 2PRNA 2XE1A 3POXA 2KXPB 2XTRA 2K4TA 3AAEB 2J4UP 3PQUA 4FSPA 4IL6O 2XG6A 4CTDA 2Y7SA 4O3YA 1T1LA 3HOLA 2R4OA 3BS0A 5G38A 2Y2XA 3AA7B 3NSGA 2ERVA 2ZFGA 5DL5A 5EE2A 3G7GA 5DL6A 4C69X 1PHOA 2XE5A 4C4VA 1IZNA 2R4LA 4E1SA 5G3AA 4RJXA 3PGRA 5G26A 1ORMA 2JMMA 8PRNA 1MPFA 3RBHA 4RJWA 3UAQA 3T24A 1P4TA 4BUMX 3T20A 2IWWA 4RLCA 2R88A 5GTHO 2FGQX 3POQA 4KRAA 5E79O 2AXTO 2QTKA 3NJTA 5AFUK 1ZHXA 2X9KA 2F1TA 5T5FA 2LHFA 4FRXA 4AUIA 1THQA 1GFNA 3GP6A 4FZMA 3BRZA 5FVNA 4G75A 3A2SX 3VZWX 5IYUA 3HOEA 3TZGA 4GCQA 5PRNA 3VZTX 3K19A 4GCPA 1YS5A 2R89A 3UPGA 2W81C 2XMXA 1G90A 2KZ7A 1HXTA 3LK42 4PJ0O 3PGUA 2FGRA 3LK3B 4N58A 4UB8O 3VY8X 4AYDC 5KAIO 4D64A 4FUVA 2Y0KA 3FYXA 2Y0HA 3DZMA 3POUA 5ADXK 3DWNA 3WI5A 4G76A 4LSFA 3AAAB 4GF4A 2KC0A 3PF1A 4U9CA 2N2MA 4AYEC 2ZLDA 3HWBA 3AA0A 6PRNA 2M07A 3T0SA 1ZHYA 1BXWA 4AKRA 1H6S1 3AA6A 2KDYA 3LK2B 4FT6A 2IWVA 4AZLA 1MM4A 2F1CX 2LFUA 5DL8A 1BT9A 4GCSA 4N59A 2R4PA 2X27X 2WJQA 2W80C 2XE2A 4O4UA 2J1NA 4PR7A 3WU2O 4D5UA 5GV0A 1GFQA 1PRNA 3AA1A 3EMNX 3VY9X 4C4VB 1IZNB 2M06A 2GE4A 2MNHA 4K3BA 3PGSA 3PORA 4XNLA 7PRNA 1GFMA 2JQYA 2KXPA 3O0EA 3AAEA 4FSOA 4KR4A 4O3XB 4QQ1A 4B61A 3VZUX 5AFUL 4JCHA 5TISO 3HW9A 2O4VA 1BH3A 4E1TA 1HXXA 3SY9A 5H2FO 3AA7A 3DA3A 4AYNA 2OMFA 4O3WA 5B5EO 1S5LO 1Q9FA 1OPFA 4XNKA 3LK41 4JFBA 4N75A 3A0BO 1ZHZA 4FZNA 3SZVA 3UU2A 1QJ9A 2F1VA 2XTQA 3BRYA 4N74A 2R4NA 2KZ7B 5G39A 5ADXL 4KR8A 1T16A 1Q9GA
chains in the Genus database with same CATH topology
3C5OA 4FZLA 2N2LA 4LSHA 4AYID 4D65A 1E54A 4Z3TA 1HXUA 3KVDD 4O3ZA 4RLBA 2XE3A 4O49A 5DL7A 4FRTA 5D5DA 1OSMA 1QJ8A 3AA0B 4AFKA 1GFPA 1QJPA 2MHLA 3SYBA 4AKRB 4AKMA 3LK3A 3AA6B 2PORA 4AYMC 4GHBA 3SY7A 2YNKA 3QRAA 2YPVA 5JDPA 4F4BA 3PRNA 1GFOA 2Y0LA 3VE1A 4RL9A 3V8UA 2K0LA 3SYSA 4FMSA 4FESA 3AAAA 3DA4A 3JTYA 3QRCA 3PQSA 4O4XA 3SZDA 2ODJA 4LSEA 1MM5A 3AA1B 1ZHWA 4PUXA 1ZHTA 4LSIA 3LK2A 3VE2A 3WI4A 4FOZA 2PRNA 2XE1A 3POXA 2KXPB 2K4TA 3AAEB 2J4UP 3PQUA 4FSPA 2XG6A 2Y7SA 4O3YA 3HOLA 2Y2XA 3AA7B 3NSGA 2ERVA 2ZFGA 5DL5A 5EE2A 3G7GA 5DL6A 4C69X 1PHOA 2XE5A 1IZNA 4E1SA 4RJXA 5G26A 1ORMA 2JMMA 8PRNA 1MPFA 3RBHA 4RJWA 3UAQA 3T24A 1P4TA 4BUMX 3T20A 4RLCA 2FGQX 3POQA 4KRAA 2QTKA 5AFUK 1ZHXA 5GV0A 2F1TA 5T5FA 2LHFA 4FRXA 4AUIA 1THQA 1GFNA 3GP6A 4FZMA 5FVNA 4G75A 3A2SX 3VZWX 5IYUA 3HOEA 3TZGA 4GCQA 5PRNA 3VZTX 3K19A 4GCPA 1YS5A 3UPGA 1G90A 2W81C 2XMXA 