2PORA

Structure of porin refined at 1.8 angstroms resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
301
structure length
301
Chain Sequence
EVKLSGDARMGVMYNGDDWNFSSRSRVLFTMSGTTDSGLEFGASFKAHESVGAETGEDGTVFLSGAFGKIEMGDALGASEALFGDLYEVGYTDLDDRGGNDIPYLTGDERLTAEDNPVLLYTYSAGAFSVAASMSDGKVGETSEDDAQEMAVAAAYTFGNYTVGLGYEKIDSPDTALMADMEQLELAAIAKFGATNVKAYYADGELDRDFARAVFDLTPVAAAATAVDHKAYGLSVDSTFGATTVGGYVQVLDIDTIDDVTYYGLGASYDLGGGASIVGGIADNDLPNSDMVADLGVKFKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of porin refined at 1.8 A resolution.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Integral membrane protein porin
molecule keywords PORIN
total genus 76
structure length 301
sequence length 301
ec nomenclature
pdb deposition date 1992-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13609 Porin_4 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2porA00
1E54A 1PHOA 3WI5A 5PRNA 3VZTX 3WI4A 2Y0HA 3SZDA 4D5UA 3K19A 4D64A 4D65A 3UU2A 2XE2A 3O0EA 3A2SX 2K4TA 3POUA 5JDPA 3UPGA 1HXXA 3SYSA 4FRXA 4KR8A 4GCQA 1HXUA 3T20A 2QTKA 4RJXA 5DL6A 2Y2XA 3SYBA 1OSMA 3PRNA 5DL5A 4C69X 3EMNX 4LSFA 1PRNA 3VY8X 2FGRA 2ODJA 2Y0KA 4KR4A 1GFQA 1MPFA 3PORA 3POQA 3VZWX 3T24A 6PRNA 2XG6A 4GCPA 1GFNA 2PORA 3FYXA 4FT6A 5DL7A 5DL8A 8PRNA 2O4VA 4FRTA 4KRAA 4FOZA 4BUMX 3VZUX 1GFOA 1BT9A 3NSGA 1OPFA 2XE1A 5FVNA 4LSIA 4AUIA 1GFMA 7PRNA 4FMSA 2XE3A 3SZVA 1HXTA 2OMFA 4GCSA 2PRNA 2J4UP 3T0SA 3HW9A 4FSPA 4LSHA 4LSEA 2Y0LA 1BH3A 3HWBA 4RJWA 1H6S1 2J1NA 3JTYA 3VY9X 2XE5A 4JFBA 3POXA 1GFPA 3SY9A 2FGQX 2ZFGA 4FSOA 2ZLDA 3SY7A
chains in the Genus database with same CATH superfamily
4FQEA 1E54A 1PHOA 1ZHWA 4K3BA 3WI5A 4UB8O 2R4LA 2KXPB 3A0HO 5PRNA 3VZTX 3WI4A 4C00A 4CTDA 2Y0HA 1ZHZA 3DA3A 5TISO 2LHFA 3SZDA 3K19A 4D5UA 4D64A 5GV0A 3RBHA 3UU2A 4D65A 2F1TA 2IWVA 2XE2A 2R89A 3AA1B 4RL9A 4C4VB 3UAQA 4AZLA 1Q9GA 3O0EA 3A2SX 2K4TA 3AA6B 3POUA 4Z3TA 3PF1A 3BRZA 3BS0A 4PUXA 4XNLA 4E1SA 5JDPA 3UPGA 1QJ8A 1G90A 2XTRA 1HXXA 3DWNA 3QRCA 2WVPA 2KC0A 3AAEB 4AYEC 1BXWA 3SYSA 3AA0A 3LK2A 4FRXA 3HOLA 2N2LA 4GCQA 1HXUA 2KZ7B 2QTKA 3PGUA 4KR8A 4RJXA 5T5FA 4AKMA 2MHLA 3HOEA 5DL6A 2F1VA 4AYDC 2Y2XA 1OSMA 3SYBA 3AA7B 5EE2A 2KZ7A 3PRNA 5GTIO 2R8AA 4K3CA 4AKRB 5DL5A 3PGRA 4U9CA 4O3YA 4C69X 2KDYA 4FESA 3DA4A 3PQSA 4AFKA 4AYID 2GE4A 