2PORA

Structure of porin refined at 1.8 angstroms resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
301
structure length
301
Chain Sequence
EVKLSGDARMGVMYNGDDWNFSSRSRVLFTMSGTTDSGLEFGASFKAHESVGAETGEDGTVFLSGAFGKIEMGDALGASEALFGDLYEVGYTDLDDRGGNDIPYLTGDERLTAEDNPVLLYTYSAGAFSVAASMSDGKVGETSEDDAQEMAVAAAYTFGNYTVGLGYEKIDSPDTALMADMEQLELAAIAKFGATNVKAYYADGELDRDFARAVFDLTPVAAAATAVDHKAYGLSVDSTFGATTVGGYVQVLDIDTIDDVTYYGLGASYDLGGGASIVGGIADNDLPNSDMVADLGVKFKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORIN
publication title Structure of porin refined at 1.8 A resolution.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Integral membrane protein porin
total genus 76
structure length 301
sequence length 301
ec nomenclature
pdb deposition date 1992-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13609 Porin_4 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2porA00
1OPFA 1HXUA 4GCSA 2XE1A 3SYBA 4D65A 2ZFGA 2J1NA 3POQA 3SZVA 6PRNA 4FRXA 4D5UA 1BH3A 1HXTA 2FGRA 4RJXA 3K19A 2J4UP 4FT6A 3VY8X 2OMFA 1OSMA 3SZDA 3SY9A 4FMSA 3EMNX 5DL8A 5PRNA 2ZLDA 2XG6A 3POUA 3FYXA 3HW9A 2QTKA 2Y0LA 3POXA 1GFQA 4RJWA 4LSIA 4LSHA 4KR8A 2ODJA 4LSFA 3WI5A 2XE5A 3SY7A 3PORA 3VZWX 3T24A 3VY9X 5DL7A 5DL5A 2XE2A 1GFPA 3WI4A 2K4TA 3JTYA 4D64A 2Y2XA 4LSEA 3SYSA 4JFBA 1GFMA 2O4VA 1PHOA 5FVNA 4C69X 2XE3A 4GCQA 1BT9A 3A2SX 2Y0HA 5JDPA 3UU2A 4FSOA 2FGQX 3VZTX 1GFNA 4FOZA 8PRNA 4GCPA 4KRAA 1MPFA 4FRTA 4KR4A 4BUMX 3T0SA 1H6S1 3O0EA 5DL6A 7PRNA 1E54A 2Y0KA 1PRNA 3HWBA 3UPGA 3PRNA 1GFOA 1HXXA 2PRNA 3T20A 4FSPA 3VZUX 3NSGA 2PORA 4AUIA
chains in the Genus database with same CATH superfamily
2R8AA 1OPFA 4FZLA 1ORMA 1HXUA 1QJ9A 4GCSA 2XE1A 3AA0A 5G38A 3SYBA 4D65A 4PUXA 2X27X 4AKMA 5D5DA 2ZFGA 4O3WA 2J1NA 3POQA 3LK3B 1ZHZA 4O49A 2N2LA 4FZMA 3SZVA 5B5EO 2W81C 6PRNA 4G76A 4FRXA 2LFUA 4B61A 2KXPB 5GTIO 4D5UA 2IWVA 4JCHA 4C4VB 1BH3A 1HXTA 2FGRA 4RJXA 3K19A 2J4UP 2ERVA 4FT6A 4O3XB 4PR7A 3DA3A 3PGUA 2OMFA 3VY8X 2LHFA 3LK2B 1OSMA 3SZDA 5G3AA 1QJ8A 4QQ1A 4FESA 4FMSA 3SY9A 5GV0A 2K0LA 2N2MA 3EMNX 1YS5A 5DL8A 4FZNA 1THQA 5E79O 5PRNA 1MM4A 2WJRA 2XTQA 3AA7A 3A0HO 3G7GA 4G75A 2ZLDA 3HOEA 3LK41 3NJTA 4GF4A 2KC0A 4AYMC 3AAEA 3GP6A 2XG6A 3AA6A 2W80C 3AA1A 1S5LO 3FYXA 3HW9A 3POUA 4GHBA 2AXTO 3TZGA 4AYDC 2R88A 2QTKA 2Y0LA 3PGRA 