2PORA

Structure of porin refined at 1.8 angstroms resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
301
structure length
301
Chain Sequence
b'EVKLSGDARMGVMYNGDDWNFSSRSRVLFTMSGTTDSGLEFGASFKAHESVGAETGEDGTVFLSGAFGKIEMGDALGASEALFGDLYEVGYTDLDDRGGNDIPYLTGDERLTAEDNPVLLYTYSAGAFSVAASMSDGKVGETSEDDAQEMAVAAAYTFGNYTVGLGYEKIDSPDTALMADMEQLELAAIAKFGATNVKAYYADGELDRDFARAVFDLTPVAAAATAVDHKAYGLSVDSTFGATTVGGYVQVLDIDTIDDVTYYGLGASYDLGGGASIVGGIADNDLPNSDMVADLGVKFKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORIN
publication title Structure of porin refined at 1.8 A resolution.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Integral membrane protein porin
total genus 76
structure length 301
sequence length 301
ec nomenclature
pdb deposition date 1992-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13609 Porin_4 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2porA00
3T0SA 2ZFGA 4D5UA 4FOZA 5PRNA 3UPGA 4KR8A 1E54A 3T20A 3VY8X 3VY9X 4GCPA 2Y0HA 2Y0LA 5JDPA 3SY9A 3POQA 4KR4A 3HW9A 4KRAA 2FGRA 3FYXA 4LSHA 2XG6A 4AUIA 1PRNA 1HXTA 2Y0KA 1GFNA 2ZLDA 1BT9A 3SZVA 2OMFA 4LSIA 4RJXA 4JFBA 4LSEA 4BUMX 2XE2A 4RJWA 5DL7A 2QTKA 2XE5A 2ODJA 3HWBA 6PRNA 1HXUA 1OSMA 1BH3A 8PRNA 1HXXA 3JTYA 4FSPA 1MPFA 3WI5A 3POXA 4FRTA 4FSOA 1GFPA 4FMSA 1OPFA 4D64A 5DL5A 3A2SX 4C69X 3T24A 3NSGA 2PRNA 4GCQA 4FRXA 4GCSA 2Y2XA 3EMNX 2FGQX 3WI4A 2O4VA 3SY7A 3POUA 1H6S1 3K19A 3SYBA 3PORA 3PRNA 1GFOA 3SZDA 3VZTX 5FVNA 1GFQA 1PHOA 1GFMA 4LSFA 4D65A 3SYSA 3VZWX 2PORA 2K4TA 3UU2A 2J4UP 3VZUX 5DL6A 2J1NA 2XE1A 3O0EA 7PRNA 4FT6A 2XE3A 5DL8A
chains in the Genus database with same CATH superfamily
5B66O 4AYDC 3T0SA 4RLCA 4B61A 4G75A 2ZFGA 2X27X 4D5UA 2F1CX 2Y7SA 4IL6O 3AA7B 4FOZA 4JCHA 5PRNA 4AZLA 1QJPA 4C4VB 3UPGA 3AA0A 3PF1A 4K3BA 2LFUA 4N59A 2AXTO 4KR8A 1E54A 4GHBA 3T20A 3VY8X 2WJRA 3VY9X 2JMMA 4AYMC 3AA0B 2MNHA 4GCPA 4AYID 4E1TA 3C5OA 2Y0HA 1QJ8A 2Y0LA 3DWOX 1IZNB 2XTQA 3KZIO 5GTIO 5JDPA 3SY9A 2R8AA 3DWNA 2R4OA 1ZHWA 3POQA 4KR4A 3TZGA 3VE2A 3HW9A 4KRAA 2FGRA 3FYXA 4LSHA 2XG6A 3V8UA 4O4UA 2R88A 3VE1A 4AUIA 1PRNA 1HXTA 1BXWA 2Y0KA 2YPVA 4F4BA 4XNKA 1GFNA 1THQA 2ZLDA 4O3WA 4K3CA 1BT9A 3SZVA 1MM5A 2F1VA 2OMFA 4LSIA 4RJXA 1QJ9A 4FESA 4JFBA 1P4TA 2KC0A 4LSEA 4BUMX 2XE2A 1Q9FA 2XTRA 5KAFO 3JCUO 2GE4A 1G90A 4RJWA 4FZNA 