2PORA

Structure of porin refined at 1.8 angstroms resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
301
structure length
301
Chain Sequence
EVKLSGDARMGVMYNGDDWNFSSRSRVLFTMSGTTDSGLEFGASFKAHESVGAETGEDGTVFLSGAFGKIEMGDALGASEALFGDLYEVGYTDLDDRGGNDIPYLTGDERLTAEDNPVLLYTYSAGAFSVAASMSDGKVGETSEDDAQEMAVAAAYTFGNYTVGLGYEKIDSPDTALMADMEQLELAAIAKFGATNVKAYYADGELDRDFARAVFDLTPVAAAATAVDHKAYGLSVDSTFGATTVGGYVQVLDIDTIDDVTYYGLGASYDLGGGASIVGGIADNDLPNSDMVADLGVKFKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Integral membrane protein porin
molecule keywords PORIN
publication title Structure of porin refined at 1.8 A resolution.
pubmed doi rcsb
source organism Rhodobacter capsulatus
total genus 76
structure length 301
sequence length 301
ec nomenclature
pdb deposition date 1992-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13609 Porin_4 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2porA00
3WI4A 3WI5A 3UPGA 4FT6A 1HXUA 4JFBA 3SZVA 3NSGA 4RJXA 3VZTX 1HXTA 3FYXA 2ZLDA 1MPFA 4LSEA 2XE5A 3O0EA 3SY7A 4AUIA 1H6S1 2XG6A 3HWBA 3EMNX 3PRNA 2XE3A 7PRNA 2ZFGA 3K19A 3SY9A 5DL7A 2Y0HA 4GCSA 4FSPA 3JTYA 1GFNA 2Y0LA 3T0SA 2K4TA 4GCQA 3POUA 2PORA 5JDPA 1BH3A 4LSFA 2FGRA 4D64A 1E54A 4C69X 3T24A 2J1NA 1BT9A 1GFMA 3A2SX 4BUMX 3POQA 5DL5A 1GFQA 4KR8A 1PHOA 3SZDA 1OPFA 4KRAA 3HW9A 5PRNA 3VY8X 1GFPA 2FGQX 2ODJA 1OSMA 2XE2A 3VY9X 2J4UP 5DL6A 1GFOA 4D65A 4KR4A 2PRNA 4RJWA 1HXXA 2QTKA 4FSOA 4FMSA 2O4VA 4FRXA 5DL8A 6PRNA 5FVNA 2XE1A 4FRTA 2Y0KA 3VZWX 4LSIA 1PRNA 8PRNA 4GCPA 3T20A 4D5UA 4LSHA 3POXA 3SYBA 3VZUX 4FOZA 3PORA 3UU2A 2OMFA 3SYSA 2Y2XA
chains in the Genus database with same CATH superfamily
3AA1A 1QJ9A 2YNKA 2R4NA 2MNHA 2X9KA 2W81C 3WI5A 3WI4A 3UPGA 2YPVA 5G38A 5H2FO 4FT6A 1T1LA 4O4UA 3HOEA 3QRAA 1HXUA 4JFBA 3HOLA 5TISO 3SZVA 1G90A 3NSGA 3AA0B 3AAEB 2JMMA 2WJQA 4RJXA 4O3YA 3AAAA 3VZTX 5D5DA 3WU2O 1HXTA 4B61A 2KDYA 3FYXA 2XTRA 4IL6O 5IYUA 2ZLDA 1MPFA 2Y2XA 4LSEA 4XNKA 5KAFO 3LK42 2XE5A 3JCUO 4K3BA 2XMXA 2XTQA 3O0EA 3SY7A 4AUIA 2KC0A 1H6S1 2XG6A 3HWBA 5G39A 3BRYA 3EMNX 3PRNA 2JQYA 4AKRA 2XE3A 7PRNA 2ZFGA 3K19A 3LK41 3SY9A 5DL7A 2KZ7B 4F4BA 4O3XB 2IWWA 2Y0HA 4Z3TA 2F1VA 2WJRA 5G3AA 5E79O 4FZMA 1QJPA 3VE1A 4FSPA 4GCSA 4U9CA 3JTYA 5B5EO 1GFNA 2Y7SA 2LFUA 2Y0LA 5AFUL 5EE2A 2K4TA 4GCQA 3T0SA 3POUA 