1GFQA 3JCUO 3POXA 2M06A 4LSIA 4RJWA 3UAQA 5ADXL 4K3BA 4LSHA 4KR8A 2WVPA 2ODJA 1T16A 3HOLA 5AFUL 5H2FO 3LK42 2R89A 4LSFA 3WI5A 3WU2O 2XE5A 3SY7A 3PORA 3V8UA 4AYNA 1ZHTA 2YNKA 3QRCA 5TISO 4IL6O 3AAAB 4FQEA 5EE2A 3VZWX 4AKRA 3T24A 3VY9X 1Q9FA 3QRAA 5DL7A 2F1VA 2R4NA 5DL5A 2XE2A 4AYEC 1GFPA 5KAIO 3WI4A 2K4TA 1ZHYA 3AA0B 3KVDD 2R4PA 3BRZA 4C4VA 3AAEB 4Z3TA 3PQSA 3JTYA 4RLBA 4D64A 2Y2XA 2GE4A 3PF1A 4LSEA 3SYSA 3C5OA 2R4LA 1GFMA 4JFBA 4O4UA 4CTDA 1IZNA 2IWWA 2O4VA 2XMXA 1PHOA 4U9CA 1MM5A 1Q9GA 2JQYA 4O3ZA 2MNHA 5FVNA 4C69X 4RL9A 2XE3A 4AZLA 4GCQA 1ZHWA 2Y7SA 3VE1A 3AAAA 1BT9A 3A2SX 2KXPA 2Y0HA 1P4TA 4C00A 5IYUA 3UU2A 5JDPA 4AFKA 4FSOA 2FGQX 3VZTX 1GFNA 4N59A 4FOZA 2KZ7A 4N74A 4AUIA 4FUVA 5GTHO 8PRNA 4GCPA 4XNLA 4KRAA 2MHLA 5T5FA 1MPFA 3AA7B 4FRTA 5KAFO 4AYID 3LK2A 3A0BO 2JMMA 4N58A 3KZIO 5G26A 1IZNB 4KR4A 2XTRA 5ADXK 3AA6B 4AKRB 1ZHXA 3AA1B 3DWNA 2X9KA 3BRYA 2F1CX 5AFUK 4BUMX 3T0SA 4XNKA 4E1SA 4UB6O 4F4BA 1H6S1 3O0EA 1G90A 3RBHA 5B66O 5DL6A 7PRNA 2M07A 2KDYA 3PQUA 1E54A 3DA4A 2Y0KA 2R4OA 3BS0A 3DZMA 1PRNA 3LK3A 4PJ0O 3DWOX 3HWBA 4RLCA 3PGSA 5G39A 3UPGA 2KZ7B 4N75A 2WJQA 3PRNA 1GFOA 4K3CA 1HXXA 1BXWA 2PRNA 3T20A 2F1TA 4FSPA 4O3YA 4E1TA 3VE2A 3VZUX 3NSGA 1T1LA 2PORA 2YPVA 4UB8O 4O4XA 1QJPA
chains in the Genus database with same CATH topology
1OPFA 4FZLA 1ORMA 1HXUA 1QJ9A 4GCSA 2XE1A 3AA0A 3SYBA 4D65A 4PUXA 2X27X 4AKMA 5D5DA 2ZFGA 4O3WA 2J1NA 3POQA 3LK3B 1ZHZA 4O49A 2N2LA 4FZMA 3SZVA 2W81C 6PRNA 4G76A 4FRXA 2LFUA 4B61A 2KXPB 4D5UA 4JCHA 1BH3A 1HXTA 2FGRA 4RJXA 3K19A 2J4UP 2ERVA 4FT6A 4O3XB 3DA3A 3VY8X 2OMFA 2LHFA 3LK2B 1OSMA 3SZDA 1QJ8A 4QQ1A 4FESA 4FMSA 3SY9A 5GV0A 2K0LA 2N2MA 3EMNX 1YS5A 5DL8A 4FZNA 1THQA 5PRNA 1MM4A 2XTQA 3AA7A 3G7GA 4G75A 2ZLDA 3HOEA 3LK41 4AYMC 4GF4A 2KC0A 3AAEA 3GP6A 2XG6A 3AA6A 2W80C 3AA1A 3FYXA 3HW9A 3POUA 4GHBA 3TZGA 4AKRA 4AYDC 2QTKA 2Y0LA 3POXA 1GFQA 4RJWA 2M06A 4LSIA 3UAQA 5ADXL 4LSHA 4KR8A 2ODJA 3HOLA 5AFUL 3LK42 4LSFA 3WI5A 2XE5A 3SY7A 3PORA 3V8UA 4AYNA 1ZHTA 2YNKA 3QRCA 3AAAB 5EE2A 3VZWX 3T24A 3VY9X 1Q9FA 3QRAA 5DL7A 2F1VA 5DL5A 2XE2A 4AYEC 1GFPA 3WI4A 2K4TA 1ZHYA 3AA0B 3KVDD 3AAEB 4Z3TA 3PQSA 3JTYA 4RLBA 4D64A 2Y2XA 2GE4A 4LSEA 3SYSA 3C5OA 4JFBA 1GFMA 4O4UA 1IZNA 2O4VA 2XMXA 1PHOA 4U9CA 1MM5A 1Q9GA 5FVNA 4O3ZA 2MNHA 4C69X 4RL9A 2XE3A 4AZLA 4GCQA 