2KZ7A 1HXTA 3LK42 4AYDC 2FGRA 3LK3B 4N58A 3VY8X 4D64A 4FUVA 2Y0KA 3FYXA 2Y0HA 3POUA 5ADXK 3WI5A 4G76A 4LSFA 3AAAB 4GF4A 2KC0A 4U9CA 2N2MA 4AYEC 2ZLDA 3HWBA 3AA0A 6PRNA 2M07A 3T0SA 1ZHYA 1BXWA 4AKRA 1H6S1 3AA6A 2KDYA 3LK2B 4FT6A 4AZLA 1MM4A 2LFUA 5DL8A 1BT9A 4GCSA 4N59A 2X27X 4O4UA 2W80C 2XE2A 2J1NA 4D5UA 1GFQA 1PRNA 3AA1A 3EMNX 3VY9X 1IZNB 2M06A 2GE4A 2MNHA 3PORA 4XNLA 7PRNA 1GFMA 2KXPA 3O0EA 4KR4A 3AAEA 4FSOA 4O3XB 4QQ1A 4B61A 5AFUL 3VZUX 4JCHA 3HW9A 2O4VA 1BH3A 4E1TA 1HXXA 3SY9A 3AA7A 3DA3A 4AYNA 2OMFA 4O3WA 1Q9FA 1OPFA 4XNKA 3LK41 4JFBA 4FZNA 1ZHZA 3SZVA 3UU2A 1QJ9A 2F1VA 2XTQA 2KZ7B 5ADXL 4KR8A 2XTRA 1Q9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D65 A;  4LSH A;  1E54 A;  1HXU A;  2XE3 A;  5DL7 A;  4FRT A;  1OSM A;  1GFP A;  3SYB A;  2POR A;  3SY7 A;  5JDP A;  3PRN A;  1GFO A;  2Y0L A;  3SYS A;  4FMS A;  3JTY A;  3SZD A;  2ODJ A;  4LSE A;  4LSI A;  3WI4 A;  4FOZ A;  2PRN A;  2XE1 A;  3POX A;  2K4T A;  2J4U P;  4FSP A;  2XG6 A;  2Y2X A;  3NSG A;  2ZFG A;  5DL5 A;  4C69 X;  5DL6 A;  1PHO A;  2XE5 A;  4RJX A;  8PRN A;  1MPF A;  4RJW A;  3T24 A;  4BUM X;  3T20 A;  2FGQ X;  3POQ A;  4KRA A;  2QTK A;  4FRX A;  4AUI A;  1GFN A;  5FVN A;  3A2S X;  3VZW X;  3VZT X;  4GCQ A;  5PRN A;  3K19 A;  4GCP A;  3UPG A;  1HXT A;  2FGR A;  3VY8 X;  4D64 A;  2Y0K A;  3FYX A;  2Y0H A;  3POU A;  3WI5 A;  4LSF A;  6PRN A;  2ZLD A;  3HWB A;  3T0S A;  1H6S 1;  4FT6 A;  5DL8 A;  1BT9 A;  4GCS A;  2XE2 A;  2J1N A;  4D5U A;  1GFQ A;  1PRN A;  3EMN X;  3VY9 X;  3POR A;  7PRN A;  1GFM A;  3O0E A;  4KR4 A;  4FSO A;  3VZU X;  3HW9 A;  2O4V A;  1BH3 A;  1HXX A;  3SY9 A;  2OMF A;  1OPF A;  4JFB A;  3SZV A;  3UU2 A;  4KR8 A; 
#chains in the Genus database with same CATH topology
 3C5O A;  4FZL A;  2WVP A;  2N2L A;  4LSH A;  4AYI D;  4D65 A;  1E54 A;  4Z3T A;  2WJR A;  1HXU A;  3KVD D;  4O3Z A;  4RLB A;  5GTI O;  2XE3 A;  4O49 A;  5DL7 A;  4FRT A;  2R8A A;  5D5D A;  5KAF O;  4C00 A;  4FQE A;  1OSM A;  3JCU O;  1QJ8 A;  3AA0 B;  4AFK A;  1GFP A;  1QJP A;  2MHL A;  3SYB A;  3KZI O;  4AKR B;  4AKM A;  3LK3 A;  3AA6 B;  2POR A;  4AYM C;  4GHB A;  3SY7 A;  3DWO X;  2YNK A;  3QRA A;  2YPV A;  5JDP A;  4K3C A;  4F4B A;  3PRN A;  1GFO A;  2Y0L A;  3VE1 A;  5B66 O;  4RL9 A;  3V8U A;  2K0L A;  3SYS A;  4FMS A;  4FES A;  3AAA A;  3A0H O;  