2ERVA 2PORA 5T5FA 4E1TA 4N59A 2F1TA 3QRCA 2AXTO 1BH3A 4FZNA 4LSFA 2FGRA 1IZNB 1Q9FA 2IWVA 4D64A 4C4VB 3AA0A 3AAEA 4E1SA 4O3WA 1E54A 3PF1A 4C69X 1QJ8A 2X27X 1ZHXA 3LK2B 2J1NA 1BXWA 2W80C 1BT9A 2LHFA 3LK3B 3NJTA 3T24A 2M07A 1THQA 2KXPB 1GFMA 3A2SX 2R8AA 4N75A 4BUMX 3AA7B 3POQA 4FQEA 5DL5A 5AFUK 1GFQA 4KR8A 1PHOA 4FUVA 5GTIO 2R88A 2K0LA 3SZDA 3V8UA 1OPFA 2R4PA 5ADXL 4KRAA 4GF4A 4K3CA 5GV0A 3DWNA 3KVDD 3AA6A 4UB8O 3VE2A 1MM5A 2N2LA 2R4LA 1S5LO 3HW9A 5PRNA 3VY8X 2R4OA 1GFPA 4GHBA 1T16A 3BS0A 4AKMA 2FGQX 2ODJA 4G75A 5G26A 4AYNA 4O3ZA 2F1CX 4XNLA 2GE4A 1OSMA 3PQUA 1IZNA 4AFKA 4C4VA 4RL9A 5ADXK 2XE2A 4AZLA 2WVPA 4FESA 3LK2A 3VY9X 2J4UP 5DL6A 4AKRB 1GFOA 3DA3A 4AYEC 2KXPA 2M06A 1MM4A 3C5OA 5KAIO 4KR4A 2PRNA 4RJWA 4D65A 4RLCA 1HXXA 2QTKA 3A0HO 2R89A 4FSOA 4FMSA 4QQ1A 3PQSA 2O4VA 4FRXA 5DL8A 5JDPA 2KZ7A 3AA1B 4RLBA 6PRNA 4CTDA 1P4TA 3DZMA 3G7GA 3GP6A 5FVNA 1ZHZA 4N58A 4UB6O 4O49A 2XE1A 4FRTA 4PUXA 4AYDC 2Y0KA 3VZWX 2MHLA 5GTHO 3AAAB 4PR7A 1ZHYA 1ZHWA 3A0BO 4LSIA 4N74A 1PRNA 4G76A 1Q9GA 3UAQA 4O4XA 3KZIO 3RBHA 4AYID 3DA4A 8PRNA 4GCPA 3T20A 3DWOX 3LK3A 4D5UA 4LSHA 3BRZA 4C00A 1ZHTA 3AA7A 3POXA 4AYMC 3PGRA 3PGUA 3TZGA 3SYBA 2N2MA 3PGSA 4FOZA 3PORA 4PJ0O 3AA6B 3UU2A 2OMFA 4JCHA 3VZUX 5B66O 4FZLA 1ORMA 3SYSA 1YS5A
chains in the Genus database with same CATH topology
3AA1A 1QJ9A 2YNKA 3WI4A 2MNHA 3WI5A 2W81C 3UPGA 2YPVA 4FT6A 4O4UA 3HOEA 3QRAA 1HXUA 4JFBA 3HOLA 3SZVA 1G90A 3NSGA 3AA0B 3AAEB 2JMMA 4RJXA 4O3YA 3AAAA 3VZTX 5D5DA 1HXTA 4B61A 2KDYA 3FYXA 2XTRA 2ZLDA 1MPFA 2Y2XA 4LSEA 4XNKA 3LK42 2XE5A 2XMXA 2XTQA 3O0EA 3SY7A 4AUIA 2KC0A 1H6S1 2XG6A 3HWBA 3EMNX 3PRNA 4AKRA 2XE3A 7PRNA 2ZFGA 3K19A 3LK41 3SY9A 5DL7A 2KZ7B 4F4BA 4O3XB 2Y0HA 4Z3TA 2F1VA 4FZMA 1QJPA 3VE1A 4FSPA 4GCSA 4U9CA 3JTYA 1GFNA 2Y7SA 2LFUA 2Y0LA 5AFUL 5EE2A 2K4TA 4GCQA 3T0SA 3POUA 2ERVA 2PORA 5T5FA 4E1TA 4N59A 2F1TA 3QRCA 5JDPA 1BH3A 4FZNA 4LSFA 2FGRA 1IZNB 1Q9FA 4D64A 3AA0A 3AAEA 4E1SA 4O3WA 1E54A 4C69X 1QJ8A 2X27X 1ZHXA 3LK2B 2J1NA 1BXWA 2W80C 1BT9A 2LHFA 3LK3B 3T24A 2M07A 1THQA 2KXPB 1GFMA 3A2SX 4BUMX 3AA7B 3POQA 5DL5A 5AFUK 1GFQA 4KR8A 1PHOA 4FUVA 2K0LA 3SZDA 3V8UA 1OPFA 5ADXL 4KRAA 4GF4A 5GV0A 3KVDD 3VE2A 3AA6A 1MM5A 2N2LA 3HW9A 5PRNA 3VY8X 1GFPA 4GHBA 4AKMA 2FGQX 2ODJA 4G75A 5G26A 4AYNA 4O3ZA 4XNLA 2GE4A 1OSMA 3PQUA 1IZNA 