1ZHWA 2Y7SA 3VE1A 1BT9A 3A2SX 2KXPA 2Y0HA 1P4TA 5IYUA 5JDPA 3UU2A 4AFKA 4FSOA 2FGQX 3VZTX 1GFNA 4N59A 4FOZA 2KZ7A 4AUIA 4FUVA 8PRNA 4GCPA 4XNLA 4KRAA 2MHLA 5T5FA 1MPFA 3AA7B 4FRTA 4AYID 3LK2A 2JMMA 4N58A 5G26A 1IZNB 4KR4A 2XTRA 5ADXK 3AA6B 4AKRB 1ZHXA 3AA1B 5AFUK 4BUMX 3T0SA 4XNKA 4E1SA 4F4BA 1H6S1 3O0EA 1G90A 3RBHA 5DL6A 7PRNA 2M07A 2KDYA 3PQUA 1E54A 3DA4A 2Y0KA 1PRNA 3LK3A 4RLCA 3HWBA 3UPGA 2KZ7B 3PRNA 1GFOA 1HXXA 1BXWA 2PRNA 3T20A 2F1TA 4FSPA 4O3YA 4E1TA 3VE2A 3VZUX 3NSGA 2YPVA 2PORA 3AAAA 4O4XA 1QJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OPF A;  1HXU A;  4GCS A;  2XE1 A;  3SYB A;  4D65 A;  2ZFG A;  2J1N A;  3POQ A;  3SZV A;  6PRN A;  4FRX A;  4D5U A;  1BH3 A;  1HXT A;  2FGR A;  4RJX A;  3K19 A;  2J4U P;  4FT6 A;  3VY8 X;  2OMF A;  1OSM A;  3SZD A;  3SY9 A;  4FMS A;  3EMN X;  5DL8 A;  5PRN A;  2ZLD A;  2XG6 A;  3POU A;  3FYX A;  3HW9 A;  2QTK A;  2Y0L A;  3POX A;  1GFQ A;  4RJW A;  4LSI A;  4LSH A;  4KR8 A;  2ODJ A;  4LSF A;  3WI5 A;  2XE5 A;  3SY7 A;  3POR A;  3VZW X;  3T24 A;  3VY9 X;  5DL7 A;  5DL5 A;  2XE2 A;  1GFP A;  3WI4 A;  2K4T A;  3JTY A;  4D64 A;  2Y2X A;  4LSE A;  3SYS A;  4JFB A;  1GFM A;  2O4V A;  1PHO A;  5FVN A;  4C69 X;  2XE3 A;  4GCQ A;  1BT9 A;  3A2S X;  2Y0H A;  5JDP A;  3UU2 A;  4FSO A;  2FGQ X;  3VZT X;  1GFN A;  4FOZ A;  8PRN A;  4GCP A;  4KRA A;  1MPF A;  4FRT A;  4KR4 A;  4BUM X;  3T0S A;  1H6S 1;  3O0E A;  5DL6 A;  7PRN A;  1E54 A;  2Y0K A;  1PRN A;  3HWB A;  3UPG A;  3PRN A;  1GFO A;  1HXX A;  2PRN A;  3T20 A;  4FSP A;  3VZU X;  3NSG A;  2POR A;  4AUI A; 
#chains in the Genus database with same CATH topology
 2R8A A;  1OPF A;  4FZL A;  1ORM A;  1HXU A;  1QJ9 A;  4GCS A;  2XE1 A;  3AA0 A;  5G38 A;  3SYB A;  4D65 A;  4PUX A;  2X27 X;  4AKM A;  5D5D A;  2ZFG A;  4O3W A;  2J1N A;  3POQ A;  3LK3 B;  1ZHZ A;  4O49 A;  2N2L A;  4FZM A;  3SZV A;  5B5E O;  2W81 C;  6PRN A;  4G76 A;  4FRX A;  2LFU A;  4B61 A;  2KXP B;  5GTI O;  4D5U A;  2IWV A;  4JCH A;  4C4V B;  1BH3 A;  1HXT A;  2FGR A;  4RJX A;  3K19 A;  2J4U P;  2ERV A;  4FT6 A;  4O3X B;  4PR7 A;  3DA3 A;  3PGU A;  2OMF A;  3VY8 X;  2LHF A;  3LK2 B;  1OSM A;  3SZD A;  5G3A A;  1QJ8 A;  4QQ1 A;  4FES A;  4FMS A;  3SY9 A;  5GV0 A;  2K0L A;  2N2M A;  3EMN X;  1YS5 A;  5DL8 A;  4FZN A;  