3AA0B

Crystal structure of actin capping protein in complex with the cp-binding motif derived from carmil
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
243
structure length
243
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
total genus 85
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aa0B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aa0B02
3AAAB 3AAEB 3LK3B 3LK2A 3AA6A 3LK42 5AFUK 5ADXL 3LK41 3AA7B 2KZ7A 1IZNB 2KXPA 3AA1A 4AKRA 3AA0B 3AAAA 3AAEA 3LK3A 3LK2B 5AFUL 3AA6B 5ADXK 2KZ7B 3AA7A 2KXPB 4AKRB 1IZNA 3AA1B 3AA0A
chains in the Genus database with same CATH superfamily
3AE9A 2J4UP 2Y6XA 5LJMA 2HHHT 4XBFB 2IUBA 4ZXLA 1ZHYA 5KX5E 1D1AA 4ASKA 4CN6A 3LK2B 4E7SA 1XNQT 3RBHA 1WLXA 3AE1A 3LBXA 4Z90A 4JCHA 2UXBT 3RH3A 4X66T 3ZYLA 4DR2T 3EMNX 3ABVA 4P1NA 2CBJA 4DIDB 4N78D 2PFVA 1KNZA 3MA9A 5LYJE 1IBLT 2C5KT 5LG3A 2IHR1 5IYUA 3UU6A 2V7LA 2X27X 2YU1A 1IBMT 3HKBE 2ODJA 5H2FO 4GK5E 2P9BA 3AE3A 3K3NA 3GN5B 3FZLB 1ZKEA 3H37A 5AQHB 2HPJA 3SY7A 2C5IT 2XG6A 3BQLA 3LK2A 4EAHA 4UF0B 3ONXA 3BK9A 2MOZA 2CWYA 2WWUA 3SYBA 1YW0A 1S5LO 2KT9A 2ZM2A 2XAJB 3FZMB 3L3PA 4COFA 2W81C 3SYSA 1MIVA 1NAFA 5HWYA 2XQAA 4EZHA 2VWAA 5C8YE 3G7GA 5ABFB 2SPCA 5LHGB 4DR3T 3SZVA 4O49A 5J2TE 4H9NC 3VZWX 4OYJA 4K0UA 3W15B 2L9QA 3GN5A 3RKGA 4UR9A 4PW8A 5PRNA 4DBQA 2WAUA 2LJLA 2Q9QA 4YTNA 4DV6T 4GCQA 3BS0A 1J5WA 3RPUA 5LXTE 4LF5T 5FL1A 2V7MA 5HCMA 2UUCT 1Q9GA 1MM5A 3QOFA 2N2MA 2HN1A 4E7ZA 5BMVE 1IAPA 4YTMA 4LF7T 2XJ7A 1QLBA 4I4TE 4HWFA 4EV6A 4AQFC 1NENA 2YN6A 2DLRA 2H7VC 2W61A 3ONLC 3EVYA 4AYID 4KUMB 3IEEA 2LM9A 5HEHA 5ABFA 2C0SA 1E7PA 3PF1A 5G26A 3FXEB 2V8SV 3A8YC 2C5JA 3FHNA 4JFBA 2OMFA 2LKHA 5HEGA 3VKHA 1ZV4X 3NKZA 3O4XE 3PQUA 5DL7A 3ZN0B 1Q9FA 3RRWA 5A1LA 5FY1A 4O3WA 2J4GA 5G38A 3WI5A 2CEAA 2JJ9A 2R6GF 1IZNA 2X67A 3T8OA 1T16A 4QX7B 2VKHA 2E9XC 3KV9A 2X9HA 4BAYB 2LRKA 4DR6T 4CN1A 3ZC0A 4C4VA 3JTYA 5EE2A 4O8SA 2BKOA 3O0EA 5FP3A 1M7KA 1WRDA 2UUBT 2EHOA 3UFGA 4HKAA 4UV9B 3QB5K 1JNZA 2LM2A 4U3CA 3CK6A 5JTGA 4DMWA 4AKHA 5DABA 4OHFA 4GK0E 2XAHB 5HEOA 2J47A 4H9RC 3PUVF 1GFMA 2BKPA 4FSPA 4H9SE 3P50A 4LF6T 4EB6E 1LVKA 2XM2A 1HFAA 4H63V 4H9PC 3LK3B 4ZOLE 3U3IA 4QXCB 2JPFA 4NXMT 5FYMA 3CX7B 1D0YA 5ABGA 4HFIA 2UU9T 3DA4A 1UX4A 4QXBB 5FMNA 2XQYA 2LKGA 2D2SA 1BR0A 1HNZT 3P4WA 4B3RT 4ZS2A 4TV8E 3E0ZA 4CI3B 2HH7A 3F2EA 3AVRA 5IYZE 3ETUA 2JQKA 4X65T 3J9X1 4GYSA 3ZCJA 2JMMA 3PJAA 5L4EA 5JREA 2B76A 3MK7C 5L3CB 3RQWA 2R89A 2UUAT 3DP7A 3PUSA 1HR0T 4O3XB 3TLSA 2V7KA 3C5OA 2BDEA 5F3JA 3AE8A 5JQGE 3SFEA 3LK3A 3C4WA 4UVCB 2R4LA 3DA3A 5CA1E 2CE7A 4A5XA 3N9NA 4LSFA 3LSVA 4CZZB 3NVOA 5DL8A 3CQXC 4GYRA 4ZI7E 3PUGA 4HFDA 3QRCA 3VE2A 4PK4A 1ZHWA 4CXWA 2K3WA 1Y01A 1MNDA 2FJEA 2CXFA 4JBWF 3C51A 3SY9A 5HEJA 2CA5A 3SWHA 4AFKA 3R6NA 3AAAB 2L3LA 3PUXF 3HR0A 4PAGA 2XTLA 4FRTA 3RX6A 1HG5A 4AXPA 5LNKA 1HF8A 4ERRA 2PG8A 1J5ET 3A7MA 4TWFA 2R4PA 1ZHXA 2V7JA 4AKRB 4K3CA 5L3EB 3RYCE 4X1IE 2UXCT 2NTYA 3AA7B 2CLYB 2E9XD 2XQ4A 4ZS3A 3ZSSA 5JDFA 3K3OA 2YNKA 5E0OA 3RF1A 4C00A 3QNUA 3HKCE 3UUNA 4YSZA 2Y7SA 3E22E 4MFRA 4EXTA 4GOUA 1J1JA 4QKNA 3FBLA 4FSOA 3HKDE 3T1YT 4ZZCA 1GQEA 5AQIB 1YXRA 1BT9A 4O2AE 1WFDA 1N36T 1LRZA 3C98B 3TZGA 3VR9A 2NTXA 2VB6A 1YD8G 2NW8A 4N58A 1DU2A 4U2YA 3OYXA 4L0RA 5JDNA 5J1GA 4YY3T 1HS7A 2JQ9A 4B61A 5AQNB 4TUYE 2ODVA 4ILCA 2X51A 3AA7A 1R8IA 3I0QA 3JC6C 3C50A 4PR7A 2BKNA 1HTJF 2NW9A 4TV9E 4NPPA 1UK5A 2J1DG 2BG9C 5AQGB 5FXVA 1KF6A 4PJMA 2BBHA 5AQMB 3AAIA 4KBMB 2KC0A 3A5XA 1JNRA 2BS4A 5JDPA 8PRNA 4F6RC 4IE7A 4HEAA 2FUPA 3ONJA 2V6YB 2E5LT 2M6IA 3AXJB 3L8RA 1XWMA 5AQSB 5IWAT 2CM0A 5AQQB 1LKXA 4GCPA 3FZKB 4AQGA 4D65A 4U33A 3VY8X 5HWXA 7PRNA 2WJQA 3ZC1A 1T72A 4PUXA 5ABHA 2G0UA 3KFWX 5CB4E 1OEDC 2LLYA 1X79A 2PORA 4B3MT 1W09A 2WSSV 3ANWB 5M4YA 2VQET 2XE1A 2LSJA 3J7Yq 4PJNA 4OK0A 2ZFGA 2AXDS 3NZQA 3N9QA 3P7IA 2LE8A 3RGLA 4A98A 3TLVA 4N59A 2W00A 4JI2T 3O1HA 4U9CA 2LHFA 4U7IA 4HFVA 2LHRA 2V6YA 3GMIA 2PRNA 5AQLB 1T98A 1HNWT 3HW9A 3PE0A 3VKGA 2Y0LA 5AQVB 5LGUB 3BQKA 2MPKA 3NRXA 5LP6E 3Q5WA 3VHLA 2X0LB 4Z8XA 4QQ1A 3QRAA 2ZMAA 3EI0A 2YOEA 3UFEA 2E2AA 4RLCA 5GV0A 2JRKA 4B3TT 3DWNA 4EOZB 3E08A 3ANWA 1MM4A 4AKIA 3ZMVB 2WS3A 3JCUO 2MAWA 3OJAA 3AB3B 3EHZA 1WYBA 4GIWA 4UV8B 3ETVA 1WR0A 4DV1T 3RIUC 1FEWA 2ZLDA 2FJAA 1SE7A 4Z91A 2VK9A 2IC9A 2K4TA 3EUHA 5LHHB 3OPCA 4TNWA 2IW5B 4N75A 4JV5T 2WU2A 1YKEB 2V7IA 3ZEFB 3KV5A 4GHBA 4AYEC 2D0UA 4UELA 3SFDA 4TWDA 4LF9T 4N74A 4UVAB 4IE0A 2BVMA 2OA5A 3H3AA 3T0SA 3CIRA 3HA4A 2VASA 1P4TA 3RIAA 2QYWA 3RKOA 4TX5A 2A3DA 3AECA 2F1CX 5L3BB 3ZMSB 2BZBA 3OTOT 4WBNE 3I1AA 2IIUA 3N2GE 3N2KE 4ZI3C 4AI6A 4TZ4C 4O4JE 2CHOA 4EZ4A 3N9MA 3PORA 4EEBA 3LK41 3OYZA 2FBWA 4CXYA 1ZHTA 1AJ3A 4Q25A 5TAOA 4PNIA 3KV6A 2KZ7B 4UF0A 4O4XA 5AQUB 3P4SA 4IE5A 4DBRA 1IBKT 3PGRA 2YEVC 3AE6A 2VKDA 4JI0T 4IDNA 2MHLA 3JAFA 3KVBA 4H9OC 4PJ0O 2IMLA 3UU5A 4IDZA 3ZLIA 2HPLA 4QH5A 4O3ZA 2Y8DA 4U74A 3GA8A 1XDPA 2X9YA 4A56A 4I50E 2YKSA 5FY7A 1G73A 4LSIA 2AXTO 5D5DA 2ODUA 