2PORA

Structure of porin refined at 1.8 angstroms resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
301
structure length
301
Chain Sequence
EVKLSGDARMGVMYNGDDWNFSSRSRVLFTMSGTTDSGLEFGASFKAHESVGAETGEDGTVFLSGAFGKIEMGDALGASEALFGDLYEVGYTDLDDRGGNDIPYLTGDERLTAEDNPVLLYTYSAGAFSVAASMSDGKVGETSEDDAQEMAVAAAYTFGNYTVGLGYEKIDSPDTALMADMEQLELAAIAKFGATNVKAYYADGELDRDFARAVFDLTPVAAAATAVDHKAYGLSVDSTFGATTVGGYVQVLDIDTIDDVTYYGLGASYDLGGGASIVGGIADNDLPNSDMVADLGVKFKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of porin refined at 1.8 A resolution.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Integral membrane protein porin
molecule keywords PORIN
total genus 76
structure length 301
sequence length 301
ec nomenclature
pdb deposition date 1992-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13609 Porin_4 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2porA00
4LSFA 3POQA 1PHOA 3EMNX 2J1NA 3SZVA 2O4VA 3VY8X 3NSGA 4LSHA 3VZUX 2FGQX 1GFOA 3SZDA 2PRNA 4D64A 5JDPA 3UU2A 4LSEA 4GCPA 4FMSA 4AUIA 3SYBA 1GFPA 4KR8A 3JTYA 4BUMX 2ZLDA 2XE3A 5PRNA 4GCQA 1HXTA 2J4UP 2PORA 1BH3A 6PRNA 3VZTX 4D65A 4FT6A 1BT9A 1GFMA 4KR4A 2ZFGA 3PORA 1E54A 5DL8A 2OMFA 3FYXA 4JFBA 2XE1A 3A2SX 4GCSA 5FVNA 4FRXA 5DL7A 3WI5A 2QTKA 4D5UA 2K4TA 2Y2XA 4FSPA 3PRNA 3T0SA 2Y0KA 8PRNA 3HWBA 2ODJA 1GFNA 2XE5A 3K19A 1OSMA 3T20A 4C69X 3O0EA 4RJXA 5DL5A 3HW9A 3SYSA 3UPGA 4RJWA 1OPFA 1H6S1 2Y0LA 3POUA 3POXA 3SY9A 1MPFA 2Y0HA 1HXXA 7PRNA 2XG6A 5DL6A 2FGRA 2XE2A 4FSOA 4LSIA 3T24A 1HXUA 1PRNA 4KRAA 1GFQA 4FOZA 3VZWX 3WI4A 3SY7A 4FRTA 3VY9X
chains in the Genus database with same CATH superfamily
5IYUA 2W81C 4LSFA 3POQA 1PHOA 4AYEC 1QJ8A 3EMNX 4O3ZA 5ADXK 2IWWA 1G90A 2J1NA 5GTIO 2KZ7A 2XTQA 3SZVA 4O3XB 2O4VA 3VY8X 3PF1A 2R4OA 3NSGA 2N2MA 3PQUA 2YNKA 4LSHA 2R8AA 4PUXA 3VZUX 2R4PA 1T1LA 2FGQX 1GFOA 4XNKA 3SZDA 2N2LA 5KAIO 4AYDC 2PRNA 4D64A 4O49A 4GF4A 5JDPA 1ZHXA 2F1CX 3KZIO 1Q9GA 4FESA 4FZNA 3AAEA 3UU2A 4LSEA 2KDYA 3AA0A 3LK2A 1IZNA 2AXTO 2ERVA 4GCPA 4FMSA 4JCHA 3VE2A 4AUIA 3A0BO 2M07A 3AA1A 1GFPA 4KR8A 3SYBA 3JTYA 4BUMX 4C00A 4FQEA 3UAQA 3VE1A 2ZLDA 4CTDA 2XE3A 3HOEA 4AZLA 5PRNA 1ZHZA 4GCQA 1HXTA 4QQ1A 4AKMA 3AA1B 5B66O 2J4UP 3BRZA 3BS0A 4AFKA 4UB6O 4F4BA 1S5LO 3JCUO 4PR7A 2WJRA 2PORA 2LFUA 3VY9X 5AFUK 3LK42 3A0HO 4N75A 