1THQ A;  5E79 O;  5PRN A;  1MM4 A;  2WJR A;  2XTQ A;  3AA7 A;  3A0H O;  3G7G A;  4G75 A;  2ZLD A;  3HOE A;  3LK4 1;  3NJT A;  4GF4 A;  2KC0 A;  4AYM C;  3AAE A;  3GP6 A;  2XG6 A;  3AA6 A;  2W80 C;  3AA1 A;  1S5L O;  3FYX A;  3HW9 A;  3POU A;  4GHB A;  2AXT O;  3TZG A;  4AYD C;  2R88 A;  2QTK A;  2Y0L A;  3PGR A;  1GFQ A;  3JCU O;  3POX A;  2M06 A;  4LSI A;  4RJW A;  3UAQ A;  5ADX L;  4K3B A;  4LSH A;  4KR8 A;  2WVP A;  2ODJ A;  1T16 A;  3HOL A;  5AFU L;  5H2F O;  3LK4 2;  2R89 A;  4LSF A;  3WI5 A;  3WU2 O;  2XE5 A;  3SY7 A;  3POR A;  3V8U A;  4AYN A;  1ZHT A;  2YNK A;  3QRC A;  5TIS O;  4IL6 O;  3AAA B;  4FQE A;  5EE2 A;  3VZW X;  4AKR A;  3T24 A;  3VY9 X;  1Q9F A;  3QRA A;  5DL7 A;  2F1V A;  2R4N A;  5DL5 A;  2XE2 A;  4AYE C;  1GFP A;  5KAI O;  3WI4 A;  2K4T A;  1ZHY A;  3AA0 B;  3KVD D;  2R4P A;  3BRZ A;  4C4V A;  3AAE B;  4Z3T A;  3PQS A;  3JTY A;  4RLB A;  4D64 A;  2Y2X A;  2GE4 A;  3PF1 A;  4LSE A;  3SYS A;  3C5O A;  2R4L A;  1GFM A;  4JFB A;  4O4U A;  4CTD A;  1IZN A;  2IWW A;  2O4V A;  2XMX A;  1PHO A;  4U9C A;  1MM5 A;  1Q9G A;  2JQY A;  4O3Z A;  2MNH A;  5FVN A;  4C69 X;  4RL9 A;  2XE3 A;  4AZL A;  4GCQ A;  1ZHW A;  2Y7S A;  3VE1 A;  3AAA A;  1BT9 A;  3A2S X;  2KXP A;  2Y0H A;  1P4T A;  4C00 A;  5IYU A;  3UU2 A;  5JDP A;  4AFK A;  4FSO A;  2FGQ X;  3VZT X;  1GFN A;  4N59 A;  4FOZ A;  2KZ7 A;  4N74 A;  4AUI A;  4FUV A;  5GTH O;  8PRN A;  4GCP A;  4XNL A;  4KRA A;  2MHL A;  5T5F A;  1MPF A;  3AA7 B;  4FRT A;  5KAF O;  4AYI D;  3LK2 A;  3A0B O;  2JMM A;  4N58 A;  3KZI O;  5G26 A;  1IZN B;  4KR4 A;  2XTR A;  5ADX K;  3AA6 B;  4AKR B;  1ZHX A;  3AA1 B;  3DWN A;  2X9K A;  3BRY A;  2F1C X;  5AFU K;  4BUM X;  3T0S A;  4XNK A;  4E1S A;  4UB6 O;  4F4B A;  1H6S 1;  3O0E A;  1G90 A;  3RBH A;  5B66 O;  5DL6 A;  7PRN A;  2M07 A;  2KDY A;  3PQU A;  1E54 A;  3DA4 A;  2Y0K A;  2R4O A;  3BS0 A;  3DZM A;  1PRN A;  3LK3 A;  4PJ0 O;  3DWO X;  3HWB A;  4RLC A;  3PGS A;  5G39 A;  3UPG A;  2KZ7 B;  4N75 A;  2WJQ A;  3PRN A;  1GFO A;  4K3C A;  1HXX A;  1BXW A;  2PRN A;  3T20 A;  2F1T A;  4FSP A;  4O3Y A;  4E1T A;  3VE2 A;  3VZU X;  3NSG A;  1T1L A;  2POR A;  2YPV A;  4UB8 O;  4O4X A;  1QJP A; 
#chains in the Genus database with same CATH homology