4AFKA 4RL9A 5ADXK 2XE2A 4AZLA 4FESA 3LK2A 3VY9X 2J4UP 5DL6A 4AKRB 1GFOA 3DA3A 4AYEC 2KXPA 2M06A 1MM4A 3C5OA 4D65A 4KR4A 2PRNA 4RJWA 5IYUA 4RLCA 1HXXA 2QTKA 4FSOA 4FMSA 4QQ1A 3PQSA 2O4VA 4FRXA 5DL8A 2KZ7A 3AA1B 4RLBA 6PRNA 1P4TA 3G7GA 3GP6A 5FVNA 1ZHZA 4N58A 4O49A 2XE1A 4FRTA 4PUXA 4AYDC 2Y0KA 3VZWX 2MHLA 3AAAB 1ZHYA 1ZHWA 4LSIA 1PRNA 4G76A 1Q9GA 3UAQA 4O4XA 3RBHA 4AYID 8PRNA 3DA4A 4GCPA 3T20A 3LK3A 4D5UA 4LSHA 1ZHTA 3AA7A 3POXA 4AYMC 3TZGA 3SYBA 2N2MA 3VZUX 4FOZA 3PORA 3AA6B 3UU2A 2OMFA 4JCHA 4FZLA 1ORMA 3SYSA 1YS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WI4 A;  3WI5 A;  3UPG A;  4FT6 A;  1HXU A;  4JFB A;  3SZV A;  3NSG A;  4RJX A;  3VZT X;  1HXT A;  3FYX A;  2ZLD A;  1MPF A;  4LSE A;  2XE5 A;  3O0E A;  3SY7 A;  4AUI A;  1H6S 1;  2XG6 A;  3HWB A;  3EMN X;  3PRN A;  2XE3 A;  7PRN A;  2ZFG A;  3K19 A;  3SY9 A;  5DL7 A;  2Y0H A;  4GCS A;  4FSP A;  3JTY A;  1GFN A;  2Y0L A;  3T0S A;  2K4T A;  4GCQ A;  3POU A;  2POR A;  5JDP A;  1BH3 A;  4LSF A;  2FGR A;  4D64 A;  1E54 A;  4C69 X;  3T24 A;  2J1N A;  1BT9 A;  1GFM A;  3A2S X;  4BUM X;  3POQ A;  5DL5 A;  1GFQ A;  4KR8 A;  1PHO A;  3SZD A;  1OPF A;  4KRA A;  3HW9 A;  5PRN A;  3VY8 X;  1GFP A;  2FGQ X;  2ODJ A;  1OSM A;  2XE2 A;  3VY9 X;  2J4U P;  5DL6 A;  1GFO A;  4D65 A;  4KR4 A;  2PRN A;  4RJW A;  1HXX A;  2QTK A;  4FSO A;  4FMS A;  2O4V A;  4FRX A;  5DL8 A;  6PRN A;  5FVN A;  2XE1 A;  4FRT A;  2Y0K A;  3VZW X;  4LSI A;  1PRN A;  8PRN A;  4GCP A;  3T20 A;  4D5U A;  4LSH A;  3POX A;  3SYB A;  3VZU X;  4FOZ A;  3POR A;  3UU2 A;  2OMF A;  3SYS A;  2Y2X A; 
#chains in the Genus database with same CATH topology
 3AA1 A;  1QJ9 A;  2YNK A;  2R4N A;  2MNH A;  2X9K A;  2W81 C;  3WI5 A;  3WI4 A;  3UPG A;  2YPV A;  5G38 A;  5H2F O;  4FT6 A;  1T1L A;  4O4U A;  3HOE A;  3QRA A;  1HXU A;  4JFB A;  3HOL A;  5TIS O;  3SZV A;  1G90 A;  3NSG A;  3AA0 B;  3AAE B;  2JMM A;  2WJQ A;  4RJX A;  4O3Y A;  3AAA A;  3VZT X;  5D5D A;  3WU2 O;  1HXT A;  4B61 A;  2KDY A;  3FYX A;  2XTR A;  4IL6 O;  5IYU A;  2ZLD A;  1MPF A;  2Y2X A;  4LSE A;  4XNK A;  5KAF O;  3LK4 2;  2XE5 A;  3JCU O;  4K3B A;  2XMX A;  2XTQ A;  3O0E A;  3SY7 A;  4AUI A;  2KC0 A;  1H6S 1;  2XG6 A;  3HWB A;  5G39 A;  3BRY A;  3EMN X;  3PRN A;  2JQY A;  4AKR A;  2XE3 A;  7PRN A;  