3LK2B 1IZNB 4N74A 4AYNA 1BH3A 5ADXL 4E1TA 6PRNA 2F1TA 3VZTX 4FT6A 4D65A 1BT9A 3PGRA 3WU2O 1GFMA 3V8UA 1MM4A 5EE2A 4KR4A 1BXWA 2IWVA 2K0LA 2ZFGA 3NJTA 1ORMA 3AAAA 3PORA 4G75A 4U9CA 1E54A 5DL8A 5B5EO 2OMFA 3FYXA 1ZHWA 4JFBA 4K3CA 2XE1A 3A2SX 4GCSA 2JQYA 2KXPB 5FVNA 4FRXA 4FUVA 4IL6O 4O4XA 5DL7A 5H2FO 4O4UA 3WI5A 3TZGA 4E1SA 2QTKA 4UB8O 1QJPA 1T16A 5GTHO 4D5UA 2R4NA 3HOLA 2K4TA 2Y2XA 1MM5A 5GV0A 4FSPA 1THQA 3PRNA 4RLCA 3T0SA 2Y0KA 1YS5A 2M06A 4B61A 8PRNA 4RL9A 4AKRB 3C5OA 3DWOX 5E79O 2MNHA 4AYID 4C4VB 3HWBA 2MHLA 2ODJA 4N59A 1GFNA 1ZHYA 2XE5A 1OSMA 3K19A 3PQSA 3PGUA 4AKRA 4C69X 2JMMA 5AFUL 3T20A 3AA6B 3O0EA 3AA0B 4RJXA 5DL5A 2WJQA 2R4LA 2YPVA 3HW9A 3AA6A 5G3AA 2R89A 4N58A 3SYSA 2WVPA 3UPGA 4RJWA 4PJ0O 2GE4A 1OPFA 4AYMC 1H6S1 2Y0LA 3POUA 5KAFO 3POXA 3G7GA 3SY9A 4G76A 3AA7B 5TISO 5G39A 3LK3B 1MPFA 2KC0A 3QRAA 2Y0HA 5G26A 4C4VA 3DWNA 4XNLA 4Z3TA 2X9KA 4GHBA 3DA4A 1HXXA 3DZMA 7PRNA 1P4TA 3GP6A 2XG6A 4RLBA 5DL6A 3PGSA 2F1VA 2FGRA 2W80C 2XE2A 4FSOA 4LSIA 3T24A 4FZMA 1HXUA 4O3YA 1PRNA 3DA3A 4KRAA 1GFQA 4O3WA 5D5DA 3AAAB 1ZHTA 3RBHA 2XMXA 4FOZA 3VZWX 3WI4A 3LK3A 2R88A 3AA7A 3LK41 2XTRA 2LHFA 4FRTA 1QJ9A 3SY7A 2X27X 2KXPA 3KVDD 1Q9FA 4FZLA 2KZ7B 5G38A 5T5FA 3AAEB 3QRCA 3BRYA 2Y7SA 4K3BA
chains in the Genus database with same CATH topology
5IYUA 2W81C 4LSFA 3POQA 1PHOA 4AYEC 1QJ8A 3EMNX 4O3ZA 5ADXK 1G90A 2J1NA 2KZ7A 2XTQA 3SZVA 4O3XB 2O4VA 3VY8X 3NSGA 2N2MA 3PQUA 2YNKA 4LSHA 3VZUX 4PUXA 2FGQX 1GFOA 4XNKA 3SZDA 2N2LA 4AYDC 2PRNA 4D64A 4O49A 4GF4A 5JDPA 1ZHXA 4FZNA 1Q9GA 4FESA 3AAEA 3UU2A 4LSEA 2KDYA 3AA0A 3LK2A 1IZNA 2ERVA 4GCPA 4JCHA 4FMSA 3VE2A 4AUIA 3AA1A 2M07A 1GFPA 4KR8A 3SYBA 3JTYA 4BUMX 3UAQA 3VE1A 2ZLDA 2XE3A 3HOEA 4AZLA 5PRNA 1ZHZA 4GCQA 1HXTA 4QQ1A 4AKMA 3AA1B 2J4UP 4F4BA 4AFKA 2PORA 2LFUA 3VY9X 5AFUK 3LK42 3LK2B 1IZNB 4AYNA 5ADXL 1BH3A 4E1TA 6PRNA 2F1TA 3VZTX 4FT6A 4D65A 1BT9A 1GFMA 3V8UA 1MM4A 4KR4A 1BXWA 2K0LA 2ZFGA 3PORA 1ORMA 3AAAA 4G75A 4U9CA 1E54A 5DL8A 2OMFA 3FYXA 1ZHWA 4JFBA 2XE1A 3A2SX 4GCSA 2KXPB 5FVNA 4FRXA 4FUVA 4O4XA 5DL7A 4O4UA 3WI5A 3TZGA 4E1SA 2QTKA 1QJPA 4D5UA 3HOLA 2K4TA 2Y2XA 1MM5A 5GV0A 4FSPA 1THQA 3PRNA 4RLCA 3T0SA 2Y0KA 1YS5A 2M06A 4B61A 8PRNA 4RL9A 4AKRB 3C5OA 4AYID 2MNHA 3HWBA 2MHLA 2ODJA 4N59A 2XE5A 1GFNA 1ZHYA 1OSMA 3K19A 3PQSA 4AKRA 4C69X 5AFUL 