5DL7A 1IZNA 5D5DA 2QTKA 4FQEA 2XE5A 4FUVA 4GF4A 1MM4A 2ODJA 3A0BO 3HWBA 4O49A 6PRNA 1T16A 1HXUA 4G76A 3WU2O 1OSMA 2KZ7A 2R4NA 4UB6O 3LK3A 1BH3A 2LHFA 2XMXA 3BRZA 2MHLA 5B5EO 8PRNA 5AFUK 1HXXA 4PUXA 1ZHYA 3JTYA 1MPFA 4FSPA 3POXA 4N58A 2KZ7B 2M07A 4U9CA 2W80C 4FRTA 3GP6A 3LK3B 4RL9A 3BRYA 4FSOA 5G39A 1GFPA 3NJTA 4FMSA 1T1LA 2K0LA 1OPFA 2R4LA 2ERVA 4N75A 3A2SX 4O3ZA 5DL5A 5DL8A 4D64A 4AYNA 4N74A 4O3XB 4AKRA 3PQSA 3KVDD 3DA4A 5GTHO 5T5FA 3T24A 4C69X 5ADXL 3NSGA 2PRNA 3PGRA 2W81C 4GCQA 2YNKA 4C4VA 4FZLA 4FRXA 1ZHZA 4GCSA 3UAQA 2Y2XA 4PJ0O 3A0HO 4AKRB 4XNLA 3EMNX 5G38A 5GV0A 3AAAA 5TISO 2FGQX 3WI4A 2O4VA 2N2LA 3HOLA 3LK41 2X9KA 1ZHXA 2WJQA 3LK2A 1H6S1 3POUA 3SY7A 2KDYA 3K19A 4Z3TA 2IWWA 4E1SA 3SYBA 3DA3A 3AAAB 2F1TA 3HOEA 3PORA 4AFKA 5IYUA 3DZMA 5G3AA 1GFOA 2R89A 3PRNA 5KAIO 3PGSA 3AA6A 3SZDA 3LK2B 3VZTX 5ADXK 5FVNA 2JQYA 1GFQA 1ZHTA 1GFMA 1PHOA 3PGUA 3LK42 4LSFA 4D65A 3AAEA 2WVPA 3SYSA 3AA6B 4FZMA 3VZWX 3AA1A 5AFUL 2PORA 2K4TA 3PQUA 4O4XA 1Q9GA 4RLBA 4QQ1A 4AKMA 3UU2A 2KXPA 2N2MA 1S5LO 2M06A 3AAEB 4O3YA 2J4UP 1ORMA 5E79O 1YS5A 3AA1B 3VZUX 3WI5A 4C00A 4PR7A 5DL6A 2J1NA 2KXPB 2IWVA 2XE1A 4AYEC 5G26A 4UB8O 3RBHA 3O0EA 3G7GA 3BS0A 2R4PA 7PRNA 3QRCA 4FT6A 5EE2A 5H2FO 3AA7A 2XE3A 4CTDA 3QRAA
chains in the Genus database with same CATH topology
4AYDC 3T0SA 4RLCA 4B61A 4G75A 2ZFGA 2X27X 4D5UA 2Y7SA 3AA7B 4FOZA 4JCHA 5PRNA 4AZLA 1QJPA 3UPGA 3AA0A 2LFUA 4N59A 4KR8A 1E54A 4GHBA 3T20A 3VY8X 3VY9X 4E1TA 2JMMA 4AYMC 3AA0B 2MNHA 4GCPA 4AYID 3C5OA 2Y0HA 1QJ8A 2Y0LA 1IZNB 2XTQA 5JDPA 3SY9A 3POQA 1ZHWA 4KR4A 3TZGA 3VE2A 3HW9A 4KRAA 2FGRA 3FYXA 4LSHA 2XG6A 3V8UA 4O4UA 3VE1A 4AUIA 5ADXK 1PRNA 1HXTA 1BXWA 2Y0KA 2YPVA 4F4BA 4XNKA 1GFNA 1THQA 2ZLDA 4O3WA 1BT9A 3SZVA 1MM5A 2F1VA 2OMFA 4LSIA 4RJXA 1QJ9A 4FESA 4JFBA 1P4TA 2KC0A 4LSEA 4BUMX 2XE2A 1Q9FA 2XTRA 2GE4A 4RJWA 4FZNA 5DL7A 1IZNA 5D5DA 2QTKA 2XE5A 4FUVA 4GF4A 1MM4A 2ODJA 3HWBA 4O49A 6PRNA 1HXUA 4G76A 1OSMA 2KZ7A 3LK3A 1BH3A 2LHFA 2XMXA 2MHLA 8PRNA 5AFUK 1HXXA 4PUXA 1ZHYA 3JTYA 1MPFA 4FSPA 3POXA 4N58A 2KZ7B 2M07A 4U9CA 2W80C 4FRTA 3GP6A 3LK3B 4RL9A 4FSOA 1GFPA 4FMSA 2K0LA 1OPFA 2ERVA 5DL5A 3A2SX 4O3ZA 4D64A 5DL8A 4AYNA 4O3XB 4AKRA 3PQSA 3KVDD 3DA4A 5T5FA 3T24A 4C69X 5ADXL 3NSGA 2PRNA 2W81C 4GCQA 2YNKA 4FZLA 4FRXA 1ZHZA 4GCSA 3UAQA 2Y2XA 4AKRB 