3AA0B

Crystal structure of actin capping protein in complex with the cp-binding motif derived from carmil
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
243
structure length
243
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
total genus 85
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aa0B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aa0B02
5AFUL 5ADXL 3AA0A 3AA1A 2KZ7A 3LK41 1IZNA 3LK2B 3AA0B 3LK42 3AA1B 3LK3B 3AA7A 3AAEA 3AAEB 4AKRB 2KXPB 2KXPA 3AA6B 3LK2A 1IZNB 5AFUK 5ADXK 3AA6A 3AA7B 2KZ7B 4AKRA 3LK3A 3AAAA 3AAAB
chains in the Genus database with same CATH superfamily
4FOZA 5L3GB 3RC3A 3VKGA 1VCSA 2NTYA 1UCUA 2PFVA 4E1SA 4KHZF 2QRXA 3K1SA 4C69X 3TLSA 2W0GA 4KRAA 2P9BA 4PK5A 3DP7A 3RRCA 3KV4A 1FMWA 3KV6A 4I0UA 4UR9A 3AAAB 2WSSV 1MMNA 4EAHA 5C2TA 3A0HO 2VKDA 2W66A 2JQ9A 3OYZA 2WCAA 1V9DA 4H63V 4HFEA 2XM2A 2WJRA 2WWUA 2ODUA 4AYMC 1UX4A 3CX7B 5LMUT 2XQ3A 5AQSB 2LKGA 2XQ7A 4LMJA 2KC0A 2LSYA 4XAXB 4JLEA 2XAQB 2V6XA 2CLYB 2H88A 2LM2A 1CHUA 4EYYR 2CBIA 2ACZA 5CJ5A 2SPCA 3SWHA 4KR4A 3T24A 4JBWF 4AZLA 5LBMA 2CWYA 2DI4A 3ZMVB 2L8KA 3P4WA 4N58A 4TWDA 2XE1A 2BVMA 4X65T 2PORA 3AA6B 3N9PA 5LMNT 3BQIA 2CRBA 1MMGA 2WZIA 3CK6A 2L9QA 2YK0A 4DIDB 3JAEA 2VWAA 4DUYT 2J1NA 3UFGA 3KBTA 4ZS2A 3HOLA 1THQA 1S94A 3VZWX 4ZZCA 2JQHA 1IZNB 2YOEA 4HFDA 2W63A 1OEDC 5L4EA 3LK3A 1YS5A 5A1LA 1OEDA 2ZM8A 3PE0A 4HEAA 2ZM6T 3RIUC 4RJXA 3Q5WA 2IWVA 4AYDC 3H37A 5JRCB 4PAGA 5JDFA 2FJDA 2LHNA 2KNDA 4DV5T 4QX8B 1MMAA 1Z0PA 3AAIA 2MNHA 2BVLA 1XMOT 3CIRA 1SA0E 3SRZA 2Y2XA 2WAUA 4EXTA 4O2BE 4DMWA 2EHOC 2WDRA 3QUJA 4LF8T 4O4HE 1G8XA 4K0KT 2UXDT 2V26A 4QWNB 2K24A 3ZCIA 2WQYA 3UU2A 2X9YA 5FVLA 5CA1E 3RX6A 2WZHA 2FJEA 4HWFA 2Y7SA 1MIWA 2ERVA 4PW8A 2MPKA 3POXA 3GP6A 1BR2A 5LG4A 4L5GA 4WYVA 4IL6O 4WBOA 3C51A 3KV5A 2BS3A 5HCJA 2GE4A 4AUIA 2D0UA 2XASB 3NRYA 4I55E 1P4TA 2VURA 2E5LT 2E9XD 4KHPT 3PQUA 2YINA 5L3EB 4HFIA 2PRNA 3EVYA 3T1YT 3ZEFB 4NPPA 2IWWA 3LK41 1KNRA 3P4QA 1Q9GA 2H7VC 1WCRA 1KK7A 1Y64B 3NSGA 4LF9T 3TLVA 4UB8O 4RJWA 5T5FA 4AI6A 3V5UA 2BS4A 2HHHT 2JMKA 3DTOA 5AQOB 3ZT5A 4N75A 4G75A 4QKNA 2MHLA 2F4VT 4NUVA 5DL6A 4RLBA 3GN5B 4RLCA 3I9YA 1WRDA 1HG5A 4ZI3D 1D0XA 4NUUA 2X0YA 3FXEB 3F57A 1HXTA 3LBXB 1NAFA 1US7B 1E1HB 4QX7B 2A9UA 1ZV4X 3NZPA 2XAHB 4IL4A 4DMVA 1J5ET 4GHBA 3VR9A 4GIWA 5HEUA 4L9IA 1N32T 3DJBA 2ZFGA 3VRBA 2V7MA 2XM1A 2W2UA 3AEEA 3F2EA 2LKHA 2M67A 1XNRT 4U7YA 3LK2B 3UUMA 2WVPA 2V6YA 3FZMB 5FP3A 3UUXB 5DL5A 5JVDE 3VE1A 3N2KE 4CI3B 4ILAA 3SY9A 2LM9A 4CZZB 4FESA 3PU8A 4O4XA 4IDPA 1QUUA 5DABA 1WLXA 3WAKA 4GCQA 2IDOB 1OXZA 1BT9A 3WAJA 2W00A 2M6BA 3UQ4A 2B1EA 1YKEB 1W0BA 4B3ST 4B3MT 3IBPA 5AQLB 3OYXA 2RPAA 4B6XA 5HCMA 3HKEE 4N74A 4AKIA 1UGOA 3PUZF 5HXCA 1XZYA 8PRNA 3R84B 1XMQT 3AEFA 3HR0A 2LHRA 3HW9A 1VOMA 5H6QB 1PRNA 4Q25A 3OVUA 4AQFC 1J1JA 2LSJA 5JDPA 1NEKA 4WW0A 4AKGA 4KR8A 1BH3A 2FJAA 2XQ5A 3N9MA 3CQCB 3QRCA 5LNKA 3FZKB 5LJMA 1KF6A 2LT3A 3A7MA 4AYID 1FJGT 7PRNA 5KMGP 4LSFA 2OMFA 3LG7A 3ZKRA 4JI7T 2XTLA 4CXYA 4C4VB 4EZ4A 4LFCT 4X64T 3ZT7A 3CQGB 4KUMB 3ABVA 3E08A 3UUBA 2XSAA 3DWOX 3I1AA 2BKNA 5HEOA 1WFDA 3MXZA 3M65A 4AIUA 3UPGA 5ABGA 2E2AA 5IUXA 5TISO 1ZOYA 1YW0A 2XAJB 4G63A 1L0VA 2XTRA 4ADZA 4FZLA 4U72A 1BXWA 3RYCE 2XAGB 5DJQC 4EV6A 3JADA 1GFNA 1T1LA 4YSYA 2Y48B 2G0UA 1D0ZA 4Z8XA 4IL9A 4O3XB 4IE4A 4DO0A 4E7ZA 4ZI3C 4YXDA 3N2OA 4CTDA 1BR1A 3UU5A 3OBVE 5B66O 1I6ZA 4UV9B 2XQAA 5FXVA 4D65A 3AE1A 2KT9A 4IE6A 5LGTB 2JQQA 4OYJA 3VR8A 2UUAT 2LSGA 4ZI2D 4QHOA 4MBQA 3WI4A 4JYAT 4U2YA 3CQXC 1T7SA 2FGQX 5JR9C 5DL7A 2M6IA 3OKQA 2XE2A 4JFBA 1LKXA 2ODJA 2XUEA 3P50A 3PU3A 4BJNA 2BKPA 3TZGA 3AB3B 1ZHXA 3FBZA 2NTXA 4UVAB 1HX1B 3A8YC 5AQVB 5FYMA 5LA6E 4MHCA 5JDNA 2BG9E 4IT4A 3VU7H 3FZLB 3X1DA 4GYRA 4AQYT 5AQPB 5HWYA 3AE9A 4X1YE 3I9WA 4A97A 4DR2T 4DV6T 3BRYA 3UFEA 3U3IA 3J7Yq 2XSBA 3AA0A 3VY9X 1EZ3A 4YTMA 1ZHCA 2XAFB 4HTEA 3SYSA 3L8RA 4IE7A 4DV7T 4AKRB 4DR5T 2CXDA 2C5KT 2W4XA 2E5VA 1GFMA 3L09A 5LOVE 4PJMA 3WU2O 3OJAA 2HH7A 3LSVA 2HPJA 2R4PA 4HN9A 5G38A 4TN7B 3RYIE 2PG8A 1KEYA 3AEGA 1ZKEA 2VVNA 2PTFA 4FRXA 3HI2A 1MNDA 3N9NA 4QH5A 3JC6C 4E7SA 3LK2A 4N78D 1WR0A 3ZYMA 3AXJB 3RQWA 3HKBE 5ABFA 3AAAA 4O2AE 3O0EA 1OPFA 2H7OA 3CX6B 1W9RA 3CKDA 3HOEA 5HXRA 4YTNA 2W67A 4GOUA 3VZUX 2NW8A 5IHYA 2BZBA 4M1PA 5AQGB 3PUVF 5J1GA 4DBRA 5HXSA 4IDNA 3UU3A 4ANJA 2N1GA 3K3NA 3JCFA 3I0QA 4LFAT 3FZFB 2CA5A 2IUBA 2CPTA 3NVOA 4ZOLE 3HWBA 4EGWA 2R4OA 2L3LA 1N36T 3ZYKA 4O49A 2Q9QD 3VRAA 1YQ4A 3UU8A 2FGRA 2X51A 2MAWA 5AFUK 5E0OA 5J2UE 1ORMA 1W0AA 4XBFB 4I4TE 5C3JA 4AKLA 3P8CD 4H63H 3DWNA 2DWGA 1KNPA 4X66T 1BR4A 4I50E 2X0HA 4GKJT 2CE7A 5KAFO 4CN6A 5LG3A 5KAIO 2YKSA 4OHFA 4QH1A 2JMHA 2M07A 3P7IA 4I43B 5BMVE 3AE7A 2PJQA 2WU2A 4ILBA 3AE6A 4IDQA 2ZLDA 2B76A 3UAQA 2IAKA 3SFDA 2QGSA 1HTJF 5FVKA 3ZT6A 4X1KE 5CB4E 2A2FX 3C50A 3ONJA 3SS1A 1LRZA 2YDSA 1XDOA 3LBXA 5BR8T 3AVRA 2V7JA 1HF8A 3NWIA 4HKAA 4EEBA 2I0MA 4GCSA 1ZHTA 4CI2B 4LFBT 5AQHB 5LHHB 2LHFA 3AA7A 5FXXA 3PV0F 2V6YB 1HNZT 2W80C 4ZI2C 5JDHA 5GTIO 4V1Av 2VQET 2JJ9A 3QRAA 1VCTA 4N59A 4EOZB 2XHEB 4YSXA 5ABEA 2FBWA 2XPKA 3SOLA 4DV2T 3UTKA 1MMDA 3QK6A 4LMKA 5CA0E 2Y8DA 2CHOA 1IJ6A 2MYSA 4OX9T 4A56A 4PNIA 1LVKA 3PUQA 2YDRA 3JTYA 4BA9A 4RL9A 3BQLA 3HA4A 1J5WA 4B3TT 3ZMSB 5EK2A 5KXJA 2JQYA 2N2NA 3POQA 2CWOA 3CPZA 5LB7B 3ETVA 3PDYA 4LF7T 2E9XB 2DLRA 4FZNA 5DQVA 2LRLA 4TV8E 2GK9A 