3AA0B

Crystal structure of actin capping protein in complex with the cp-binding motif derived from carmil
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
243
structure length
243
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-1
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 85
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aa0B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aa0B02
4AKRB 3AA0A 3LK2A 2KZ7B 2KXPA 3AAAA 3LK3A 3AA0B 3LK2B 3AA1A 3LK3B 1IZNA 2KXPB 3AAAB 3LK41 3AA7A 3AA1B 3LK42 1IZNB 5ADXL 3AA6A 5ADXK 3AAEA 3AA7B 4AKRA 5AFUL 3AA6B 5AFUK 3AAEB 2KZ7A
chains in the Genus database with same CATH superfamily
4AKRB 2DNXA 2XQ7A 5AQQB 2VQET 4HTEA 4U7IA 2Q9QD 3FZHB 2KXPB 1HF8A 4G2AA 5HCMA 3AE1A 2C0SA 3AA1B 3WI4A 5LG4A 3UU5A 2FUPA 2X66A 4X62T 3FZKB 3CPZA 3AAEB 3PUSA 4X64T 4AZLA 1EZ3A 1YXRA 4LSEA 3ZJ1A 3KDSE 1WCRA 1IJ5A 3S4UA 2CXLA 4AQFC 2LE8A 4KHZF 1ZKEA 3LK2B 4CTDA 2WWUA 1N33T 4JEHB 3ZYMA 5FYMA 4FOZA 2J4UP 3NRYA 3ZN1B 1E2AA 3VU7H 1W9RA 4HWDA 1ZOYA 4F4BA 3F57A 5JRCA 3GWHA 4IE0A 5FXZA 3PV0F 3JAFA 3MJXA 4K3CA 3N2KE 4CXWA 5JR9C 5B5EO 2F1TA 3BK9A 4PK5A 2YU1A 2FJEA 1YQ3A 3AE8A 4C69X 3CWZB 3D0TA 4DR3T 2KWIB 4XNLA 4IE6A 4WBNE 1QJ8A 3K19A 3KVBA 2CHNA 4B3TT 3FHNA 1ZV4X 4DVDA 3UTKA 1YKHB 1UX5A 2R4PA 2LRLA 5IUXA 2JQKA 2C5IT 5DQVA 3EDUA 4OYJA 2WMNA 2IW5B 4C90A 2A3DA 2MBGA 1T16A 3QK6A 3PORA 4RL9A 2VVSA 4RJWA 1WRDA 3FBZA 3IF8B 2X9YA 4QXBB 4LSHA 3UFEA 2M67A 2YU2A 5FY7A 4QX7B 2QYWA 5KXJA 5LHIB 2GK9A 3EABA 2XQ5A 3RQUA 3KV9A 3J9X1 2J1DG 1HX8A 4PUXA 4XNKA 1SHZC 3HOLA 2OA5A 4EZHA 3SZDA 3N2OA 3H3MA 4IDNA 4I50E 4O2BE 3ZCJA 2QA7A 1H6S1 4D64A 2X9KA 4AKRA 1MMDA 2KWHA 3AA6B 3N9NA 2K24A 4AQGA 4FRXA 4AKHA 4QWNB 1E1HB 5IHYA 2KXPA 5HEJA 4CI2B 3AA1A 2X68A 3RPUA 5FXVA 4N78D 1Z8UA 2X0HA 5ABEA 1YQ4A 2W4XA 4H9SE 2XJ7A 3AAEA 4PJMA 5ABHA 2W66A 2L8KA 3PQSA 4CZZB 3LK2A 5LA6E 2W63A 2W62A 1V9DA 3QC9A 4DUZT 4AKGA 1N32T 4DBQA 3NRXA 1MNEA 4UV9B 3LK42 3NVOA 3CMLA 2J62A 5LMUT 4CXXA 3ZT7A 2F1CX 4H9QC 3EHZA 2UUAT 2WWVA 4TWDA 3UU6A 5FVNA 1BR1A 2N1GA 3TLSA 2QGSA 2M07A 1HTJF 4H63H 3VRBA 1T8BA 3PUAA 3AE3A 1UURA 2C5JA 4OK0A 2MAWA 1G8XA 3ZJ2A 4JI8T 3HWBA 4NUUA 5LHHB 1YW0A 2CWYA 2LRKA 4TWFA 2IMLA 2CXFA 3ZT6A 3N9QA 4UR9A 1J1JA 1FEWA 1OEDE 4H9PC 3Q5WA 4DO0A 4ILAA 4AXPA 3WI5A 2UUBT 2E8IA 5KDMC 4PFOA 1OEDC 4DMWA 4KHPT 3JAEA 1M62A 4KP3C 2V7JA 3ETUA 5KAFO 5FMNA 4A97A 4B3MT 3JC6C 3PGSA 3AEGA 5J2UE 4O4IE 3SFDA 2VB6A 2J1NA 2UXDT 4DR7T 4U31A 4P1NA 1YD8G 2X0LB 3HKCE 2J4GA 3LK41 3TKLB 3AVRA 3AA6A 5ADXK 5CB4E 5HEUA 5JVDE 2WSSV 2YNKA 1ZHCA 4AKLA 4BJMA 3ZSSA 2XQAA 3EI0A 4UIGA 3UU4A 2C5KT 1GFQA 2MYSA 2VURA 3C98B 5JDGA 3OTOT 1I94T 2A2FX 3C5OA 2XASB 3PUWF 2EHOC 4AISA 2XAJB 2CMRA 2WAUA 3M65A 4WBOA 3G7GA 2SPCA 4IGUA 1KFYA 5JDQA 4HFHA 4EEDA 3A0HO 1WYBA 4FUVA 2WDRA 3ONXA 2V1DB 2Y6XA 1XDOA 4U2ZA 3K1SA 3MKDA 2V6XA 2V7LA 2LOSA 3CIRA 4RJXA 2V7MA 3I0QA 4JBWF 2XAQB 3V5SA 3OBVE 3LK3A 3AEDA 4HFDA 3PUXF 3RQWA 4L5GA 5JR9B 5L3FB 4JI3T 4QH5A 1MM4A 3P4WA 5DJQC 3W15B 4NXNT 1MIYA 2F1VA 2X27X 4TV8E 3T0SA 2LOPA 3P8CD 4IL9A 5JDNA 3ZC0A 3KBUA 2H7OA 4EXTA 1IBKT 3DTOA 2Y7SA 4DNDA 2PJQA 2PRNA 2ZMAA 4DV4T 1NAFA 2HHHT 4ISSA 2BG9E 2LSYA 3FXDB 5HWYA 5L3EB 4UVBB 2XSAA 1WR6A 5JDHA 3CX7B 3A2SX 4U72A 2QRXA 4DV5T 5AQSB 3AA7B 5LP6E 3ZKRA 2BG9C 3BQIA 6PRNA 2IWVA 2X9XA 3J7Yq 4FI5A 1GFOA 3G06A 3DP7A 4TV9E 5F5WA 3RRCA 5IWAT 2MOZA 5JREA 4LMJA 2JQQA 2VKDA 1NEKA 3P4PA 3RHWA 1DU2A 4H9RC 4GF4A 2LSJA 4L9IA 5AQRB 3CQGB 1LRZA 4ZI2C 2FJAA 2VVNA 5B66O 1FMVA 3O1IA 3NSGA 2XQYA 1FMWA 4KBMB 3ZYLA 5C3JA 4ILCA 2XM1A 2H88A 5AQHB 2W00A 4UEMA 5HEOA 4DUYT 1KNZA 4EEBA 4LFCT 5LNKA 5LGTB 2XE3A 1HG2A 1IBLT 2JQYA 2M6IA 4NXMT 3ZYKA 4HKAA 5LOVE 5JQGE 3H3AA 3UUXB 5LGNB 2LHRA 5CA0E 5ADXL 3NWIA 4ZI3D 3ZMVB 2X0YA 2HN2A 2XE5A 4O4HE 4AQFA 2JIWA 3DA4A 3ANWB 3KBTA 2YPVA 2RA1A 4FJOA 1J5ET 5AQFB 2Y0LA 2WU2A 4IE4A 2ODUA 1I6ZA 4AYID 3IEEA 3ZCIA 4QXCB 1ZEEA 3EAMA 2ODJA 5LCYA 5L3BB 4O4LE 5JR9A 3MZKB 5AQTB 5HXHA 2V7IA 4CN4A 2IUBA 1US7B 3VZWX 2WJRA 1SUMB 1QSDA 2V26A 2D0TA 2ZM6T 4H63V 5HAXA 4QXHB 4Z3TA 4YHJA 4DV1T 4KX6A 2K5BB 1Q9GA 1UX4A 5AQJB 3AA7A 4IE5A 2CXDA 1BR4A 1MMNA 5L3CB 2CLYC 2I6HA 3QRCA 1B7TA 5TAOA 5KX5E 4FZLA 4YLHA 5LHGB 4KMCA 4LF8T 2WJQA 1H7CA 2E9XD 3RX6A 4FQEA 2ZM2A 5AQNB 4PJLA 4PW8A 2W0GA 1IBMT 2PBIA 3B5MA 1ZHYA 3VY9X 4G75A 4ANJA 2YDQA 3K8PC 4KI0F 2H3RA 1HXTA 3DWNA 4U74A 2XTQA 3IBPA 2Q9QC 4ZXLA 2NW8A 3UQ4A 5CA1E 4G76A 2DWKA 3V5UA 3UUMA 4AUIA 2BS4A 1ZHWA 2E5LT 1AJ3A 4WW0A 1XDPA 1WLXA 4YSYA 2ES0A 5DQWA 5JH7E 4O4JE 2WQYA 1HNZT 2P9BA 2NR4A 4UB8O 2XAFB 4BAYB 3O9XA 4GKJT 4M1PA 4NUVA 4ISTA 4MHCA 1NENA 5HWXA 3KZIO 3F31A 4DBRA 3NKZA 2Y0HA 2EHOB 2NWBA 2PG8A 3ANWA 5J1GA 4CN6A 3MXZA 1GFMA 2JMMA 4JLEA 3F2EA 5PRNA 2A9UA 5FXXA 3UU8A 2BDEA 1YS5A 2ZFGA 3HA4A 2WZIA 3QRAA 5JDFA 3WI3A 4U33A 4H9NC 4MLKA 4LMKA 3P4RA 2OMFA 5L47A 2K0LA 4BUMX 4IDPA 1SA0E 3AA0B 4HWHA 3O4XE 4IDOA 3AAAB 2CBJA 2HPJA 4GCSA 5ABFB 4CI3B 4FT6A 4H9OC 2UU9T 4D65A 3OJAA 5H6QB 3RIUC 4HN9A 3N9OA 5A1LA 4YFSA 1VOMA 5AQMB 2ZLDA 5L2LA 2CRBA 5CGMA 5JDPA 4YSXA 1D1AA 4C4VB 2BBHA 3AEFA 4NIQA 4TNWA 5H2FO 3E0ZA 4COFA 1MIWA 3Q2MA 2BG9B 1VCSA 5M4YA 3VRAA 5G38A 2WVPA 5J0ZA 5GTHO 2R6GF 3C4XA 2DLRA 3KVDD 4PAGA 2DL1A 4AYMC 5AQPB 2LT3A 3I9WA 5BR8T 2BZBA 2VL8A 2UXXB 3PUQA 2LSGA 4I4TE 1ZHTA 2WDVA 4JFBA 2IHR1 4PNIA 4B3RT 1IJ6A 4MBQA 3NZQA 1XMOT 