2XMXA 5AFUK 4G75A 3EMNX 4LSFA 1PRNA 3VY8X 2FGRA 2ODJA 2Y0KA 5ADXK 1ZHTA 2X9KA 4O3WA 4KR4A 1GFQA 1MPFA 1ZHYA 3GP6A 3PORA 3A0BO 3DWOX 3POQA 3QRAA 4FZNA 2XG6A 3AAAA 3BRYA 1GFNA 2PORA 4GCPA 4UB6O 4F4BA 3FYXA 3VE2A 4N59A 2YNKA 3WU2O 1S5LO 4FT6A 2WJRA 5DL7A 4N58A 3TZGA 4O49A 4PR7A 2Y7SA 5DL8A 8PRNA 2LFUA 2O4VA 4FRTA 2JQYA 5IYUA 4C4VA 4KRAA 1T1LA 4FOZA 4BUMX 3VZUX 1GFOA 1BT9A 3NSGA 4FZLA 1P4TA 1IZNB 1OPFA 1ZHXA 2XE1A 4O4XA 2R4OA 4LSIA 5FVNA 2F1CX 2K0LA 3AA0B 3LK2B 5G39A 5GTHO 4AYMC 4GHBA 1T16A 4AUIA 3AA7A 1GFMA 3NJTA 7PRNA 4QQ1A 3LK3B 3PGSA 4FMSA 4IL6O 1MM4A 2XE3A 3SZVA 2W81C 3G7GA 1HXTA 2OMFA 2MNHA 4RLCA 4GCSA 2PRNA 4FUVA 5KAFO 2J4UP 4FZMA 4AKRA 3JCUO 5E79O 2XTQA 4N75A 2R4NA 2X27X 3T0SA 3HW9A 5G38A 2ERVA 3KVDD 5G3AA 3LK3A 2R88A 4FSPA 4LSHA 4LSEA 2M07A 3LK41 1QJPA 2Y0LA 3VE1A 4B61A 5ADXL 1BH3A 3HWBA 2W80C 4RJWA 4PJ0O 3V8UA 2R4PA 1H6S1 5KAIO 3AAEA 5H2FO 2YPVA 2JMMA 1YS5A 2J1NA 4O4UA 3JTYA 3VY9X 2XE5A 2AXTO 2KXPA 5B5EO 4JFBA 2WJQA 3LK42 3KZIO 4O3ZA 4RLBA 2IWWA 2M06A 4AYNA 3T20A 3T24A 1ORMA 4GF4A 5AFUL 3AA1A 3DZMA 3POXA 5G26A 6PRNA 4E1TA 1IZNA 1QJ9A 3C5OA 1GFPA 5B66O 1MM5A 2FGQX 2N2MA 2ZFGA 4FSOA 4N74A 4O3XB 1THQA 4G76A 3SY9A 4JCHA 4XNKA 3AAAB 5D5DA 3AA6A 3VZWX 1Q9FA 3PQUA 2ZLDA 3SY7A
chains in the Genus database with same CATH topology
1E54A 1PHOA 1ZHWA 3WI5A 2KXPB 5PRNA 3VZTX 3WI4A 2Y0HA 1ZHZA 3DA3A 3SZDA 2LHFA 4D5UA 3K19A 4D64A 5GV0A 3RBHA 3UU2A 4D65A 2F1TA 2XE2A 3AA1B 4RL9A 3UAQA 4AZLA 1Q9GA 3O0EA 3A2SX 2K4TA 3AA6B 3POUA 4Z3TA 4E1SA 4XNLA 4PUXA 5JDPA 3UPGA 1QJ8A 2XTRA 1HXXA 3QRCA 2KC0A 3AAEB 4AYEC 1BXWA 3SYSA 3AA0A 3LK2A 4FRXA 3HOLA 2N2LA 4GCQA 1HXUA 2KZ7B 2QTKA 4KR8A 4RJXA 5T5FA 4AKMA 3T20A 2MHLA 3HOEA 5DL6A 2F1VA 4AYDC 2Y2XA 1OSMA 3SYBA 3AA7B 2KZ7A 3PRNA 4AKRB 5DL5A 4U9CA 4O3YA 4C69X 2KDYA 4FESA 3DA4A 3PQSA 4AFKA 4AYID 2GE4A 2XMXA 5AFUK 4G75A 3EMNX 4LSFA 1PRNA 3VY8X 2FGRA 2ODJA 2Y0KA 5ADXK 1ZHTA 4O3WA 4KR4A 1GFQA 1MPFA 1ZHYA 3GP6A 3PORA 3POQA 4FZNA 5EE2A 3QRAA 3T24A 2XG6A 3AAAA 4GCPA 1GFNA 2PORA 3V8UA 3VE1A 4F4BA 3FYXA 3VE2A 4N59A 2YNKA 4FT6A 5DL7A 3TZGA 4N58A 4O49A 5DL8A 2Y7SA 8PRNA 2LFUA 2O4VA 4FRTA 5IYUA 4KRAA 4FOZA 4BUMX 3VZUX 1GFOA 1BT9A 3NSGA 4FZLA 1P4TA 1IZNB 1OPFA 1ZHXA 2XE1A 4O4XA 5FVNA 4LSIA 2K0LA 3AA0B 3LK2B 4AYMC 4GHBA 4AUIA 3AA7A 1GFMA 7PRNA 4QQ1A 3LK3B 4FMSA 