4YY3T 3ZSSA 2DL1A 3OPCA 3A2SX 2KLQA 5G39A 2BS2A 1UURA 1S5LO 1H7CA 3N9QA 3N9OA 2IW5B 4EEDA 3F31A 4YHHT 4X62T 3LJCA 3HL6A 1XWMA 5IWAT 5FXZA 3TLUA 3SY7A 4AFKA 5L3BB 4JUYA 2NP9A 3SYBA 1KFYA 5JDMA 4U33A 3EABA 3AVSA 3W15B 2LEHA 2X9HA 3EI0A 2ZM0A 4A5XA 1T8BA 4Z91A 3PORA 1HNWT 1ZHWA 1W09A 2EHOA 3V5SA 2WU5A 3IA3A 3DZMA 2IMLA 5F3JA 1QJ8A 3TKLB 2LLYA 3O1HA 5KX5E 3UQ7A 2F1VA 4QXCB 4O4JE 3EUHA 4ERRA 1UX5A 3FYXA 5B5EO 5J0ZA 4QH4A 2VASA 2Q9QA 2CEAA 4DVDA 4GK0E 4QQ1A 4D64A 1T16A 3C98B 4HWIB 3IEEA 3RRWA 4DR1T 4CN1A 3U78A 3N2GE 3RKOA 2XQ6A 4KP3C 1MPFA 5AQTB 4AYNA 3PGSA 2YEVC 5L2LA 3PUXF 2MBGA 1WYCA 3MKDA 1ZEEA 4TX5A 4HWCA 1IBKT 1GFPA 4HWHA 3ANWA 4MFRA 1HX8A 4WNKA 1M62A 4MALA 3KVAA 2DWKA 2NWBA 5PRNA 5JR9B 2XQ8A 4FI5A 5L3DB 4FQEA 4P0BA 3ESLA 3GN5A 4BUMX 1FMVA 2WS3A 4C90A 4O4IE 1OWAA 3NJTA 4UEMA 3I0OA 4JI8T 2V7IA 2NOXA 3VHLA 3C64A 2WBLA 4A98A 1M7KA 2MTQA 1U5PA 2HPLA 1Z8UA 4H9NC 2QTKA 2X9KA 5JR9A 5LYJE 2YN6A 5FMNA 5H2FO 3GMIA 5LGNB 3P4RA 5LHGB 1O3XA 3KBUA 5L3CB 2AE9A 3G7GA 3FXDB 3KINB 3PUYF 3K3OA 4HFCA 5FY7A 1OEDB 2WM9A 4F8HA 2UXXB 2J47A 5ABHA 2FJBA 1E7PA 3PJAJ 3HKCE 1DU2A 3AA7B 5J2TE 3FBLA 3PTRB 1OSMA 2I6HA 3EAMA 4QXHB 4TZ4C 2BBHA 2ODVA 3ZPOA 2WWVA 4B61A 3RH3A 2Y0KA 2CBJA 3T0SA 4DV3T 2CXFA 3KVDD 3LDQB 3AEDA 3TLTA 2V7LA 2H3RA 3RPUA 4JI3T 3RLFF 4DR6T 4KMCA 4EZHA 2Y0LA 1S35A 3O9XA 2W61A 2R88A 2XE3A 4YTPA 2X67A 4LMLA 3S4UA 3HKDE 2BG9C 2E9XA 3BQKA 3JCUO 4IIJE 5LP6E 4AISA 5G26A 5IYUA 3O1IA 4HFVA 2LSKA 4LF6T 2C5JA 1IBLT 3WI5A 3RYHE 2D5UA 3BK9A 1WR6A 2XZEA 5JDGA 5CGMA 2FUPA 3PQSA 1U4QA 3GWHA 4PK6A 4UF0A 1ZHYA 2K3WA 3OTOT 4J2CA 1IBMT 3NRXA 3R6NA 3Q2MA 1IAPA 4OK0A 4JI4T 2BKOA 4C91A 4U3CA 1ZP0A 4AYEC 1QLBA 3ETUA 3C4ZA 3PGUA 4H9SE 4JV5T 1KNZA 2D0TA 4FSOA 4FZMA 5JRCA 2YDQA 2A3DA 2D9DA 2WMNA 2Q9QC 3RC8A 4JCHA 2K4TA 4JI2T 2Y0HA 2AXDS 4DNDA 2K5BB 4YSZA 3ZLIA 5LXTE 2J4UP 3L39A 1D1CA 2IHR1 1HCIA 2VKHA 3AECA 3ZN1B 3ZJ1A 4ZI7E 2VB6A 3RIFA 2NR4A 2K0LA 4O4UA 1LVFA 4DV1T 4PR7A 4KI0F 1MM4A 5AQFB 4UB6O 3VY8X 5AQQB 2PBIA 2MOZA 1HXUA 1GQEA 2XMXA 2R8AA 2UUBT 1X9BA 4U74A 3NKZA 4ISTA 1YD8G 4U31A 2Y6XA 4FT6A 5HXHA 3TLWA 1Q9FA 3C5OA 5LCYA 5EK3A 4PJNA 2BDEA 4IHJE 2LFUA 4TWHA 3MK7C 3RKGA 4UV8B 3FHNA 3E22E 4YLHA 5D5DA 4DR3T 2R6GF 2C0SA 4Z3TA 5EE2A 4LSHA 1VRBA 2F1TA 4O3YA 2N2LA 3LK3B 3PRNA 3CMLA 3UULA 5LGUB 2KXPA 3RF1A 2ZM2A 4UF0B 2BBJA 1XNQT 1OEDE 3JAFA 3A0BO 4C00A 3AEBA 5AQIB 4PJLA 4K0UA 1UK5A 4U7IA 3EDVA 3SFEA 3WI3A 2X68A 4UIGA 2JPFA 3FB2A 2LSIA 3AA1B 2X9XA 4K3BA 4GF4A 4YJ3E 4XNLA 4G2AA 2EHOB 5JREA 3ONXA 1T98A 4UELA 4BJMA 2C5IT 2VVSA 2JMMA 2K9AA 4ZXLA 5ETWA 5H6RB 2QA7A 2LOSA 3RYFE 2KMFA 1IZNA 5EZYE 5HEJA 3ZYLA 5L47A 5JDQA 4DUZT 2WJQA 3VE2A 5AQKB 4G76A 2RA1A 4YFSA 5JTGA 2JQKA 2KSRA 4K3CA 3MJXA 3Q5DA 4IE5A 1H6S1 1G73A 2DHRA 4JI0T 3B57A 3CWZB 3EDUA 3Q9DA 3KFWX 3O1JA 3RHWA 2WDVA 2CXLA 3T20A 2I59A 3ZN0B 1FIOA 1SUMB 2V8SV 2BG9B 3PURA 1FEWA 1YXRA 4U9CA 4DV0T 2CCQA 3RI5A 2UU9T 4NXNT 4XNKA 1BR0A 4AKHA 5HYAA 3NZQA 1T72A 2J1DG 4H9QC 2W62A 3P4SA 5G3AA 4IGUA 4P0AA 2K48A 3ZCJA 4PUXA 4ILCA 4AQFA 2VL8A 4ILUA 3AAEA 3G06A 3A5XA 3ZMTB 2X0LB 3ANWB 3ONLC 2XE5A 1CUNA 5JQGE 3AA1A 4X20E 3L3PA 5EK4A 1IJ5A 5JH7E 3BRZA 3KDSE 1HG2A 4PJJA 4YHJA 3RIAA 3Q5XA 3IF8B 4ZS3A 2XTQA 3ZSTA 4IDZA 3ZMUB 1XDPA 3IHRA 4FSPA 4ISSA 4QXBB 3AE2A 4TUYE 5GTHO 4DBQA 4UXNB 1SHZC 4FUVA 3Q5EA 4FRTA 2OV9A 5CFBA 4IE0A 2OLTA 4P1NA 2UXCT 4DR4T 2HN2A 3KZIO 3E0ZA 2JIWA 3FZHB 2OA5A 5AQJB 2XG6A 3AA6A 2CLYC 3GA8A 1HR0T 1E2AA 1JNRA 3M3ZB 4L0RA 5L3FB 4HWDA 1MNEA 3AE4A 2X66A 4TV9E 2E8IA 5TAOA 4BAYB 4WZXA 4PFOA 3N5LA 5FXWA 4MLKA 4F6RC 4YT0A 1D1BA 2KZ7A 2NW9A 4CXWA 3RGLA 5HEHA 3AA0B 3LK42 4FJOA 3QB5K 2YU2A 3AE3A 4ZEYA 4DV4T 5C8YE 2WDQA 3CVRA 3K8PC 2XQ4A 5LBQB 2J4GA 2X27X 1E54A 4CXXA 3T8OA 5FL1A 3PUAA 1ZHZA 4LF4T 2YNKA 4O3WA 5AQMB 4JEUB 3MZKB 3ZJ2A 3JC6D 3KV9A 2XQ9A 2KDYA 4U2ZA 5HWXA 3KVBA 4ZHQE 4JI5T 1G90A 3AXJA 5HEGA 2M06A 3RQUA 5DQWA 3UU4A 3SZDA 4CI1B 3T1HT 2N2MA 4YJ2E 4TNWA 1MIYA 4XZCA 3LFMA 2R4LA 2IC6A 1GFQA 2ES0A 4OYKA 4GK5E 2VL0A 4DR7T 4X5TA 4WBNE 3K19A 3B5MA 2AXTO 2Q9QB 3PUGA 2LE8A 3MACA 3CX8B 4GCPA 1I94T 3ZC1A 4EB6E 2WB5A 5FKYA 4NIQA 4AXPA 1R8IA 4AQGA 5GV0A 4UVBB 4LF5T 4O8SA 2V1DB 1D1AA 3UU6A 1AJ3A 2D2SA 3PUSA 2DCFA 4ASKA 2ZLYA 5DL8A 4HFHA 3VZTX 2HN1A 5AQNB 6PRNA 3P4PA 4NXMT 4IDOA 1WYBA 5AQRB 2W81C 1Y01A 2VKJA 3UUNA 3VKHA 5HXEA 4CN4A 5FVNA 2X9WA 4E1TA 1MM5A 4IREA 3PGRA 3O4XE 2Z6EA 4O3ZA 3UT5E 2CHNA 3AAEB 3BS0A 2J62A 2IIUA 2WP9A 1QJPA 1JNZA 4OFZA 5F5WA 1MIVA 2KZ7B 3H3MA 4AKRA 2XJ7A 5ADXL 5GONE 2F1CX 3MA9A 2V5DA 5L4HA 3SZVA 4LSIA 4LSEA 1HS7A 4TNVA 4JEHB 4X1IE 2YPVA 3D0TA 4D5UA 5LJNA 1HXXA 2LRKA 2VKOA 1GFOA 3DA4A 2A72A 1UUSA 4GYSA 3EHZA 3QNUA 2KINB 4HE8A 4HFBA 3J9X1 2NW7A 3RBHA 3NBXX 2V5CA 2V7KA 2VK9A 5FY0A 5ABFB 2KWHA 2ZMAA 1N34T 4P09A 5IYZE 4B3RT 2XQYA 3ZMZB 2UXNB 2R4NA 5ADXK 5FNVE 5FL0A 5FY1A 3AEAA 3AE5A 4Z90A 3DA3A 2VQFT 2CMRA 4HGAA 3V8UA 3POUA 1B7TA 2O4VA 4EYUA 2LOPA 2ACXA 4CQIA 5KDMC 3PF1A 4H9RC 3QC9A 2EHOD 5LHIB 3K3QC 1PHOA 2WMOA 2H89A 4PFPA 2BG9A 3C4XA 3QB5A 3RIUA 1QJ9A 2WY2A 4PK4A 1D0YA 2QYWA 2UUCT 4H9PC 2N9DA 5HAXA 2JRKA 2UXBT 1YKHB 4ZZBA 3ZC0A 4AKMA 5E79O 3PUWF 2KWIB 1HFAA 4TWFA 4FMSA 5AQUB 2DNXA 1NENA 3EMNX 4F4BA 2E9XC 3N9LA 1SE7A 1N33T 4KX6A 4H9OC 5F8PA 1X79A 5JDLA 4EIWA 2IC9A 2YU1A 4C4VA 2QVAA 2LJLA 3QOFA 3PJAA 1NWMX 5AFUL 4GKKT 1YQ3A 4JI6T 2RP4A 2CM0A 4O4LE 1HNXT 2KXPB 5M4YA 4PJ0O 1QSDA 3AE8A 4KBMB 3C4WA 4JI1T 2XY8B 3H3AA 4COFA 3B13A 2R89A 4UVCB