4UELA 3C64A 2K9AA 2XM2A 1MMAA 3FZFB 3L09A 5LYJE 2W67A 4NPPA 2M06A 3ZLIA 3AE9A 2BS2A 2BBJA 3AE4A 3P4SA 5E0OA 3BRYA 4LF5T 2EHOA 2V7KA 4IREA 3UU2A 3ZMTB 2F4VT 2MHLA 1IAPA 2VL0A 3O1JA 4KUMB 2AE9A 4A56A 1OXZA 3PU3A 4AYDC 4TUYE 3FXEB 4X20E 4FZMA 4Z90A 1ZP0A 3N5LA 3L39A 4WZXA 2LSKA 1GQEA 2JRKA 3VZUX 2VWAA 3A7MA 3ESLA 2A72A 1J5WA 3N9PA 4GK0E 4HE8A 3AA0A 3RF1A 2CHOA 2ZM0A 3PURA 3PF1A 2RPAA 4L0RA 1ORMA 3AAAA 3AECA 3PUGA 3Q5EA 4YTNA 5C2TA 2ZLYA 2ERVA 4TZ4C 4BJNA 2FGRA 1R8IA 3VHLA 3SRZA 4I0UA 2GE4A 4EZ4A 1WR0A 3RC3A 1KK7A 3K3QC 3GA8A 3T20A 2BKOA 2YDSA 3EUHA 4C4VA 4XAXB 2HN1A 3SWHA 3CQCB 2WP9A 3VR8A 5H6RB 4ZOLE 2BG9A 3ZPOA 1D0YA 2CLYB 3A5XA 3I9YA 3PE0A 2ACZA 3BQKA 4QHOA 2KLQA 4C91A 2D5UA 2HH7A 2G0UA 2IAKA 3RC8A 4QX8B 1U5PA 3RYCE 3RGLA 4GYRA 1X79A 4KRAA 1BR2A 2X9HA 4B3ST 3ZSTA 2K3WA 4C00A 1W0AA 4JI6T 5LXTE 2Q9QB 3TLUA 3PQUA 4HWCA 5LJNA 4HFBA 4FZNA 4EAHA 4KR4A 3GMIA 2MPKA 3ONJA 3UFGA 2VQFT 3TLWA 3UUBA 4PJNA 3RYHE 4N59A 4U9CA 5D5DA 1MIVA 5GTIO 3ZEFB 3NBXX 2MNHA 3PUVF 1Y64B 3HOEA 2WMOA 4CQIA 4E7ZA 1QJPA 3EVYA 3LFMA 4FRTA 4LSIA 4IHJE 2X9WA 3UU3A 3NJTA 1G90A 1FJGT 3VKGA 2V5DA 1ZHXA 2DI4A 2UXNB 2V8SV 3ETVA 4ZZCA 1HFAA 4JI0T 3VKHA 5EZYE 3OPCA 3PUYF 2W80C 4U3CA 1WFDA 4RLBA 1BXWA 4ILBA 5KMGP 3HKDE 3WAKA 2UXBT 3AB3B 2NTXA 2W61A 4ZI7E 3TZGA 1KNPA 3LJCA 3T8OA 2Y8DA 1Y01A 5L3DB 5DL5A 5AQIB 1KF6A 2PTFA 1KEYA 4E1TA 2CM0A 2YDRA 2XSBA 3M3ZB 5AQGB 1Z0PA 1D1CA 2IIUA 4DR2T 1D1BA 2PFVA 2X67A 1UCUA 5FXWA 4P09A 4K3BA 3PRNA 5HXSA 2R88A 4FESA 4TNVA 5GV0A 2E5VA 2WB5A 2WY2A 3CVRA 1UGOA 1S94A 4JI1T 4B61A 3ZT5A 2LHFA 3AE5A 3HKBE 2CE7A 1Q9FA 3FBLA 4EV6A 5FL1A 2YK0A 5JDMA 4IL6O 2UXCT 3RYFE 1O3XA 4X66T 4GHBA 3HI2A 3NZPA 2RP4A 5KAIO 3Q9DA 4HEAA 3BS0A 4AIUA 5IYZE 3N9LA 3CX6B 4DR1T 4CN1A 4EYUA 3PGUA 5G3AA 2R4OA 3QB5K 1U4QA 2AXTO 2FJBA 2I0MA 3ZC1A 1HNXT 2Q9QA 4FSOA 2WZHA 1BR0A 2CWOA 4TWHA 4EIWA 1WYCA 4DR4T 2N2LA 4OYKA 3VZTX 2NP9A 2AXDS 4DV6T 2VK9A 4DR5T 4DMVA 4Q25A 3TLVA 1P4TA 4ZI3C 3B13A 2IWWA 4O3WA 4HWFA 3HR0A 2LM9A 4ADZA 3A0BO 3ABVA 2KC0A 1XNQT 4JCHA 1N34T 5LG3A 2LEHA 5FNVE 4LF4T 2UUCT 3EMNX 5G39A 1OSMA 3UPGA 2QVAA 3I0OA 1VCTA 5HEGA 3ONLC 2KMFA 3I1AA 3AEBA 1M7KA 5HYAA 3AXJB 4LF6T 5EE2A 2CA5A 1OEDB 2NW7A 3MK7C 3C4ZA 2YN6A 3Q5DA 4UVCB 2PORA 4GYSA 2LHNA 3N2GE 3LG7A 1E7PA 5JTGA 2VKHA 4YHHT 5FY1A 3AE6A 2I59A 4O2AE 5AQVB 4EOZB 4Z8XA 4YTMA 3POUA 4MALA 4BA9A 3RIUA 3RIAA 3ZMUB 2E9XC 2Y0KA 4UVAB 2ODVA 5ETWA 2CBIA 4PK6A 4YJ2E 3RKGA 2MTQA 1HCIA 4LF9T 2D9DA 2KZ7B 1NWMX 3FZLB 3SOLA 4HFEA 1OWAA 3CKDA 4ZZBA 1QJ9A 3PGRA 1YKEB 5EK3A 2JQ9A 5DL7A 1UK5A 4A98A 4I55E 3HL6A 3JTYA 4Z91A 4X5TA 1LVFA 4GIWA 4K0UA 3UULA 4GCQA 2XMXA 4FSPA 1X9BA 1XWMA 4IL4A 3AE2A 3O0EA 4IIJE 2HPLA 5L3GB 5HXCA 3WAJA 1T1LA 1HG5A 5AFUK 2CCQA 2XQ9A 5LGUB 4DIDB 4MFRA 1XZYA 4O4XA 1L0VA 3QUJA 1G73A 2V5CA 2WCAA 4HFIA 3V8UA 5GONE 4N58A 5FVLA 2NW9A 1UUSA 4LFAT 2B76A 2R4NA 3BQLA 3LBXB 2L3LA 5T5FA 2BKNA 3L8RA 2Y48B 3OYXA 3ZN0B 3PJAJ 2YEVC 3DWOX 4HGAA 3AXJA 4G63A 4DR6T 5ABGA 1OEDA 3SZVA 2KSRA 2Z6EA 1S5LO 3AEEA 3AE7A 2XAHB 2JJ9A 1LVKA 5HEHA 4LFBT 4YJ3E 2OLTA 5TISO 3UQ7A 1OPFA 4U2YA 4N75A 3MA9A 2LKGA 3B57A 3EDVA 4X1IE 3SY7A 3E08A 3P50A 4DV2T 4IT4A 4WNKA 2DWGA 4F8HA 1XMQT 2XAGB 4QKNA 1D0XA 4FMSA 1HNWT 2XTRA 3HKEE 3PJAA 5E79O 1ZHZA 1XNRT 4K0KT 1LKXA 5FKYA 2KZ7A 2DCFA 5FY0A 2YKSA 4JEUB 2XE2A 4ILUA 4ZS2A 5LMNT 2XQ4A 2XQ8A 1PHOA 4YTPA 2LJLA 3LK3B 3T1HT 4OHFA 4N74A 4JUYA 3MACA 5EK4A 4QQ1A 2XTLA 1CHUA 3SYSA 4AYNA 4HFVA 2O4VA 2W81C 5FP3A 2FGQX 5BMVE 4X1KE 1HR0T 5J2TE 3UT5E 3JC6D 5FL0A 5C8YE 4GKKT 3SFEA 2KDYA 5HXEA 2H7VC 2L9QA 2CEAA 2WM9A 3AEAA 1IZNB 2KT9A 3JADA 3T1YT 2IC6A 2JMKA 1FIOA 1GFNA 1QUUA 3WU2O 4DV3T 5F8PA 1T72A 4EB6E 2E2AA 3QNUA 4GCPA 3VY8X 7PRNA 5ABFA 4OX9T 2ACXA 4ZHQE 4IDQA 4AQYT 3GN5B 3P7IA 3DJBA 4LMLA 3KV4A 3K3NA 2R4LA 3LBXA 4X1YE 5AFUL 3HW9A 3VE1A 2FJDA 1SE7A 3FZMB 3POXA 3PDYA 2WS3A 3LSVA 4DV0T 2EHOD 2OV9A 2WBLA 2N2MA 3VR9A 5LB7B 3BRZA 3OKQA 2B1EA 2R8AA 2XUEA 4P0AA 3GP6A 1HXXA 3JCUO 3RLFF 5LBMA 2KINB 3AVSA 2QTKA 4J2CA 1MNDA 1MPFA 3U3IA 2LFUA 1CUNA 4IDZA 4ZEYA 5AQLB 4AYEC 2BKPA 1HS7A 1T98A 5L4EA 3OVUA 4UXNB 4A5XA 3A8YC 2IDOB 3KVAA 1BH3A 3UUNA 4B6XA 2V6YB 3LDQB 4XZCA 2WU5A 5DL6A 4TN7B 3O1HA 3KV6A 5HCJA 4RLCA 2E9XB 2LM2A 1HXUA 3L3PA 5CJ5A 1S35A 2WDQA 4X65T 2X51A 3AAIA 1JNRA 2NTYA 2K4TA 3E22E 1QLBA 4O8SA 2J47A 5FVKA 1THQA 2M6BA 4OFZA 2VKJA 4F6RC 4V1Av 3C50A 4YT0A 3QOFA 4YY3T 4I43B 1MM5A 3SYBA 5LBQB 4JI2T 3PUZF 2KNDA 4UF0B 4PFPA 3N9MA 2CPTA 3SS1A 3DA3A 4ASKA 4CI1B 5F3JA 2JPFA 3SY9A 3RYIE 3T24A 1N36T 3C51A 2XY8B 4P0BA 4ZI2D 4JI5T 1BT9A 2XHEB 1IZNA 2N2NA 2XE1A 4EGWA 5DL8A 4QH1A 4O4UA 3OYZA 3POQA 4XBFB 4AKMA 2JMHA 3UAQA 4HWIB 5AQUB 4O49A 4LF7T 3VE2A 4DV7T 5CFBA 3GN5A 2XG6A 2YINA 3FB2A 1MMGA 5AQOB 4JI7T 1W09A 4CXYA 2DHRA 1PRNA 3PTRB 4AKIA 1GFPA 1T7SA 4U7YA 3R6NA 4PR7A 3FYXA 2BVMA 4EYYR 3P4QA 5EK2A 2VKOA 3K3OA 5JRCB 2IC9A 4UB6O 3QB5A 4HFCA 2Y2XA 4TX5A 2VASA 3U78A 4GK5E 4WYVA 3RIFA 3IHRA 3CQXC 1E54A 2YOEA 4GOUA 3RH3A 3PU8A 3Q5XA 5JDLA 5L4HA 3ZMZB 2LSIA 4YXDA 2XQ6A 4O3XB 5DABA 4D5UA 2W2UA 4E7SA 3DZMA 5IYUA 4E1SA 2LKHA 3ZMSB 4IE7A 4LSFA 8PRNA 4JV5T 2XPKA 2ZM8A 3KV5A 4KR8A 4O3YA 2V6YA 2K48A 2D0UA 4AI6A 3RRWA 2XZEA 4PK4A 4YSZA 3C4WA 2E9XA 2N9DA 4PJJA 2NOXA 2D2SA 5HXRA 3RKOA 4JYAT 3JCFA 5LJMA 1JNZA 3RBHA 4ZS3A 4AFKA 1VRBA 1D0ZA 3CX8B 2BVLA 5AQKB 3X1DA 3KFWX 4QH4A 4UF0A 1HX1B 2FBWA 2H89A 3TLTA 1KNRA 2R89A 3H37A 3IA3A 4UV8B 5G26A 2XQ3A 4JI4T 2LLYA 3RI5A 1W0BA 2JQHA 4PJ0O 3KINB 4ERRA 3R84B 3CK6A 4O3ZA 2BS3A