3DA4 A;  3JTY A;  3PQS A;  3QRC A;  4O4X A;  2ODJ A;  4LSE A;  3SZD A;  1MM5 A;  3AA1 B;  1ZHW A;  4PUX A;  1ZHT A;  4LSI A;  3LK2 A;  4UB6 O;  3VE2 A;  3WI4 A;  4FOZ A;  2PRN A;  2XE1 A;  3POX A;  2KXP B;  2XTR A;  2K4T A;  3AAE B;  2J4U P;  3PQU A;  4FSP A;  4IL6 O;  2XG6 A;  4CTD A;  2Y7S A;  4O3Y A;  1T1L A;  3HOL A;  2R4O A;  3BS0 A;  5G38 A;  2Y2X A;  3AA7 B;  3NSG A;  2ERV A;  2ZFG A;  5DL5 A;  5EE2 A;  3G7G A;  5DL6 A;  4C69 X;  1PHO A;  2XE5 A;  4C4V A;  1IZN A;  2R4L A;  4E1S A;  5G3A A;  4RJX A;  3PGR A;  5G26 A;  1ORM A;  2JMM A;  8PRN A;  1MPF A;  3RBH A;  4RJW A;  3UAQ A;  3T24 A;  1P4T A;  4BUM X;  3T20 A;  2IWW A;  4RLC A;  2R88 A;  5GTH O;  2FGQ X;  3POQ A;  4KRA A;  5E79 O;  2AXT O;  2QTK A;  3NJT A;  5AFU K;  1ZHX A;  2X9K A;  2F1T A;  5T5F A;  2LHF A;  4FRX A;  4AUI A;  1THQ A;  1GFN A;  3GP6 A;  4FZM A;  3BRZ A;  5FVN A;  4G75 A;  3A2S X;  3VZW X;  5IYU A;  3HOE A;  3TZG A;  4GCQ A;  5PRN A;  3VZT X;  3K19 A;  4GCP A;  1YS5 A;  2R89 A;  3UPG A;  2W81 C;  2XMX A;  1G90 A;  2KZ7 A;  1HXT A;  3LK4 2;  4PJ0 O;  3PGU A;  2FGR A;  3LK3 B;  4N58 A;  4UB8 O;  3VY8 X;  4AYD C;  5KAI O;  4D64 A;  4FUV A;  2Y0K A;  3FYX A;  2Y0H A;  3DZM A;  3POU A;  5ADX K;  3DWN A;  3WI5 A;  4G76 A;  4LSF A;  3AAA B;  4GF4 A;  2KC0 A;  3PF1 A;  4U9C A;  2N2M A;  4AYE C;  2ZLD A;  3HWB A;  3AA0 A;  6PRN A;  2M07 A;  3T0S A;  1ZHY A;  1BXW A;  4AKR A;  1H6S 1;  3AA6 A;  2KDY A;  3LK2 B;  4FT6 A;  2IWV A;  4AZL A;  1MM4 A;  2F1C X;  2LFU A;  5DL8 A;  1BT9 A;  4GCS A;  4N59 A;  2R4P A;  2X27 X;  2WJQ A;  2W80 C;  2XE2 A;  4O4U A;  2J1N A;  4PR7 A;  3WU2 O;  4D5U A;  5GV0 A;  1GFQ A;  1PRN A;  3AA1 A;  3EMN X;  3VY9 X;  4C4V B;  1IZN B;  2M06 A;  2GE4 A;  2MNH A;  4K3B A;  3PGS A;  3POR A;  4XNL A;  7PRN A;  1GFM A;  2JQY A;  2KXP A;  3O0E A;  3AAE A;  4FSO A;  4KR4 A;  4O3X B;  4QQ1 A;  4B61 A;  3VZU X;  5AFU L;  4JCH A;  5TIS O;  3HW9 A;  2O4V A;  1BH3 A;  4E1T A;  1HXX A;  3SY9 A;  5H2F O;  3AA7 A;  3DA3 A;  4AYN A;  2OMF A;  4O3W A;  5B5E O;  1S5L O;  1Q9F A;  1OPF A;  4XNK A;  3LK4 1;  4JFB A;  4N75 A;  3A0B O;  1ZHZ A;  4FZN A;  3SZV A;  3UU2 A;  1QJ9 A;  2F1V A;  2XTQ A;  3BRY A;  4N74 A;  2R4N A;  2KZ7 B;  5G39 A;  5ADX L;  4KR8 A;  1T16 A;  1Q9G A; 
#chains in the Genus database with same CATH homology