4XNLA 3EMNX 5GV0A 3AAAA 2FGQX 3WI4A 2O4VA 2N2LA 3HOLA 3LK41 1G90A 1ZHXA 3LK2A 3POUA 1H6S1 3SY7A 4Z3TA 2KDYA 3K19A 4E1SA 3SYBA 3DA3A 3AAAB 2F1TA 3HOEA 3PORA 4AFKA 5IYUA 1GFOA 3PRNA 3SZDA 3AA6A 3LK2B 3VZTX 5FVNA 1GFQA 1ZHTA 1GFMA 1PHOA 4LSFA 3LK42 4D65A 3AAEA 3SYSA 3AA6B 4FZMA 3VZWX 3AA1A 5AFUL 2PORA 2K4TA 3PQUA 4O4XA 1Q9GA 4RLBA 4QQ1A 4AKMA 3UU2A 2KXPA 2N2MA 3AAEB 2M06A 4O3YA 2J4UP 1ORMA 1YS5A 3AA1B 3VZUX 3WI5A 5DL6A 2J1NA 2KXPB 2XE1A 4AYEC 5G26A 3RBHA 3O0EA 3G7GA 7PRNA 3QRCA 4FT6A 5EE2A 3AA7A 2XE3A 3QRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T0S A;  2ZFG A;  4D5U A;  4FOZ A;  5PRN A;  3UPG A;  4KR8 A;  1E54 A;  3T20 A;  3VY8 X;  3VY9 X;  4GCP A;  2Y0H A;  2Y0L A;  5JDP A;  3SY9 A;  3POQ A;  4KR4 A;  3HW9 A;  4KRA A;  2FGR A;  3FYX A;  4LSH A;  2XG6 A;  4AUI A;  1PRN A;  1HXT A;  2Y0K A;  1GFN A;  2ZLD A;  1BT9 A;  3SZV A;  2OMF A;  4LSI A;  4RJX A;  4JFB A;  4LSE A;  4BUM X;  2XE2 A;  4RJW A;  5DL7 A;  2QTK A;  2XE5 A;  2ODJ A;  3HWB A;  6PRN A;  1HXU A;  1OSM A;  1BH3 A;  8PRN A;  1HXX A;  3JTY A;  4FSP A;  1MPF A;  3WI5 A;  3POX A;  4FRT A;  4FSO A;  1GFP A;  4FMS A;  1OPF A;  4D64 A;  5DL5 A;  3A2S X;  4C69 X;  3T24 A;  3NSG A;  2PRN A;  4GCQ A;  4FRX A;  4GCS A;  2Y2X A;  3EMN X;  2FGQ X;  3WI4 A;  2O4V A;  3SY7 A;  3POU A;  1H6S 1;  3K19 A;  3SYB A;  3POR A;  3PRN A;  1GFO A;  3SZD A;  3VZT X;  5FVN A;  1GFQ A;  1PHO A;  1GFM A;  4LSF A;  4D65 A;  3SYS A;  3VZW X;  2POR A;  2K4T A;  3UU2 A;  2J4U P;  3VZU X;  5DL6 A;  2J1N A;  2XE1 A;  3O0E A;  7PRN A;  4FT6 A;  2XE3 A;  5DL8 A; 
#chains in the Genus database with same CATH topology
 5B66 O;  4AYD C;  3T0S A;  4RLC A;  4B61 A;  4G75 A;  2ZFG A;  2X27 X;  4D5U A;  2F1C X;  2Y7S A;  4IL6 O;  3AA7 B;  4FOZ A;  4JCH A;  5PRN A;  4AZL A;  1QJP A;  4C4V B;  3UPG A;  3AA0 A;  3PF1 A;  4K3B A;  2LFU A;  4N59 A;  2AXT O;  4KR8 A;  1E54 A;  4GHB A;  3T20 A;  3VY8 X;  2WJR A;  3VY9 X;  2JMM A;  4AYM C;  3AA0 B;  2MNH A;  4GCP A;  4AYI D;  4E1T A;  3C5O A;  2Y0H A;  1QJ8 A;  2Y0L A;  3DWO X;  1IZN B;  2XTQ A;  3KZI O;  5GTI O;  5JDP A;  3SY9 A;  2R8A A;  3DWN A;  2R4O A;  1ZHW A;  3POQ A;  4KR4 A;  3TZG A;  3VE2 A;  3HW9 A;  4KRA A;  2FGR A;  3FYX A;  4LSH A;  2XG6 A;  3V8U A;  4O4U A;  2R88 A;  3VE1 A;  4AUI A;  