chains in the Genus database with same CATH topology
1GFOA 4AKRB 3DP7A 2DNXA 4TV9E 3AA0A 2L3LA 5T5FA 3RRCA 2MOZA 2ZM0A 3PURA 5JREA 2JQQA 2VKDA 4HTEA 2Y48B 4L0RA 1ORMA 3AAAA 2Q9QD 3PUGA 3OYXA 2ZLYA 2KXPB 1HF8A 4G2AA 3ZN0B 2YEVC 4H9RC 2ERVA 4GF4A 4TZ4C 4BJNA 2C0SA 2FGRA 2LSJA 3AA1B 4HGAA 3WI4A 4L9IA 4G63A 5LG4A 3CQGB 3SRZA 3VHLA 2GE4A 4EZ4A 1LRZA 4ZI2C 3RC3A 1KK7A 2X66A 3K3QC 3SZVA 3CPZA 2Z6EA 3AAEB 1FMVA 3GA8A 1EZ3A 3O1IA 3PUSA 4AZLA 3T20A 3NSGA 4LSEA 3EUHA 2XQYA 3KDSE 3ZJ1A 4XAXB 3S4UA 1IJ5A 2CXLA 2XAHB 4AQFC 2LE8A 1FMWA 2JJ9A 1LVKA 3CQCB 3SWHA 1ZKEA 3LK2B 4KBMB 3ZYLA 5H6RB 4ZOLE 4YJ3E 2WWUA 2W00A 4UEMA 4JEHB 3ZPOA 3ZYMA 1D0YA 1OPFA 5FYMA 4FOZA 2CLYB 1KNZA 2J4UP 3NRYA 3ZN1B 3A5XA 3I9YA 3VU7H 5LNKA 5LGTB 3MA9A 3PE0A 3B57A 2XE3A 3BQKA 3EDVA 1HG2A 4F4BA 4X1IE 3SY7A 3F57A 4QHOA 5JRCA 3E08A 3GWHA 2KLQA 4IE0A 2D5UA 2HH7A 2G0UA 2IAKA 4C91A 3ZYKA 4HKAA 5FXZA 3RC8A 5LOVE 5JQGE 4QX8B 1U5PA 4WNKA 2DWGA 3MJXA 3H3AA 3UUXB 3RYCE 3N2KE 5LGNB 4GYRA 2XAGB 2LHRA 1X79A 4KRAA 4CXWA 4QKNA 5JR9C 1BR2A 1D0XA 2X9HA 4FMSA 2F1TA 3BK9A 4PK5A 5CA0E 5ADXL 2YU1A 2XTRA 5LXTE 2Q9QB 3PQUA 3HKEE 4ZI3D 3ZMVB 5LJNA 2XE5A 4O4HE 4C69X 4AQFA 3CWZB 1ZHZA 4FZNA 1LKXA 2KZ7A 3DA4A 2DCFA 3D0TA 3ANWB 3KBTA 5FY0A 2KWIB 4EAHA 4JEUB 2XE2A 4XNLA 2YPVA 4IE6A 2RA1A 4WBNE 4ILUA 3GMIA 4KR4A 4ZS2A 1QJ8A 3K19A 3KVBA 4FJOA 1PHOA 4PJNA 2LJLA 3FHNA 3LK3B 1ZV4X 4OHFA 3RYHE 4DVDA 2Y0LA 3UTKA 1YKHB 1UX5A 4JUYA 4IE4A 3MACA 5EK4A 2ODUA 4N59A 2XTLA 4QQ1A 4U9CA 3SYSA 5D5DA 4AYNA 1MIVA 4AYID 2C5IT 3IEEA 5DQVA 3ZCIA 3ZEFB 3EDUA 4HFVA 4OYJA 2O4VA 4QXCB 2WMNA 1ZEEA 2W81C 3NBXX 2IW5B 5FP3A 2ODJA 2FGQX 5BMVE 4C90A 5LCYA 5L3BB 4X1KE 2A3DA 2MNHA 2MBGA 1Y64B 5J2TE 2WMOA 3JC6D 3UT5E 3HOEA 4O4LE 5JR9A 4CQIA 5C8YE 3QK6A 3MZKB 4E7ZA 3PORA 1QJPA 3EVYA 5HXHA 2KDYA 2V7IA 4RL9A 5HXEA 3LFMA 2H7VC 2L9QA 4FRTA 2CEAA 4LSIA 1US7B 4IHJE 2WM9A 4RJWA 2X9WA 1WRDA 3FBZA 3IF8B 1G90A 2X9YA 3VKGA 1IZNB 1ZHXA 4QXBB 4LSHA 2KT9A 3UFEA 3VZWX 2IC6A 2JMKA 2M67A 2YU2A 4QX7B 2DI4A 5FY7A 1FIOA 1QSDA 1GFNA 2V26A 2UXNB 2D0TA 1QUUA 4H63V 3ETVA 5LHIB 1HFAA 5HAXA 2GK9A 3VKHA 4QXHB 5EZYE 4Z3TA 4YHJA 5F8PA 3KV9A 3J9X1 2J1DG 2W80C 4EB6E 1HX8A 4PUXA 4GCPA 4RLBA 4XNKA 1SHZC 1BXWA 5KMGP 3VY8X 7PRNA 3HOLA 2ACXA 2K5BB 2OA5A 1Q9GA 1UX4A 4ZHQE 3HKDE 4EZHA 3AA7A 3GN5B 3SZDA 3WAKA 4IE5A 3N2OA 3P7IA 3DJBA 2CXDA 4I50E 1BR4A 3AB3B 4O2BE 1MMNA 5L3CB 3KV4A 2CLYC 2NTXA 2QA7A 3K3NA 3ZCJA 1H6S1 2W61A 3QRCA 1B7TA 5TAOA 4ZI7E 5KX5E 3LBXA 4X1YE 3TZGA 5AFUL 4AKRA 1MMDA 3HW9A 4FZLA 4YLHA 5LHGB 3LJCA 2KWHA 3AA6B 3VE1A 4KMCA 3T8OA 2Y8DA 3N9NA 2K24A 5L3DB 4AQGA 5DL5A 1H7CA 2E9XD 3RX6A 3POXA 4FRXA 3PDYA 4AKHA 2ZM2A 4E1TA 4QWNB 1E1HB 5IHYA 2KXPA 2CM0A 4PJLA 2EHOD 4PW8A 4CI2B 2W0GA 2WBLA 2N2MA 2X68A 3AA1A 3RPUA 5FXVA 4N78D 2PBIA 1Z0PA 1D1CA 3OKQA 1ZHYA 3VY9X 4G75A 4ANJA 1D1BA 2PFVA 2X67A 4H9SE 3K8PC 1UCUA 5FXWA 4P09A 2B1EA 2H3RA 1HXTA 3PRNA 4U74A 5HXSA 3AAEA 4FESA 2XTQA 4PJMA 5GV0A 2XUEA 3IBPA 2Q9QC 4P0AA 3GP6A 2NW8A 5CA1E 4G76A 1HXXA 3CVRA 2L8KA 1S94A 4B61A 3PQSA 2DWKA 4CZZB 3V5UA 5LBMA 3UUMA 2LHFA 4AUIA 3LK2A 3HKBE 5LA6E 2CE7A 1ZHWA 2KINB 2W63A 3AVSA 1AJ3A 1Q9FA 3FBLA 4WW0A 2W62A 2QTKA 4J2CA 1V9DA 3QC9A 1MNDA 4AKGA 1MPFA 4DBQA 3U3IA 2YK0A 3NRXA 5JDMA 1MNEA 1WLXA 4UV9B 2LFUA 3LK42 3RYFE 1O3XA 2ES0A 1CUNA 5DQWA 5JH7E 3CMLA 4IDZA 4O4JE 4GHBA 3HI2A 3NZPA 4AYEC 2RP4A 4CXXA 1HS7A 3Q9DA 1T98A 4HEAA 2P9BA 4UXNB 4H9QC 5IYZE 3N9LA 3CX6B 3KVAA 1BH3A 3UUNA 4B6XA 2XAFB 4BAYB 4EYUA 3O9XA 5FVNA 4XZCA 1BR1A 2N1GA 1U4QA 4ISTA 4M1PA 4NUVA 5DL6A 4TN7B 2QGSA 3O1HA 2M07A 3KV6A 4MHCA 4RLCA 1HTJF 2E9XB 3ZC1A 4FSOA 2Q9QA 4H63H 1HXUA 5HWXA 3L3PA 1BR0A 2CWOA 3F31A 3PUAA 4EIWA 4DBRA 4D64A 1S35A 2Y0HA 1WYCA 2EHOB 2NWBA 2PG8A 2C5JA 2X51A 3ANWA 3AAIA 4OK0A 2N2LA 4OYKA 5J1GA 1G8XA 2NTYA 2NP9A 2K4TA 3VZTX 3ZJ2A 3E22E 3HWBA 2VK9A 4NUUA 4O8SA 5LHHB 3MXZA 1THQA 1YW0A 2CWYA 4DMVA 1GFMA 4OFZA 2VKJA 4JLEA 3F2EA 4F6RC 4V1Av 2JMMA 3C50A 1P4TA 5PRNA 4ZI3C 3B13A 4I43B 2CXFA 3N9QA 4O3WA 1MM5A 5FXXA 3HR0A 3SYBA 2BDEA 1YS5A 1FEWA 5LBQB 2ZFGA 2LM9A 4UF0B 2KNDA 4PFPA 4ADZA 3HA4A 3N9MA 4H9PC 3Q5WA 3SS1A 3QRAA 3DA3A 4DO0A 4ASKA 5JDFA 4CI1B 3WI3A 4AXPA 5F3JA 2JPFA 2KC0A 2E8IA 3WI5A 5KDMC 4JCHA 4H9NC 4PFOA 3SY9A 4MLKA 3RYIE 3T24A 2LEHA 4DMWA 2OMFA 3C51A 5FNVE 2K0LA 3EMNX 4BUMX 1SA0E 4P0BA 4KP3C 3AA0B 4ZI2D 1OSMA 2V7JA 3ETUA 3UPGA 3O4XE 2XHEB 1BT9A 3I0OA 5FMNA 2N2NA 1IZNA 3AAAB 2XE1A 2HPJA 2KMFA 3I1AA 4GCSA 5DL8A 3JC6C 4CI3B 4FT6A 4H9OC 4O4UA 3OYZA 3POQA 5J2UE 4D65A 4XBFB 4AKMA 3OJAA 4O4IE 5H6QB 4HN9A 2JMHA 3N9OA 5HYAA 3UAQA 5A1LA 5EE2A 4YFSA 2CA5A 1VOMA 4O49A 3VE2A 2NW7A 2VB6A 3MK7C 2ZLDA 3C4ZA 2J1NA 5L2LA 4UVCB 2PORA 5JDPA 1D1AA 1YD8G 3GN5A 2XG6A 2X0LB 3HKCE 2YINA 4GYSA 2LHNA 3FB2A 3LK41 3N2GE 3TKLB 1MMGA 3LG7A 3E0ZA 4CXYA 2DHRA 1MIWA 3PTRB 3Q2MA 1PRNA 3AVRA 3AA6A 4AKIA 2VKHA 5ADXK 5M4YA 5FY1A 5CB4E 5JVDE 1GFPA 2WSSV 2YNKA 3R6NA 2I59A 4O2AE 4EOZB 1ZHCA 4AKLA 3FYXA 4BJMA 4Z8XA 2BVMA 4EYYR 5EK2A 4UIGA 2VKOA 3K3OA 5JRCB 2IC9A 2C5KT 3C4XA 1GFQA 2DLRA 2MYSA 3KVDD 4MALA 3POUA 4BA9A 4PAGA 4TX5A 2Y2XA 4AYMC 3C98B 2VASA 3U78A 4GK5E 5JDGA 2LT3A 3I9WA 2BZBA 3ZMUB 2E9XC 2Y0KA 2A2FX 3IHRA 3C5OA 4UVAB 2VL8A 3CQXC 2UXXB 2ODVA 3PUQA 1E54A 