chains in the Genus database with same CATH topology
2G0UA 3IEEA 4FOZA 1D0ZA 3RRWA 5L3GB 4Z8XA 3U78A 3N2GE 3RKOA 4O3XB 3RC3A 4KP3C 4IGUA 3VKGA 4P0AA 2K48A 4IE4A 1MPFA 4DO0A 3ZCJA 4AYNA 4E7ZA 4PUXA 2NTYA 4ZI3C 1UCUA 4AQFA 3N2OA 2PFVA 2YEVC 2VL8A 5L2LA 4E1SA 2MBGA 4ILUA 1WYCA 3AAEA 1BR1A 4C69X 2W0GA 3OBVE 3MKDA 4KRAA 1ZEEA 2P9BA 3A5XA 4UV9B 5FXVA 4D65A 4TX5A 3ZMTB 4PK5A 3DP7A 3RRCA 2X0LB 3ANWB 3KV4A 2XE5A 1FMWA 2KT9A 1CUNA 1GFPA 3KV6A 3AAAB 4IE6A 5LGTB 5JQGE 2JQQA 4OYJA 3AA1A 2WSSV 3ANWA 4X20E 4MFRA 1HX8A 1MMNA 2LSGA 4MALA 4WNKA 4ZI2D 3KVAA 4QHOA 4EAHA 2DWKA 3L3PA 4MBQA 2NWBA 3WI4A 5PRNA 2VKDA 3OYZA 5JR9B 5EK4A 1IJ5A 4FI5A 5L3DB 4P0BA 3CQXC 2FGQX 3ESLA 5JR9C 5JH7E 5DL7A 3GN5A 4BUMX 1V9DA 1FMVA 4H63V 4C90A 3KDSE 3OKQA 4O4IE 1OWAA 1LKXA 2XE2A 4JFBA 2WWUA 2ODJA 1HG2A 2ODUA 2XUEA 4AYMC 4PJJA 4UEMA 1UX4A 3CX7B 3I0OA 4YHJA 2V7IA 2NOXA 3PU3A 3VHLA 3C64A 2WBLA 3Q5XA 4BJNA 2KC0A 3TZGA 3AB3B 2MTQA 1ZHXA 1U5PA 2HPLA 3FBZA 3IF8B 4H9NC 2QTKA 5JR9A 2LSYA 4XAXB 4ZS3A 4JLEA 2XAQB 2NTXA 2CLYB 4UVAB 5LYJE 2XTQA 5FMNA 5FYMA 4IDZA 5LA6E 4MHCA 3ZMUB 5JDNA 3IHRA 4FSPA 3GMIA 4ISSA 3VU7H 4EYYR 5LGNB 5LHGB 4QXBB 1O3XA 4GYRA 2SPCA 3SWHA 4KR4A 4TUYE 3T24A 5HWYA 4X1YE 3I9WA 5LBMA 4AZLA 2CWYA 3KBUA 5L3CB 3UFEA 3G7GA 3FXDB 2DI4A 4DBQA 3ZMVB 3U3IA 3KINB 3J7Yq 2L8KA 4UXNB 3K3OA 3AA0A 3VY9X 1EZ3A 1SHZC 4FUVA 5FY7A 4N58A 1ZHCA 4FRTA 2XAFB 4HTEA 2WM9A 3SYSA 4IE7A 4IE0A 2XE1A 2BVMA 2UXXB 4AKRB 2PORA 2CXDA 2C5KT 3AA6B 3N9PA 1GFMA 3L09A 3E0ZA 5LOVE 3BQIA 4PJMA 2OA5A 3HKCE 2XG6A 3AA6A 2CLYC 3AA7B 1MMGA 3GA8A 5J2TE 3FBLA 3OJAA 2HH7A 2L9QA 2HPJA 3PTRB 4HN9A 2YK0A 4TN7B 4L0RA 4QXHB 4TZ4C 5L3FB 3RYIE 1OSMA 2PG8A 2VWAA 2ODVA 3ZPOA 2J1NA 1MNEA 2X66A 4B61A 1ZKEA 3RH3A 2Y0KA 3KBTA 4TV9E 2E8IA 4ZS2A 3HOLA 3T0SA 1THQA 2CXFA 1S94A 3HI2A 5TAOA 4BAYB 1MNDA 3KVDD 4FRXA 3N9NA 3VZWX 3JC6C 4E7SA 3LK2A 4N78D 1IZNB 2V7LA 4PFOA 3ZYMA 2W63A 2H3RA 3N5LA 3RPUA 3HKBE 3LK3A 3AAAA 4O2AE 5FXWA 5A1LA 1OPFA 1YS5A 2H7OA 3O0EA 3CX6B 3CKDA 4MLKA 2ZM8A 5HXRA 3PE0A 4HEAA 1D1BA 4F6RC 3HOEA 4KMCA 2KZ7A 2NW9A 4CXWA 4EZHA 2Y0LA 4RJXA 1S35A 3AA0B 3LK42 2W61A 4GOUA 3O9XA 3Q5WA 2XE3A 3VZUX 2NW8A 4FJOA 2X67A 5IHYA 4AYDC 2BZBA 2YU2A 3H37A 5JRCB 4PAGA 4M1PA 3S4UA 3HKDE 5J1GA 5JDFA 4DBRA 5HXSA 2LHNA 4ANJA 2KNDA 2N1GA 3K3NA 5C8YE 4QX8B 2E9XA 1MMAA 3CVRA 1Z0PA 3AAIA 3BQKA 3I0QA 3K8PC 4IIJE 5LBQB 5LP6E 1E54A 2MNHA 4CXXA 2X27X 2BVLA 2CA5A 5G26A 3T8OA 5IYUA 3PUAA 1ZHZA 3O1IA 4HFVA 2YNKA 4ZOLE 3HWBA 1SA0E 3SRZA 2Y2XA 2WAUA 2LSKA 4EXTA 2C5JA 4O3WA 2L3LA 3MZKB 4JEUB 4O2BE 3ZJ2A 3JC6D 3KV9A 4DMWA 2EHOC 3RYHE 3ZYKA 3WI5A 4O49A 2KDYA 3QUJA 2D5UA 2Q9QD 4O4HE 3BK9A 1G8XA 5HWXA 2V26A 1WR6A 3KVBA 5JDGA 4QWNB 4ZHQE 2K24A 3PQSA 1U4QA 2FGRA 1G90A 3ZCIA 3GWHA 4PK6A 4UF0A 1ZHYA 2M06A 3UU2A 2X9YA 5CA1E 4J2CA 3RX6A 2X51A 3NRXA 5AFUK 3R6NA 5DQWA 3Q2MA 3SZDA 1IAPA 4CI1B 5E0OA 4OK0A 2N2MA 2Y7SA 1MIWA 5J2UE 2ERVA 4YJ2E 4PW8A 1ORMA 1MIYA 4XZCA 4C91A 4XBFB 4I4TE 3LFMA 3POXA 4AYEC 3GP6A 2IC6A 1BR2A 4AKLA 3ETUA 5LG4A 3C4ZA 4L5GA 1GFQA 2ES0A 4H9SE 3P8CD 4H63H 4OYKA 4WBOA 3C51A 3KV5A 4GK5E 1KNZA 2GE4A 4WBNE 3K19A 4AUIA 2D0TA 4FSOA 2D0UA 2DWGA 2XASB 4FZMA 5JRCA 3NRYA 2Q9QB 3PUGA 1BR4A 2A3DA 2LE8A 3CX8B 3MACA 4I55E 1P4TA 4I50E 3ZC1A 4EB6E 4GCPA 2WMNA 2Q9QC 4AXPA 2E9XD 4AQGA 3PQUA 5GV0A 4UVBB 2YINA 3RC8A 5L3EB 4O8SA 2CE7A 4JCHA 2K4TA 2PRNA 3EVYA 3ZEFB 2V1DB 1D1AA 2Y0HA 3LK41 4DNDA 4OHFA 1AJ3A 2K5BB 2JMHA 2D2SA 2M07A 3ZLIA 5LXTE 1Q9GA 3P7IA 3PUSA 4I43B 2H7VC 2J4UP 2DCFA 4ASKA 2ZLYA 5DL8A 1D1CA 1KK7A 3VZTX 1HCIA 2VKHA 3ZN1B 3ZJ1A 5BMVE 6PRNA 2PJQA 1Y64B 3NSGA 4ZI7E 1WYBA 2VB6A 2W81C 2ZLDA 2K0LA 4O4UA 1LVFA 2VKJA 4RJWA 3UUNA 4AI6A 5T5FA 2IAKA 3UAQA 3VKHA 5HXEA 2QGSA 3V5UA 1HTJF 5FVNA 4X1KE 2X9WA 4E1TA 5CB4E 2JMKA 2A2FX 1MM5A 3C50A 1MM4A 3DTOA 3VY8X 3SS1A 3O4XE 2Z6EA 1LRZA 2PBIA 2MOZA 3LBXA 4O3ZA 4G75A 3AVRA 4QKNA 3UT5E 1HXUA 2MHLA 4NUVA 5DL6A 3AAEB 4RLBA 2XMXA 3GN5B 2V7JA 1HF8A 4HKAA 3VE2A 1QJPA 4RLCA 3I9YA 4OFZA 3B13A 1MIVA 1WRDA 4U74A 1HG5A 4ZI3D 2KZ7B 4ISTA 1YD8G 4AKRA 1D0XA 2Y6XA 4NUUA 4FT6A 3FXEB 5ADXL 3F57A 1HXTA 4GCSA 3LBXB 5GONE 1ZHTA 3MA9A 4CI2B 1NAFA 1US7B 1E1HB 4QX7B 3SZVA 5HXHA 3NZPA 1ZV4X 2XAHB 5LHHB 4DMVA 2LHFA 4LSIA 1HS7A 1Q9FA 4LSEA 3C5OA 5LCYA 5EK3A 4PJNA 4JEHB 3AA7A 4GHBA 2BDEA 4GIWA 4IHJE 4X1IE 5FXXA 2YPVA 3D0TA 4L9IA 4D5UA 2LFUA 2W80C 3DJBA 5LJNA 4ZI2C 5JDHA 4V1Av 1HXXA 2JJ9A 3MK7C 2VKOA 1GFOA 3DA4A 2ZFGA 3QRAA 2V7MA 4UV8B 2A72A 4N59A 3FHNA 3E22E 4GYSA 4YLHA 3F2EA 4EOZB 2KINB 2XHEB 2M67A 4HE8A 5D5DA 3J9X1 3SOLA 2NW7A 3UTKA 3RBHA 2C0SA 4Z3TA 5EE2A 4LSHA 3LK2B 3NBXX 1MMDA 3UUMA 2V7KA 1VRBA 2F1TA 4O3YA 2VK9A 5FY0A 2N2LA 3LK3B 2KWHA 2ZMAA 3PRNA 4P09A 3QK6A 5IYZE 5CA0E 5FP3A 3CMLA 3UULA 5LGUB 2XQYA 2Y8DA 2KXPA 3UUXB 5DL5A 5JVDE 1IJ6A 2MYSA 3VE1A 3N2KE 2ZM2A 3ZMZB 2UXNB 4UF0B 4A56A 4PNIA 1LVKA 4CI3B 3PUQA 3SY9A 5ADXK 5FNVE 5FY1A 2LM9A 4CZZB 4FESA 3JTYA 3PU8A 4BA9A 4O4XA 4RL9A 3DA3A 4PJLA 3BQLA 2CMRA 4HGAA 3HA4A 1QUUA 4K0UA 1WLXA 5DABA 3V8UA 3POUA 3EDVA 3WAKA 3ZMSB 4GCQA 5EK2A 1OXZA 1BT9A 2N2NA 3WI3A 1B7TA 3WAJA 2O4VA 2X68A 2LOPA 4UIGA 2W00A 4EYUA 2JPFA 3FB2A 2LSIA 3AA1B 2X9XA 2ACXA 3POQA 2B1EA 1YKEB 2CWOA 4CQIA 5KDMC 3CPZA 3ETVA 3IBPA 4YJ3E 4GF4A 4G2AA 2EHOB 4XNLA 3OYXA 5JREA 