1PRN A;  1HXT A;  1BXW A;  2Y0K A;  2YPV A;  4F4B A;  4XNK A;  1GFN A;  1THQ A;  2ZLD A;  4O3W A;  4K3C A;  1BT9 A;  3SZV A;  1MM5 A;  2F1V A;  2OMF A;  4LSI A;  4RJX A;  1QJ9 A;  4FES A;  4JFB A;  1P4T A;  2KC0 A;  4LSE A;  4BUM X;  2XE2 A;  1Q9F A;  2XTR A;  5KAF O;  3JCU O;  2GE4 A;  1G90 A;  4RJW A;  4FZN A;  5DL7 A;  1IZN A;  5D5D A;  2QTK A;  4FQE A;  2XE5 A;  4FUV A;  4GF4 A;  1MM4 A;  2ODJ A;  3A0B O;  3HWB A;  4O49 A;  6PRN A;  1T16 A;  1HXU A;  4G76 A;  3WU2 O;  1OSM A;  2KZ7 A;  2R4N A;  4UB6 O;  3LK3 A;  1BH3 A;  2LHF A;  2XMX A;  3BRZ A;  2MHL A;  5B5E O;  8PRN A;  5AFU K;  1HXX A;  4PUX A;  1ZHY A;  3JTY A;  1MPF A;  4FSP A;  3POX A;  4N58 A;  2KZ7 B;  2M07 A;  4U9C A;  2W80 C;  4FRT A;  3GP6 A;  3LK3 B;  4RL9 A;  3BRY A;  4FSO A;  5G39 A;  1GFP A;  3NJT A;  4FMS A;  1T1L A;  2K0L A;  1OPF A;  2R4L A;  2ERV A;  4N75 A;  3A2S X;  4O3Z A;  5DL5 A;  5DL8 A;  4D64 A;  4AYN A;  4N74 A;  4O3X B;  4AKR A;  3PQS A;  3KVD D;  3DA4 A;  5GTH O;  5T5F A;  3T24 A;  4C69 X;  5ADX L;  3NSG A;  2PRN A;  3PGR A;  2W81 C;  4GCQ A;  2YNK A;  4C4V A;  4FZL A;  4FRX A;  1ZHZ A;  4GCS A;  3UAQ A;  2Y2X A;  4PJ0 O;  3A0H O;  4AKR B;  4XNL A;  3EMN X;  5G38 A;  5GV0 A;  3AAA A;  5TIS O;  2FGQ X;  3WI4 A;  2O4V A;  2N2L A;  3HOL A;  3LK4 1;  2X9K A;  1ZHX A;  2WJQ A;  3LK2 A;  1H6S 1;  3POU A;  3SY7 A;  2KDY A;  3K19 A;  4Z3T A;  2IWW A;  4E1S A;  3SYB A;  3DA3 A;  3AAA B;  2F1T A;  3HOE A;  3POR A;  4AFK A;  5IYU A;  3DZM A;  5G3A A;  1GFO A;  2R89 A;  3PRN A;  5KAI O;  3PGS A;  3AA6 A;  3SZD A;  3LK2 B;  3VZT X;  5ADX K;  5FVN A;  2JQY A;  1GFQ A;  1ZHT A;  1GFM A;  1PHO A;  3PGU A;  3LK4 2;  4LSF A;  4D65 A;  3AAE A;  2WVP A;  3SYS A;  3AA6 B;  4FZM A;  3VZW X;  3AA1 A;  5AFU L;  2POR A;  2K4T A;  3PQU A;  4O4X A;  1Q9G A;  4RLB A;  4QQ1 A;  4AKM A;  3UU2 A;  2KXP A;  2N2M A;  1S5L O;  2M06 A;  3AAE B;  4O3Y A;  2J4U P;  1ORM A;  5E79 O;  1YS5 A;  3AA1 B;  3VZU X;  3WI5 A;  4C00 A;  4PR7 A;  5DL6 A;  2J1N A;  2KXP B;  2IWV A;  2XE1 A;  4AYE C;  5G26 A;  4UB8 O;  3RBH A;  3O0E A;  3G7G A;  3BS0 A;  2R4P A;  7PRN A;  3QRC A;  4FT6 A;  5EE2 A;  5H2F O;  3AA7 A;  2XE3 A;  4CTD A;  3QRA A; 
#chains in the Genus database with same CATH homology