2ACZA 2Z6EA 3VRBA 3TLWA 3T1HT 2JMHA 2XQ6A 3RYHE 5JR9B 2XTRA 3C64A 2D9DA 4G2AA 4LF4T 2MNHA 1HXTA 3F57A 5AFUK 3Q5EA 2R4NA 2KNDA 1Z0PA 3PUZF 2WZHA 2IWVA 2WY2A 2OV9A 3N5LA 4KR4A 4P0AA 2Q9QC 5EK2A 3SS1A 3S4UA 4FZMA 2YDQA 3N9LA 2RPAA 2WMOA 1GFNA 3VZUX 3VR8A 4DR7T 4CN4A 5F5WA 1IJ6A 2K5BB 4DR5T 2PTFA 2K0LA 2QA7A 2XSBA 3M3ZB 1FIOA 5HXEA 1OPFA 2NW7A 5L3FB 2A2FX 2DNXA 2XUEA 4P0BA 1MIYA 4MBQA 1HXXA 4FZNA 3CKDA 1QJ9A 3A2SX 4TN7B 1HCIA 5JR9A 1I6ZA 1Z8UA 2ERVA 4HWDA 4QH4A 4IGUA 1PRNA 3V8UA 1BR4A 2DHRA 4JI6T 4MALA 5HYAA 2XSAA 2XHEB 2WP9A 2V1DB 3MKDA 1YQ4A 4QX8B 4JEHB 3A0HO 4D5UA 1OWAA 2D0TA 2GK9A 2M6BA 4M1PA 1MMAA 5JH7E 4JI1T 5LGTB 2W66A 1SUMB 4P09A 3TLTA 3GWHA 2W67A 3K1SA 3L39A 2F1TA 3LK42 5DQWA 3RI5A 2BBJA 2IC6A 2VURA 1XDOA 4HTEA 4X64T 2R88A 3DTOA 3MACA 1QSDA 2XY8B 5FXWA 5LJNA 4YHJA 4RLBA 5LHIB 2MYSA 2XTQA 1YQ3A 2LRLA 3OBVE 1MIWA 2EHOC 3Q5XA 5JRCB 4KHPT 5AQOB 4EYYR 1MMGA 3O1JA 1T7SA 5DJQC 5JDQA 2YDRA 4JI8T 5H6QB 5CA0E 2W4XA 4DV0T 5B5EO 4FI5A 2FGRA 4YFSA 4IDOA 3CVRA 1LVFA 5J2UE 4KMCA 4AKGA 2XQ3A 1OEDE 4CI1B 3NSGA 2WCAA 5FKYA 4UEMA 3UAQA 4AZLA 3NZPA 3EDVA 2RA1A 4DO0A 3FBZA 5ADXK 1GFQA 4FJOA 3AE5A 3I9WA 4UIGA 1G8XA 4LFAT 1B7TA 2NP9A 4C91A 1WR6A 3PU3A 2LOPA 3K3QC 2IDOB 4IL4A 5HCJA 4RL9A 2LHNA 1E1HB 1ORMA 5KAIO 2XQ8A 3ZT6A 3JADA 4ILAA 3VRAA 3JAEA 5JRCA 2K9AA 3UUMA 1N32T 4HN9A 4TWHA 2M06A 3L09A 2WMNA 4E1TA 1Y64B 4HGAA 1OEDB 3FZHB 4B3ST 3PTRB 4H9QC 3VY9X 2Q9QD 3UU4A 4LSEA 5LOVE 1HX1B 3JCFA 2BS3A 2X9XA 4V1Av 3MZKB 3RYIE 3OKQA 2V26A 2PJQA 2H3RA 2DWGA 3AAAA 2XASB 4EIWA 1ZHZA 4EYUA 1UGOA 2VVSA 3PJAJ 3PUWF 4WNKA 1N33T 3P4RA 4U7YA 2ZM6T 2KMFA 1MMDA 4X5TA 2WVPA 1KK7A 2DWKA 4HE8A 2IWWA 4GF4A 1YS5A 2XZEA 4X20E 4HFBA 1V9DA 4AKRA 4AKMA 4L9IA 2XAFB 4CXXA 2YU2A 3AEEA 2KXPB 2DL1A 2VKJA 4ZI2C 2KDYA 2KLQA 4CTDA 2F1VA 4IDQA 3KBUA 4DR1T 4DV4T 2J1NA 2UXXB 1T1LA 2N2NA 3V5UA 3LJCA 1XZYA 3AA6B 1MMNA 2J62A 4F8HA 4FESA 3FXDB 4KP3C 2QVAA 2Y48B 4K3BA 2AE9A 2XE3A 4E1SA 4YLHA 3RC8A 2E8IA 5KMGP 5LB7B 4PK5A 3AEFA 2EHOD 2WDRA 4PK6A 4LFCT 4GCSA 1VCSA 4I0UA 2WJRA 2XM1A 3UT5E 4IE6A 3NJTA 4OX9T 4JI5T 2N2LA 3I0OA 4IE4A 2LSGA 2Y0HA 3BRZA 3KBTA 5HXSA 3UULA 1E2AA 4XNLA 3T24A 4DMVA 1I94T 2LSKA 3ZSTA 1UX5A 5CGMA 1YKHB 3RIFA 1ZEEA 3WAKA 2N1GA 5JDHA 4RJWA 2XPKA 3D0TA 5EK4A 2F4VT 2I6HA 3EDUA 1QUUA 4DR4T 5G39A 3MJXA 3QC9A 1X9BA 2NWBA 3AA6A 5FNVE 2X9WA 3AVSA 4WW0A 5B66O 3WAJA 5HAXA 3ZMUB 3UU3A 2CCQA 3PU8A 3NWIA 3HL6A 2X0HA 3AXJA 1H7CA 5AQFB 3TLUA 4O4LE 2CBIA 5JVDE 5HXHA 1HG2A 4ISSA 5TISO 4AYMC 2WB5A 2XAGB 4ADZA 4MHCA 3DWOX 4NUVA 3UU8A 5AQRB 1NWMX 5L4HA 4FRXA 5LBQB 4MLKA 4QHOA 4OYKA 4DV7T 2VL8A 5DL6A 3I9YA 4HWCA 4ILBA 1UURA 4J2CA 4GKKT 2WU5A 5DL5A 4BA9A 1ZHCA 4KRAA 4JLEA 5LCYA 2CXLA 3OVUA 2HN2A 2V6XA 1CUNA 3K19A 3B13A 2UXNB 4IREA 4X1YE 2XQ7A 2L8KA 5L3GB 2E9XB 3HI2A 4AKLA 1BR1A 2ACXA 3ZCIA 2DCFA 1FJGT 1IJ5A 1E54A 2WZIA 4FUVA 4H63H 4PJLA 4AUIA 5ETWA 2A9UA 4AQFA 2Q9QB 5EK3A 5FL0A 1ZOYA 3Q2MA 2OLTA 1D1CA 4ZI2D 2VVNA 3JC6D 1MNEA 1WCRA 2KINB 3QK6A 5F8PA 4UB8O 4NIQA 3VU7H 3RC3A 3AEGA 2WDVA 4HWHA 3F31A 2X9KA 4O2BE 3AA1B 4KX6A 4B6XA 1O3XA 5G3AA 2UXDT 5JDLA 3RRCA 4CI2B 2H88A 3HOLA 4ISTA 4CQIA 3CX8B 3NRYA 1QJPA 5L47A 3POXA 2JQHA 5FVKA 1WYCA 4UVBB 2KSRA 3M65A 3G06A 2XE2A 5C3JA 4RJXA 4FT6A 5JDGA 4ZHQE 3ZYMA 2E9XA 1HXUA 1W0AA 2WQYA 1HNXT 2WBLA 4BJNA 3ZN1B 3SOLA 1S35A 4LMLA 1IZNB 4DUZT 4LF8T 3UUBA 4IIJE 4YJ2E 2ZM8A 4XZCA 4LMJA 3QUJA 2ZM0A 4HFCA 4UB6O 4JYAT 3CX6B 2XAQB 1BR2A 3V5SA 5KXJA 4C4VB 3ZT5A 2FJBA 4LSHA 4YTPA 2WDQA 5H6RB 3O9XA 1GFPA 2DI4A 5T5FA 2MBGA 2VQFT 5C2TA 2QTKA 4PJJA 2EHOB 1BXWA 3AA1A 4Z3TA 4OFZA 4C69X 1GFOA 4HFHA 3KZIO 3FB2A 4I43B 3CPZA 1NEKA 2JQQA 4IL6O 5CFBA 2W62A 2KZ7A 4JUYA 3C4XA 5FY0A 6PRNA 1CHUA 1U4QA 4DVDA 2FGQX 4O4IE 5DQVA 3BRYA 2X0YA 5LG4A 4U31A 4GKJT 2CMRA 3ZJ2A 5LMNT 2XE5A 1M62A 4YT0A 3AE7A 3A0BO 2GE4A 3TKLB 4KR8A 2RP4A 3UQ7A 4C90A 3X1DA 5IHYA 2FJDA 2O4VA 5AQKB 2CHNA 1U5PA 4D64A 2JMKA 2V5CA 5J0ZA 3DZMA 5LA6E 3RLFF 5EZYE 3GP6A 3ZMTB 1OSMA 3ZPOA 3POQA 2X68A 3EABA 4F4BA 3P4QA 4IT4A 2W0GA 1XNRT 4UXNB 1SA0E 2VKOA 3NBXX 5GONE 5HXRA 3PUYF 2CPTA 1UUSA 2K48A 3P8CD 1D0ZA 2W2UA 4K0KT 5FVLA 2LOSA 2YPVA 2Y0KA 2LSYA 2BG9E 5GTIO 2XQ5A 4DV3T 1D1BA 4G75A 3K8PC 4EEDA 3RQUA 4ZZBA 1XMQT 4DV5T 2R8AA 2IAKA 3AE4A 3BQIA 4QXHB 4QWNB 3VZTX 1BH3A 1UCUA 4ZI3D 3N2OA 5LGNB 3LDQB 3HKEE 4HWIB 4O4HE 1T8BA 5AQPB 4WZXA 3AE2A 4FMSA 4YJ3E 4JI4T 2M07A 5HEUA 4DNDA 2NOXA 4IHJE 4X1KE 4FOZA 2MTQA 1VOMA 2WWVA 3Q5DA 2W63A 4XNKA 2BG9B 2VL0A 3ZMZB 5JR9C 1VCTA 1KFYA 2KWIB 3AA0B 4AIUA 3FZFB 4EGWA 2D5UA 3KV4A 5CJ5A 4O4UA 3VE1A 1KNPA 5KAFO 3KVDD 1ZP0A 3UUXB 4WBOA 1L0VA 2CRBA 4YXDA 2LFUA 3AAEB 5L3DB 4YSXA 2JQYA 3CWZB 5LBMA 2QRXA 3AEBA 4DV2T 5LMUT 5ABEA 5JDMA 3PQSA 2ZLYA 2JIWA 3PV0F 3R84B 3PGSA 1KEYA 3LG7A 4G63A 3AEAA 3WU2O 5IUXA 3P4PA 1THQA 2I0MA 3LFMA 2M67A 3PUQA 1OXZA 3C4ZA 4JI3T 1XMOT 2YDSA 3SZDA 3ZYKA 1SHZC 3RHWA 5AFUL 1FMWA 2H7OA 1HX8A 4NUUA 3ZT7A 1D0XA 2BG9A 2N9DA 4HFEA 3KDSE 2BVLA 3AA0A 4YSYA 4G76A 