2JMMA 3T20A 3AA6B 3O0EA 3AA0B 4RJXA 5DL5A 2YPVA 3HW9A 3AA6A 4N58A 3SYSA 3UPGA 4RJWA 2GE4A 1OPFA 4AYMC 1H6S1 2Y0LA 3POUA 3POXA 3G7GA 3SY9A 4G76A 3AA7B 3LK3B 1MPFA 2KC0A 3QRAA 2Y0HA 5G26A 4XNLA 4Z3TA 4GHBA 3DA4A 1HXXA 7PRNA 1P4TA 3GP6A 2XG6A 4RLBA 5DL6A 2F1VA 2FGRA 2W80C 2XE2A 4FSOA 4LSIA 3T24A 4FZMA 1HXUA 4O3YA 1PRNA 3DA3A 4KRAA 1GFQA 4O3WA 5D5DA 3AAAB 1ZHTA 3RBHA 2XMXA 4FOZA 3VZWX 3WI4A 3LK3A 3AA7A 3LK41 3SY7A 2XTRA 2LHFA 4FRTA 1QJ9A 2X27X 2KXPA 3KVDD 1Q9FA 4FZLA 2KZ7B 5T5FA 3AAEB 3QRCA 5EE2A 2Y7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LSF A;  3POQ A;  1PHO A;  3EMN X;  2J1N A;  3SZV A;  2O4V A;  3VY8 X;  3NSG A;  4LSH A;  3VZU X;  2FGQ X;  1GFO A;  3SZD A;  2PRN A;  4D64 A;  5JDP A;  3UU2 A;  4LSE A;  4GCP A;  4FMS A;  4AUI A;  3SYB A;  1GFP A;  4KR8 A;  3JTY A;  4BUM X;  2ZLD A;  2XE3 A;  5PRN A;  4GCQ A;  1HXT A;  2J4U P;  2POR A;  1BH3 A;  6PRN A;  3VZT X;  4D65 A;  4FT6 A;  1BT9 A;  1GFM A;  4KR4 A;  2ZFG A;  3POR A;  1E54 A;  5DL8 A;  2OMF A;  3FYX A;  4JFB A;  2XE1 A;  3A2S X;  4GCS A;  5FVN A;  4FRX A;  5DL7 A;  3WI5 A;  2QTK A;  4D5U A;  2K4T A;  2Y2X A;  4FSP A;  3PRN A;  3T0S A;  2Y0K A;  8PRN A;  3HWB A;  2ODJ A;  1GFN A;  2XE5 A;  3K19 A;  1OSM A;  3T20 A;  4C69 X;  3O0E A;  4RJX A;  5DL5 A;  3HW9 A;  3SYS A;  3UPG A;  4RJW A;  1OPF A;  1H6S 1;  2Y0L A;  3POU A;  3POX A;  3SY9 A;  1MPF A;  2Y0H A;  1HXX A;  7PRN A;  2XG6 A;  5DL6 A;  2FGR A;  2XE2 A;  4FSO A;  4LSI A;  3T24 A;  1HXU A;  1PRN A;  4KRA A;  1GFQ A;  4FOZ A;  3VZW X;  3WI4 A;  3SY7 A;  4FRT A;  3VY9 X; 
#chains in the Genus database with same CATH topology
 5IYU A;  2W81 C;  4LSF A;  3POQ A;  1PHO A;  4AYE C;  1QJ8 A;  3EMN X;  4O3Z A;  5ADX K;  2IWW A;  1G90 A;  2J1N A;  5GTI O;  2KZ7 A;  2XTQ A;  3SZV A;  4O3X B;  2O4V A;  3VY8 X;  3PF1 A;  2R4O A;  3NSG A;  2N2M A;  3PQU A;  2YNK A;  4LSH A;  2R8A A;  4PUX A;  3VZU X;  2R4P A;  1T1L A;  2FGQ X;  1GFO A;  4XNK A;  3SZD A;  2N2L A;  5KAI O;  4AYD C;  2PRN A;  4D64 A;  4O49 A;  4GF4 A;  5JDP A;  1ZHX A;  2F1C X;  3KZI O;  1Q9G A;  4FES A;  4FZN A;  3AAE A;  3UU2 A;  4LSE A;  2KDY A;  3AA0 A;  3LK2 A;  1IZN A;  2AXT O;  2ERV A;  4GCP A;  4FMS A;  4JCH A;  3VE2 A;  4AUI A;  3A0B O;  2M07 A;  3AA1 A;  1GFP A;  4KR8 A;  3SYB A;  3JTY