1MM4A 2XE3A 3SZVA 2W81C 3G7GA 1HXTA 2OMFA 2MNHA 4RLCA 4GCSA 2PRNA 4FUVA 2J4UP 4FZMA 4AKRA 2XTQA 2X27X 3T0SA 3HW9A 2ERVA 3KVDD 3LK3A 4FSPA 4LSHA 4LSEA 2M07A 3LK41 1QJPA 2Y0LA 4B61A 5ADXL 1BH3A 3HWBA 2W80C 4RJWA 1H6S1 3AAEA 2YPVA 2JMMA 1YS5A 2J1NA 4O4UA 3JTYA 3VY9X 2XE5A 2KXPA 4JFBA 4O3ZA 3LK42 4RLBA 2M06A 4AYNA 1ORMA 4GF4A 5AFUL 3AA1A 3POXA 5G26A 6PRNA 4E1TA 1IZNA 1QJ9A 3C5OA 1GFPA 1MM5A 2FGQX 2N2MA 2ZFGA 4FSOA 4O3XB 3SY9A 1THQA 4G76A 1G90A 4JCHA 4XNKA 3AAAB 5D5DA 3AA6A 3VZWX 1Q9FA 3PQUA 2ZLDA 3SY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E54 A;  1PHO A;  3WI5 A;  5PRN A;  3VZT X;  3WI4 A;  2Y0H A;  3SZD A;  4D5U A;  3K19 A;  4D64 A;  4D65 A;  3UU2 A;  2XE2 A;  3O0E A;  3A2S X;  2K4T A;  3POU A;  5JDP A;  3UPG A;  1HXX A;  3SYS A;  4FRX A;  4KR8 A;  4GCQ A;  1HXU A;  3T20 A;  2QTK A;  4RJX A;  5DL6 A;  2Y2X A;  3SYB A;  1OSM A;  3PRN A;  5DL5 A;  4C69 X;  3EMN X;  4LSF A;  1PRN A;  3VY8 X;  2FGR A;  2ODJ A;  2Y0K A;  4KR4 A;  1GFQ A;  1MPF A;  3POR A;  3POQ A;  3VZW X;  3T24 A;  6PRN A;  2XG6 A;  4GCP A;  1GFN A;  2POR A;  3FYX A;  4FT6 A;  5DL7 A;  5DL8 A;  8PRN A;  2O4V A;  4FRT A;  4KRA A;  4FOZ A;  4BUM X;  3VZU X;  1GFO A;  1BT9 A;  3NSG A;  1OPF A;  2XE1 A;  5FVN A;  4LSI A;  4AUI A;  1GFM A;  7PRN A;  4FMS A;  2XE3 A;  3SZV A;  1HXT A;  2OMF A;  4GCS A;  2PRN A;  2J4U P;  3T0S A;  3HW9 A;  4FSP A;  4LSH A;  4LSE A;  2Y0L A;  1BH3 A;  3HWB A;  4RJW A;  1H6S 1;  2J1N A;  3JTY A;  3VY9 X;  2XE5 A;  4JFB A;  3POX A;  1GFP A;  3SY9 A;  2FGQ X;  2ZFG A;  4FSO A;  2ZLD A;  3SY7 A; 
#chains in the Genus database with same CATH topology
 4FQE A;  1E54 A;  1PHO A;  1ZHW A;  4K3B A;  3WI5 A;  4UB8 O;  2R4L A;  2KXP B;  3A0H O;  5PRN A;  3VZT X;  3WI4 A;  4C00 A;  4CTD A;  2Y0H A;  1ZHZ A;  3DA3 A;  5TIS O;  2LHF A;  3SZD A;  3K19 A;  4D5U A;  4D64 A;  5GV0 A;  3RBH A;  3UU2 A;  4D65 A;  2F1T A;  2IWV A;  2XE2 A;  2R89 A;  3AA1 B;  4RL9 A;  4C4V B;  3UAQ A;  4AZL A;  1Q9G A;  3O0E A;  3A2S X;  2K4T A;  3AA6 B;  3POU A;  4Z3T A;  3PF1 A;  3BRZ A;  3BS0 A;  4PUX A;  4XNL A;  4E1S A;  5JDP A;  3UPG A;  1QJ8 A;  1G90 A;  2XTR A;  1HXX A;  3DWN A;  3QRC A;  2WVP A;  2KC0 A;  3AAE B;  4AYE C;  1BXW A;  3SYS A;  3AA0 A;  3LK2 A;  4FRX A;  3HOL A;  2N2L A;  4GCQ A;  1HXU