2CWOA 3PURA 3POUA 4ILUA 4IDPA 4FQEA 3DJBA 2R4OA 4ANJA 3AAEA 3UPGA 3PRNA 4TNVA 4WYVA 1N34T 1FMVA 3CMLA 5E79O 4JEUB 1EZ3A 3KVAA 3CQGB 3RYFE 4DUYT 1S94A 1OEDA 5L2LA 4JI7T 3U78A 3ZKRA 3ZJ1A 2CXDA 3WI4A 4FZLA 2H89A 3IF8B 4PFPA 4AISA 3CQCB 4AYNA 3H3MA 3IBPA 2BS2A 3PDYA 3PGUA 2E5VA 3PUAA 2I59A 4AYDC 3O1IA 3UQ4A 3HOEA 1G90A 2X66A 2PBIA 4BUMX 5KDMC 2B1EA 3FYXA 2KWHA 4U2ZA 1PHOA 4KI0F 1W9RA 5AQJB 4QH1A 2NR4A 4O3YA 5FXZA 1US7B 3UTKA 5FVNA 4A97A 4U72A 3EAMA 3UU2A 3N9OA 1MPFA 2LEHA 4L5GA 2KXPA 3KINB 3QB5A 3B57A 1W0BA 4BJMA 3AEDA 3LBXB 2Y2XA 3T20A 1VRBA 4KHZF 4LMKA 5AQTB 2WM9A 4LFBT 1H6S1 2K24A 4AQYT 3MXZA 4X62T 3WI3A 3SRZA 1KNRA 2YK0A 4XAXB 2LT3A 3ESLA 2QGSA 4ZEYA 1QJ8A 2CLYC 5ADXL 2YINA 3RIUA 2LSIA 5GTHO 2V5DA 3HWBA 2XMXA 2ES0A 3IA3A 2W80C 5BR8T 5HXCA 3B5MA 3IHRA 4I55E 4PFOA 3N9PA 4NXNT 2XQ9A 5FXXA 4IL9A 3Q9DA 2A72A 4YHHT
chains in the Genus database with same CATH topology
5LGTB 2J4UP 4P09A 2Y6XA 2Y7SA 3E22E 4MFRA 3GWHA 5LJMA 4EXTA 3LK42 2F1TA 4GOUA 5DQWA 2WBLA 4BJNA 3ZN1B 3SOLA 4XBFB 1S35A 2IC6A 4QKNA 3FBLA 1IZNB 4HTEA 1ZHYA 5KX5E 1D1AA 4IIJE 4YJ2E 4FSOA 3DTOA 4ASKA 3HKDE 2ZM8A 4XZCA 3LK2B 1QSDA 3MACA 3QUJA 5FXWA 5LJNA 2ZM0A 4YHJA 4E7SA 1MMAA 3CX6B 2XAQB 1BT9A 1BR2A 3V5SA 4O2AE 1WLXA 4RLBA 3RBHA 5LHIB 2MYSA 1LRZA 3LBXA 2XTQA 3C98B 4LSHA 3TZGA 2NTXA 5H6RB 3O9XA 1GFPA 2DI4A 3OBVE 4JCHA 2MBGA 1MIWA 2EHOC 3Q5XA 3RH3A 5T5FA 3ZYLA 5JRCB 3EMNX 2VB6A 1YD8G 2NW8A 1MMGA 3O1JA 4EYYR 2QTKA 4PJJA 4N58A 2EHOB 5DJQC 1HXXA 5JDQA 1BXWA 3AA1A 4Z3TA 4OFZA 3OYXA 4L0RA 5JDNA 5J1GA 1HS7A 4C69X 4N78D 2PFVA 1KNZA 4B61A 1GFOA 4TUYE 5H6QB 3MA9A 2ODVA 5CA0E 5LYJE 2C5KT 4FI5A 2X51A 3AA7A 3FB2A 2FGRA 4I43B 3CPZA 3I0QA 3JC6C 3C50A 4YFSA 5IYUA 3CVRA 1HTJF 1LVFA 2NW9A 2V7LA 4KMCA 4TV9E 5J2UE 2X27X 2YU1A 2J1DG 4AKGA 2JQQA 5FXVA 4PJMA 4CI1B 3NSGA 3HKBE 2W62A 2KZ7A 3AAIA 4JUYA 2ODJA 3C4XA 5FY0A 4KBMB 2KC0A 4UEMA 3A5XA 4GK5E 3UAQA 6PRNA 4AZLA 3NZPA 4DVDA 1U4QA 3EDVA 2P9BA 2RA1A 3K3NA 2FGQX 3GN5B 1ZKEA 3FBZA 3H37A 4O4IE 5DQVA 4DO0A 8PRNA 5JDPA 4F6RC 5LG4A 5ADXK 4IE7A 4FJOA 4HEAA 1GFQA 2CMRA 3ZJ2A 2XE5A 3I9WA 4UIGA 2HPJA 3SY7A 2C5IT 1G8XA 2XG6A 3BQLA 1B7TA 2NP9A 3LK2A 4EAHA 2GE4A 3TKLB 1WR6A 3PU3A 2LOPA 3K3QC 4C91A 4UF0B 3ONXA 3BK9A 2MOZA 2CM0A 4KR8A 2CWYA 2WWUA 2RP4A 4C90A 5IHYA 4RL9A 2O4VA 1E1HB 2LHNA 1ORMA 3SYBA 1LKXA 1YW0A 4GCPA 2KT9A 4AQGA 4D65A 1U5PA 3VY8X 2ZM2A 5HWXA 2XAJB 7PRNA 3L3PA 5JRCA 2K9AA 3UUMA 2JMKA 4D64A 3ZC1A 2W81C 3SYSA 1MIVA 1NAFA 4HN9A 5HWYA 5LA6E 5EZYE 3GP6A 3ZMTB 4PUXA 4EZHA 2VWAA 2M06A 2G0UA 5C8YE 1OSMA 3KFWX 3G7GA 3L09A 2WMNA 5CB4E 3ZPOA 2SPCA 4E1TA 1Y64B 4HGAA 1X79A 2PORA 3POQA 5LHGB 2WSSV 3ANWB 5M4YA 2X68A 3SZVA 4O49A 4F4BA 5J2TE 4H9NC 2LSJA 2XE1A 3J7Yq 2W0GA 3VZWX 4OYJA 3PTRB 4PJNA 4H9QC 4OK0A 4UXNB 1SA0E 2ZFGA 3VY9X 2VKOA 3NZQA 2Q9QD 4K0UA 3NBXX 5GONE 5HXRA 3N9QA 4LSEA 5LOVE 3P7IA 2LE8A 2K48A 3P8CD 3W15B 1D0ZA 2L9QA 2YPVA 2LOSA 2Y0KA 3GN5A 2X9XA 2LSYA 4V1Av 3MZKB 4PW8A 4N59A 5PRNA 2W00A 3O1HA 3RYIE 3OKQA 4DBQA 1D1BA 2V26A 4G75A 4U9CA 2WAUA 2LJLA 2H3RA 2PJQA 2Q9QA 3K8PC 1HXUA 2LHFA 4HFVA 2LHRA 3GMIA 2PRNA 4GCQA 2DWGA 1T98A 3AAAA 2XASB 3HW9A 4EIWA 1ZHZA 3PE0A 3RPUA 4EYUA 5LXTE 3VKGA 2Y0LA 5LGUB 3BQKA 2IAKA 2V7MA 3NRXA 5LP6E 1Q9GA 1MM5A 3BQIA 4QXHB 2N2MA 4QWNB 3VZTX 4WNKA 4E7ZA 3Q5WA 5BMVE 1BH3A 1IAPA 3VHLA 2KMFA 1MMDA 2X0LB 1UCUA 4I4TE 4Z8XA 3N2OA 1KK7A 4ZI3D 4AQFC 5LGNB 4QQ1A 3QRAA 2DLRA 2H7VC 2W61A 2ZMAA 2DWKA 3HKEE 4HE8A 4O4HE 3EVYA 4GF4A 4AYID 4KUMB 1H6S1 1YS5A 4X20E 3IEEA 1V9DA 4AKRA 3UFEA 2LM9A 4RLCA 5GV0A 4AKMA 4FMSA 2C0SA 2JRKA 4L9IA 2XAFB 4CXXA 2YU2A 4EOZB 3FXEB 4YJ3E 5G26A 2M07A 3E08A 4DNDA 2NOXA 2C5JA 2KXPB 3FHNA 3ANWA 4IHJE 4X1KE 1MM4A 4FOZA 2VKJA 3ZMVB 4ZI2C 4AKIA 2KDYA 4JFBA 2OMFA 2MTQA 3VKHA 1ZHXA 2KLQA 3OJAA 1ZV4X 3AB3B 3O4XE 2F1VA 1WYBA 3PQUA 5DL7A 4GIWA 4UV8B 3ZN0B 3ETVA 1VOMA 1Q9FA 3RRWA 3KBUA 2W63A 5A1LA 4XNKA 3ZMZB 2J1NA 2UXXB 5JR9C 2N2NA 2KWIB 3AA0B 1FEWA 5FY1A 3V5UA 3LJCA 2D5UA 3KV4A 4O3WA 2ZLDA 4O4UA 3VE1A 3AA6B 1MMNA 4FESA 2VK9A 3KVDD 2IC9A 3FXDB 4KP3C 2K4TA 3EUHA 5LHHB 3WI5A 2Y48B 2IW5B 2CEAA 2XE3A 2JJ9A 1IZNA 3UUXB 2X67A 4WBOA 4E1SA 4YLHA 3RC8A 2E8IA 2LFUA 3AAEB 5KMGP 5L3DB 3T8OA 1YKEB 2V7IA 3ZEFB 4QX7B 2VKHA 3KV5A 2E9XC 3KV9A 4GHBA 3CWZB 4PK5A 4AYEC 5LBMA 2EHOD 2X9HA 2D0UA 4PK6A 4GCSA 4BAYB 5JDMA 3PQSA 2ZLYA 3ZC0A 4UELA 3UT5E 4IE6A 3JTYA 5EE2A 4O8SA 2N2LA 3R84B 3O0EA 3I0OA 4M1PA 3LG7A 5FP3A 4IE4A 2LSGA 1WRDA 4UVAB 2Y0HA 2EHOA 4IE0A 2BVMA 3KBTA 4G63A 5HXSA 4HKAA 3UULA 4UV9B 4XNLA 2OA5A 3H3AA 1THQA 3T0SA 3LFMA 2M67A 4DMVA 3T24A 3HA4A 2VASA 2LSKA 3PUQA 1P4TA 1UX5A 1OXZA 1YKHB 3C4ZA 1ZEEA 3RKOA 4TX5A 3WAKA 2A3DA 2N1GA 4DMWA 5JDHA 3SZDA 4AKHA 5DABA 4RJWA 4OHFA 3ZYKA 5L3BB 1SHZC 4GK0E 3D0TA 2XAHB 5AFUL 3ZMSB 2BZBA 1FMWA 2H7OA 1HX8A 4H9RC 5EK4A 3I1AA 4NUUA 4WBNE 1GFMA 3N2GE 1D0XA 3N2KE 2N9DA 3EDUA 4H9SE 4TZ4C 3KDSE 4ZI3C 4AI6A 1QUUA 4FSPA 2BVLA 4O4JE 4EB6E 3AA0A 3MJXA 1LVKA 3QC9A 4EZ4A 3N9MA 1HFAA 4H63V 