A;  4BUM X;  4C00 A;  4FQE A;  3UAQ A;  3VE1 A;  2ZLD A;  4CTD A;  2XE3 A;  3HOE A;  4AZL A;  5PRN A;  1ZHZ A;  4GCQ A;  1HXT A;  4QQ1 A;  4AKM A;  3AA1 B;  5B66 O;  2J4U P;  3BRZ A;  3BS0 A;  4AFK A;  4UB6 O;  4F4B A;  1S5L O;  3JCU O;  4PR7 A;  2WJR A;  2POR A;  2LFU A;  3VY9 X;  5AFU K;  3LK4 2;  3A0H O;  4N75 A;  3LK2 B;  1IZN B;  4N74 A;  4AYN A;  1BH3 A;  5ADX L;  4E1T A;  6PRN A;  2F1T A;  3VZT X;  4FT6 A;  4D65 A;  1BT9 A;  3PGR A;  3WU2 O;  1GFM A;  3V8U A;  1MM4 A;  5EE2 A;  4KR4 A;  1BXW A;  2IWV A;  2K0L A;  2ZFG A;  3NJT A;  1ORM A;  3AAA A;  3POR A;  4G75 A;  4U9C A;  1E54 A;  5DL8 A;  5B5E O;  2OMF A;  3FYX A;  1ZHW A;  4JFB A;  4K3C A;  2XE1 A;  3A2S X;  4GCS A;  2JQY A;  2KXP B;  5FVN A;  4FRX A;  4FUV A;  4IL6 O;  4O4X A;  5DL7 A;  5H2F O;  4O4U A;  3WI5 A;  3TZG A;  4E1S A;  2QTK A;  4UB8 O;  1QJP A;  1T16 A;  5GTH O;  4D5U A;  2R4N A;  3HOL A;  2K4T A;  2Y2X A;  1MM5 A;  5GV0 A;  4FSP A;  1THQ A;  3PRN A;  4RLC A;  3T0S A;  2Y0K A;  1YS5 A;  2M06 A;  4B61 A;  8PRN A;  4RL9 A;  4AKR B;  3C5O A;  3DWO X;  5E79 O;  2MNH A;  4AYI D;  4C4V B;  3HWB A;  2MHL A;  2ODJ A;  4N59 A;  1GFN A;  1ZHY A;  2XE5 A;  1OSM A;  3K19 A;  3PQS A;  3PGU A;  4AKR A;  4C69 X;  2JMM A;  5AFU L;  3T20 A;  3AA6 B;  3O0E A;  3AA0 B;  4RJX A;  5DL5 A;  2WJQ A;  2R4L A;  2YPV A;  3HW9 A;  3AA6 A;  5G3A A;  2R89 A;  4N58 A;  3SYS A;  2WVP A;  3UPG A;  4RJW A;  4PJ0 O;  2GE4 A;  1OPF A;  4AYM C;  1H6S 1;  2Y0L A;  3POU A;  5KAF O;  3POX A;  3G7G A;  3SY9 A;  4G76 A;  3AA7 B;  5TIS O;  5G39 A;  3LK3 B;  1MPF A;  2KC0 A;  3QRA A;  2Y0H A;  5G26 A;  4C4V A;  3DWN A;  4XNL A;  4Z3T A;  2X9K A;  4GHB A;  3DA4 A;  1HXX A;  3DZM A;  7PRN A;  1P4T A;  3GP6 A;  2XG6 A;  4RLB A;  5DL6 A;  3PGS A;  2F1V A;  2FGR A;  2W80 C;  2XE2 A;  4FSO A;  4LSI A;  3T24 A;  4FZM A;  1HXU A;  4O3Y A;  1PRN A;  3DA3 A;  4KRA A;  1GFQ A;  4O3W A;  5D5D A;  3AAA B;  1ZHT A;  3RBH A;  2XMX A;  4FOZ A;  3VZW X;  3WI4 A;  3LK3 A;  2R88 A;  3AA7 A;  3LK4 1;  2XTR A;  2LHF A;  4FRT A;  1QJ9 A;  3SY7 A;  2X27 X;  2KXP A;  3KVD D;  1Q9F A;  4FZL A;  2KZ7 B;  5G38 A;  5T5F A;  3AAE B;  3QRC A;  3BRY A;  2Y7S A;  4K3B A; 
#chains in the Genus database with same CATH homology