A;  2KZ7 B;  2QTK A;  3PGU A;  4KR8 A;  4RJX A;  5T5F A;  4AKM A;  2MHL A;  3HOE A;  5DL6 A;  2F1V A;  4AYD C;  2Y2X A;  1OSM A;  3SYB A;  3AA7 B;  5EE2 A;  2KZ7 A;  3PRN A;  5GTI O;  2R8A A;  4K3C A;  4AKR B;  5DL5 A;  3PGR A;  4U9C A;  4O3Y A;  4C69 X;  2KDY A;  4FES A;  3DA4 A;  3PQS A;  4AFK A;  4AYI D;  2GE4 A;  2XMX A;  5AFU K;  4G75 A;  3EMN X;  4LSF A;  1PRN A;  3VY8 X;  2FGR A;  2ODJ A;  2Y0K A;  5ADX K;  1ZHT A;  2X9K A;  4O3W A;  4KR4 A;  1GFQ A;  1MPF A;  1ZHY A;  3GP6 A;  3POR A;  3A0B O;  3DWO X;  3POQ A;  3QRA A;  4FZN A;  2XG6 A;  3AAA A;  3BRY A;  1GFN A;  2POR A;  4GCP A;  4UB6 O;  4F4B A;  3FYX A;  3VE2 A;  4N59 A;  2YNK A;  3WU2 O;  1S5L O;  4FT6 A;  2WJR A;  5DL7 A;  4N58 A;  3TZG A;  4O49 A;  4PR7 A;  2Y7S A;  5DL8 A;  8PRN A;  2LFU A;  2O4V A;  4FRT A;  2JQY A;  5IYU A;  4C4V A;  4KRA A;  1T1L A;  4FOZ A;  4BUM X;  3VZU X;  1GFO A;  1BT9 A;  3NSG A;  4FZL A;  1P4T A;  1IZN B;  1OPF A;  1ZHX A;  2XE1 A;  4O4X A;  2R4O A;  4LSI A;  5FVN A;  2F1C X;  2K0L A;  3AA0 B;  3LK2 B;  5G39 A;  5GTH O;  4AYM C;  4GHB A;  1T16 A;  4AUI A;  3AA7 A;  1GFM A;  3NJT A;  7PRN A;  4QQ1 A;  3LK3 B;  3PGS A;  4FMS A;  4IL6 O;  1MM4 A;  2XE3 A;  3SZV A;  2W81 C;  3G7G A;  1HXT A;  2OMF A;  2MNH A;  4RLC A;  4GCS A;  2PRN A;  4FUV A;  5KAF O;  2J4U P;  4FZM A;  4AKR A;  3JCU O;  5E79 O;  2XTQ A;  4N75 A;  2R4N A;  2X27 X;  3T0S A;  3HW9 A;  5G38 A;  2ERV A;  3KVD D;  5G3A A;  3LK3 A;  2R88 A;  4FSP A;  4LSH A;  4LSE A;  2M07 A;  3LK4 1;  1QJP A;  2Y0L A;  3VE1 A;  4B61 A;  5ADX L;  1BH3 A;  3HWB A;  2W80 C;  4RJW A;  4PJ0 O;  3V8U A;  2R4P A;  1H6S 1;  5KAI O;  3AAE A;  5H2F O;  2YPV A;  2JMM A;  1YS5 A;  2J1N A;  4O4U A;  3JTY A;  3VY9 X;  2XE5 A;  2AXT O;  2KXP A;  5B5E O;  4JFB A;  2WJQ A;  3LK4 2;  3KZI O;  4O3Z A;  4RLB A;  2IWW A;  2M06 A;  4AYN A;  3T20 A;  3T24 A;  1ORM A;  4GF4 A;  5AFU L;  3AA1 A;  3DZM A;  3POX A;  5G26 A;  6PRN A;  4E1T A;  1IZN A;  1QJ9 A;  3C5O A;  1GFP A;  5B66 O;  1MM5 A;  2FGQ X;  2N2M A;  2ZFG A;  4FSO A;  4N74 A;  4O3X B;  1THQ A;  4G76 A;  3SY9 A;  4JCH A;  4XNK A;  3AAA B;  5D5D A;  3AA6 A;  3VZW X;  1Q9F A;  3PQU A;  2ZLD A;  3SY7 A; 
#chains in the Genus database with same CATH homology