4G76A 4H9PC 3LK3B 2CWOA 2NWBA 3PORA 4ZOLE 3U3IA 3AA6A 4QXCB 5FNVE 2X9WA 3AVSA 3PURA 4WW0A 3LK41 3POUA 4ILUA 3WAJA 5HAXA 2JPFA 3ZMUB 5FYMA 2CCQA 3PU8A 3OYZA 3CX7B 3DJBA 1D0YA 4CXYA 1ZHTA 1AJ3A 4ANJA 3AAEA 5TAOA 4PNIA 3HL6A 3DA4A 1H7CA 3KV6A 2KZ7B 3UPGA 4UF0A 4O4XA 1UX4A 4QXBB 5FMNA 4O4LE 3PRNA 2XQYA 5JVDE 5HXHA 2D2SA 1BR0A 4IE5A 4DBRA 1HG2A 2YEVC 4ISSA 4ZS2A 2VKDA 4AYMC 4TV8E 2XAGB 3E0ZA 4ADZA 4CI3B 4MHCA 2MHLA 1FMVA 3CMLA 4NUVA 2HH7A 3KVBA 4H9OC 3F2EA 1NWMX 3AVRA 5IYZE 3ETUA 4FZNA 4IDZA 3J9X1 3ZLIA 4GYSA 2HPLA 4JEUB 3ZCJA 1EZ3A 3KVAA 2JMMA 5JREA 4O3ZA 4FRXA 2Y8DA 3CQGB 3RYFE 3MK7C 1S94A 4U74A 3GA8A 5L3CB 2X9YA 4A56A 4I50E 3DP7A 5L2LA 3PUSA 4O3XB 5LBQB 5FY7A 1G73A 4LSIA 2V7KA 4MLKA 4QHOA 3C5OA 4OYKA 3U78A 5D5DA 2ODUA 2BDEA 3ZJ1A 2CXDA 5F3JA 2VL8A 3WI4A 2Z6EA 5DL6A 5JQGE 2JMHA 3I9YA 3LK3A 3RYHE 3C4WA 4UVCB 5JR9B 2XTRA 4FZLA 3IF8B 4PFPA 3C64A 3CQCB 4G2AA 3DA3A 3IBPA 4AYNA 4J2CA 5CA1E 3PDYA 5DL5A 2CE7A 3N9NA 4LSFA 3PUAA 2I59A 4BA9A 4CZZB 5DL8A 3CQXC 4GYRA 1ZHCA 2MNHA 4JLEA 4KRAA 5LCYA 4AYDC 4ZI7E 3O1IA 2CXLA 1HXTA 3F57A 5AFUK 3HOEA 1CUNA 3K19A 3PUGA 2X66A 3B13A 1G90A 2PBIA 4BUMX 5KDMC 2B1EA 3FYXA 2KWHA 2UXNB 4X1YE 2KNDA 3QRCA 1Z0PA 2L8KA 5L3GB 2E9XB 3HI2A 4AKLA 1BR1A 2ACXA 4PK4A 1PHOA 1ZHWA 3VE2A 4CXWA 3N5LA 4KR4A 4P0AA 3ZCIA 2DCFA 2Q9QC 5EK2A 1IJ5A 1E54A 1MNDA 4FUVA 4H63H 2CXFA 4PJLA 4AUIA 5ETWA 3S4UA 3SS1A 4FZMA 3N9LA 2WMOA 3C51A 3SY9A 4AQFA 2Q9QB 1GFNA 4O3YA 3VZUX 5EK3A 3Q2MA 5FXZA 2CA5A 1US7B 1D1CA 3R6NA 3SWHA 3AAAB 4AFKA 3UTKA 5FVNA 2L3LA 4ZI2D 3JC6D 3HR0A 1MNEA 2KINB 3QK6A 5F8PA 4PAGA 2XTLA 4FRTA 4U72A 3RX6A 1HG5A 3UU2A 1IJ6A 3N9OA 3VU7H 2K5BB 2LEHA 4L5GA 3RC3A 4AXPA 5LNKA 3KINB 1MPFA 1HF8A 2KXPA 3B57A 4ERRA 2K0LA 4BJMA 2QA7A 3LBXB 2Y2XA 2PG8A 1FIOA 3T20A 1VRBA 5HXEA 1OPFA 2NW7A 5L3FB 2A2FX 2DNXA 2XUEA 2WM9A 3F31A 4P0BA 1MIYA 2K24A 4MBQA 3MXZA 2V7JA 4O2BE 3WI3A 4AKRB 3CKDA 3AA1B 3SRZA 4B6XA 5JH7E 1O3XA 1QJ9A 5L3EB 3A2SX 2YK0A 4TN7B 1HCIA 4XAXB 2LT3A 3ESLA 3RYCE 2QGSA 5JR9A 3RRCA 4CI2B 5JDLA 2ERVA 1QJ8A 2CLYC 4X1IE 2YINA 5ADXL 4ISTA 2LSIA 2NTYA 3HOLA 3AA7B 4CQIA 3CX8B 3NRYA 4IGUA 1PRNA 1QJPA 3HWBA 3POXA 3V8UA 1BR4A 2XMXA 2DHRA 2CLYB 2ES0A 2E9XD 4ZS3A 2W80C 4MALA 5HYAA 2XHEB 5HXCA 2V1DB 1WYCA 4UVBB 3IHRA 4I55E 4PFOA 3MKDA 5JDFA 3M65A 3K3OA 4QX8B 4JEHB 4D5UA 1OWAA 3N9PA 2XE2A 2YNKA 4RJXA 5E0OA 5FXXA 4FT6A 2D0TA 2GK9A 3HKCE 5JDGA 4ZHQE 3ZYMA 3Q9DA 2A72A 2E9XA 3UUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAA B;  3AAE B;  3LK3 B;  3LK2 A;  3AA6 A;  3LK4 2;  5AFU K;  5ADX L;  3LK4 1;  3AA7 B;  2KZ7 A;  1IZN B;  2KXP A;  3AA1 A;  4AKR A;  3AA0 B;  3AAA A;  3AAE A;  3LK3 A;  3LK2 B;  5AFU L;  3AA6 B;  5ADX K;  2KZ7 B;  3AA7 A;  2KXP B;  4AKR B;  1IZN A;  3AA1 B;  3AA0 A; 
#chains in the Genus database with same CATH topology
 3AE9 A;  2J4U P;  2Y6X A;  5LJM A;  2HHH T;  4XBF B;  2IUB A;  4ZXL A;  1ZHY A;  5KX5 E;  1D1A A;  4ASK A;  4CN6 A;  3LK2 B;  4E7S A;  1XNQ T;  3RBH A;  1WLX A;  3AE1 A;  3LBX A;  4Z90 A;  4JCH A;  2UXB T;  3RH3 A;  4X66 T;  3ZYL A;  4DR2 T;  3EMN X;  3ABV A;  4P1N A;  2CBJ A;  4DID B;  4N78 D;  2PFV A;  1KNZ A;  3MA9 A;  5LYJ E;  1IBL T;  2C5K T;  5LG3 A;  2IHR 1;  5IYU A;  3UU6 A;  2V7L A;  2X27 X;  2YU1 A;  1IBM T;  3HKB E;  2ODJ A;  5H2F O;  4GK5 E;  2P9B A;  3AE3 A;  3K3N A;  3GN5 B;  3FZL B;  1ZKE A;  3H37 A;  5AQH B;  2HPJ A;  3SY7 A;  2C5I T;  2XG6 A;  3BQL A;  3LK2 A;  4EAH A;  4UF0 B;  3ONX A;  3BK9 A;  2MOZ A;  2CWY A;  2WWU A;  3SYB A;  1YW0 A;  1S5L O;  2KT9 A;  2ZM2 A;  2XAJ B;  3FZM B;  3L3P A;  4COF A;  2W81 C;  3SYS A;  1MIV A;  1NAF A;  5HWY A;  2XQA A;  4EZH A;  2VWA A;  5C8Y E;  3G7G A;  5ABF B;  2SPC A;  5LHG B;  4DR3 T;  3SZV A;  4O49 A;  5J2T E;  4H9N C;  3VZW X;  4OYJ A;  4K0U A;  3W15 B;  2L9Q A;  3GN5 A;  3RKG A;  4UR9 A;  4PW8 A;  5PRN A;  4DBQ A;  2WAU A;  2LJL A;  2Q9Q A;  4YTN A;  4DV6 T;  4GCQ A;  3BS0 A;  1J5W A;  3RPU A;  5LXT E;  4LF5 T;  5FL1 A;  2V7M A;  5HCM A;  2UUC T;  1Q9G A;  1MM5 A;  3QOF A;  2N2M A;  2HN1 A;  4E7Z A;  5BMV E;  1IAP A;  4YTM A;  4LF7 T;  2XJ7 A;  1QLB A;  4I4T E;  4HWF A;  4EV6 A;  4AQF C;  1NEN A;  2YN6 A;  2DLR A;  2H7V C;  2W61 A;  3ONL C;  3EVY A;  4AYI D;  4KUM B;  3IEE A;  2LM9 A;  5HEH A;  5ABF A;  2C0S A;  1E7P A;  3PF1 A;  5G26 A;  3FXE B;  2V8S V;  3A8Y C;  2C5J A;  3FHN A;  4JFB A;  2OMF A;  2LKH A;  5HEG A;  3VKH A;  1ZV4 X;  3NKZ A;  3O4X E;  3PQU A;  5DL7 A;  3ZN0 B;  1Q9F A;  3RRW A;  5A1L A;  5FY1 A;  4O3W A;  2J4G A;  5G38 A;  3WI5 A;  2CEA A;  2JJ9 A;  2R6G F;  1IZN A;  2X67 A;  3T8O A;  1T16 A;  4QX7 B;  2VKH A;  2E9X C;  3KV9 A;  2X9H A;  4BAY B;  2LRK A;  4DR6 T;  4CN1 A;  3ZC0 A;  4C4V A;  3JTY A;  5EE2 A;  4O8S A;  2BKO A;  3O0E A;  5FP3 A;  1M7K A;  1WRD A;  2UUB T;  2EHO A;  3UFG A;  4HKA A;  4UV9 B;  3QB5 K;  1JNZ A;  2LM2 A;  4U3C A;  3CK6 A;  5JTG A;  4DMW A;  4AKH A;  5DAB A;  4OHF A;  