 1OPF A;  4FZL A;  1ORM A;  1HXU A;  1QJ9 A;  4GCS A;  2XE1 A;  3AA0 A;  3SYB A;  4D65 A;  4PUX A;  2X27 X;  4AKM A;  5D5D A;  2ZFG A;  4O3W A;  2J1N A;  3POQ A;  3LK3 B;  1ZHZ A;  4O49 A;  2N2L A;  4FZM A;  3SZV A;  2W81 C;  6PRN A;  4G76 A;  4FRX A;  2LFU A;  4B61 A;  2KXP B;  4D5U A;  4JCH A;  1BH3 A;  1HXT A;  2FGR A;  4RJX A;  3K19 A;  2J4U P;  2ERV A;  4FT6 A;  4O3X B;  3DA3 A;  3VY8 X;  2OMF A;  2LHF A;  3LK2 B;  1OSM A;  3SZD A;  1QJ8 A;  4QQ1 A;  4FES A;  4FMS A;  3SY9 A;  5GV0 A;  2K0L A;  2N2M A;  3EMN X;  1YS5 A;  5DL8 A;  4FZN A;  1THQ A;  5PRN A;  1MM4 A;  2XTQ A;  3AA7 A;  3G7G A;  4G75 A;  2ZLD A;  3HOE A;  3LK4 1;  4AYM C;  4GF4 A;  2KC0 A;  3AAE A;  3GP6 A;  2XG6 A;  3AA6 A;  2W80 C;  3AA1 A;  3FYX A;  3HW9 A;  3POU A;  4GHB A;  3TZG A;  4AKR A;  4AYD C;  2QTK A;  2Y0L A;  3POX A;  1GFQ A;  4RJW A;  2M06 A;  4LSI A;  3UAQ A;  5ADX L;  4LSH A;  4KR8 A;  2ODJ A;  3HOL A;  5AFU L;  3LK4 2;  4LSF A;  3WI5 A;  2XE5 A;  3SY7 A;  3POR A;  3V8U A;  4AYN A;  1ZHT A;  2YNK A;  3QRC A;  3AAA B;  5EE2 A;  3VZW X;  3T24 A;  3VY9 X;  1Q9F A;  3QRA A;  5DL7 A;  2F1V A;  5DL5 A;  2XE2 A;  4AYE C;  1GFP A;  3WI4 A;  2K4T A;  1ZHY A;  3AA0 B;  3KVD D;  3AAE B;  4Z3T A;  3PQS A;  3JTY A;  4RLB A;  4D64 A;  2Y2X A;  2GE4 A;  4LSE A;  3SYS A;  3C5O A;  4JFB A;  1GFM A;  4O4U A;  1IZN A;  2O4V A;  2XMX A;  1PHO A;  4U9C A;  1MM5 A;  1Q9G A;  5FVN A;  4O3Z A;  2MNH A;  4C69 X;  4RL9 A;  2XE3 A;  4AZL A;  4GCQ A;  1ZHW A;  2Y7S A;  3VE1 A;  1BT9 A;  3A2S X;  2KXP A;  2Y0H A;  1P4T A;  5IYU A;  5JDP A;  3UU2 A;  4AFK A;  4FSO A;  2FGQ X;  3VZT X;  1GFN A;  4N59 A;  4FOZ A;  2KZ7 A;  4AUI A;  4FUV A;  8PRN A;  4GCP A;  4XNL A;  4KRA A;  2MHL A;  5T5F A;  1MPF A;  3AA7 B;  4FRT A;  4AYI D;  3LK2 A;  2JMM A;  4N58 A;  5G26 A;  1IZN B;  4KR4 A;  2XTR A;  5ADX K;  3AA6 B;  4AKR B;  1ZHX A;  3AA1 B;  5AFU K;  4BUM X;  3T0S A;  4XNK A;  4E1S A;  4F4B A;  1H6S 1;  3O0E A;  1G90 A;  3RBH A;  5DL6 A;  7PRN A;  2M07 A;  2KDY A;  3PQU A;  1E54 A;  3DA4 A;  2Y0K A;  1PRN A;  3LK3 A;  4RLC A;  3HWB A;  3UPG A;  2KZ7 B;  3PRN A;  1GFO A;  1HXX A;  1BXW A;  2PRN A;  3T20 A;  2F1T A;  4FSP A;  4O3Y A;  4E1T A;  3VE2 A;  3VZU X;  3NSG A;  2YPV A;  2POR A;  3AAA A;  4O4X A;  1QJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...