3ONXA 3PDYA 1T98A 3QC9A 2E9XB 2DLRA 2EHOD 4H9RC 4UELA 4B6XA 4BJMA 3K3QC 2C5IT 5LHIB 1PHOA 3HKEE 4AKIA 2JMMA 4FZNA 5HXCA 2WMOA 8PRNA 3R84B 2K9AA 4PFPA 3HR0A 5DQVA 2LHRA 3HW9A 1VOMA 5ETWA 5H6RB 3C4XA 5H6QB 1PRNA 1QJ9A 2QA7A 2LOSA 4TV8E 3RYFE 2GK9A 2KMFA 1IZNA 4PK4A 4AQFC 1D0YA 5EZYE 3ZYLA 2LSJA 5JDPA 4WW0A 4AKGA 4KR8A 1BH3A 3A2SX 2KLQA 4H9PC 2N9DA 3N9MA 5JDQA 1H7CA 3CQCB 3N9QA 3N9OA 3QRCA 2IW5B 5HAXA 2JRKA 5LNKA 5LJMA 4G76A 1YKHB 2LT3A 2RA1A 4YFSA 4AYID 7PRNA 3ZC0A 5KMGP 4AKMA 3F31A 4LSFA 2KWIB 3LJCA 2OMFA 3HL6A 3LG7A 1HFAA 4FMSA 5FXZA 3SY7A 4AFKA 2DNXA 5L3BB 4JUYA 2NP9A 2XTLA 3MJXA 4IE5A 4EZ4A 4CXYA 3SYBA 3EMNX 4F4BA 2E9XC 3N9LA 5JDMA 3CQGB 4KUMB 3AVSA 3W15B 2LEHA 4H9OC 1H6S1 3E08A 2X9HA 2ZM0A 1G73A 1X79A 2DHRA 5F8PA 4EIWA 5JDLA 3I1AA 3B57A 3CWZB 2IC9A 3PORA 2YU1A 3MXZA 3M65A 3EDUA 2EHOA 3V5SA 1ZHWA 3UPGA 2LJLA 3Q9DA 1NWMX 5AFUL 5F3JA 1QJ8A 3KFWX 3TKLB 3O1JA 3O1HA 5KX5E 2F1VA 4QXCB 2CXLA 4O4JE 1YW0A 2I59A 2XAJB 4G63A 3ZN0B 3T20A 2RP4A 2CM0A 1FIOA 3EUHA 4ERRA 1UX5A 3PURA 3FYXA 1FEWA 4O4LE 2XTRA 4ADZA 4U9CA 4FZLA 2CCQA 2KXPB 4U72A 1BXWA 4XNKA 3RYCE 1BR0A 5M4YA 2XAGB 5DJQC 1QSDA 4KBMB 2VASA 3C4WA 2Q9QA 2CEAA 5HYAA 4AKHA 4DVDA 3NZQA 1GFNA 4GK0E 2Y48B 2J1DG 3H3AA 4QQ1A 4H9QC 4D64A 3C98B 4UVCB 2W62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFU L;  5ADX L;  3AA0 A;  3AA1 A;  2KZ7 A;  3LK4 1;  1IZN A;  3LK2 B;  3AA0 B;  3LK4 2;  3AA1 B;  3LK3 B;  3AA7 A;  3AAE A;  3AAE B;  4AKR B;  2KXP B;  2KXP A;  3AA6 B;  3LK2 A;  1IZN B;  5AFU K;  5ADX K;  3AA6 A;  3AA7 B;  2KZ7 B;  4AKR A;  3LK3 A;  3AAA A;  3AAA B; 
#chains in the Genus database with same CATH topology
 4FOZ A;  5L3G B;  3RC3 A;  3VKG A;  1VCS A;  2NTY A;  1UCU A;  2PFV A;  4E1S A;  4KHZ F;  2QRX A;  3K1S A;  4C69 X;  3TLS A;  2W0G A;  4KRA A;  2P9B A;  4PK5 A;  3DP7 A;  3RRC A;  3KV4 A;  1FMW A;  3KV6 A;  4I0U A;  4UR9 A;  3AAA B;  2WSS V;  1MMN A;  4EAH A;  5C2T A;  3A0H O;  2VKD A;  2W66 A;  2JQ9 A;  3OYZ A;  2WCA A;  1V9D A;  4H63 V;  4HFE A;  2XM2 A;  2WJR A;  2WWU A;  2ODU A;  4AYM C;  1UX4 A;  3CX7 B;  5LMU T;  2XQ3 A;  5AQS B;  2LKG A;  2XQ7 A;  4LMJ A;  2KC0 A;  2LSY A;  4XAX B;  4JLE A;  2XAQ B;  2V6X A;  2CLY B;  2H88 A;  2LM2 A;  1CHU A;  4EYY R;  2CBI A;  2ACZ A;  5CJ5 A;  2SPC A;  3SWH A;  4KR4 A;  3T24 A;  4JBW F;  4AZL A;  5LBM A;  2CWY A;  2DI4 A;  3ZMV B;  2L8K A;  3P4W A;  4N58 A;  4TWD A;  2XE1 A;  2BVM A;  4X65 T;  2POR A;  3AA6 B;  3N9P A;  5LMN T;  3BQI A;  2CRB A;  1MMG A;  2WZI A;  3CK6 A;  2L9Q A;  2YK0 A;  4DID B;  3JAE A;  2VWA A;  4DUY T;  2J1N A;  3UFG A;  3KBT A;  4ZS2 A;  3HOL A;  1THQ A;  1S94 A;  3VZW X;  4ZZC A;  2JQH A;  1IZN B;  2YOE A;  4HFD A;  2W63 A;  1OED C;  5L4E A;  3LK3 A;  1YS5 A;  5A1L A;  1OED A;  2ZM8 A;  3PE0 A;  4HEA A;  2ZM6 T;  3RIU C;  4RJX A;  3Q5W A;  2IWV A;  4AYD C;  3H37 A;  5JRC B;  4PAG A;  5JDF A;  2FJD A;  2LHN A;  2KND A;  4DV5 T;  4QX8 B;  1MMA A;  1Z0P A;  3AAI A;  2MNH A;  2BVL A;  1XMO T;  3CIR A;  1SA0 E;  3SRZ A;  2Y2X A;  2WAU A;  4EXT A;  4O2B E;  4DMW A;  2EHO C;  2WDR A;  3QUJ A;  4LF8 T;  4O4H E;  1G8X A;  4K0K T;  2UXD T;  2V26 A;  4QWN B;  2K24 A;  3ZCI A;  2WQY A;  3UU2 A;  2X9Y A;  5FVL A;  5CA1 E;  3RX6 A;  2WZH A;  2FJE A;  4HWF A;  2Y7S A;  1MIW A;  2ERV A;  4PW8 A;  2MPK A;  3POX A;  3GP6 A;  1BR2 A;  5LG4 A;  4L5G A;  4WYV A;  4IL6 O;  4WBO A;  3C51 A;  3KV5 A;  2BS3 A;  5HCJ A;  2GE4 A;  4AUI A;  2D0U A;  2XAS B;  3NRY A;  4I55 E;  1P4T A;  2VUR A;  2E5L T;  2E9X D;  4KHP T;  3PQU A;  2YIN A;  5L3E B;  4HFI A;  2PRN A;  3EVY A;  3T1Y T;  3ZEF B;  4NPP A;  2IWW A;  3LK4 1;  1KNR A;  3P4Q A;  1Q9G A;  2H7V C;  1WCR A;  1KK7 A;  1Y64 B;  3NSG A;  4LF9 T;  3TLV A;  4UB8 O;  4RJW A;  5T5F A;  4AI6 A;  3V5U A;  2BS4 A;  2HHH T;  2JMK A;  3DTO A;  5AQO B;  3ZT5 A;  4N75 A;  4G75 A;  4QKN A;  2MHL A;  2F4V T;  4NUV A;  5DL6 A;  4RLB A;  3GN5 B;  4RLC A;  3I9Y A;  1WRD A;  1HG5 A;  4ZI3 D;  1D0X A;  4NUU A;  2X0Y A;  3FXE B;  3F57 A;  1HXT A;  3LBX B;  1NAF A;  1US7 B;  1E1H B;  4QX7 B;  2A9U A;  1ZV4 X;  3NZP A;  2XAH B;  4IL4 A;  4DMV A;  1J5E T;  4GHB A;  3VR9 A;  4GIW A;  5HEU A;  4L9I A;  1N32 T;  3DJB A;  2ZFG A;  3VRB A;  2V7M A;  2XM1 A;  2W2U A;  3AEE A;  3F2E A;  2LKH A;  2M67 A;  1XNR T;  4U7Y A;  3LK2 B;  3UUM A;  2WVP A;  2V6Y A;  3FZM B;  5FP3 A;  3UUX B;  5DL5 A;  5JVD E;  3VE1 A;  3N2K E;  4CI3 B;  4ILA A;  3SY9 A;  2LM9 A;  4CZZ B;  4FES A;  3PU8 A;  4O4X A;  4IDP A;  1QUU A;  5DAB A;  1WLX A;  3WAK A;  4GCQ A;  2IDO B;  1OXZ A;  1BT9 A;  3WAJ A;  2W00 A;  2M6B A;  3UQ4 A;  2B1E A;  1YKE B;  1W0B A;  4B3S T;  4B3M T;  3IBP A;  5AQL B;  3OYX A;  2RPA A;  4B6X A;  5HCM A;  3HKE E;  4N74 A;  4AKI A;  1UGO A;  3PUZ F;  5HXC A;  1XZY A;  8PRN A;  3R84 B;  1XMQ T;  3AEF A;  3HR0 A;  2LHR A;  3HW9 A;  1VOM A;  5H6Q B;  1PRN A;  4Q25 A;  3OVU A;  4AQF C;  1J1J A;  2LSJ A;  5JDP A;  1NEK A;  4WW0 A;  4AKG A;  4KR8 A;  1BH3 A;  2FJA A;  2XQ5 A;  3N9M A;  3CQC B;  3QRC A;  5LNK A;  3FZK B;  5LJM A;  1KF6 A;  2LT3 A;  3A7M A;  4AYI D;  1FJG T;  7PRN A;  5KMG P;  4LSF A;  2OMF A;  3LG7 A;  3ZKR A;  4JI7 T;  2XTL A;  4CXY A;  4C4V B;  4EZ4 A;  4LFC T;  4X64 T;  3ZT7 A;  3CQG B;  4KUM B;  3ABV A;  3E08 A;  3UUB A;  2XSA