4GK0 E;  2XAH B;  5HEO A;  2J47 A;  4H9R C;  3PUV F;  1GFM A;  2BKP A;  4FSP A;  4H9S E;  3P50 A;  4LF6 T;  4EB6 E;  1LVK A;  2XM2 A;  1HFA A;  4H63 V;  4H9P C;  3LK3 B;  4ZOL E;  3U3I A;  4QXC B;  2JPF A;  4NXM T;  5FYM A;  3CX7 B;  1D0Y A;  5ABG A;  4HFI A;  2UU9 T;  3DA4 A;  1UX4 A;  4QXB B;  5FMN A;  2XQY A;  2LKG A;  2D2S A;  1BR0 A;  1HNZ T;  3P4W A;  4B3R T;  4ZS2 A;  4TV8 E;  3E0Z A;  4CI3 B;  2HH7 A;  3F2E A;  3AVR A;  5IYZ E;  3ETU A;  2JQK A;  4X65 T;  3J9X 1;  4GYS A;  3ZCJ A;  2JMM A;  3PJA A;  5L4E A;  5JRE A;  2B76 A;  3MK7 C;  5L3C B;  3RQW A;  2R89 A;  2UUA T;  3DP7 A;  3PUS A;  1HR0 T;  4O3X B;  3TLS A;  2V7K A;  3C5O A;  2BDE A;  5F3J A;  3AE8 A;  5JQG E;  3SFE A;  3LK3 A;  3C4W A;  4UVC B;  2R4L A;  3DA3 A;  5CA1 E;  2CE7 A;  4A5X A;  3N9N A;  4LSF A;  3LSV A;  4CZZ B;  3NVO A;  5DL8 A;  3CQX C;  4GYR A;  4ZI7 E;  3PUG A;  4HFD A;  3QRC A;  3VE2 A;  4PK4 A;  1ZHW A;  4CXW A;  2K3W A;  1Y01 A;  1MND A;  2FJE A;  2CXF A;  4JBW F;  3C51 A;  3SY9 A;  5HEJ A;  2CA5 A;  3SWH A;  4AFK A;  3R6N A;  3AAA B;  2L3L A;  3PUX F;  3HR0 A;  4PAG A;  2XTL A;  4FRT A;  3RX6 A;  1HG5 A;  4AXP A;  5LNK A;  1HF8 A;  4ERR A;  2PG8 A;  1J5E T;  3A7M A;  4TWF A;  2R4P A;  1ZHX A;  2V7J A;  4AKR B;  4K3C A;  5L3E B;  3RYC E;  4X1I E;  2UXC T;  2NTY A;  3AA7 B;  2CLY B;  2E9X D;  2XQ4 A;  4ZS3 A;  3ZSS A;  5JDF A;  3K3O A;  2YNK A;  5E0O A;  3RF1 A;  4C00 A;  3QNU A;  3HKC E;  3UUN A;  4YSZ A;  2Y7S A;  3E22 E;  4MFR A;  4EXT A;  4GOU A;  1J1J A;  4QKN A;  3FBL A;  4FSO A;  3HKD E;  3T1Y T;  4ZZC A;  1GQE A;  5AQI B;  1YXR A;  1BT9 A;  4O2A E;  1WFD A;  1N36 T;  1LRZ A;  3C98 B;  3TZG A;  3VR9 A;  2NTX A;  2VB6 A;  1YD8 G;  2NW8 A;  4N58 A;  1DU2 A;  4U2Y A;  3OYX A;  4L0R A;  5JDN A;  5J1G A;  4YY3 T;  1HS7 A;  2JQ9 A;  4B61 A;  5AQN B;  4TUY E;  2ODV A;  4ILC A;  2X51 A;  3AA7 A;  1R8I A;  3I0Q A;  3JC6 C;  3C50 A;  4PR7 A;  2BKN A;  1HTJ F;  2NW9 A;  4TV9 E;  4NPP A;  1UK5 A;  2J1D G;  2BG9 C;  5AQG B;  5FXV A;  1KF6 A;  4PJM A;  2BBH A;  5AQM B;  3AAI A;  4KBM B;  2KC0 A;  3A5X A;  1JNR A;  2BS4 A;  5JDP A;  8PRN A;  4F6R C;  4IE7 A;  4HEA A;  2FUP A;  3ONJ A;  2V6Y B;  2E5L T;  2M6I A;  3AXJ B;  3L8R A;  1XWM A;  5AQS B;  5IWA T;  2CM0 A;  5AQQ B;  1LKX A;  4GCP A;  3FZK B;  4AQG A;  4D65 A;  4U33 A;  3VY8 X;  5HWX A;  7PRN A;  2WJQ A;  3ZC1 A;  1T72 A;  4PUX A;  5ABH A;  2G0U A;  3KFW X;  5CB4 E;  1OED C;  2LLY A;  1X79 A;  2POR A;  4B3M T;  1W09 A;  2WSS V;  3ANW B;  5M4Y A;  2VQE T;  2XE1 A;  2LSJ A;  3J7Y q;  4PJN A;  4OK0 A;  2ZFG A;  2AXD S;  3NZQ A;  3N9Q A;  3P7I A;  2LE8 A;  3RGL A;  4A98 A;  3TLV A;  4N59 A;  2W00 A;  4JI2 T;  3O1H A;  4U9C A;  2LHF A;  4U7I A;  4HFV A;  2LHR A;  2V6Y A;  3GMI A;  2PRN A;  5AQL B;  1T98 A;  1HNW T;  3HW9 A;  3PE0 A;  3VKG A;  2Y0L A;  5AQV B;  5LGU B;  3BQK A;  2MPK A;  3NRX A;  5LP6 E;  3Q5W A;  3VHL A;  2X0L B;  4Z8X A;  4QQ1 A;  3QRA A;  2ZMA A;  3EI0 A;  2YOE A;  3UFE A;  2E2A A;  4RLC A;  5GV0 A;  2JRK A;  4B3T T;  3DWN A;  4EOZ B;  3E08 A;  3ANW A;  1MM4 A;  4AKI A;  3ZMV B;  2WS3 A;  3JCU O;  2MAW A;  3OJA A;  3AB3 B;  3EHZ A;  1WYB A;  4GIW A;  4UV8 B;  3ETV A;  1WR0 A;  4DV1 T;  3RIU C;  1FEW A;  2ZLD A;  2FJA A;  1SE7 A;  4Z91 A;  2VK9 A;  2IC9 A;  2K4T A;  3EUH A;  5LHH B;  3OPC A;  4TNW A;  2IW5 B;  4N75 A;  4JV5 T;  2WU2 A;  1YKE B;  2V7I A;  3ZEF B;  3KV5 A;  4GHB A;  4AYE C;  2D0U A;  4UEL A;  3SFD A;  4TWD A;  4LF9 T;  4N74 A;  4UVA B;  4IE0 A;  2BVM A;  2OA5 A;  3H3A A;  3T0S A;  3CIR A;  3HA4 A;  2VAS A;  1P4T A;  3RIA A;  2QYW A;  3RKO A;  4TX5 A;  2A3D A;  3AEC A;  2F1C X;  5L3B B;  3ZMS B;  2BZB A;  3OTO T;  4WBN E;  3I1A A;  2IIU A;  3N2G E;  3N2K E;  4ZI3 C;  4AI6 A;  4TZ4 C;  4O4J E;  2CHO A;  4EZ4 A;  3N9M A;  3POR A;  4EEB A;  3LK4 1;  3OYZ A;  2FBW A;  4CXY A;  1ZHT A;  1AJ3 A;  4Q25 A;  5TAO A;  4PNI A;  3KV6 A;  2KZ7 B;  4UF0 A;  4O4X A;  5AQU B;  3P4S A;  4IE5 A;  4DBR A;  1IBK T;  3PGR A;  2YEV C;  3AE6 A;  2VKD A;  4JI0 T;  4IDN A;  2MHL A;  3JAF A;  3KVB A;  4H9O C;  4PJ0 O;  2IML A;  3UU5 A;  4IDZ A;  3ZLI A;  2HPL A;  4QH5 A;  4O3Z A;  2Y8D A;  4U74 A;  3GA8 A;  1XDP A;  2X9Y A;  4A56 A;  4I50 E;  2YKS A;  5FY7 A;  1G73 A;  4LSI A;  2AXT O;  5D5D A;  2ODU A;  2ACZ A;  2Z6E A;  3VRB A;  3TLW A;  3T1H T;  2JMH A;  2XQ6 A;  3RYH E;  5JR9 B;  2XTR A;  3C64 A;  2D9D A;  4G2A A;  4LF4 T;  2MNH A;  1HXT A;  3F57 A;  5AFU K;  3Q5E A;  2R4N A;  2KND A;  1Z0P A;  3PUZ F;  2WZH A;  2IWV A;  2WY2 A;  2OV9 A;  3N5L A;  4KR4 A;  4P0A A;  2Q9Q C;  5EK2 A;  3SS1 A;  3S4U A;  4FZM A;  2YDQ A;  3N9L A;  2RPA A;  2WMO A;  1GFN A;  3VZU X;  3VR8 A;  4DR7 T;  4CN4 A;  5F5W A;  1IJ6 A;  2K5B B;  4DR5 T;  2PTF A;  2K0L A;  2QA7 A;  2XSB A;  3M3Z B;  1FIO A;  5HXE A;  1OPF A;  2NW7 A;  5L3F B;  2A2F X;  2DNX A;  2XUE A;  4P0B A;  1MIY A;  4MBQ A;  