 1E54 A;  1PHO A;  1ZHW A;  3WI5 A;  2KXP B;  5PRN A;  3VZT X;  3WI4 A;  2Y0H A;  1ZHZ A;  3DA3 A;  3SZD A;  2LHF A;  4D5U A;  3K19 A;  4D64 A;  5GV0 A;  3RBH A;  3UU2 A;  4D65 A;  2F1T A;  2XE2 A;  3AA1 B;  4RL9 A;  3UAQ A;  4AZL A;  1Q9G A;  3O0E A;  3A2S X;  2K4T A;  3AA6 B;  3POU A;  4Z3T A;  4E1S A;  4XNL A;  4PUX A;  5JDP A;  3UPG A;  1QJ8 A;  2XTR A;  1HXX A;  3QRC A;  2KC0 A;  3AAE B;  4AYE C;  1BXW A;  3SYS A;  3AA0 A;  3LK2 A;  4FRX A;  3HOL A;  2N2L A;  4GCQ A;  1HXU A;  2KZ7 B;  2QTK A;  4KR8 A;  4RJX A;  5T5F A;  4AKM A;  3T20 A;  2MHL A;  3HOE A;  5DL6 A;  2F1V A;  4AYD C;  2Y2X A;  1OSM A;  3SYB A;  3AA7 B;  2KZ7 A;  3PRN A;  4AKR B;  5DL5 A;  4U9C A;  4O3Y A;  4C69 X;  2KDY A;  4FES A;  3DA4 A;  3PQS A;  4AFK A;  4AYI D;  2GE4 A;  2XMX A;  5AFU K;  4G75 A;  3EMN X;  4LSF A;  1PRN A;  3VY8 X;  2FGR A;  2ODJ A;  2Y0K A;  5ADX K;  1ZHT A;  4O3W A;  4KR4 A;  1GFQ A;  1MPF A;  1ZHY A;  3GP6 A;  3POR A;  3POQ A;  4FZN A;  5EE2 A;  3QRA A;  3T24 A;  2XG6 A;  3AAA A;  4GCP A;  1GFN A;  2POR A;  3V8U A;  3VE1 A;  4F4B A;  3FYX A;  3VE2 A;  4N59 A;  2YNK A;  4FT6 A;  5DL7 A;  3TZG A;  4N58 A;  4O49 A;  5DL8 A;  2Y7S A;  8PRN A;  2LFU A;  2O4V A;  4FRT A;  5IYU A;  4KRA A;  4FOZ A;  4BUM X;  3VZU X;  1GFO A;  1BT9 A;  3NSG A;  4FZL A;  1P4T A;  1IZN B;  1OPF A;  1ZHX A;  2XE1 A;  4O4X A;  5FVN A;  4LSI A;  2K0L A;  3AA0 B;  3LK2 B;  4AYM C;  4GHB A;  4AUI A;  3AA7 A;  1GFM A;  7PRN A;  4QQ1 A;  3LK3 B;  4FMS A;  1MM4 A;  2XE3 A;  3SZV A;  2W81 C;  3G7G A;  1HXT A;  2OMF A;  2MNH A;  4RLC A;  4GCS A;  2PRN A;  4FUV A;  2J4U P;  4FZM A;  4AKR A;  2XTQ A;  2X27 X;  3T0S A;  3HW9 A;  2ERV A;  3KVD D;  3LK3 A;  4FSP A;  4LSH A;  4LSE A;  2M07 A;  3LK4 1;  1QJP A;  2Y0L A;  4B61 A;  5ADX L;  1BH3 A;  3HWB A;  2W80 C;  4RJW A;  1H6S 1;  3AAE A;  2YPV A;  2JMM A;  1YS5 A;  2J1N A;  4O4U A;  3JTY A;  3VY9 X;  2XE5 A;  2KXP A;  4JFB A;  4O3Z A;  3LK4 2;  4RLB A;  2M06 A;  4AYN A;  1ORM A;  4GF4 A;  5AFU L;  3AA1 A;  3POX A;  5G26 A;  6PRN A;  4E1T A;  1IZN A;  1QJ9 A;  3C5O A;  1GFP A;  1MM5 A;  2FGQ X;  2N2M A;  2ZFG A;  4FSO A;  4O3X B;  3SY9 A;  1THQ A;  4G76 A;  1G90 A;  4JCH A;  4XNK A;  3AAA B;  5D5D A;  3AA6 A;  3VZW X;  1Q9F A;  3PQU A;  2ZLD A;  3SY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...