2XASB 4GOUA 2LSGA 3RH3A 4I4TE 2EHOC 3PU8A 3Q5XA 5ETWA 5JDLA 1ZHTA 4PK6A 4JFBA 2XAJB 3ZMZB 4YJ2E 2LSIA 2MTQA 2CMRA 2WAUA 3M65A 4PNIA 1HCIA 4WBOA 3G7GA 1IJ6A 4MBQA 2SPCA 3NZQA 4IGUA 5JDQA 2KZ7B 1NWMX 4UELA 4O3XB 3SOLA 5DABA 4D5UA 1OWAA 3CKDA 3C64A 2K9AA 1QJ9A 4E7SA 1YKEB 1WYBA 5EK3A 5IYUA 4E1SA 5DL7A 3ZMSB 4IE7A 4LSFA 8PRNA 4FUVA 3ONXA 2V1DB 2Y6XA 1MMAA 3L09A 5LYJE 2ZM8A 3KV5A 4KR8A 4I55E 3MKDA 2M06A 4O3YA 3HL6A 2V7LA 3JTYA 3ZLIA 2K48A 2D0UA 2LOSA 4AI6A 4RJXA 2V7MA 1LVFA 4GIWA 3RRWA 3I0QA 4PK4A 4K0UA 2XAQB 3UULA 3C4WA 3V5SA 4GCQA 5E0OA 3OBVE 2XMXA 3LK3A 2E9XA 2N9DA 4FSPA 4PJJA 2NOXA 2D2SA 5HXRA 5JR9B 4L5GA 3O0EA 5L3FB 3RKOA 2EHOA 2V7KA 1MM4A 5LJMA 5DJQC 3UU2A 4IIJE 3ZMTB 3W15B 2MHLA 3RBHA 2HPLA 4ZS3A 1MIYA 5HXCA 5L3GB 4AFKA 2F1VA 1IAPA 3WAJA 1VRBA 1D0ZA 2X27X 1HG5A 3O1JA 4KUMB 4TV8E 3CX8B 4A56A 3T0SA 2LOPA 2BVLA 1OXZA 5AFUK 3P8CD 3PU3A 4AYDC 5JDNA 3ZC0A 2CCQA 3KBUA 2H7OA 4EXTA 5LGUB 3DTOA 3FXEB 4TUYE 4X20E 2Y7SA 4MFRA 4DNDA 2PJQA 2PRNA 3KFWX 4FZMA 2ZMAA 4O4XA 1NAFA 4ISSA 3QUJA 4UF0A 1G73A 2LSYA 3FXDB 5HWYA 5L3EB 3N5LA 4UVBB 2LSKA 1WR6A 3V8UA 3H37A 5JDHA 5GONE 4N58A 2JRKA 3VZUX 2VWAA 3CX7B 4UV8B 4U72A 3A2SX 5G26A 3ESLA 2A72A 2NW9A 3AA7B 5LP6E 3KINB 3BQIA 4ERRA 3N9PA 3R84B 6PRNA 2X9XA 3J7Yq 4O3ZA 4GK0E 3BQLA 4FI5A 4HE8A 3LBXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AKR B;  3AA0 A;  3LK2 A;  2KZ7 B;  2KXP A;  3AAA A;  3LK3 A;  3AA0 B;  3LK2 B;  3AA1 A;  3LK3 B;  1IZN A;  2KXP B;  3AAA B;  3LK4 1;  3AA7 A;  3AA1 B;  3LK4 2;  1IZN B;  5ADX L;  3AA6 A;  5ADX K;  3AAE A;  3AA7 B;  4AKR A;  5AFU L;  3AA6 B;  5AFU K;  3AAE B;  2KZ7 A; 
#chains in the Genus database with same CATH topology
 4AKR B;  2DNX A;  2XQ7 A;  5AQQ B;  2VQE T;  4HTE A;  4U7I A;  2Q9Q D;  3FZH B;  2KXP B;  1HF8 A;  4G2A A;  5HCM A;  3AE1 A;  2C0S A;  3AA1 B;  3WI4 A;  5LG4 A;  3UU5 A;  2FUP A;  2X66 A;  4X62 T;  3FZK B;  3CPZ A;  3AAE B;  3PUS A;  4X64 T;  4AZL A;  1EZ3 A;  1YXR A;  4LSE A;  3ZJ1 A;  3KDS E;  1WCR A;  1IJ5 A;  3S4U A;  2CXL A;  4AQF C;  2LE8 A;  4KHZ F;  1ZKE A;  3LK2 B;  4CTD A;  2WWU A;  1N33 T;  4JEH B;  3ZYM A;  5FYM A;  4FOZ A;  2J4U P;  3NRY A;  3ZN1 B;  1E2A A;  3VU7 H;  1W9R A;  4HWD A;  1ZOY A;  4F4B A;  3F57 A;  5JRC A;  3GWH A;  4IE0 A;  5FXZ A;  3PV0 F;  3JAF A;  3MJX A;  4K3C A;  3N2K E;  4CXW A;  5JR9 C;  5B5E O;  2F1T A;  3BK9 A;  4PK5 A;  2YU1 A;  2FJE A;  1YQ3 A;  3AE8 A;  4C69 X;  3CWZ B;  3D0T A;  4DR3 T;  2KWI B;  4XNL A;  4IE6 A;  4WBN E;  1QJ8 A;  3K19 A;  3KVB A;  2CHN A;  4B3T T;  3FHN A;  1ZV4 X;  4DVD A;  3UTK A;  1YKH B;  1UX5 A;  2R4P A;  2LRL A;  5IUX A;  2JQK A;  2C5I T;  5DQV A;  3EDU A;  4OYJ A;  2WMN A;  2IW5 B;  4C90 A;  2A3D A;  2MBG A;  1T16 A;  3QK6 A;  3POR A;  4RL9 A;  2VVS A;  4RJW A;  1WRD A;  3FBZ A;  3IF8 B;  2X9Y A;  4QXB B;  4LSH A;  3UFE A;  2M67 A;  2YU2 A;  5FY7 A;  4QX7 B;  2QYW A;  5KXJ A;  5LHI B;  2GK9 A;  3EAB A;  2XQ5 A;  3RQU A;  3KV9 A;  3J9X 1;  2J1D G;  1HX8 A;  4PUX A;  4XNK A;  1SHZ C;  3HOL A;  2OA5 A;  4EZH A;  3SZD A;  3N2O A;  3H3M A;  4IDN A;  4I50 E;  4O2B E;  3ZCJ A;  2QA7 A;  1H6S 1;  4D64 A;  2X9K A;  4AKR A;  1MMD A;  2KWH A;  3AA6 B;  3N9N A;  2K24 A;  4AQG A;  4FRX A;  4AKH A;  4QWN B;  1E1H B;  5IHY A;  2KXP A;  5HEJ A;  4CI2 B;  3AA1 A;  2X68 A;  3RPU A;  5FXV A;  4N78 D;  1Z8U A;  2X0H A;  5ABE A;  1YQ4 A;  2W4X A;  4H9S E;  2XJ7 A;  3AAE A;  4PJM A;  5ABH A;  2W66 A;  2L8K A;  3PQS A;  4CZZ B;  3LK2 A;  5LA6 E;  2W63 A;  2W62 A;  1V9D A;  3QC9 A;  4DUZ T;  4AKG A;  1N32 T;  4DBQ A;  3NRX A;  1MNE A;  4UV9 B;  3LK4 2;  3NVO A;  3CML A;  2J62 A;  5LMU T;  4CXX A;  3ZT7 A;  2F1C X;  4H9Q C;  3EHZ A;  2UUA T;  2WWV A;  4TWD A;  3UU6 A;  5FVN A;  1BR1 A;  2N1G A;  3TLS A;  2QGS A;  2M07 A;  1HTJ F;  4H63 H;  3VRB A;  1T8B A;  3PUA A;  3AE3 A;  1UUR A;  2C5J A;  4OK0 A;  2MAW A;  1G8X A;  3ZJ2 A;  4JI8 T;  3HWB A;  4NUU A;  5LHH B;  1YW0 A;  2CWY A;  2LRK A;  4TWF A;  2IML A;  2CXF A;  3ZT6 A;  3N9Q A;  4UR9 A;  1J1J A;  1FEW A;  1OED E;  4H9P C;  3Q5W A;  4DO0 A;  4ILA A;  4AXP A;  3WI5 A;  2UUB T;  2E8I A;  5KDM C;  4PFO A;  1OED C;  4DMW A;  4KHP T;  3JAE A;  1M62 A;  4KP3 C;  2V7J A;  3ETU A;  5KAF O;  5FMN A;  4A97 A;  4B3M T;  3JC6 C;  3PGS A;  3AEG A;  5J2U E;  4O4I E;  3SFD A;  2VB6 A;  2J1N A;  2UXD T;  4DR7 T;  4U31 A;  4P1N A;  1YD8 G;  2X0L B;  3HKC E;  2J4G A;  3LK4 1;  3TKL B;  3AVR A;  3AA6 A;  5ADX K;  5CB4 E;  5HEU A;  5JVD E;  2WSS V;  2YNK A;  1ZHC A;  4AKL A;  4BJM A;  3ZSS A;  2XQA A;  3EI0 A;  4UIG A;  3UU4 A;  2C5K T;  1GFQ A;  2MYS A;  2VUR A;  3C98 B;  5JDG A;  3OTO T;  1I94 T;  2A2F X;  3C5O A;  2XAS B;  3PUW F;  2EHO C;  4AIS A;  2XAJ B;  2CMR A;  2WAU A;  3M65 A;  4WBO A;  3G7G A;  2SPC A;  4IGU A;  1KFY A;  5JDQ A;  4HFH A;  4EED A;  3A0H O;  1WYB A;  4FUV A;  2WDR A;  3ONX A;  2V1D B;  2Y6X A;  1XDO A;  4U2Z A;  3K1S A;  3MKD A;  2V6X A;  2V7L A;  2LOS A;  3CIR A;  4RJX A;  2V7M A;  3I0Q A;  4JBW F;  2XAQ B;  3V5S A;  3OBV E;  3LK3 A;  3AED A;  4HFD A;  3PUX F;  3RQW A;  4L5G A;  5JR9 B;  5L3F B;  4JI3 T;  4QH5 A;  1MM4 A;  3P4W A;  5DJQ C;  3W15 B;  4NXN T;  1MIY A;  2F1V A;  2X27 X;  4TV8 E;  3T0S A;  2LOP A;  3P8C D;  4IL9 A;  5JDN A;  3ZC0 A;  3KBU A;  2H7O A;  4EXT A;  