 3C5O A;  4FZL A;  2N2L A;  4LSH A;  4AYI D;  4D65 A;  1E54 A;  4Z3T A;  1HXU A;  3KVD D;  4O3Z A;  4RLB A;  2XE3 A;  4O49 A;  5DL7 A;  4FRT A;  5D5D A;  1OSM A;  1QJ8 A;  3AA0 B;  4AFK A;  1GFP A;  1QJP A;  2MHL A;  3SYB A;  4AKR B;  4AKM A;  3LK3 A;  3AA6 B;  2POR A;  4AYM C;  4GHB A;  3SY7 A;  2YNK A;  3QRA A;  2YPV A;  5JDP A;  4F4B A;  3PRN A;  1GFO A;  2Y0L A;  3VE1 A;  4RL9 A;  3V8U A;  2K0L A;  3SYS A;  4FMS A;  4FES A;  3AAA A;  3DA4 A;  3JTY A;  3QRC A;  3PQS A;  4O4X A;  3SZD A;  2ODJ A;  4LSE A;  1MM5 A;  3AA1 B;  1ZHW A;  4PUX A;  1ZHT A;  4LSI A;  3LK2 A;  3VE2 A;  3WI4 A;  4FOZ A;  2PRN A;  2XE1 A;  3POX A;  2KXP B;  2K4T A;  3AAE B;  2J4U P;  3PQU A;  4FSP A;  2XG6 A;  2Y7S A;  4O3Y A;  3HOL A;  2Y2X A;  3AA7 B;  3NSG A;  2ERV A;  2ZFG A;  5DL5 A;  5EE2 A;  3G7G A;  5DL6 A;  4C69 X;  1PHO A;  2XE5 A;  1IZN A;  4E1S A;  4RJX A;  5G26 A;  1ORM A;  2JMM A;  8PRN A;  1MPF A;  3RBH A;  4RJW A;  3UAQ A;  3T24 A;  1P4T A;  4BUM X;  3T20 A;  4RLC A;  2FGQ X;  3POQ A;  4KRA A;  2QTK A;  5AFU K;  1ZHX A;  5GV0 A;  2F1T A;  5T5F A;  2LHF A;  4FRX A;  4AUI A;  1THQ A;  1GFN A;  3GP6 A;  4FZM A;  5FVN A;  4G75 A;  3A2S X;  3VZW X;  5IYU A;  3HOE A;  3TZG A;  4GCQ A;  5PRN A;  3VZT X;  3K19 A;  4GCP A;  1YS5 A;  3UPG A;  1G90 A;  2W81 C;  2XMX A;  2KZ7 A;  1HXT A;  3LK4 2;  4AYD C;  2FGR A;  3LK3 B;  4N58 A;  3VY8 X;  4D64 A;  4FUV A;  2Y0K A;  3FYX A;  2Y0H A;  3POU A;  5ADX K;  3WI5 A;  4G76 A;  4LSF A;  3AAA B;  4GF4 A;  2KC0 A;  4U9C A;  2N2M A;  4AYE C;  2ZLD A;  3HWB A;  3AA0 A;  6PRN A;  2M07 A;  3T0S A;  1ZHY A;  1BXW A;  4AKR A;  1H6S 1;  3AA6 A;  2KDY A;  3LK2 B;  4FT6 A;  4AZL A;  1MM4 A;  2LFU A;  5DL8 A;  1BT9 A;  4GCS A;  4N59 A;  2X27 X;  4O4U A;  2W80 C;  2XE2 A;  2J1N A;  4D5U A;  1GFQ A;  1PRN A;  3AA1 A;  3EMN X;  3VY9 X;  1IZN B;  2M06 A;  2GE4 A;  2MNH A;  3POR A;  4XNL A;  7PRN A;  1GFM A;  2KXP A;  3O0E A;  4KR4 A;  3AAE A;  4FSO A;  4O3X B;  4QQ1 A;  4B61 A;  5AFU L;  3VZU X;  4JCH A;  3HW9 A;  2O4V A;  1BH3 A;  4E1T A;  1HXX A;  3SY9 A;  3AA7 A;  3DA3 A;  4AYN A;  2OMF A;  4O3W A;  1Q9F A;  1OPF A;  4XNK A;  3LK4 1;  4JFB A;  4FZN A;  1ZHZ A;  3SZV A;  3UU2 A;  1QJ9 A;  2F1V A;  2XTQ A;  2KZ7 B;  5ADX L;  4KR8 A;  2XTR A;  1Q9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...