1HXX A;  4FZN A;  3CKD A;  1QJ9 A;  3A2S X;  4TN7 B;  1HCI A;  5JR9 A;  1I6Z A;  1Z8U A;  2ERV A;  4HWD A;  4QH4 A;  4IGU A;  1PRN A;  3V8U A;  1BR4 A;  2DHR A;  4JI6 T;  4MAL A;  5HYA A;  2XSA A;  2XHE B;  2WP9 A;  2V1D B;  3MKD A;  1YQ4 A;  4QX8 B;  4JEH B;  3A0H O;  4D5U A;  1OWA A;  2D0T A;  2GK9 A;  2M6B A;  4M1P A;  1MMA A;  5JH7 E;  4JI1 T;  5LGT B;  2W66 A;  1SUM B;  4P09 A;  3TLT A;  3GWH A;  2W67 A;  3K1S A;  3L39 A;  2F1T A;  3LK4 2;  5DQW A;  3RI5 A;  2BBJ A;  2IC6 A;  2VUR A;  1XDO A;  4HTE A;  4X64 T;  2R88 A;  3DTO A;  3MAC A;  1QSD A;  2XY8 B;  5FXW A;  5LJN A;  4YHJ A;  4RLB A;  5LHI B;  2MYS A;  2XTQ A;  1YQ3 A;  2LRL A;  3OBV E;  1MIW A;  2EHO C;  3Q5X A;  5JRC B;  4KHP T;  5AQO B;  4EYY R;  1MMG A;  3O1J A;  1T7S A;  5DJQ C;  5JDQ A;  2YDR A;  4JI8 T;  5H6Q B;  5CA0 E;  2W4X A;  4DV0 T;  5B5E O;  4FI5 A;  2FGR A;  4YFS A;  4IDO A;  3CVR A;  1LVF A;  5J2U E;  4KMC A;  4AKG A;  2XQ3 A;  1OED E;  4CI1 B;  3NSG A;  2WCA A;  5FKY A;  4UEM A;  3UAQ A;  4AZL A;  3NZP A;  3EDV A;  2RA1 A;  4DO0 A;  3FBZ A;  5ADX K;  1GFQ A;  4FJO A;  3AE5 A;  3I9W A;  4UIG A;  1G8X A;  4LFA T;  1B7T A;  2NP9 A;  4C91 A;  1WR6 A;  3PU3 A;  2LOP A;  3K3Q C;  2IDO B;  4IL4 A;  5HCJ A;  4RL9 A;  2LHN A;  1E1H B;  1ORM A;  5KAI O;  2XQ8 A;  3ZT6 A;  3JAD A;  4ILA A;  3VRA A;  3JAE A;  5JRC A;  2K9A A;  3UUM A;  1N32 T;  4HN9 A;  4TWH A;  2M06 A;  3L09 A;  2WMN A;  4E1T A;  1Y64 B;  4HGA A;  1OED B;  3FZH B;  4B3S T;  3PTR B;  4H9Q C;  3VY9 X;  2Q9Q D;  3UU4 A;  4LSE A;  5LOV E;  1HX1 B;  3JCF A;  2BS3 A;  2X9X A;  4V1A v;  3MZK B;  3RYI E;  3OKQ A;  2V26 A;  2PJQ A;  2H3R A;  2DWG A;  3AAA A;  2XAS B;  4EIW A;  1ZHZ A;  4EYU A;  1UGO A;  2VVS A;  3PJA J;  3PUW F;  4WNK A;  1N33 T;  3P4R A;  4U7Y A;  2ZM6 T;  2KMF A;  1MMD A;  4X5T A;  2WVP A;  1KK7 A;  2DWK A;  4HE8 A;  2IWW A;  4GF4 A;  1YS5 A;  2XZE A;  4X20 E;  4HFB A;  1V9D A;  4AKR A;  4AKM A;  4L9I A;  2XAF B;  4CXX A;  2YU2 A;  3AEE A;  2KXP B;  2DL1 A;  2VKJ A;  4ZI2 C;  2KDY A;  2KLQ A;  4CTD A;  2F1V A;  4IDQ A;  3KBU A;  4DR1 T;  4DV4 T;  2J1N A;  2UXX B;  1T1L A;  2N2N A;  3V5U A;  3LJC A;  1XZY A;  3AA6 B;  1MMN A;  2J62 A;  4F8H A;  4FES A;  3FXD B;  4KP3 C;  2QVA A;  2Y48 B;  4K3B A;  2AE9 A;  2XE3 A;  4E1S A;  4YLH A;  3RC8 A;  2E8I A;  5KMG P;  5LB7 B;  4PK5 A;  3AEF A;  2EHO D;  2WDR A;  4PK6 A;  4LFC T;  4GCS A;  1VCS A;  4I0U A;  2WJR A;  2XM1 A;  3UT5 E;  4IE6 A;  3NJT A;  4OX9 T;  4JI5 T;  2N2L A;  3I0O A;  4IE4 A;  2LSG A;  2Y0H A;  3BRZ A;  3KBT A;  5HXS A;  3UUL A;  1E2A A;  4XNL A;  3T24 A;  4DMV A;  1I94 T;  2LSK A;  3ZST A;  1UX5 A;  5CGM A;  1YKH B;  3RIF A;  1ZEE A;  3WAK A;  2N1G A;  5JDH A;  4RJW A;  2XPK A;  3D0T A;  5EK4 A;  2F4V T;  2I6H A;  3EDU A;  1QUU A;  4DR4 T;  5G39 A;  3MJX A;  3QC9 A;  1X9B A;  2NWB A;  3AA6 A;  5FNV E;  2X9W A;  3AVS A;  4WW0 A;  5B66 O;  3WAJ A;  5HAX A;  3ZMU B;  3UU3 A;  2CCQ A;  3PU8 A;  3NWI A;  3HL6 A;  2X0H A;  3AXJ A;  1H7C A;  5AQF B;  3TLU A;  4O4L E;  2CBI A;  5JVD E;  5HXH A;  1HG2 A;  4ISS A;  5TIS O;  4AYM C;  2WB5 A;  2XAG B;  4ADZ A;  4MHC A;  3DWO X;  4NUV A;  3UU8 A;  5AQR B;  1NWM X;  5L4H A;  4FRX A;  5LBQ B;  4MLK A;  4QHO A;  4OYK A;  4DV7 T;  2VL8 A;  5DL6 A;  3I9Y A;  4HWC A;  4ILB A;  1UUR A;  4J2C A;  4GKK T;  2WU5 A;  5DL5 A;  4BA9 A;  1ZHC A;  4KRA A;  4JLE A;  5LCY A;  2CXL A;  3OVU A;  2HN2 A;  2V6X A;  1CUN A;  3K19 A;  3B13 A;  2UXN B;  4IRE A;  4X1Y E;  2XQ7 A;  2L8K A;  5L3G B;  2E9X B;  3HI2 A;  4AKL A;  1BR1 A;  2ACX A;  3ZCI A;  2DCF A;  1FJG T;  1IJ5 A;  1E54 A;  2WZI A;  4FUV A;  4H63 H;  4PJL A;  4AUI A;  5ETW A;  2A9U A;  4AQF A;  2Q9Q B;  5EK3 A;  5FL0 A;  1ZOY A;  3Q2M A;  2OLT A;  1D1C A;  4ZI2 D;  2VVN A;  3JC6 D;  1MNE A;  1WCR A;  2KIN B;  3QK6 A;  5F8P A;  4UB8 O;  4NIQ A;  3VU7 H;  3RC3 A;  3AEG A;  2WDV A;  4HWH A;  3F31 A;  2X9K A;  4O2B E;  3AA1 B;  4KX6 A;  4B6X A;  1O3X A;  5G3A A;  2UXD T;  5JDL A;  3RRC A;  4CI2 B;  2H88 A;  3HOL A;  4IST A;  4CQI A;  3CX8 B;  3NRY A;  1QJP A;  5L47 A;  3POX A;  2JQH A;  5FVK A;  1WYC A;  4UVB B;  2KSR A;  3M65 A;  3G06 A;  2XE2 A;  5C3J A;  4RJX A;  4FT6 A;  5JDG A;  4ZHQ E;  3ZYM A;  2E9X A;  1HXU A;  1W0A A;  2WQY A;  1HNX T;  2WBL A;  4BJN A;  3ZN1 B;  3SOL A;  1S35 A;  4LML A;  1IZN B;  4DUZ T;  4LF8 T;  3UUB A;  4IIJ E;  4YJ2 E;  2ZM8 A;  4XZC A;  4LMJ A;  3QUJ A;  2ZM0 A;  4HFC A;  4UB6 O;  4JYA T;  3CX6 B;  2XAQ B;  1BR2 A;  3V5S A;  5KXJ A;  4C4V B;  3ZT5 A;  2FJB A;  4LSH A;  4YTP A;  2WDQ A;  5H6R B;  3O9X A;  1GFP A;  2DI4 A;  5T5F A;  2MBG A;  2VQF T;  5C2T A;  2QTK A;  4PJJ A;  2EHO B;  1BXW A;  3AA1 A;  4Z3T A;  4OFZ A;  4C69 X;  1GFO A;  4HFH A;  3KZI O;  3FB2 A;  4I43 B;  3CPZ A;  1NEK A;  2JQQ A;  4IL6 O;  5CFB A;  2W62 A;  2KZ7 A;  4JUY A;  3C4X A;  5FY0 A;  6PRN A;  1CHU A;  1U4Q A;  4DVD A;  