 4AYD C;  3T0S A;  4RLC A;  4B61 A;  4G75 A;  2ZFG A;  2X27 X;  4D5U A;  2Y7S A;  3AA7 B;  4FOZ A;  4JCH A;  5PRN A;  4AZL A;  1QJP A;  3UPG A;  3AA0 A;  2LFU A;  4N59 A;  4KR8 A;  1E54 A;  4GHB A;  3T20 A;  3VY8 X;  3VY9 X;  4E1T A;  2JMM A;  4AYM C;  3AA0 B;  2MNH A;  4GCP A;  4AYI D;  3C5O A;  2Y0H A;  1QJ8 A;  2Y0L A;  1IZN B;  2XTQ A;  5JDP A;  3SY9 A;  3POQ A;  1ZHW A;  4KR4 A;  3TZG A;  3VE2 A;  3HW9 A;  4KRA A;  2FGR A;  3FYX A;  4LSH A;  2XG6 A;  3V8U A;  4O4U A;  3VE1 A;  4AUI A;  5ADX K;  1PRN A;  1HXT A;  1BXW A;  2Y0K A;  2YPV A;  4F4B A;  4XNK A;  1GFN A;  1THQ A;  2ZLD A;  4O3W A;  1BT9 A;  3SZV A;  1MM5 A;  2F1V A;  2OMF A;  4LSI A;  4RJX A;  1QJ9 A;  4FES A;  4JFB A;  1P4T A;  2KC0 A;  4LSE A;  4BUM X;  2XE2 A;  1Q9F A;  2XTR A;  2GE4 A;  4RJW A;  4FZN A;  5DL7 A;  1IZN A;  5D5D A;  2QTK A;  2XE5 A;  4FUV A;  4GF4 A;  1MM4 A;  2ODJ A;  3HWB A;  4O49 A;  6PRN A;  1HXU A;  4G76 A;  1OSM A;  2KZ7 A;  3LK3 A;  1BH3 A;  2LHF A;  2XMX A;  2MHL A;  8PRN A;  5AFU K;  1HXX A;  4PUX A;  1ZHY A;  3JTY A;  1MPF A;  4FSP A;  3POX A;  4N58 A;  2KZ7 B;  2M07 A;  4U9C A;  2W80 C;  4FRT A;  3GP6 A;  3LK3 B;  4RL9 A;  4FSO A;  1GFP A;  4FMS A;  2K0L A;  1OPF A;  2ERV A;  5DL5 A;  3A2S X;  4O3Z A;  4D64 A;  5DL8 A;  4AYN A;  4O3X B;  4AKR A;  3PQS A;  3KVD D;  3DA4 A;  5T5F A;  3T24 A;  4C69 X;  5ADX L;  3NSG A;  2PRN A;  2W81 C;  4GCQ A;  2YNK A;  4FZL A;  4FRX A;  1ZHZ A;  4GCS A;  3UAQ A;  2Y2X A;  4AKR B;  4XNL A;  3EMN X;  5GV0 A;  3AAA A;  2FGQ X;  3WI4 A;  2O4V A;  2N2L A;  3HOL A;  3LK4 1;  1G90 A;  1ZHX A;  3LK2 A;  3POU A;  1H6S 1;  3SY7 A;  4Z3T A;  2KDY A;  3K19 A;  4E1S A;  3SYB A;  3DA3 A;  3AAA B;  2F1T A;  3HOE A;  3POR A;  4AFK A;  5IYU A;  1GFO A;  3PRN A;  3SZD A;  3AA6 A;  3LK2 B;  3VZT X;  5FVN A;  1GFQ A;  1ZHT A;  1GFM A;  1PHO A;  4LSF A;  3LK4 2;  4D65 A;  3AAE A;  3SYS A;  3AA6 B;  4FZM A;  3VZW X;  3AA1 A;  5AFU L;  2POR A;  2K4T A;  3PQU A;  4O4X A;  1Q9G A;  4RLB A;  4QQ1 A;  4AKM A;  3UU2 A;  2KXP A;  2N2M A;  3AAE B;  2M06 A;  4O3Y A;  2J4U P;  1ORM A;  1YS5 A;  3AA1 B;  3VZU X;  3WI5 A;  5DL6 A;  2J1N A;  2KXP B;  2XE1 A;  4AYE C;  5G26 A;  3RBH A;  3O0E A;  3G7G A;  7PRN A;  3QRC A;  4FT6 A;  5EE2 A;  3AA7 A;  2XE3 A;  3QRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...