A;  3DWO X;  3I1A A;  2BKN A;  5HEO A;  1WFD A;  3MXZ A;  3M65 A;  4AIU A;  3UPG A;  5ABG A;  2E2A A;  5IUX A;  5TIS O;  1ZOY A;  1YW0 A;  2XAJ B;  4G63 A;  1L0V A;  2XTR A;  4ADZ A;  4FZL A;  4U72 A;  1BXW A;  3RYC E;  2XAG B;  5DJQ C;  4EV6 A;  3JAD A;  1GFN A;  1T1L A;  4YSY A;  2Y48 B;  2G0U A;  1D0Z A;  4Z8X A;  4IL9 A;  4O3X B;  4IE4 A;  4DO0 A;  4E7Z A;  4ZI3 C;  4YXD A;  3N2O A;  4CTD A;  1BR1 A;  3UU5 A;  3OBV E;  5B66 O;  1I6Z A;  4UV9 B;  2XQA A;  5FXV A;  4D65 A;  3AE1 A;  2KT9 A;  4IE6 A;  5LGT B;  2JQQ A;  4OYJ A;  3VR8 A;  2UUA T;  2LSG A;  4ZI2 D;  4QHO A;  4MBQ A;  3WI4 A;  4JYA T;  4U2Y A;  3CQX C;  1T7S A;  2FGQ X;  5JR9 C;  5DL7 A;  2M6I A;  3OKQ A;  2XE2 A;  4JFB A;  1LKX A;  2ODJ A;  2XUE A;  3P50 A;  3PU3 A;  4BJN A;  2BKP A;  3TZG A;  3AB3 B;  1ZHX A;  3FBZ A;  2NTX A;  4UVA B;  1HX1 B;  3A8Y C;  5AQV B;  5FYM A;  5LA6 E;  4MHC A;  5JDN A;  2BG9 E;  4IT4 A;  3VU7 H;  3FZL B;  3X1D A;  4GYR A;  4AQY T;  5AQP B;  5HWY A;  3AE9 A;  4X1Y E;  3I9W A;  4A97 A;  4DR2 T;  4DV6 T;  3BRY A;  3UFE A;  3U3I A;  3J7Y q;  2XSB A;  3AA0 A;  3VY9 X;  1EZ3 A;  4YTM A;  1ZHC A;  2XAF B;  4HTE A;  3SYS A;  3L8R A;  4IE7 A;  4DV7 T;  4AKR B;  4DR5 T;  2CXD A;  2C5K T;  2W4X A;  2E5V A;  1GFM A;  3L09 A;  5LOV E;  4PJM A;  3WU2 O;  3OJA A;  2HH7 A;  3LSV A;  2HPJ A;  2R4P A;  4HN9 A;  5G38 A;  4TN7 B;  3RYI E;  2PG8 A;  1KEY A;  3AEG A;  1ZKE A;  2VVN A;  2PTF A;  4FRX A;  3HI2 A;  1MND A;  3N9N A;  4QH5 A;  3JC6 C;  4E7S A;  3LK2 A;  4N78 D;  1WR0 A;  3ZYM A;  3AXJ B;  3RQW A;  3HKB E;  5ABF A;  3AAA A;  4O2A E;  3O0E A;  1OPF A;  2H7O A;  3CX6 B;  1W9R A;  3CKD A;  3HOE A;  5HXR A;  4YTN A;  2W67 A;  4GOU A;  3VZU X;  2NW8 A;  5IHY A;  2BZB A;  4M1P A;  5AQG B;  3PUV F;  5J1G A;  4DBR A;  5HXS A;  4IDN A;  3UU3 A;  4ANJ A;  2N1G A;  3K3N A;  3JCF A;  3I0Q A;  4LFA T;  3FZF B;  2CA5 A;  2IUB A;  2CPT A;  3NVO A;  4ZOL E;  3HWB A;  4EGW A;  2R4O A;  2L3L A;  1N36 T;  3ZYK A;  4O49 A;  2Q9Q D;  3VRA A;  1YQ4 A;  3UU8 A;  2FGR A;  2X51 A;  2MAW A;  5AFU K;  5E0O A;  5J2U E;  1ORM A;  1W0A A;  4XBF B;  4I4T E;  5C3J A;  4AKL A;  3P8C D;  4H63 H;  3DWN A;  2DWG A;  1KNP A;  4X66 T;  1BR4 A;  4I50 E;  2X0H A;  4GKJ T;  2CE7 A;  5KAF O;  4CN6 A;  5LG3 A;  5KAI O;  2YKS A;  4OHF A;  4QH1 A;  2JMH A;  2M07 A;  3P7I A;  4I43 B;  5BMV E;  3AE7 A;  2PJQ A;  2WU2 A;  4ILB A;  3AE6 A;  4IDQ A;  2ZLD A;  2B76 A;  3UAQ A;  2IAK A;  3SFD A;  2QGS A;  1HTJ F;  5FVK A;  3ZT6 A;  4X1K E;  5CB4 E;  2A2F X;  3C50 A;  3ONJ A;  3SS1 A;  1LRZ A;  2YDS A;  1XDO A;  3LBX A;  5BR8 T;  3AVR A;  2V7J A;  1HF8 A;  3NWI A;  4HKA A;  4EEB A;  2I0M A;  4GCS A;  1ZHT A;  4CI2 B;  4LFB T;  5AQH B;  5LHH B;  2LHF A;  3AA7 A;  5FXX A;  3PV0 F;  2V6Y B;  1HNZ T;  2W80 C;  4ZI2 C;  5JDH A;  5GTI O;  4V1A v;  2VQE T;  2JJ9 A;  3QRA A;  1VCT A;  4N59 A;  4EOZ B;  2XHE B;  4YSX A;  5ABE A;  2FBW A;  2XPK A;  3SOL A;  4DV2 T;  3UTK A;  1MMD A;  3QK6 A;  4LMK A;  5CA0 E;  2Y8D A;  2CHO A;  1IJ6 A;  2MYS A;  4OX9 T;  4A56 A;  4PNI A;  1LVK A;  3PUQ A;  2YDR A;  3JTY A;  4BA9 A;  4RL9 A;  3BQL A;  3HA4 A;  1J5W A;  4B3T T;  3ZMS B;  5EK2 A;  5KXJ A;  2JQY A;  2N2N A;  3POQ A;  2CWO A;  3CPZ A;  5LB7 B;  3ETV A;  3PDY A;  4LF7 T;  2E9X B;  2DLR A;  4FZN A;  5DQV A;  2LRL A;  4TV8 E;  2GK9 A;  4YY3 T;  3ZSS A;  2DL1 A;  3OPC A;  3A2S X;  2KLQ A;  5G39 A;  2BS2 A;  1UUR A;  1S5L O;  1H7C A;  3N9Q A;  3N9O A;  2IW5 B;  4EED A;  3F31 A;  4YHH T;  4X62 T;  3LJC A;  3HL6 A;  1XWM A;  5IWA T;  5FXZ A;  3TLU A;  3SY7 A;  4AFK A;  5L3B B;  4JUY A;  2NP9 A;  3SYB A;  1KFY A;  5JDM A;  4U33 A;  3EAB A;  3AVS A;  3W15 B;  2LEH A;  2X9H A;  3EI0 A;  2ZM0 A;  4A5X A;  1T8B A;  4Z91 A;  3POR A;  1HNW T;  1ZHW A;  1W09 A;  2EHO A;  3V5S A;  2WU5 A;  3IA3 A;  3DZM A;  2IML A;  5F3J A;  1QJ8 A;  3TKL B;  2LLY A;  3O1H A;  5KX5 E;  3UQ7 A;  2F1V A;  4QXC B;  4O4J E;  3EUH A;  4ERR A;  1UX5 A;  3FYX A;  5B5E O;  5J0Z A;  4QH4 A;  2VAS A;  2Q9Q A;  2CEA A;  4DVD A;  4GK0 E;  4QQ1 A;  4D64 A;  1T16 A;  3C98 B;  4HWI B;  3IEE A;  3RRW A;  4DR1 T;  4CN1 A;  3U78 A;  3N2G E;  3RKO A;  2XQ6 A;  4KP3 C;  1MPF A;  5AQT B;  4AYN A;  3PGS A;  2YEV C;  5L2L A;  3PUX F;  2MBG A;  1WYC A;  3MKD A;  1ZEE A;  4TX5 A;  4HWC A;  1IBK T;  1GFP A;  4HWH A;  3ANW A;  4MFR A;  1HX8 A;  4WNK A;  1M62 A;  4MAL A;  3KVA A;  2DWK A;  2NWB A;  5PRN A;  5JR9 B;  2XQ8 A;  4FI5 A;  5L3D B;  4FQE A;  4P0B A;  3ESL A;  3GN5 A;  4BUM X;  1FMV A;  2WS3 A;  4C90 A;  4O4I E;  1OWA A;  3NJT A;  4UEM A;  3I0O A;  4JI8 T;  2V7I A;  2NOX A;  3VHL A;  3C64 A;  2WBL A;  4A98 A;  1M7K A;  2MTQ A;  1U5P A;  2HPL A;  1Z8U A;  4H9N C;  2QTK A;  2X9K A;  5JR9 A;  5LYJ E;  2YN6 A;  5FMN A;  5H2F O;  3GMI A;  5LGN B;  3P4R A;  5LHG B;  1O3X A;  3KBU A;  5L3C B;  2AE9 A;  3G7G A;  3FXD B;  3KIN B;  3PUY F;  3K3O A;  4HFC A;  5FY7 A;  1OED B;  2WM9 A;  4F8H A;  2UXX B;  2J47 A;  5ABH A;  2FJB A;  1E7P A;  3PJA J;  3HKC E;  1DU2 A;  3AA7 B;  5J2T E;  3FBL A;  3PTR B;  1OSM A;  2I6H A;  3EAM A;  4QXH B;  4TZ4 C;  2BBH A;  2ODV A;  3ZPO A;  2WWV A;  4B61 A;  3RH3 A;  2Y0K A;  2CBJ A;  3T0S A;  4DV3 T;  2CXF A;  3KVD D;  3LDQ B;  3AED A;  3TLT A;  2V7L A;  2H3R A;  3RPU A;  