2FGQ X;  4O4I E;  5DQV A;  3BRY A;  2X0Y A;  5LG4 A;  4U31 A;  4GKJ T;  2CMR A;  3ZJ2 A;  5LMN T;  2XE5 A;  1M62 A;  4YT0 A;  3AE7 A;  3A0B O;  2GE4 A;  3TKL B;  4KR8 A;  2RP4 A;  3UQ7 A;  4C90 A;  3X1D A;  5IHY A;  2FJD A;  2O4V A;  5AQK B;  2CHN A;  1U5P A;  4D64 A;  2JMK A;  2V5C A;  5J0Z A;  3DZM A;  5LA6 E;  3RLF F;  5EZY E;  3GP6 A;  3ZMT B;  1OSM A;  3ZPO A;  3POQ A;  2X68 A;  3EAB A;  4F4B A;  3P4Q A;  4IT4 A;  2W0G A;  1XNR T;  4UXN B;  1SA0 E;  2VKO A;  3NBX X;  5GON E;  5HXR A;  3PUY F;  2CPT A;  1UUS A;  2K48 A;  3P8C D;  1D0Z A;  2W2U A;  4K0K T;  5FVL A;  2LOS A;  2YPV A;  2Y0K A;  2LSY A;  2BG9 E;  5GTI O;  2XQ5 A;  4DV3 T;  1D1B A;  4G75 A;  3K8P C;  4EED A;  3RQU A;  4ZZB A;  1XMQ T;  4DV5 T;  2R8A A;  2IAK A;  3AE4 A;  3BQI A;  4QXH B;  4QWN B;  3VZT X;  1BH3 A;  1UCU A;  4ZI3 D;  3N2O A;  5LGN B;  3LDQ B;  3HKE E;  4HWI B;  4O4H E;  1T8B A;  5AQP B;  4WZX A;  3AE2 A;  4FMS A;  4YJ3 E;  4JI4 T;  2M07 A;  5HEU A;  4DND A;  2NOX A;  4IHJ E;  4X1K E;  4FOZ A;  2MTQ A;  1VOM A;  2WWV A;  3Q5D A;  2W63 A;  4XNK A;  2BG9 B;  2VL0 A;  3ZMZ B;  5JR9 C;  1VCT A;  1KFY A;  2KWI B;  3AA0 B;  4AIU A;  3FZF B;  4EGW A;  2D5U A;  3KV4 A;  5CJ5 A;  4O4U A;  3VE1 A;  1KNP A;  5KAF O;  3KVD D;  1ZP0 A;  3UUX B;  4WBO A;  1L0V A;  2CRB A;  4YXD A;  2LFU A;  3AAE B;  5L3D B;  4YSX A;  2JQY A;  3CWZ B;  5LBM A;  2QRX A;  3AEB A;  4DV2 T;  5LMU T;  5ABE A;  5JDM A;  3PQS A;  2ZLY A;  2JIW A;  3PV0 F;  3R84 B;  3PGS A;  1KEY A;  3LG7 A;  4G63 A;  3AEA A;  3WU2 O;  5IUX A;  3P4P A;  1THQ A;  2I0M A;  3LFM A;  2M67 A;  3PUQ A;  1OXZ A;  3C4Z A;  4JI3 T;  1XMO T;  2YDS A;  3SZD A;  3ZYK A;  1SHZ C;  3RHW A;  5AFU L;  1FMW A;  2H7O A;  1HX8 A;  4NUU A;  3ZT7 A;  1D0X A;  2BG9 A;  2N9D A;  4HFE A;  3KDS E;  2BVL A;  3AA0 A;  4YSY A;  4G76 A;  2CWO A;  3PUR A;  3POU A;  4ILU A;  4IDP A;  4FQE A;  3DJB A;  2R4O A;  4ANJ A;  3AAE A;  3UPG A;  3PRN A;  4TNV A;  4WYV A;  1N34 T;  1FMV A;  3CML A;  5E79 O;  4JEU B;  1EZ3 A;  3KVA A;  3CQG B;  3RYF E;  4DUY T;  1S94 A;  1OED A;  5L2L A;  4JI7 T;  3U78 A;  3ZKR A;  3ZJ1 A;  2CXD A;  3WI4 A;  4FZL A;  2H89 A;  3IF8 B;  4PFP A;  4AIS A;  3CQC B;  4AYN A;  3H3M A;  3IBP A;  2BS2 A;  3PDY A;  3PGU A;  2E5V A;  3PUA A;  2I59 A;  4AYD C;  3O1I A;  3UQ4 A;  3HOE A;  1G90 A;  2X66 A;  2PBI A;  4BUM X;  5KDM C;  2B1E A;  3FYX A;  2KWH A;  4U2Z A;  1PHO A;  4KI0 F;  1W9R A;  5AQJ B;  4QH1 A;  2NR4 A;  4O3Y A;  5FXZ A;  1US7 B;  3UTK A;  5FVN A;  4A97 A;  4U72 A;  3EAM A;  3UU2 A;  3N9O A;  1MPF A;  2LEH A;  4L5G A;  2KXP A;  3KIN B;  3QB5 A;  3B57 A;  1W0B A;  4BJM A;  3AED A;  3LBX B;  2Y2X A;  3T20 A;  1VRB A;  4KHZ F;  4LMK A;  5AQT B;  2WM9 A;  4LFB T;  1H6S 1;  2K24 A;  4AQY T;  3MXZ A;  4X62 T;  3WI3 A;  3SRZ A;  1KNR A;  2YK0 A;  4XAX B;  2LT3 A;  3ESL A;  2QGS A;  4ZEY A;  1QJ8 A;  2CLY C;  5ADX L;  2YIN A;  3RIU A;  2LSI A;  5GTH O;  2V5D A;  3HWB A;  2XMX A;  2ES0 A;  3IA3 A;  2W80 C;  5BR8 T;  5HXC A;  3B5M A;  3IHR A;  4I55 E;  4PFO A;  3N9P A;  4NXN T;  2XQ9 A;  5FXX A;  4IL9 A;  3Q9D A;  2A72 A;  4YHH T; 
#chains in the Genus database with same CATH homology
 5LGT B;  2J4U P;  4P09 A;  2Y6X A;  2Y7S A;  3E22 E;  4MFR A;  3GWH A;  5LJM A;  4EXT A;  3LK4 2;  2F1T A;  4GOU A;  5DQW A;  2WBL A;  4BJN A;  3ZN1 B;  3SOL A;  4XBF B;  1S35 A;  2IC6 A;  4QKN A;  3FBL A;  1IZN B;  4HTE A;  1ZHY A;  5KX5 E;  1D1A A;  4IIJ E;  4YJ2 E;  4FSO A;  3DTO A;  4ASK A;  3HKD E;  2ZM8 A;  4XZC A;  3LK2 B;  1QSD A;  3MAC A;  3QUJ A;  5FXW A;  5LJN A;  2ZM0 A;  4YHJ A;  4E7S A;  1MMA A;  3CX6 B;  2XAQ B;  1BT9 A;  1BR2 A;  3V5S A;  4O2A E;  1WLX A;  4RLB A;  3RBH A;  5LHI B;  2MYS A;  1LRZ A;  3LBX A;  2XTQ A;  3C98 B;  4LSH A;  3TZG A;  2NTX A;  5H6R B;  3O9X A;  1GFP A;  2DI4 A;  3OBV E;  4JCH A;  2MBG A;  1MIW A;  2EHO C;  3Q5X A;  3RH3 A;  5T5F A;  3ZYL A;  5JRC B;  3EMN X;  2VB6 A;  1YD8 G;  2NW8 A;  1MMG A;  3O1J A;  4EYY R;  2QTK A;  4PJJ A;  4N58 A;  2EHO B;  5DJQ C;  1HXX A;  5JDQ A;  1BXW A;  3AA1 A;  4Z3T A;  4OFZ A;  3OYX A;  4L0R A;  5JDN A;  5J1G A;  1HS7 A;  4C69 X;  4N78 D;  2PFV A;  1KNZ A;  4B61 A;  1GFO A;  4TUY E;  5H6Q B;  3MA9 A;  2ODV A;  5CA0 E;  5LYJ E;  2C5K T;  4FI5 A;  2X51 A;  3AA7 A;  3FB2 A;  2FGR A;  4I43 B;  3CPZ A;  3I0Q A;  3JC6 C;  3C50 A;  4YFS A;  5IYU A;  3CVR A;  1HTJ F;  1LVF A;  2NW9 A;  2V7L A;  4KMC A;  4TV9 E;  5J2U E;  2X27 X;  2YU1 A;  2J1D G;  4AKG A;  2JQQ A;  5FXV A;  4PJM A;  4CI1 B;  3NSG A;  3HKB E;  2W62 A;  2KZ7 A;  3AAI A;  4JUY A;  2ODJ A;  3C4X A;  5FY0 A;  4KBM B;  2KC0 A;  4UEM A;  3A5X A;  4GK5 E;  3UAQ A;  6PRN A;  4AZL A;  3NZP A;  4DVD A;  1U4Q A;  3EDV A;  2P9B A;  2RA1 A;  3K3N A;  2FGQ X;  3GN5 B;  1ZKE A;  3FBZ A;  3H37 A;  4O4I E;  5DQV A;  4DO0 A;  8PRN A;  5JDP A;  4F6R C;  5LG4 A;  5ADX K;  4IE7 A;  4FJO A;  4HEA