1IBK T;  3DTO A;  2Y7S A;  4DND A;  2PJQ A;  2PRN A;  2ZMA A;  4DV4 T;  1NAF A;  2HHH T;  4ISS A;  2BG9 E;  2LSY A;  3FXD B;  5HWY A;  5L3E B;  4UVB B;  2XSA A;  1WR6 A;  5JDH A;  3CX7 B;  3A2S X;  4U72 A;  2QRX A;  4DV5 T;  5AQS B;  3AA7 B;  5LP6 E;  3ZKR A;  2BG9 C;  3BQI A;  6PRN A;  2IWV A;  2X9X A;  3J7Y q;  4FI5 A;  1GFO A;  3G06 A;  3DP7 A;  4TV9 E;  5F5W A;  3RRC A;  5IWA T;  2MOZ A;  5JRE A;  4LMJ A;  2JQQ A;  2VKD A;  1NEK A;  3P4P A;  3RHW A;  1DU2 A;  4H9R C;  4GF4 A;  2LSJ A;  4L9I A;  5AQR B;  3CQG B;  1LRZ A;  4ZI2 C;  2FJA A;  2VVN A;  5B66 O;  1FMV A;  3O1I A;  3NSG A;  2XQY A;  1FMW A;  4KBM B;  3ZYL A;  5C3J A;  4ILC A;  2XM1 A;  2H88 A;  5AQH B;  2W00 A;  4UEM A;  5HEO A;  4DUY T;  1KNZ A;  4EEB A;  4LFC T;  5LNK A;  5LGT B;  2XE3 A;  1HG2 A;  1IBL T;  2JQY A;  2M6I A;  4NXM T;  3ZYK A;  4HKA A;  5LOV E;  5JQG E;  3H3A A;  3UUX B;  5LGN B;  2LHR A;  5CA0 E;  5ADX L;  3NWI A;  4ZI3 D;  3ZMV B;  2X0Y A;  2HN2 A;  2XE5 A;  4O4H E;  4AQF A;  2JIW A;  3DA4 A;  3ANW B;  3KBT A;  2YPV A;  2RA1 A;  4FJO A;  1J5E T;  5AQF B;  2Y0L A;  2WU2 A;  4IE4 A;  2ODU A;  1I6Z A;  4AYI D;  3IEE A;  3ZCI A;  4QXC B;  1ZEE A;  3EAM A;  2ODJ A;  5LCY A;  5L3B B;  4O4L E;  5JR9 A;  3MZK B;  5AQT B;  5HXH A;  2V7I A;  4CN4 A;  2IUB A;  1US7 B;  3VZW X;  2WJR A;  1SUM B;  1QSD A;  2V26 A;  2D0T A;  2ZM6 T;  4H63 V;  5HAX A;  4QXH B;  4Z3T A;  4YHJ A;  4DV1 T;  4KX6 A;  2K5B B;  1Q9G A;  1UX4 A;  5AQJ B;  3AA7 A;  4IE5 A;  2CXD A;  1BR4 A;  1MMN A;  5L3C B;  2CLY C;  2I6H A;  3QRC A;  1B7T A;  5TAO A;  5KX5 E;  4FZL A;  4YLH A;  5LHG B;  4KMC A;  4LF8 T;  2WJQ A;  1H7C A;  2E9X D;  3RX6 A;  4FQE A;  2ZM2 A;  5AQN B;  4PJL A;  4PW8 A;  2W0G A;  1IBM T;  2PBI A;  3B5M A;  1ZHY A;  3VY9 X;  4G75 A;  4ANJ A;  2YDQ A;  3K8P C;  4KI0 F;  2H3R A;  1HXT A;  3DWN A;  4U74 A;  2XTQ A;  3IBP A;  2Q9Q C;  4ZXL A;  2NW8 A;  3UQ4 A;  5CA1 E;  4G76 A;  2DWK A;  3V5U A;  3UUM A;  4AUI A;  2BS4 A;  1ZHW A;  2E5L T;  1AJ3 A;  4WW0 A;  1XDP A;  1WLX A;  4YSY A;  2ES0 A;  5DQW A;  5JH7 E;  4O4J E;  2WQY A;  1HNZ T;  2P9B A;  2NR4 A;  4UB8 O;  2XAF B;  4BAY B;  3O9X A;  4GKJ T;  4M1P A;  4NUV A;  4IST A;  4MHC A;  1NEN A;  5HWX A;  3KZI O;  3F31 A;  4DBR A;  3NKZ A;  2Y0H A;  2EHO B;  2NWB A;  2PG8 A;  3ANW A;  5J1G A;  4CN6 A;  3MXZ A;  1GFM A;  2JMM A;  4JLE A;  3F2E A;  5PRN A;  2A9U A;  5FXX A;  3UU8 A;  2BDE A;  1YS5 A;  2ZFG A;  3HA4 A;  2WZI A;  3QRA A;  5JDF A;  3WI3 A;  4U33 A;  4H9N C;  4MLK A;  4LMK A;  3P4R A;  2OMF A;  5L47 A;  2K0L A;  4BUM X;  4IDP A;  1SA0 E;  3AA0 B;  4HWH A;  3O4X E;  4IDO A;  3AAA B;  2CBJ A;  2HPJ A;  4GCS A;  5ABF B;  4CI3 B;  4FT6 A;  4H9O C;  2UU9 T;  4D65 A;  3OJA A;  5H6Q B;  3RIU C;  4HN9 A;  3N9O A;  5A1L A;  4YFS A;  1VOM A;  5AQM B;  2ZLD A;  5L2L A;  2CRB A;  5CGM A;  5JDP A;  4YSX A;  1D1A A;  4C4V B;  2BBH A;  3AEF A;  4NIQ A;  4TNW A;  5H2F O;  3E0Z A;  4COF A;  1MIW A;  3Q2M A;  2BG9 B;  1VCS A;  5M4Y A;  3VRA A;  5G38 A;  2WVP A;  5J0Z A;  5GTH O;  2R6G F;  3C4X A;  2DLR A;  3KVD D;  4PAG A;  2DL1 A;  4AYM C;  5AQP B;  2LT3 A;  3I9W A;  5BR8 T;  2BZB A;  2VL8 A;  2UXX B;  3PUQ A;  2LSG A;  4I4T E;  1ZHT A;  2WDV A;  4JFB A;  2IHR 1;  4PNI A;  4B3R T;  1IJ6 A;  4MBQ A;  3NZQ A;  1XMO T;  4UEL A;  3C64 A;  2K9A A;  2XM2 A;  1MMA A;  3FZF B;  3L09 A;  5LYJ E;  2W67 A;  4NPP A;  2M06 A;  3ZLI A;  3AE9 A;  2BS2 A;  2BBJ A;  3AE4 A;  3P4S A;  5E0O A;  3BRY A;  4LF5 T;  2EHO A;  2V7K A;  4IRE A;  3UU2 A;  3ZMT B;  2F4V T;  2MHL A;  1IAP A;  2VL0 A;  3O1J A;  4KUM B;  2AE9 A;  4A56 A;  1OXZ A;  3PU3 A;  4AYD C;  4TUY E;  3FXE B;  4X20 E;  4FZM A;  4Z90 A;  1ZP0 A;  3N5L A;  3L39 A;  4WZX A;  2LSK A;  1GQE A;  2JRK A;  3VZU X;  2VWA A;  3A7M A;  3ESL A;  2A72 A;  1J5W A;  3N9P A;  4GK0 E;  4HE8 A;  3AA0 A;  3RF1 A;  2CHO A;  2ZM0 A;  3PUR A;  3PF1 A;  2RPA A;  4L0R A;  1ORM A;  3AAA A;  3AEC A;  3PUG A;  3Q5E A;  4YTN A;  5C2T A;  2ZLY A;  2ERV A;  4TZ4 C;  4BJN A;  2FGR A;  1R8I A;  3VHL A;  3SRZ A;  4I0U A;  2GE4 A;  4EZ4 A;  1WR0 A;  3RC3 A;  1KK7 A;  3K3Q C;  3GA8 A;  3T20 A;  2BKO A;  2YDS A;  3EUH A;  4C4V A;  4XAX B;  2HN1 A;  3SWH A;  3CQC B;  2WP9 A;  3VR8 A;  5H6R B;  4ZOL E;  2BG9 A;  3ZPO A;  1D0Y A;  2CLY B;  3A5X A;  3I9Y A;  3PE0 A;  2ACZ A;  3BQK A;  4QHO A;  2KLQ A;  4C91 A;  2D5U A;  2HH7 A;  2G0U A;  2IAK A;  3RC8 A;  4QX8 B;  1U5P A;  3RYC E;  3RGL A;  4GYR A;  1X79 A;  4KRA A;  1BR2 A;  2X9H A;  4B3S T;  3ZST A;  2K3W A;  4C00 A;  1W0A A;  4JI6 T;  5LXT E;  2Q9Q B;  3TLU A;  3PQU A;  4HWC A;  5LJN A;  4HFB A;  4FZN A;  4EAH A;  4KR4 A;  3GMI A;  2MPK A;  3ONJ A;  3UFG A;  2VQF T;  3TLW A;  3UUB A;  4PJN A;  3RYH E;  4N59 A;  4U9C A;  5D5D A;  1MIV A;  5GTI O;  3ZEF B;  3NBX X;  2MNH A;  3PUV F;  1Y64 B;  3HOE A;  2WMO A;  4CQI A;  4E7Z A;  1QJP A;  3EVY A;  3LFM A;  4FRT A;  4LSI A;  4IHJ E;  2X9W A;  3UU3 A;  3NJT A;  1G90 A;  1FJG T;  3VKG A;  2V5D A;  1ZHX A;  2DI4 A;  2UXN B;  2V8S V;  3ETV A;  4ZZC A;  1HFA A;  4JI0 T;  3VKH A;  5EZY E;  3OPC A;  3PUY F;  2W80 C;  4U3C A;  1WFD A;  4RLB A;  1BXW A;  4ILB A;  5KMG P;  3HKD E;  3WAK A;  2UXB T;  3AB3 B;  2NTX A;  2W61 A;  4ZI7 E;  3TZG A;  1KNP A;  3LJC A;  3T8O A;  2Y8D A;  