4JI3 T;  3RLF F;  4DR6 T;  4KMC A;  4EZH A;  2Y0L A;  1S35 A;  3O9X A;  2W61 A;  2R88 A;  2XE3 A;  4YTP A;  2X67 A;  4LML A;  3S4U A;  3HKD E;  2BG9 C;  2E9X A;  3BQK A;  3JCU O;  4IIJ E;  5LP6 E;  4AIS A;  5G26 A;  5IYU A;  3O1I A;  4HFV A;  2LSK A;  4LF6 T;  2C5J A;  1IBL T;  3WI5 A;  3RYH E;  2D5U A;  3BK9 A;  1WR6 A;  2XZE A;  5JDG A;  5CGM A;  2FUP A;  3PQS A;  1U4Q A;  3GWH A;  4PK6 A;  4UF0 A;  1ZHY A;  2K3W A;  3OTO T;  4J2C A;  1IBM T;  3NRX A;  3R6N A;  3Q2M A;  1IAP A;  4OK0 A;  4JI4 T;  2BKO A;  4C91 A;  4U3C A;  1ZP0 A;  4AYE C;  1QLB A;  3ETU A;  3C4Z A;  3PGU A;  4H9S E;  4JV5 T;  1KNZ A;  2D0T A;  4FSO A;  4FZM A;  5JRC A;  2YDQ A;  2A3D A;  2D9D A;  2WMN A;  2Q9Q C;  3RC8 A;  4JCH A;  2K4T A;  4JI2 T;  2Y0H A;  2AXD S;  4DND A;  2K5B B;  4YSZ A;  3ZLI A;  5LXT E;  2J4U P;  3L39 A;  1D1C A;  2IHR 1;  1HCI A;  2VKH A;  3AEC A;  3ZN1 B;  3ZJ1 A;  4ZI7 E;  2VB6 A;  3RIF A;  2NR4 A;  2K0L A;  4O4U A;  1LVF A;  4DV1 T;  4PR7 A;  4KI0 F;  1MM4 A;  5AQF B;  4UB6 O;  3VY8 X;  5AQQ B;  2PBI A;  2MOZ A;  1HXU A;  1GQE A;  2XMX A;  2R8A A;  2UUB T;  1X9B A;  4U74 A;  3NKZ A;  4IST A;  1YD8 G;  4U31 A;  2Y6X A;  4FT6 A;  5HXH A;  3TLW A;  1Q9F A;  3C5O A;  5LCY A;  5EK3 A;  4PJN A;  2BDE A;  4IHJ E;  2LFU A;  4TWH A;  3MK7 C;  3RKG A;  4UV8 B;  3FHN A;  3E22 E;  4YLH A;  5D5D A;  4DR3 T;  2R6G F;  2C0S A;  4Z3T A;  5EE2 A;  4LSH A;  1VRB A;  2F1T A;  4O3Y A;  2N2L A;  3LK3 B;  3PRN A;  3CML A;  3UUL A;  5LGU B;  2KXP A;  3RF1 A;  2ZM2 A;  4UF0 B;  2BBJ A;  1XNQ T;  1OED E;  3JAF A;  3A0B O;  4C00 A;  3AEB A;  5AQI B;  4PJL A;  4K0U A;  1UK5 A;  4U7I A;  3EDV A;  3SFE A;  3WI3 A;  2X68 A;  4UIG A;  2JPF A;  3FB2 A;  2LSI A;  3AA1 B;  2X9X A;  4K3B A;  4GF4 A;  4YJ3 E;  4XNL A;  4G2A A;  2EHO B;  5JRE A;  3ONX A;  1T98 A;  4UEL A;  4BJM A;  2C5I T;  2VVS A;  2JMM A;  2K9A A;  4ZXL A;  5ETW A;  5H6R B;  2QA7 A;  2LOS A;  3RYF E;  2KMF A;  1IZN A;  5EZY E;  5HEJ A;  3ZYL A;  5L47 A;  5JDQ A;  4DUZ T;  2WJQ A;  3VE2 A;  5AQK B;  4G76 A;  2RA1 A;  4YFS A;  5JTG A;  2JQK A;  2KSR A;  4K3C A;  3MJX A;  3Q5D A;  4IE5 A;  1H6S 1;  1G73 A;  2DHR A;  4JI0 T;  3B57 A;  3CWZ B;  3EDU A;  3Q9D A;  3KFW X;  3O1J A;  3RHW A;  2WDV A;  2CXL A;  3T20 A;  2I59 A;  3ZN0 B;  1FIO A;  1SUM B;  2V8S V;  2BG9 B;  3PUR A;  1FEW A;  1YXR A;  4U9C A;  4DV0 T;  2CCQ A;  3RI5 A;  2UU9 T;  4NXN T;  4XNK A;  1BR0 A;  4AKH A;  5HYA A;  3NZQ A;  1T72 A;  2J1D G;  4H9Q C;  2W62 A;  3P4S A;  5G3A A;  4IGU A;  4P0A A;  2K48 A;  3ZCJ A;  4PUX A;  4ILC A;  4AQF A;  2VL8 A;  4ILU A;  3AAE A;  3G06 A;  3A5X A;  3ZMT B;  2X0L B;  3ANW B;  3ONL C;  2XE5 A;  1CUN A;  5JQG E;  3AA1 A;  4X20 E;  3L3P A;  5EK4 A;  1IJ5 A;  5JH7 E;  3BRZ A;  3KDS E;  1HG2 A;  4PJJ A;  4YHJ A;  3RIA A;  3Q5X A;  3IF8 B;  4ZS3 A;  2XTQ A;  3ZST A;  4IDZ A;  3ZMU B;  1XDP A;  3IHR A;  4FSP A;  4ISS A;  4QXB B;  3AE2 A;  4TUY E;  5GTH O;  4DBQ A;  4UXN B;  1SHZ C;  4FUV A;  3Q5E A;  4FRT A;  2OV9 A;  5CFB A;  4IE0 A;  2OLT A;  4P1N A;  2UXC T;  4DR4 T;  2HN2 A;  3KZI O;  3E0Z A;  2JIW A;  3FZH B;  2OA5 A;  5AQJ B;  2XG6 A;  3AA6 A;  2CLY C;  3GA8 A;  1HR0 T;  1E2A A;  1JNR A;  3M3Z B;  4L0R A;  5L3F B;  4HWD A;  1MNE A;  3AE4 A;  2X66 A;  4TV9 E;  2E8I A;  5TAO A;  4BAY B;  4WZX A;  4PFO A;  3N5L A;  5FXW A;  4MLK A;  4F6R C;  4YT0 A;  1D1B A;  2KZ7 A;  2NW9 A;  4CXW A;  3RGL A;  5HEH A;  3AA0 B;  3LK4 2;  4FJO A;  3QB5 K;  2YU2 A;  3AE3 A;  4ZEY A;  4DV4 T;  5C8Y E;  2WDQ A;  3CVR A;  3K8P C;  2XQ4 A;  5LBQ B;  2J4G A;  2X27 X;  1E54 A;  4CXX A;  3T8O A;  5FL1 A;  3PUA A;  1ZHZ A;  4LF4 T;  2YNK A;  4O3W A;  5AQM B;  4JEU B;  3MZK B;  3ZJ2 A;  3JC6 D;  3KV9 A;  2XQ9 A;  2KDY A;  4U2Z A;  5HWX A;  3KVB A;  4ZHQ E;  4JI5 T;  1G90 A;  3AXJ A;  5HEG A;  2M06 A;  3RQU A;  5DQW A;  3UU4 A;  3SZD A;  4CI1 B;  3T1H T;  2N2M A;  4YJ2 E;  4TNW A;  1MIY A;  4XZC A;  3LFM A;  2R4L A;  2IC6 A;  1GFQ A;  2ES0 A;  4OYK A;  4GK5 E;  2VL0 A;  4DR7 T;  4X5T A;  4WBN E;  3K19 A;  3B5M A;  2AXT O;  2Q9Q B;  3PUG A;  2LE8 A;  3MAC A;  3CX8 B;  4GCP A;  1I94 T;  3ZC1 A;  4EB6 E;  2WB5 A;  5FKY A;  4NIQ A;  4AXP A;  1R8I A;  4AQG A;  5GV0 A;  4UVB B;  4LF5 T;  4O8S A;  2V1D B;  1D1A A;  3UU6 A;  1AJ3 A;  2D2S A;  3PUS A;  2DCF A;  4ASK A;  2ZLY A;  5DL8 A;  4HFH A;  3VZT X;  2HN1 A;  5AQN B;  6PRN A;  3P4P A;  4NXM T;  4IDO A;  1WYB A;  5AQR B;  2W81 C;  1Y01 A;  2VKJ A;  3UUN A;  3VKH A;  5HXE A;  4CN4 A;  5FVN A;  2X9W A;  4E1T A;  1MM5 A;  4IRE A;  3PGR A;  3O4X E;  2Z6E A;  4O3Z A;  3UT5 E;  2CHN A;  3AAE B;  3BS0 A;  2J62 A;  2IIU A;  2WP9 A;  1QJP A;  1JNZ A;  4OFZ A;  5F5W A;  1MIV A;  2KZ7 B;  3H3M A;  4AKR A;  2XJ7 A;  5ADX L;  5GON E;  2F1C X;  3MA9 A;  2V5D A;  5L4H A;  3SZV A;  4LSI A;  4LSE A;  1HS7 A;  4TNV A;  4JEH B;  4X1I E;  2YPV A;  3D0T A;  4D5U A;  5LJN A;  1HXX A;  2LRK A;  2VKO A;  1GFO A;  3DA4 A;  2A72 A;  1UUS A;  4GYS A;  3EHZ A;  3QNU A;  2KIN B;  4HE8 A;  4HFB A;  3J9X 1;  2NW7 A;  3RBH A;  3NBX X;  2V5C A;  2V7K A;  2VK9 A;  5FY0 A;  5ABF B;  2KWH A;  2ZMA A;  1N34 T;  4P09 A;  5IYZ E;  4B3R T;  2XQY A;  3ZMZ B;  2UXN B;  2R4N A;  5ADX K;  5FNV E;  5FL0 A;  5FY1 A;  3AEA A;  3AE5 A;  4Z90 A;  3DA3 A;  2VQF T;  