 5IYU A;  2W81 C;  4LSF A;  3POQ A;  1PHO A;  4AYE C;  1QJ8 A;  3EMN X;  4O3Z A;  5ADX K;  1G90 A;  2J1N A;  2KZ7 A;  2XTQ A;  3SZV A;  4O3X B;  2O4V A;  3VY8 X;  3NSG A;  2N2M A;  3PQU A;  2YNK A;  4LSH A;  3VZU X;  4PUX A;  2FGQ X;  1GFO A;  4XNK A;  3SZD A;  2N2L A;  4AYD C;  2PRN A;  4D64 A;  4O49 A;  4GF4 A;  5JDP A;  1ZHX A;  4FZN A;  1Q9G A;  4FES A;  3AAE A;  3UU2 A;  4LSE A;  2KDY A;  3AA0 A;  3LK2 A;  1IZN A;  2ERV A;  4GCP A;  4JCH A;  4FMS A;  3VE2 A;  4AUI A;  3AA1 A;  2M07 A;  1GFP A;  4KR8 A;  3SYB A;  3JTY A;  4BUM X;  3UAQ A;  3VE1 A;  2ZLD A;  2XE3 A;  3HOE A;  4AZL A;  5PRN A;  1ZHZ A;  4GCQ A;  1HXT A;  4QQ1 A;  4AKM A;  3AA1 B;  2J4U P;  4F4B A;  4AFK A;  2POR A;  2LFU A;  3VY9 X;  5AFU K;  3LK4 2;  3LK2 B;  1IZN B;  4AYN A;  5ADX L;  1BH3 A;  4E1T A;  6PRN A;  2F1T A;  3VZT X;  4FT6 A;  4D65 A;  1BT9 A;  1GFM A;  3V8U A;  1MM4 A;  4KR4 A;  1BXW A;  2K0L A;  2ZFG A;  3POR A;  1ORM A;  3AAA A;  4G75 A;  4U9C A;  1E54 A;  5DL8 A;  2OMF A;  3FYX A;  1ZHW A;  4JFB A;  2XE1 A;  3A2S X;  4GCS A;  2KXP B;  5FVN A;  4FRX A;  4FUV A;  4O4X A;  5DL7 A;  4O4U A;  3WI5 A;  3TZG A;  4E1S A;  2QTK A;  1QJP A;  4D5U A;  3HOL A;  2K4T A;  2Y2X A;  1MM5 A;  5GV0 A;  4FSP A;  1THQ A;  3PRN A;  4RLC A;  3T0S A;  2Y0K A;  1YS5 A;  2M06 A;  4B61 A;  8PRN A;  4RL9 A;  4AKR B;  3C5O A;  4AYI D;  2MNH A;  3HWB A;  2MHL A;  2ODJ A;  4N59 A;  2XE5 A;  1GFN A;  1ZHY A;  1OSM A;  3K19 A;  3PQS A;  4AKR A;  4C69 X;  5AFU L;  2JMM A;  3T20 A;  3AA6 B;  3O0E A;  3AA0 B;  4RJX A;  5DL5 A;  2YPV A;  3HW9 A;  3AA6 A;  4N58 A;  3SYS A;  3UPG A;  4RJW A;  2GE4 A;  1OPF A;  4AYM C;  1H6S 1;  2Y0L A;  3POU A;  3POX A;  3G7G A;  3SY9 A;  4G76 A;  3AA7 B;  3LK3 B;  1MPF A;  2KC0 A;  3QRA A;  2Y0H A;  5G26 A;  4XNL A;  4Z3T A;  4GHB A;  3DA4 A;  1HXX A;  7PRN A;  1P4T A;  3GP6 A;  2XG6 A;  4RLB A;  5DL6 A;  2F1V A;  2FGR A;  2W80 C;  2XE2 A;  4FSO A;  4LSI A;  3T24 A;  4FZM A;  1HXU A;  4O3Y A;  1PRN A;  3DA3 A;  4KRA A;  1GFQ A;  4O3W A;  5D5D A;  3AAA B;  1ZHT A;  3RBH A;  2XMX A;  4FOZ A;  3VZW X;  3WI4 A;  3LK3 A;  3AA7 A;  3LK4 1;  3SY7 A;  2XTR A;  2LHF A;  4FRT A;  1QJ9 A;  2X27 X;  2KXP A;  3KVD D;  1Q9F A;  4FZL A;  2KZ7 B;  5T5F A;  3AAE B;  3QRC A;  5EE2 A;  2Y7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...