1Y01 A;  5L3D B;  5DL5 A;  5AQI B;  1KF6 A;  2PTF A;  1KEY A;  4E1T A;  2CM0 A;  2YDR A;  2XSB A;  3M3Z B;  5AQG B;  1Z0P A;  1D1C A;  2IIU A;  4DR2 T;  1D1B A;  2PFV A;  2X67 A;  1UCU A;  5FXW A;  4P09 A;  4K3B A;  3PRN A;  5HXS A;  2R88 A;  4FES A;  4TNV A;  5GV0 A;  2E5V A;  2WB5 A;  2WY2 A;  3CVR A;  1UGO A;  1S94 A;  4JI1 T;  4B61 A;  3ZT5 A;  2LHF A;  3AE5 A;  3HKB E;  2CE7 A;  1Q9F A;  3FBL A;  4EV6 A;  5FL1 A;  2YK0 A;  5JDM A;  4IL6 O;  2UXC T;  3RYF E;  1O3X A;  4X66 T;  4GHB A;  3HI2 A;  3NZP A;  2RP4 A;  5KAI O;  3Q9D A;  4HEA A;  3BS0 A;  4AIU A;  5IYZ E;  3N9L A;  3CX6 B;  4DR1 T;  4CN1 A;  4EYU A;  3PGU A;  5G3A A;  2R4O A;  3QB5 K;  1U4Q A;  2AXT O;  2FJB A;  2I0M A;  3ZC1 A;  1HNX T;  2Q9Q A;  4FSO A;  2WZH A;  1BR0 A;  2CWO A;  4TWH A;  4EIW A;  1WYC A;  4DR4 T;  2N2L A;  4OYK A;  3VZT X;  2NP9 A;  2AXD S;  4DV6 T;  2VK9 A;  4DR5 T;  4DMV A;  4Q25 A;  3TLV A;  1P4T A;  4ZI3 C;  3B13 A;  2IWW A;  4O3W A;  4HWF A;  3HR0 A;  2LM9 A;  4ADZ A;  3A0B O;  3ABV A;  2KC0 A;  1XNQ T;  4JCH A;  1N34 T;  5LG3 A;  2LEH A;  5FNV E;  4LF4 T;  2UUC T;  3EMN X;  5G39 A;  1OSM A;  3UPG A;  2QVA A;  3I0O A;  1VCT A;  5HEG A;  3ONL C;  2KMF A;  3I1A A;  3AEB A;  1M7K A;  5HYA A;  3AXJ B;  4LF6 T;  5EE2 A;  2CA5 A;  1OED B;  2NW7 A;  3MK7 C;  3C4Z A;  2YN6 A;  3Q5D A;  4UVC B;  2POR A;  4GYS A;  2LHN A;  3N2G E;  3LG7 A;  1E7P A;  5JTG A;  2VKH A;  4YHH T;  5FY1 A;  3AE6 A;  2I59 A;  4O2A E;  5AQV B;  4EOZ B;  4Z8X A;  4YTM A;  3POU A;  4MAL A;  4BA9 A;  3RIU A;  3RIA A;  3ZMU B;  2E9X C;  2Y0K A;  4UVA B;  2ODV A;  5ETW A;  2CBI A;  4PK6 A;  4YJ2 E;  3RKG A;  2MTQ A;  1HCI A;  4LF9 T;  2D9D A;  2KZ7 B;  1NWM X;  3FZL B;  3SOL A;  4HFE A;  1OWA A;  3CKD A;  4ZZB A;  1QJ9 A;  3PGR A;  1YKE B;  5EK3 A;  2JQ9 A;  5DL7 A;  1UK5 A;  4A98 A;  4I55 E;  3HL6 A;  3JTY A;  4Z91 A;  4X5T A;  1LVF A;  4GIW A;  4K0U A;  3UUL A;  4GCQ A;  2XMX A;  4FSP A;  1X9B A;  1XWM A;  4IL4 A;  3AE2 A;  3O0E A;  4IIJ E;  2HPL A;  5L3G B;  5HXC A;  3WAJ A;  1T1L A;  1HG5 A;  5AFU K;  2CCQ A;  2XQ9 A;  5LGU B;  4DID B;  4MFR A;  1XZY A;  4O4X A;  1L0V A;  3QUJ A;  1G73 A;  2V5C A;  2WCA A;  4HFI A;  3V8U A;  5GON E;  4N58 A;  5FVL A;  2NW9 A;  1UUS A;  4LFA T;  2B76 A;  2R4N A;  3BQL A;  3LBX B;  2L3L A;  5T5F A;  2BKN A;  3L8R A;  2Y48 B;  3OYX A;  3ZN0 B;  3PJA J;  2YEV C;  3DWO X;  4HGA A;  3AXJ A;  4G63 A;  4DR6 T;  5ABG A;  1OED A;  3SZV A;  2KSR A;  2Z6E A;  1S5L O;  3AEE A;  3AE7 A;  2XAH B;  2JJ9 A;  1LVK A;  5HEH A;  4LFB T;  4YJ3 E;  2OLT A;  5TIS O;  3UQ7 A;  1OPF A;  4U2Y A;  4N75 A;  3MA9 A;  2LKG A;  3B57 A;  3EDV A;  4X1I E;  3SY7 A;  3E08 A;  3P50 A;  4DV2 T;  4IT4 A;  4WNK A;  2DWG A;  4F8H A;  1XMQ T;  2XAG B;  4QKN A;  1D0X A;  4FMS A;  1HNW T;  2XTR A;  3HKE E;  3PJA A;  5E79 O;  1ZHZ A;  1XNR T;  4K0K T;  1LKX A;  5FKY A;  2KZ7 A;  2DCF A;  5FY0 A;  2YKS A;  4JEU B;  2XE2 A;  4ILU A;  4ZS2 A;  5LMN T;  2XQ4 A;  2XQ8 A;  1PHO A;  4YTP A;  2LJL A;  3LK3 B;  3T1H T;  4OHF A;  4N74 A;  4JUY A;  3MAC A;  5EK4 A;  4QQ1 A;  2XTL A;  1CHU A;  3SYS A;  4AYN A;  4HFV A;  2O4V A;  2W81 C;  5FP3 A;  2FGQ X;  5BMV E;  4X1K E;  1HR0 T;  5J2T E;  3UT5 E;  3JC6 D;  5FL0 A;  5C8Y E;  4GKK T;  3SFE A;  2KDY A;  5HXE A;  2H7V C;  2L9Q A;  2CEA A;  2WM9 A;  3AEA A;  1IZN B;  2KT9 A;  3JAD A;  3T1Y T;  2IC6 A;  2JMK A;  1FIO A;  1GFN A;  1QUU A;  3WU2 O;  4DV3 T;  5F8P A;  1T72 A;  4EB6 E;  2E2A A;  3QNU A;  4GCP A;  3VY8 X;  7PRN A;  5ABF A;  4OX9 T;  2ACX A;  4ZHQ E;  4IDQ A;  4AQY T;  3GN5 B;  3P7I A;  3DJB A;  4LML A;  3KV4 A;  3K3N A;  2R4L A;  3LBX A;  4X1Y E;  5AFU L;  3HW9 A;  3VE1 A;  2FJD A;  1SE7 A;  3FZM B;  3POX A;  3PDY A;  2WS3 A;  3LSV A;  4DV0 T;  2EHO D;  2OV9 A;  2WBL A;  2N2M A;  3VR9 A;  5LB7 B;  3BRZ A;  3OKQ A;  2B1E A;  2R8A A;  2XUE A;  4P0A A;  3GP6 A;  1HXX A;  3JCU O;  3RLF F;  5LBM A;  2KIN B;  3AVS A;  2QTK A;  4J2C A;  1MND A;  1MPF A;  3U3I A;  2LFU A;  1CUN A;  4IDZ A;  4ZEY A;  5AQL B;  4AYE C;  2BKP A;  1HS7 A;  1T98 A;  5L4E A;  3OVU A;  4UXN B;  4A5X A;  3A8Y C;  2IDO B;  3KVA A;  1BH3 A;  3UUN A;  4B6X A;  2V6Y B;  3LDQ B;  4XZC A;  2WU5 A;  5DL6 A;  4TN7 B;  3O1H A;  3KV6 A;  5HCJ A;  4RLC A;  2E9X B;  2LM2 A;  1HXU A;  3L3P A;  5CJ5 A;  1S35 A;  2WDQ A;  4X65 T;  2X51 A;  3AAI A;  1JNR A;  2NTY A;  2K4T A;  3E22 E;  1QLB A;  4O8S A;  2J47 A;  5FVK A;  1THQ A;  2M6B A;  4OFZ A;  2VKJ A;  4F6R C;  4V1A v;  3C50 A;  4YT0 A;  3QOF A;  4YY3 T;  4I43 B;  1MM5 A;  3SYB A;  5LBQ B;  4JI2 T;  3PUZ F;  2KND A;  4UF0 B;  4PFP A;  3N9M A;  2CPT A;  3SS1 A;  3DA3 A;  4ASK A;  4CI1 B;  5F3J A;  2JPF A;  3SY9 A;  3RYI E;  3T24 A;  1N36 T;  3C51 A;  2XY8 B;  4P0B A;  4ZI2 D;  4JI5 T;  1BT9 A;  2XHE B;  1IZN A;  2N2N A;  2XE1 A;  4EGW A;  5DL8 A;  4QH1 A;  4O4U A;  3OYZ A;  3POQ A;  4XBF B;  4AKM A;  2JMH A;  3UAQ A;  4HWI B;  5AQU B;  4O49 A;  4LF7 T;  3VE2 A;  4DV7 T;  5CFB A;  3GN5 A;  2XG6 A;  2YIN A;  3FB2 A;  1MMG A;  5AQO B;  4JI7 T;  1W09 A;  4CXY A;  2DHR A;  1PRN A;  3PTR B;  4AKI A;  1GFP A;  1T7S A;  4U7Y A;  3R6N A;  4PR7 A;  3FYX A;  2BVM A;  4EYY R;  3P4Q A;  5EK2 A;  2VKO A;  3K3O A;  5JRC B;  2IC9 A;  4UB6 O;  3QB5 A;  4HFC A;  2Y2X A;  4TX5 A;  2VAS A;  