2ZFG A;  3K19 A;  3LK4 1;  3SY9 A;  5DL7 A;  2KZ7 B;  4F4B A;  4O3X B;  2IWW A;  2Y0H A;  4Z3T A;  2F1V A;  2WJR A;  5G3A A;  5E79 O;  4FZM A;  1QJP A;  3VE1 A;  4FSP A;  4GCS A;  4U9C A;  3JTY A;  5B5E O;  1GFN A;  2Y7S A;  2LFU A;  2Y0L A;  5AFU L;  5EE2 A;  2K4T A;  4GCQ A;  3T0S A;  3POU A;  2ERV A;  2POR A;  5T5F A;  4E1T A;  4N59 A;  2F1T A;  3QRC A;  2AXT O;  1BH3 A;  4FZN A;  4LSF A;  2FGR A;  1IZN B;  1Q9F A;  2IWV A;  4D64 A;  4C4V B;  3AA0 A;  3AAE A;  4E1S A;  4O3W A;  1E54 A;  3PF1 A;  4C69 X;  1QJ8 A;  2X27 X;  1ZHX A;  3LK2 B;  2J1N A;  1BXW A;  2W80 C;  1BT9 A;  2LHF A;  3LK3 B;  3NJT A;  3T24 A;  2M07 A;  1THQ A;  2KXP B;  1GFM A;  3A2S X;  2R8A A;  4N75 A;  4BUM X;  3AA7 B;  3POQ A;  4FQE A;  5DL5 A;  5AFU K;  1GFQ A;  4KR8 A;  1PHO A;  4FUV A;  5GTI O;  2R88 A;  2K0L A;  3SZD A;  3V8U A;  1OPF A;  2R4P A;  5ADX L;  4KRA A;  4GF4 A;  4K3C A;  5GV0 A;  3DWN A;  3KVD D;  3AA6 A;  4UB8 O;  3VE2 A;  1MM5 A;  2N2L A;  2R4L A;  1S5L O;  3HW9 A;  5PRN A;  3VY8 X;  2R4O A;  1GFP A;  4GHB A;  1T16 A;  3BS0 A;  4AKM A;  2FGQ X;  2ODJ A;  4G75 A;  5G26 A;  4AYN A;  4O3Z A;  2F1C X;  4XNL A;  2GE4 A;  1OSM A;  3PQU A;  1IZN A;  4AFK A;  4C4V A;  4RL9 A;  5ADX K;  2XE2 A;  4AZL A;  2WVP A;  4FES A;  3LK2 A;  3VY9 X;  2J4U P;  5DL6 A;  4AKR B;  1GFO A;  3DA3 A;  4AYE C;  2KXP A;  2M06 A;  1MM4 A;  3C5O A;  5KAI O;  4KR4 A;  2PRN A;  4RJW A;  4D65 A;  4RLC A;  1HXX A;  2QTK A;  3A0H O;  2R89 A;  4FSO A;  4FMS A;  4QQ1 A;  3PQS A;  2O4V A;  4FRX A;  5DL8 A;  5JDP A;  2KZ7 A;  3AA1 B;  4RLB A;  6PRN A;  4CTD A;  1P4T A;  3DZM A;  3G7G A;  3GP6 A;  5FVN A;  1ZHZ A;  4N58 A;  4UB6 O;  4O49 A;  2XE1 A;  4FRT A;  4PUX A;  4AYD C;  2Y0K A;  3VZW X;  2MHL A;  5GTH O;  3AAA B;  4PR7 A;  1ZHY A;  1ZHW A;  3A0B O;  4LSI A;  4N74 A;  1PRN A;  4G76 A;  1Q9G A;  3UAQ A;  4O4X A;  3KZI O;  3RBH A;  4AYI D;  3DA4 A;  8PRN A;  4GCP A;  3T20 A;  3DWO X;  3LK3 A;  4D5U A;  4LSH A;  3BRZ A;  4C00 A;  1ZHT A;  3AA7 A;  3POX A;  4AYM C;  3PGR A;  3PGU A;  3TZG A;  3SYB A;  2N2M A;  3PGS A;  4FOZ A;  3POR A;  4PJ0 O;  3AA6 B;  3UU2 A;  2OMF A;  4JCH A;  3VZU X;  5B66 O;  4FZL A;  1ORM A;  3SYS A;  1YS5 A; 
#chains in the Genus database with same CATH homology