2CMR A;  4HGA A;  3V8U A;  3POU A;  1B7T A;  2O4V A;  4EYU A;  2LOP A;  2ACX A;  4CQI A;  5KDM C;  3PF1 A;  4H9R C;  3QC9 A;  2EHO D;  5LHI B;  3K3Q C;  1PHO A;  2WMO A;  2H89 A;  4PFP A;  2BG9 A;  3C4X A;  3QB5 A;  3RIU A;  1QJ9 A;  2WY2 A;  4PK4 A;  1D0Y A;  2QYW A;  2UUC T;  4H9P C;  2N9D A;  5HAX A;  2JRK A;  2UXB T;  1YKH B;  4ZZB A;  3ZC0 A;  4AKM A;  5E79 O;  3PUW F;  2KWI B;  1HFA A;  4TWF A;  4FMS A;  5AQU B;  2DNX A;  1NEN A;  3EMN X;  4F4B A;  2E9X C;  3N9L A;  1SE7 A;  1N33 T;  4KX6 A;  4H9O C;  5F8P A;  1X79 A;  5JDL A;  4EIW A;  2IC9 A;  2YU1 A;  4C4V A;  2QVA A;  2LJL A;  3QOF A;  3PJA A;  1NWM X;  5AFU L;  4GKK T;  1YQ3 A;  4JI6 T;  2RP4 A;  2CM0 A;  4O4L E;  1HNX T;  2KXP B;  5M4Y A;  4PJ0 O;  1QSD A;  3AE8 A;  4KBM B;  3C4W A;  4JI1 T;  2XY8 B;  3H3A A;  4COF A;  3B13 A;  2R89 A;  4UVC B; 
#chains in the Genus database with same CATH homology
 2G0U A;  3IEE A;  4FOZ A;  1D0Z A;  3RRW A;  5L3G B;  4Z8X A;  3U78 A;  3N2G E;  3RKO A;  4O3X B;  3RC3 A;  4KP3 C;  4IGU A;  3VKG A;  4P0A A;  2K48 A;  4IE4 A;  1MPF A;  4DO0 A;  3ZCJ A;  4AYN A;  4E7Z A;  4PUX A;  2NTY A;  4ZI3 C;  1UCU A;  4AQF A;  3N2O A;  2PFV A;  2YEV C;  2VL8 A;  5L2L A;  4E1S A;  2MBG A;  4ILU A;  1WYC A;  3AAE A;  1BR1 A;  4C69 X;  2W0G A;  3OBV E;  3MKD A;  4KRA A;  1ZEE A;  2P9B A;  3A5X A;  4UV9 B;  5FXV A;  4D65 A;  4TX5 A;  3ZMT B;  4PK5 A;  3DP7 A;  3RRC A;  2X0L B;  3ANW B;  3KV4 A;  2XE5 A;  1FMW A;  2KT9 A;  1CUN A;  1GFP A;  3KV6 A;  3AAA B;  4IE6 A;  5LGT B;  5JQG E;  2JQQ A;  4OYJ A;  3AA1 A;  2WSS V;  3ANW A;  4X20 E;  4MFR A;  1HX8 A;  1MMN A;  2LSG A;  4MAL A;  4WNK A;  4ZI2 D;  3KVA A;  4QHO A;  4EAH A;  2DWK A;  3L3P A;  4MBQ A;  2NWB A;  3WI4 A;  5PRN A;  2VKD A;  3OYZ A;  5JR9 B;  5EK4 A;  1IJ5 A;  4FI5 A;  5L3D B;  4P0B A;  3CQX C;  2FGQ X;  3ESL A;  5JR9 C;  5JH7 E;  5DL7 A;  3GN5 A;  4BUM X;  1V9D A;  1FMV A;  4H63 V;  4C90 A;  3KDS E;  3OKQ A;  4O4I E;  1OWA A;  1LKX A;  2XE2 A;  4JFB A;  2WWU A;  2ODJ A;  1HG2 A;  2ODU A;  2XUE A;  4AYM C;  4PJJ A;  4UEM A;  1UX4 A;  3CX7 B;  3I0O A;  4YHJ A;  2V7I A;  2NOX A;  3PU3 A;  3VHL A;  3C64 A;  2WBL A;  3Q5X A;  4BJN A;  2KC0 A;  3TZG A;  3AB3 B;  2MTQ A;  1ZHX A;  1U5P A;  2HPL A;  3FBZ A;  3IF8 B;  4H9N C;  2QTK A;  5JR9 A;  2LSY A;  4XAX B;  4ZS3 A;  4JLE A;  2XAQ B;  2NTX A;  2CLY B;  4UVA B;  5LYJ E;  2XTQ A;  5FMN A;  5FYM A;  4IDZ A;  5LA6 E;  4MHC A;  3ZMU B;  5JDN A;  3IHR A;  4FSP A;  3GMI A;  4ISS A;  3VU7 H;  4EYY R;  5LGN B;  5LHG B;  4QXB B;  1O3X A;  4GYR A;  2SPC A;  3SWH A;  4KR4 A;  4TUY E;  3T24 A;  5HWY A;  4X1Y E;  3I9W A;  5LBM A;  4AZL A;  2CWY A;  3KBU A;  5L3C B;  3UFE A;  3G7G A;  3FXD B;  2DI4 A;  4DBQ A;  3ZMV B;  3U3I A;  3KIN B;  3J7Y q;  2L8K A;  4UXN B;  3K3O A;  3AA0 A;  3VY9 X;  1EZ3 A;  1SHZ C;  4FUV A;  5FY7 A;  4N58 A;  1ZHC A;  4FRT A;  2XAF B;  4HTE A;  2WM9 A;  3SYS A;  4IE7 A;  4IE0 A;  2XE1 A;  2BVM A;  2UXX B;  4AKR B;  2POR A;  2CXD A;  2C5K T;  3AA6 B;  3N9P A;  1GFM A;  3L09 A;  3E0Z A;  5LOV E;  3BQI A;  4PJM A;  2OA5 A;  3HKC E;  2XG6 A;  3AA6 A;  2CLY C;  3AA7 B;  1MMG A;  3GA8 A;  5J2T E;  3FBL A;  3OJA A;  2HH7 A;  2L9Q A;  2HPJ A;  3PTR B;  4HN9 A;  2YK0 A;  4TN7 B;  4L0R A;  4QXH B;  4TZ4 C;  5L3F B;  3RYI E;  1OSM A;  2PG8 A;  2VWA A;  2ODV A;  3ZPO A;  2J1N A;  1MNE A;  2X66 A;  4B61 A;  1ZKE A;  3RH3 A;  2Y0K A;  3KBT A;  4TV9 E;  2E8I A;  4ZS2 A;  3HOL A;  3T0S A;  1THQ A;  2CXF A;  1S94 A;  3HI2 A;  5TAO A;  4BAY B;  1MND A;  3KVD D;  4FRX A;  3N9N A;  3VZW X;  3JC6 C;  4E7S A;  3LK2 A;  4N78 D;  1IZN B;  2V7L A;  4PFO A;  3ZYM A;  2W63 A;  2H3R A;  3N5L A;  3RPU A;  3HKB E;  3LK3 A;  3AAA A;  4O2A E;  5FXW A;  5A1L A;  1OPF A;  1YS5 A;  2H7O A;  3O0E A;  3CX6 B;  3CKD A;  4MLK A;  2ZM8 A;  5HXR A;  3PE0 A;  4HEA A;  1D1B A;  4F6R C;  3HOE A;  4KMC A;  2KZ7 A;  2NW9 A;  4CXW A;  4EZH A;  2Y0L A;  4RJX A;  1S35 A;  3AA0 B;  3LK4 2;  2W61 A;  4GOU A;  3O9X A;  3Q5W A;  2XE3 A;  3VZU X;  2NW8 A;  4FJO A;  2X67 A;  5IHY A;  4AYD C;  2BZB A;  2YU2 A;  3H37 A;  5JRC B;  4PAG A;  4M1P A;  3S4U A;  3HKD E;  5J1G A;  5JDF A;  4DBR A;  5HXS A;  2LHN A;  4ANJ A;  2KND A;  2N1G A;  3K3N A;  5C8Y E;  4QX8 B;  2E9X A;  1MMA A;  3CVR A;  1Z0P A;  3AAI A;  3BQK A;  3I0Q A;  3K8P C;  4IIJ E;  5LBQ B;  5LP6 E;  1E54 A;  2MNH A;  4CXX A;  2X27 X;  2BVL A;  2CA5 A;  5G26 A;  3T8O A;  5IYU A;  3PUA A;  1ZHZ A;  3O1I A;  4HFV A;  2YNK A;  4ZOL E;  3HWB A;  1SA0 E;  3SRZ A;  2Y2X A;  2WAU A;  2LSK A;  4EXT A;  2C5J A;  4O3W A;  2L3L A;  3MZK B;  4JEU B;  4O2B E;  3ZJ2 A;  3JC6 D;  3KV9 A;  4DMW A;  2EHO C;  3RYH E;  3ZYK A;  3WI5 A;  4O49 A;  2KDY A;  3QUJ A;  2D5U A;  2Q9Q D;  4O4H E;  3BK9 A;  1G8X A;  5HWX A;  2V26 A;  1WR6 A;  3KVB A;  5JDG A;  4QWN B;  4ZHQ E;  2K24 A;  3PQS A;  1U4Q A;  2FGR A;  1G90 A;  3ZCI A;  3GWH A;  4PK6 A;  4UF0 A;  1ZHY A;  2M06 A;  3UU2 A;  2X9Y A;  5CA1 E;  4J2C A;  3RX6 A;  2X51 A;  3NRX A;  5AFU K;  3R6N A;  5DQW A;  3Q2M A;  3SZD A;  1IAP A;  4CI1 B;  5E0O A;  4OK0 A;  2N2M A;  2Y7S A;  1MIW A;  5J2U E;  2ERV A;  4YJ2 E;  4PW8 A;  1ORM A;  1MIY A;  4XZC A;  4C91 A;  4XBF B;  4I4T E;  3LFM A;  3POX A;  4AYE C;  3GP6 A;  2IC6 A;  1BR2 A;  4AKL