3U78 A;  4GK5 E;  4WYV A;  3RIF A;  3IHR A;  3CQX C;  1E54 A;  2YOE A;  4GOU A;  3RH3 A;  3PU8 A;  3Q5X A;  5JDL A;  5L4H A;  3ZMZ B;  2LSI A;  4YXD A;  2XQ6 A;  4O3X B;  5DAB A;  4D5U A;  2W2U A;  4E7S A;  3DZM A;  5IYU A;  4E1S A;  2LKH A;  3ZMS B;  4IE7 A;  4LSF A;  8PRN A;  4JV5 T;  2XPK A;  2ZM8 A;  3KV5 A;  4KR8 A;  4O3Y A;  2V6Y A;  2K48 A;  2D0U A;  4AI6 A;  3RRW A;  2XZE A;  4PK4 A;  4YSZ A;  3C4W A;  2E9X A;  2N9D A;  4PJJ A;  2NOX A;  2D2S A;  5HXR A;  3RKO A;  4JYA T;  3JCF A;  5LJM A;  1JNZ A;  3RBH A;  4ZS3 A;  4AFK A;  1VRB A;  1D0Z A;  3CX8 B;  2BVL A;  5AQK B;  3X1D A;  3KFW X;  4QH4 A;  4UF0 A;  1HX1 B;  2FBW A;  2H89 A;  3TLT A;  1KNR A;  2R89 A;  3H37 A;  3IA3 A;  4UV8 B;  5G26 A;  2XQ3 A;  4JI4 T;  2LLY A;  3RI5 A;  1W0B A;  2JQH A;  4PJ0 O;  3KIN B;  4ERR A;  3R84 B;  3CK6 A;  4O3Z A;  2BS3 A; 
#chains in the Genus database with same CATH homology
 1GFO A;  4AKR B;  3DP7 A;  2DNX A;  4TV9 E;  3AA0 A;  2L3L A;  5T5F A;  3RRC A;  2MOZ A;  2ZM0 A;  3PUR A;  5JRE A;  2JQQ A;  2VKD A;  4HTE A;  2Y48 B;  4L0R A;  1ORM A;  3AAA A;  2Q9Q D;  3PUG A;  3OYX A;  2ZLY A;  2KXP B;  1HF8 A;  4G2A A;  3ZN0 B;  2YEV C;  4H9R C;  2ERV A;  4GF4 A;  4TZ4 C;  4BJN A;  2C0S A;  2FGR A;  2LSJ A;  3AA1 B;  4HGA A;  3WI4 A;  4L9I A;  4G63 A;  5LG4 A;  3CQG B;  3SRZ A;  3VHL A;  2GE4 A;  4EZ4 A;  1LRZ A;  4ZI2 C;  3RC3 A;  1KK7 A;  2X66 A;  3K3Q C;  3SZV A;  3CPZ A;  2Z6E A;  3AAE B;  1FMV A;  3GA8 A;  1EZ3 A;  3O1I A;  3PUS A;  4AZL A;  3T20 A;  3NSG A;  4LSE A;  3EUH A;  2XQY A;  3KDS E;  3ZJ1 A;  4XAX B;  3S4U A;  1IJ5 A;  2CXL A;  2XAH B;  4AQF C;  2LE8 A;  1FMW A;  2JJ9 A;  1LVK A;  3CQC B;  3SWH A;  1ZKE A;  3LK2 B;  4KBM B;  3ZYL A;  5H6R B;  4ZOL E;  4YJ3 E;  2WWU A;  2W00 A;  4UEM A;  4JEH B;  3ZPO A;  3ZYM A;  1D0Y A;  1OPF A;  5FYM A;  4FOZ A;  2CLY B;  1KNZ A;  2J4U P;  3NRY A;  3ZN1 B;  3A5X A;  3I9Y A;  3VU7 H;  5LNK A;  5LGT B;  3MA9 A;  3PE0 A;  3B57 A;  2XE3 A;  3BQK A;  3EDV A;  1HG2 A;  4F4B A;  4X1I E;  3SY7 A;  3F57 A;  4QHO A;  5JRC A;  3E08 A;  3GWH A;  2KLQ A;  4IE0 A;  2D5U A;  2HH7 A;  2G0U A;  2IAK A;  4C91 A;  3ZYK A;  4HKA A;  5FXZ A;  3RC8 A;  5LOV E;  5JQG E;  4QX8 B;  1U5P A;  4WNK A;  2DWG A;  3MJX A;  3H3A A;  3UUX B;  3RYC E;  3N2K E;  5LGN B;  4GYR A;  2XAG B;  2LHR A;  1X79 A;  4KRA A;  4CXW A;  4QKN A;  5JR9 C;  1BR2 A;  1D0X A;  2X9H A;  4FMS A;  2F1T A;  3BK9 A;  4PK5 A;  5CA0 E;  5ADX L;  2YU1 A;  2XTR A;  5LXT E;  2Q9Q B;  3PQU A;  3HKE E;  4ZI3 D;  3ZMV B;  5LJN A;  2XE5 A;  4O4H E;  4C69 X;  4AQF A;  3CWZ B;  1ZHZ A;  4FZN A;  1LKX A;  2KZ7 A;  3DA4 A;  2DCF A;  3D0T A;  3ANW B;  3KBT A;  5FY0 A;  2KWI B;  4EAH A;  4JEU B;  2XE2 A;  4XNL A;  2YPV A;  4IE6 A;  2RA1 A;  4WBN E;  4ILU A;  3GMI A;  4KR4 A;  4ZS2 A;  1QJ8 A;  3K19 A;  3KVB A;  4FJO A;  1PHO A;  4PJN A;  2LJL A;  3FHN A;  3LK3 B;  1ZV4 X;  4OHF A;  3RYH E;  4DVD A;  2Y0L A;  3UTK A;  1YKH B;  1UX5 A;  4JUY A;  4IE4 A;  3MAC A;  5EK4 A;  2ODU A;  4N59 A;  2XTL A;  4QQ1 A;  4U9C A;  3SYS A;  5D5D A;  4AYN A;  1MIV A;  4AYI D;  2C5I T;  3IEE A;  5DQV A;  3ZCI A;  3ZEF B;  3EDU A;  4HFV A;  4OYJ A;  2O4V A;  4QXC B;  2WMN A;  1ZEE A;  2W81 C;  3NBX X;  2IW5 B;  5FP3 A;  2ODJ A;  2FGQ X;  5BMV E;  4C90 A;  5LCY A;  5L3B B;  4X1K E;  2A3D A;  2MNH A;  2MBG A;  1Y64 B;  5J2T E;  2WMO A;  3JC6 D;  3UT5 E;  3HOE A;  4O4L E;  5JR9 A;  4CQI A;  5C8Y E;  3QK6 A;  3MZK B;  4E7Z A;  3POR A;  1QJP A;  3EVY A;  5HXH A;  2KDY A;  2V7I A;  4RL9 A;  5HXE A;  3LFM A;  2H7V C;  2L9Q A;  4FRT A;  2CEA A;  4LSI A;  1US7 B;  4IHJ E;  2WM9 A;  4RJW A;  2X9W A;  1WRD A;  3FBZ A;  3IF8 B;  1G90 A;  2X9Y A;  3VKG A;  1IZN B;  1ZHX A;  4QXB B;  4LSH A;  2KT9 A;  3UFE A;  3VZW X;  2IC6 A;  2JMK A;  2M67 A;  2YU2 A;  4QX7 B;  2DI4 A;  5FY7 A;  1FIO A;  1QSD A;  1GFN A;  2V26 A;  2UXN B;  2D0T A;  1QUU A;  4H63 V;  3ETV A;  5LHI B;  1HFA A;  5HAX A;  2GK9 A;  3VKH A;  4QXH B;  5EZY E;  4Z3T A;  4YHJ A;  5F8P A;  3KV9 A;  3J9X 1;  2J1D G;  2W80 C;  4EB6 E;  1HX8 A;  4PUX A;  4GCP A;  4RLB A;  4XNK A;  1SHZ C;  1BXW A;  5KMG P;  3VY8 X;  7PRN A;  3HOL A;  2ACX A;  2K5B B;  2OA5 A;  1Q9G A;  1UX4 A;  4ZHQ E;  3HKD E;  4EZH A;  3AA7 A;  3GN5 B;  3SZD A;  3WAK A;  4IE5 A;  3N2O A;  3P7I A;  3DJB A;  2CXD A;  4I50 E;  1BR4 A;  3AB3 B;  4O2B E;  1MMN A;  5L3C B;  3KV4 A;  2CLY C;  2NTX A;  2QA7 A;  3K3N A;  3ZCJ A;  1H6S 1;  2W61 A;  3QRC A;  1B7T A;  5TAO A;  4ZI7 E;  5KX5 E;  3LBX A;  4X1Y E;  3TZG A;  5AFU L;  4AKR A;  1MMD A;  3HW9 A;  4FZL A;  4YLH A;  5LHG B;  3LJC A;  2KWH A;  3AA6 B;  3VE1 A;  4KMC A;  3T8O A;  2Y8D A;  3N9N A;  2K24 A;  5L3D B;  4AQG A;  5DL5 A;  1H7C A;  2E9X D;  3RX6 A;  3POX A;  4FRX A;  3PDY A;  4AKH A;  2ZM2 A;  4E1T A;  4QWN B;  1E1H B;  5IHY A;  2KXP A;  2CM0 A;  4PJL A;  2EHO D;  4PW8 A;  4CI2 B;  2W0G A;  2WBL A;  2N2M A;  2X68 A;  3AA1 A;  3RPU A;  5FXV A;  4N78 D;  2PBI A;  1Z0P A;  1D1C A;  3OKQ A;  1ZHY A;  3VY9 X;  4G75 A;  4ANJ A;  1D1B A;  2PFV A;  2X67 A;  4H9S E;  3K8P C;  1UCU A;  5FXW A;  4P09 A;  2B1E A;  2H3R A;  1HXT A;  3PRN A;  4U74 A;  5HXS A;  3AAE A;  4FES A;  2XTQ A;  4PJM A;  5GV0 A;  2XUE A;  3IBP A;  2Q9Q C;  4P0A A;  3GP6 A;  2NW8 A;  5CA1 