 3AA1 A;  1QJ9 A;  2YNK A;  3WI4 A;  2MNH A;  3WI5 A;  2W81 C;  3UPG A;  2YPV A;  4FT6 A;  4O4U A;  3HOE A;  3QRA A;  1HXU A;  4JFB A;  3HOL A;  3SZV A;  1G90 A;  3NSG A;  3AA0 B;  3AAE B;  2JMM A;  4RJX A;  4O3Y A;  3AAA A;  3VZT X;  5D5D A;  1HXT A;  4B61 A;  2KDY A;  3FYX A;  2XTR A;  2ZLD A;  1MPF A;  2Y2X A;  4LSE A;  4XNK A;  3LK4 2;  2XE5 A;  2XMX A;  2XTQ A;  3O0E A;  3SY7 A;  4AUI A;  2KC0 A;  1H6S 1;  2XG6 A;  3HWB A;  3EMN X;  3PRN A;  4AKR A;  2XE3 A;  7PRN A;  2ZFG A;  3K19 A;  3LK4 1;  3SY9 A;  5DL7 A;  2KZ7 B;  4F4B A;  4O3X B;  2Y0H A;  4Z3T A;  2F1V A;  4FZM A;  1QJP A;  3VE1 A;  4FSP A;  4GCS A;  4U9C A;  3JTY A;  1GFN A;  2Y7S A;  2LFU A;  2Y0L A;  5AFU L;  5EE2 A;  2K4T A;  4GCQ A;  3T0S A;  3POU A;  2ERV A;  2POR A;  5T5F A;  4E1T A;  4N59 A;  2F1T A;  3QRC A;  5JDP A;  1BH3 A;  4FZN A;  4LSF A;  2FGR A;  1IZN B;  1Q9F A;  4D64 A;  3AA0 A;  3AAE A;  4E1S A;  4O3W A;  1E54 A;  4C69 X;  1QJ8 A;  2X27 X;  1ZHX A;  3LK2 B;  2J1N A;  1BXW A;  2W80 C;  1BT9 A;  2LHF A;  3LK3 B;  3T24 A;  2M07 A;  1THQ A;  2KXP B;  1GFM A;  3A2S X;  4BUM X;  3AA7 B;  3POQ A;  5DL5 A;  5AFU K;  1GFQ A;  4KR8 A;  1PHO A;  4FUV A;  2K0L A;  3SZD A;  3V8U A;  1OPF A;  5ADX L;  4KRA A;  4GF4 A;  5GV0 A;  3KVD D;  3VE2 A;  3AA6 A;  1MM5 A;  2N2L A;  3HW9 A;  5PRN A;  3VY8 X;  1GFP A;  4GHB A;  4AKM A;  2FGQ X;  2ODJ A;  4G75 A;  5G26 A;  4AYN A;  4O3Z A;  4XNL A;  2GE4 A;  1OSM A;  3PQU A;  1IZN A;  4AFK A;  4RL9 A;  5ADX K;  2XE2 A;  4AZL A;  4FES A;  3LK2 A;  3VY9 X;  2J4U P;  5DL6 A;  4AKR B;  1GFO A;  3DA3 A;  4AYE C;  2KXP A;  2M06 A;  1MM4 A;  3C5O A;  4D65 A;  4KR4 A;  2PRN A;  4RJW A;  5IYU A;  4RLC A;  1HXX A;  2QTK A;  4FSO A;  4FMS A;  4QQ1 A;  3PQS A;  2O4V A;  4FRX A;  5DL8 A;  2KZ7 A;  3AA1 B;  4RLB A;  6PRN A;  1P4T A;  3G7G A;  3GP6 A;  5FVN A;  1ZHZ A;  4N58 A;  4O49 A;  2XE1 A;  4FRT A;  4PUX A;  4AYD C;  2Y0K A;  3VZW X;  2MHL A;  3AAA B;  1ZHY A;  1ZHW A;  4LSI A;  1PRN A;  4G76 A;  1Q9G A;  3UAQ A;  4O4X A;  3RBH A;  4AYI D;  8PRN A;  3DA4 A;  4GCP A;  3T20 A;  3LK3 A;  4D5U A;  4LSH A;  1ZHT A;  3AA7 A;  3POX A;  4AYM C;  3TZG A;  3SYB A;  2N2M A;  3VZU X;  4FOZ A;  3POR A;  3AA6 B;  3UU2 A;  2OMF A;  4JCH A;  4FZL A;  1ORM A;  3SYS A;  1YS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...