A;  3ETU A;  5LG4 A;  3C4Z A;  4L5G A;  1GFQ A;  2ES0 A;  4H9S E;  3P8C D;  4H63 H;  4OYK A;  4WBO A;  3C51 A;  3KV5 A;  4GK5 E;  1KNZ A;  2GE4 A;  4WBN E;  3K19 A;  4AUI A;  2D0T A;  4FSO A;  2D0U A;  2DWG A;  2XAS B;  4FZM A;  5JRC A;  3NRY A;  2Q9Q B;  3PUG A;  1BR4 A;  2A3D A;  2LE8 A;  3CX8 B;  3MAC A;  4I55 E;  1P4T A;  4I50 E;  3ZC1 A;  4EB6 E;  4GCP A;  2WMN A;  2Q9Q C;  4AXP A;  2E9X D;  4AQG A;  3PQU A;  5GV0 A;  4UVB B;  2YIN A;  3RC8 A;  5L3E B;  4O8S A;  2CE7 A;  4JCH A;  2K4T A;  2PRN A;  3EVY A;  3ZEF B;  2V1D B;  1D1A A;  2Y0H A;  3LK4 1;  4DND A;  4OHF A;  1AJ3 A;  2K5B B;  2JMH A;  2D2S A;  2M07 A;  3ZLI A;  5LXT E;  1Q9G A;  3P7I A;  3PUS A;  4I43 B;  2H7V C;  2J4U P;  2DCF A;  4ASK A;  2ZLY A;  5DL8 A;  1D1C A;  1KK7 A;  3VZT X;  1HCI A;  2VKH A;  3ZN1 B;  3ZJ1 A;  5BMV E;  6PRN A;  2PJQ A;  1Y64 B;  3NSG A;  4ZI7 E;  1WYB A;  2VB6 A;  2W81 C;  2ZLD A;  2K0L A;  4O4U A;  1LVF A;  2VKJ A;  4RJW A;  3UUN A;  4AI6 A;  5T5F A;  2IAK A;  3UAQ A;  3VKH A;  5HXE A;  2QGS A;  3V5U A;  1HTJ F;  5FVN A;  4X1K E;  2X9W A;  4E1T A;  5CB4 E;  2JMK A;  2A2F X;  1MM5 A;  3C50 A;  1MM4 A;  3DTO A;  3VY8 X;  3SS1 A;  3O4X E;  2Z6E A;  1LRZ A;  2PBI A;  2MOZ A;  3LBX A;  4O3Z A;  4G75 A;  3AVR A;  4QKN A;  3UT5 E;  1HXU A;  2MHL A;  4NUV A;  5DL6 A;  3AAE B;  4RLB A;  2XMX A;  3GN5 B;  2V7J A;  1HF8 A;  4HKA A;  3VE2 A;  1QJP A;  4RLC A;  3I9Y A;  4OFZ A;  3B13 A;  1MIV A;  1WRD A;  4U74 A;  1HG5 A;  4ZI3 D;  2KZ7 B;  4IST A;  1YD8 G;  4AKR A;  1D0X A;  2Y6X A;  4NUU A;  4FT6 A;  3FXE B;  5ADX L;  3F57 A;  1HXT A;  4GCS A;  3LBX B;  5GON E;  1ZHT A;  3MA9 A;  4CI2 B;  1NAF A;  1US7 B;  1E1H B;  4QX7 B;  3SZV A;  5HXH A;  3NZP A;  1ZV4 X;  2XAH B;  5LHH B;  4DMV A;  2LHF A;  4LSI A;  1HS7 A;  1Q9F A;  4LSE A;  3C5O A;  5LCY A;  5EK3 A;  4PJN A;  4JEH B;  3AA7 A;  4GHB A;  2BDE A;  4GIW A;  4IHJ E;  4X1I E;  5FXX A;  2YPV A;  3D0T A;  4L9I A;  4D5U A;  2LFU A;  2W80 C;  3DJB A;  5LJN A;  4ZI2 C;  5JDH A;  4V1A v;  1HXX A;  2JJ9 A;  3MK7 C;  2VKO A;  1GFO A;  3DA4 A;  2ZFG A;  3QRA A;  2V7M A;  4UV8 B;  2A72 A;  4N59 A;  3FHN A;  3E22 E;  4GYS A;  4YLH A;  3F2E A;  4EOZ B;  2KIN B;  2XHE B;  2M67 A;  4HE8 A;  5D5D A;  3J9X 1;  3SOL A;  2NW7 A;  3UTK A;  3RBH A;  2C0S A;  4Z3T A;  5EE2 A;  4LSH A;  3LK2 B;  3NBX X;  1MMD A;  3UUM A;  2V7K A;  1VRB A;  2F1T A;  4O3Y A;  2VK9 A;  5FY0 A;  2N2L A;  3LK3 B;  2KWH A;  2ZMA A;  3PRN A;  4P09 A;  3QK6 A;  5IYZ E;  5CA0 E;  5FP3 A;  3CML A;  3UUL A;  5LGU B;  2XQY A;  2Y8D A;  2KXP A;  3UUX B;  5DL5 A;  5JVD E;  1IJ6 A;  2MYS A;  3VE1 A;  3N2K E;  2ZM2 A;  3ZMZ B;  2UXN B;  4UF0 B;  4A56 A;  4PNI A;  1LVK A;  4CI3 B;  3PUQ A;  3SY9 A;  5ADX K;  5FNV E;  5FY1 A;  2LM9 A;  4CZZ B;  4FES A;  3JTY A;  3PU8 A;  4BA9 A;  4O4X A;  4RL9 A;  3DA3 A;  4PJL A;  3BQL A;  2CMR A;  4HGA A;  3HA4 A;  1QUU A;  4K0U A;  1WLX A;  5DAB A;  3V8U A;  3POU A;  3EDV A;  3WAK A;  3ZMS B;  4GCQ A;  5EK2 A;  1OXZ A;  1BT9 A;  2N2N A;  3WI3 A;  1B7T A;  3WAJ A;  2O4V A;  2X68 A;  2LOP A;  4UIG A;  2W00 A;  4EYU A;  2JPF A;  3FB2 A;  2LSI A;  3AA1 B;  2X9X A;  2ACX A;  3POQ A;  2B1E A;  1YKE B;  2CWO A;  4CQI A;  5KDM C;  3CPZ A;  3ETV A;  3IBP A;  4YJ3 E;  4GF4 A;  4G2A A;  2EHO B;  4XNL A;  3OYX A;  5JRE A;  3ONX A;  3PDY A;  1T98 A;  3QC9 A;  2E9X B;  2DLR A;  2EHO D;  4H9R C;  4UEL A;  4B6X A;  4BJM A;  3K3Q C;  2C5I T;  5LHI B;  1PHO A;  3HKE E;  4AKI A;  2JMM A;  4FZN A;  5HXC A;  2WMO A;  8PRN A;  3R84 B;  2K9A A;  4PFP A;  3HR0 A;  5DQV A;  2LHR A;  3HW9 A;  1VOM A;  5ETW A;  5H6R B;  3C4X A;  5H6Q B;  1PRN A;  1QJ9 A;  2QA7 A;  2LOS A;  4TV8 E;  3RYF E;  2GK9 A;  2KMF A;  1IZN A;  4PK4 A;  4AQF C;  1D0Y A;  5EZY E;  3ZYL A;  2LSJ A;  5JDP A;  4WW0 A;  4AKG A;  4KR8 A;  1BH3 A;  3A2S X;  2KLQ A;  4H9P C;  2N9D A;  3N9M A;  5JDQ A;  1H7C A;  3CQC B;  3N9Q A;  3N9O A;  3QRC A;  2IW5 B;  5HAX A;  2JRK A;  5LNK A;  5LJM A;  4G76 A;  1YKH B;  2LT3 A;  2RA1 A;  4YFS A;  4AYI D;  7PRN A;  3ZC0 A;  5KMG P;  4AKM A;  3F31 A;  4LSF A;  2KWI B;  3LJC A;  2OMF A;  3HL6 A;  3LG7 A;  1HFA A;  4FMS A;  5FXZ A;  3SY7 A;  4AFK A;  2DNX A;  5L3B B;  4JUY A;  2NP9 A;  2XTL A;  3MJX A;  4IE5 A;  4EZ4 A;  4CXY A;  3SYB A;  3EMN X;  4F4B A;  2E9X C;  3N9L A;  5JDM A;  3CQG B;  4KUM B;  3AVS A;  3W15 B;  2LEH A;  4H9O C;  1H6S 1;  3E08 A;  2X9H A;  2ZM0 A;  1G73 A;  1X79 A;  2DHR A;  5F8P A;  4EIW A;  5JDL A;  3I1A A;  3B57 A;  3CWZ B;  2IC9 A;  3POR A;  2YU1 A;  3MXZ A;  3M65 A;  3EDU A;  2EHO A;  3V5S A;  1ZHW A;  3UPG A;  2LJL A;  3Q9D A;  1NWM X;  5AFU L;  5F3J A;  1QJ8 A;  3KFW X;  3TKL B;  3O1J A;  3O1H A;  5KX5 E;  2F1V A;  4QXC B;  2CXL A;  4O4J E;  1YW0 A;  2I59 A;  2XAJ B;  4G63 A;  3ZN0 B;  3T20 A;  2RP4 A;  2CM0 A;  1FIO A;  3EUH A;  4ERR A;  1UX5 A;  3PUR A;  3FYX A;  1FEW A;  4O4L E;  2XTR A;  4ADZ A;  4U9C A;  4FZL A;  2CCQ A;  2KXP B;  4U72 A;  1BXW A;  4XNK A;  3RYC E;  1BR0 A;  5M4Y A;  2XAG B;  5DJQ C;  1QSD A;  4KBM B;  2VAS A;  3C4W A;  2Q9Q A;  2CEA A;  5HYA A;  4AKH A;  4DVD A;  3NZQ A;  1GFN A;  4GK0 E;  2Y48 B;  2J1D G;  3H3A A;  4QQ1 A;  4H9Q C;  4D64 A;  3C98 B;  4UVC B;  2W62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...