E;  4G76 A;  1HXX A;  3CVR A;  2L8K A;  1S94 A;  4B61 A;  3PQS A;  2DWK A;  4CZZ B;  3V5U A;  5LBM A;  3UUM A;  2LHF A;  4AUI A;  3LK2 A;  3HKB E;  5LA6 E;  2CE7 A;  1ZHW A;  2KIN B;  2W63 A;  3AVS A;  1AJ3 A;  1Q9F A;  3FBL A;  4WW0 A;  2W62 A;  2QTK A;  4J2C A;  1V9D A;  3QC9 A;  1MND A;  4AKG A;  1MPF A;  4DBQ A;  3U3I A;  2YK0 A;  3NRX A;  5JDM A;  1MNE A;  1WLX A;  4UV9 B;  2LFU A;  3LK4 2;  3RYF E;  1O3X A;  2ES0 A;  1CUN A;  5DQW A;  5JH7 E;  3CML A;  4IDZ A;  4O4J E;  4GHB A;  3HI2 A;  3NZP A;  4AYE C;  2RP4 A;  4CXX A;  1HS7 A;  3Q9D A;  1T98 A;  4HEA A;  2P9B A;  4UXN B;  4H9Q C;  5IYZ E;  3N9L A;  3CX6 B;  3KVA A;  1BH3 A;  3UUN A;  4B6X A;  2XAF B;  4BAY B;  4EYU A;  3O9X A;  5FVN A;  4XZC A;  1BR1 A;  2N1G A;  1U4Q A;  4IST A;  4M1P A;  4NUV A;  5DL6 A;  4TN7 B;  2QGS A;  3O1H A;  2M07 A;  3KV6 A;  4MHC A;  4RLC A;  1HTJ F;  2E9X B;  3ZC1 A;  4FSO A;  2Q9Q A;  4H63 H;  1HXU A;  5HWX A;  3L3P A;  1BR0 A;  2CWO A;  3F31 A;  3PUA A;  4EIW A;  4DBR A;  4D64 A;  1S35 A;  2Y0H A;  1WYC A;  2EHO B;  2NWB A;  2PG8 A;  2C5J A;  2X51 A;  3ANW A;  3AAI A;  4OK0 A;  2N2L A;  4OYK A;  5J1G A;  1G8X A;  2NTY A;  2NP9 A;  2K4T A;  3VZT X;  3ZJ2 A;  3E22 E;  3HWB A;  2VK9 A;  4NUU A;  4O8S A;  5LHH B;  3MXZ A;  1THQ A;  1YW0 A;  2CWY A;  4DMV A;  1GFM A;  4OFZ A;  2VKJ A;  4JLE A;  3F2E A;  4F6R C;  4V1A v;  2JMM A;  3C50 A;  1P4T A;  5PRN A;  4ZI3 C;  3B13 A;  4I43 B;  2CXF A;  3N9Q A;  4O3W A;  1MM5 A;  5FXX A;  3HR0 A;  3SYB A;  2BDE A;  1YS5 A;  1FEW A;  5LBQ B;  2ZFG A;  2LM9 A;  4UF0 B;  2KND A;  4PFP A;  4ADZ A;  3HA4 A;  3N9M A;  4H9P C;  3Q5W A;  3SS1 A;  3QRA A;  3DA3 A;  4DO0 A;  4ASK A;  5JDF A;  4CI1 B;  3WI3 A;  4AXP A;  5F3J A;  2JPF A;  2KC0 A;  2E8I A;  3WI5 A;  5KDM C;  4JCH A;  4H9N C;  4PFO A;  3SY9 A;  4MLK A;  3RYI E;  3T24 A;  2LEH A;  4DMW A;  2OMF A;  3C51 A;  5FNV E;  2K0L A;  3EMN X;  4BUM X;  1SA0 E;  4P0B A;  4KP3 C;  3AA0 B;  4ZI2 D;  1OSM A;  2V7J A;  3ETU A;  3UPG A;  3O4X E;  2XHE B;  1BT9 A;  3I0O A;  5FMN A;  2N2N A;  1IZN A;  3AAA B;  2XE1 A;  2HPJ A;  2KMF A;  3I1A A;  4GCS A;  5DL8 A;  3JC6 C;  4CI3 B;  4FT6 A;  4H9O C;  4O4U A;  3OYZ A;  3POQ A;  5J2U E;  4D65 A;  4XBF B;  4AKM A;  3OJA A;  4O4I E;  5H6Q B;  4HN9 A;  2JMH A;  3N9O A;  5HYA A;  3UAQ A;  5A1L A;  5EE2 A;  4YFS A;  2CA5 A;  1VOM A;  4O49 A;  3VE2 A;  2NW7 A;  2VB6 A;  3MK7 C;  2ZLD A;  3C4Z A;  2J1N A;  5L2L A;  4UVC B;  2POR A;  5JDP A;  1D1A A;  1YD8 G;  3GN5 A;  2XG6 A;  2X0L B;  3HKC E;  2YIN A;  4GYS A;  2LHN A;  3FB2 A;  3LK4 1;  3N2G E;  3TKL B;  1MMG A;  3LG7 A;  3E0Z A;  4CXY A;  2DHR A;  1MIW A;  3PTR B;  3Q2M A;  1PRN A;  3AVR A;  3AA6 A;  4AKI A;  2VKH A;  5ADX K;  5M4Y A;  5FY1 A;  5CB4 E;  5JVD E;  1GFP A;  2WSS V;  2YNK A;  3R6N A;  2I59 A;  4O2A E;  4EOZ B;  1ZHC A;  4AKL A;  3FYX A;  4BJM A;  4Z8X A;  2BVM A;  4EYY R;  5EK2 A;  4UIG A;  2VKO A;  3K3O A;  5JRC B;  2IC9 A;  2C5K T;  3C4X A;  1GFQ A;  2DLR A;  2MYS A;  3KVD D;  4MAL A;  3POU A;  4BA9 A;  4PAG A;  4TX5 A;  2Y2X A;  4AYM C;  3C98 B;  2VAS A;  3U78 A;  4GK5 E;  5JDG A;  2LT3 A;  3I9W A;  2BZB A;  3ZMU B;  2E9X C;  2Y0K A;  2A2F X;  3IHR A;  3C5O A;  4UVA B;  2VL8 A;  3CQX C;  2UXX B;  2ODV A;  3PUQ A;  1E54 A;  2XAS B;  4GOU A;  2LSG A;  3RH3 A;  4I4T E;  2EHO C;  3PU8 A;  3Q5X A;  5ETW A;  5JDL A;  1ZHT A;  4PK6 A;  4JFB A;  2XAJ B;  3ZMZ B;  4YJ2 E;  2LSI A;  2MTQ A;  2CMR A;  2WAU A;  3M65 A;  4PNI A;  1HCI A;  4WBO A;  3G7G A;  1IJ6 A;  4MBQ A;  2SPC A;  3NZQ A;  4IGU A;  5JDQ A;  2KZ7 B;  1NWM X;  4UEL A;  4O3X B;  3SOL A;  5DAB A;  4D5U A;  1OWA A;  3CKD A;  3C64 A;  2K9A A;  1QJ9 A;  4E7S A;  1YKE B;  1WYB A;  5EK3 A;  5IYU A;  4E1S A;  5DL7 A;  3ZMS B;  4IE7 A;  4LSF A;  8PRN A;  4FUV A;  3ONX A;  2V1D B;  2Y6X A;  1MMA A;  3L09 A;  5LYJ E;  2ZM8 A;  3KV5 A;  4KR8 A;  4I55 E;  3MKD A;  2M06 A;  4O3Y A;  3HL6 A;  2V7L A;  3JTY A;  3ZLI A;  2K48 A;  2D0U A;  2LOS A;  4AI6 A;  4RJX A;  2V7M A;  1LVF A;  4GIW A;  3RRW A;  3I0Q A;  4PK4 A;  4K0U A;  2XAQ B;  3UUL A;  3C4W A;  3V5S A;  4GCQ A;  5E0O A;  3OBV E;  2XMX A;  3LK3 A;  2E9X A;  2N9D A;  4FSP A;  4PJJ A;  2NOX A;  2D2S A;  5HXR A;  5JR9 B;  4L5G A;  3O0E A;  5L3F B;  3RKO A;  2EHO A;  2V7K A;  1MM4 A;  5LJM A;  5DJQ C;  3UU2 A;  4IIJ E;  3ZMT B;  3W15 B;  2MHL A;  3RBH A;  2HPL A;  4ZS3 A;  1MIY A;  5HXC A;  5L3G B;  4AFK A;  2F1V A;  1IAP A;  3WAJ A;  1VRB A;  1D0Z A;  2X27 X;  1HG5 A;  3O1J A;  4KUM B;  4TV8 E;  3CX8 B;  4A56 A;  3T0S A;  2LOP A;  2BVL A;  1OXZ A;  5AFU K;  3P8C D;  3PU3 A;  4AYD C;  5JDN A;  3ZC0 A;  2CCQ A;  3KBU A;  2H7O A;  4EXT A;  5LGU B;  3DTO A;  3FXE B;  4TUY E;  4X20 E;  2Y7S A;  4MFR A;  4DND A;  2PJQ A;  2PRN A;  3KFW X;  4FZM A;  2ZMA A;  4O4X A;  1NAF A;  4ISS A;  3QUJ A;  4UF0 A;  1G73 A;  2LSY A;  3FXD B;  5HWY A;  5L3E B;  3N5L A;  4UVB B;  2LSK A;  1WR6 A;  3V8U A;  3H37 A;  5JDH A;  5GON E;  4N58 A;  2JRK A;  3VZU X;  2VWA A;  3CX7 B;  4UV8 B;  4U72 A;  3A2S X;  5G26 A;  3ESL A;  2A72 A;  2NW9 A;  3AA7 B;  5LP6 E;  3KIN B;  3BQI A;  4ERR A;  3N9P A;  3R84 B;  6PRN A;  2X9X A;  3J7Y q;  4O3Z A;  4GK0 E;  3BQL A;  4FI5 A;  4HE8 A;  3LBX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...