A;  1GFQ A;  2CMR A;  3ZJ2 A;  2XE5 A;  3I9W A;  4UIG A;  2HPJ A;  3SY7 A;  2C5I T;  1G8X A;  2XG6 A;  3BQL A;  1B7T A;  2NP9 A;  3LK2 A;  4EAH A;  2GE4 A;  3TKL B;  1WR6 A;  3PU3 A;  2LOP A;  3K3Q C;  4C91 A;  4UF0 B;  3ONX A;  3BK9 A;  2MOZ A;  2CM0 A;  4KR8 A;  2CWY A;  2WWU A;  2RP4 A;  4C90 A;  5IHY A;  4RL9 A;  2O4V A;  1E1H B;  2LHN A;  1ORM A;  3SYB A;  1LKX A;  1YW0 A;  4GCP A;  2KT9 A;  4AQG A;  4D65 A;  1U5P A;  3VY8 X;  2ZM2 A;  5HWX A;  2XAJ B;  7PRN A;  3L3P A;  5JRC A;  2K9A A;  3UUM A;  2JMK A;  4D64 A;  3ZC1 A;  2W81 C;  3SYS A;  1MIV A;  1NAF A;  4HN9 A;  5HWY A;  5LA6 E;  5EZY E;  3GP6 A;  3ZMT B;  4PUX A;  4EZH A;  2VWA A;  2M06 A;  2G0U A;  5C8Y E;  1OSM A;  3KFW X;  3G7G A;  3L09 A;  2WMN A;  5CB4 E;  3ZPO A;  2SPC A;  4E1T A;  1Y64 B;  4HGA A;  1X79 A;  2POR A;  3POQ A;  5LHG B;  2WSS V;  3ANW B;  5M4Y A;  2X68 A;  3SZV A;  4O49 A;  4F4B A;  5J2T E;  4H9N C;  2LSJ A;  2XE1 A;  3J7Y q;  2W0G A;  3VZW X;  4OYJ A;  3PTR B;  4PJN A;  4H9Q C;  4OK0 A;  4UXN B;  1SA0 E;  2ZFG A;  3VY9 X;  2VKO A;  3NZQ A;  2Q9Q D;  4K0U A;  3NBX X;  5GON E;  5HXR A;  3N9Q A;  4LSE A;  5LOV E;  3P7I A;  2LE8 A;  2K48 A;  3P8C D;  3W15 B;  1D0Z A;  2L9Q A;  2YPV A;  2LOS A;  2Y0K A;  3GN5 A;  2X9X A;  2LSY A;  4V1A v;  3MZK B;  4PW8 A;  4N59 A;  5PRN A;  2W00 A;  3O1H A;  3RYI E;  3OKQ A;  4DBQ A;  1D1B A;  2V26 A;  4G75 A;  4U9C A;  2WAU A;  2LJL A;  2H3R A;  2PJQ A;  2Q9Q A;  3K8P C;  1HXU A;  2LHF A;  4HFV A;  2LHR A;  3GMI A;  2PRN A;  4GCQ A;  2DWG A;  1T98 A;  3AAA A;  2XAS B;  3HW9 A;  4EIW A;  1ZHZ A;  3PE0 A;  3RPU A;  4EYU A;  5LXT E;  3VKG A;  2Y0L A;  5LGU B;  3BQK A;  2IAK A;  2V7M A;  3NRX A;  5LP6 E;  1Q9G A;  1MM5 A;  3BQI A;  4QXH B;  2N2M A;  4QWN B;  3VZT X;  4WNK A;  4E7Z A;  3Q5W A;  5BMV E;  1BH3 A;  1IAP A;  3VHL A;  2KMF A;  1MMD A;  2X0L B;  1UCU A;  4I4T E;  4Z8X A;  3N2O A;  1KK7 A;  4ZI3 D;  4AQF C;  5LGN B;  4QQ1 A;  3QRA A;  2DLR A;  2H7V C;  2W61 A;  2ZMA A;  2DWK A;  3HKE E;  4HE8 A;  4O4H E;  3EVY A;  4GF4 A;  4AYI D;  4KUM B;  1H6S 1;  1YS5 A;  4X20 E;  3IEE A;  1V9D A;  4AKR A;  3UFE A;  2LM9 A;  4RLC A;  5GV0 A;  4AKM A;  4FMS A;  2C0S A;  2JRK A;  4L9I A;  2XAF B;  4CXX A;  2YU2 A;  4EOZ B;  3FXE B;  4YJ3 E;  5G26 A;  2M07 A;  3E08 A;  4DND A;  2NOX A;  2C5J A;  2KXP B;  3FHN A;  3ANW A;  4IHJ E;  4X1K E;  1MM4 A;  4FOZ A;  2VKJ A;  3ZMV B;  4ZI2 C;  4AKI A;  2KDY A;  4JFB A;  2OMF A;  2MTQ A;  3VKH A;  1ZHX A;  2KLQ A;  3OJA A;  1ZV4 X;  3AB3 B;  3O4X E;  2F1V A;  1WYB A;  3PQU A;  5DL7 A;  4GIW A;  4UV8 B;  3ZN0 B;  3ETV A;  1VOM A;  1Q9F A;  3RRW A;  3KBU A;  2W63 A;  5A1L A;  4XNK A;  3ZMZ B;  2J1N A;  2UXX B;  5JR9 C;  2N2N A;  2KWI B;  3AA0 B;  1FEW A;  5FY1 A;  3V5U A;  3LJC A;  2D5U A;  3KV4 A;  4O3W A;  2ZLD A;  4O4U A;  3VE1 A;  3AA6 B;  1MMN A;  4FES A;  2VK9 A;  3KVD D;  2IC9 A;  3FXD B;  4KP3 C;  2K4T A;  3EUH A;  5LHH B;  3WI5 A;  2Y48 B;  2IW5 B;  2CEA A;  2XE3 A;  2JJ9 A;  1IZN A;  3UUX B;  2X67 A;  4WBO A;  4E1S A;  4YLH A;  3RC8 A;  2E8I A;  2LFU A;  3AAE B;  5KMG P;  5L3D B;  3T8O A;  1YKE B;  2V7I A;  3ZEF B;  4QX7 B;  2VKH A;  3KV5 A;  2E9X C;  3KV9 A;  4GHB A;  3CWZ B;  4PK5 A;  4AYE C;  5LBM A;  2EHO D;  2X9H A;  2D0U A;  4PK6 A;  4GCS A;  4BAY B;  5JDM A;  3PQS A;  2ZLY A;  3ZC0 A;  4UEL A;  3UT5 E;  4IE6 A;  3JTY A;  5EE2 A;  4O8S A;  2N2L A;  3R84 B;  3O0E A;  3I0O A;  4M1P A;  3LG7 A;  5FP3 A;  4IE4 A;  2LSG A;  1WRD A;  4UVA B;  2Y0H A;  2EHO A;  4IE0 A;  2BVM A;  3KBT A;  4G63 A;  5HXS A;  4HKA A;  3UUL A;  4UV9 B;  4XNL A;  2OA5 A;  3H3A A;  1THQ A;  3T0S A;  3LFM A;  2M67 A;  4DMV A;  3T24 A;  3HA4 A;  2VAS A;  2LSK A;  3PUQ A;  1P4T A;  1UX5 A;  1OXZ A;  1YKH B;  3C4Z A;  1ZEE A;  3RKO A;  4TX5 A;  3WAK A;  2A3D A;  2N1G A;  4DMW A;  5JDH A;  3SZD A;  4AKH A;  5DAB A;  4RJW A;  4OHF A;  3ZYK A;  5L3B B;  1SHZ C;  4GK0 E;  3D0T A;  2XAH B;  5AFU L;  3ZMS B;  2BZB A;  1FMW A;  2H7O A;  1HX8 A;  4H9R C;  5EK4 A;  3I1A A;  4NUU A;  4WBN E;  1GFM A;  3N2G E;  1D0X A;  3N2K E;  2N9D A;  3EDU A;  4H9S E;  4TZ4 C;  3KDS E;  4ZI3 C;  4AI6 A;  1QUU A;  4FSP A;  2BVL A;  4O4J E;  4EB6 E;  3AA0 A;  3MJX A;  1LVK A;  3QC9 A;  4EZ4 A;  3N9M A;  1HFA A;  4H63 V;  4G76 A;  4H9P C;  3LK3 B;  2CWO A;  2NWB A;  3POR A;  4ZOL E;  3U3I A;  3AA6 A;  4QXC B;  5FNV E;  2X9W A;  3AVS A;  3PUR A;  4WW0 A;  3LK4 1;  3POU A;  4ILU A;  3WAJ A;  5HAX A;  2JPF A;  3ZMU B;  5FYM A;  2CCQ A;  3PU8 A;  3OYZ A;  3CX7 B;  3DJB A;  1D0Y A;  4CXY A;  1ZHT A;  1AJ3 A;  4ANJ A;  3AAE A;  5TAO A;  4PNI A;  3HL6 A;  3DA4 A;  1H7C A;  3KV6 A;  2KZ7 B;  3UPG A;  4UF0 A;  4O4X A;  1UX4 A;  4QXB B;  5FMN A;  4O4L E;  3PRN A;  2XQY A;  5JVD E;  5HXH A;  2D2S A;  1BR0 A;  4IE5 A;  4DBR A;  1HG2 A;  2YEV C;  4ISS A;  4ZS2 A;  2VKD A;  4AYM C;  4TV8 E;  2XAG B;  3E0Z A;  4ADZ A;  4CI3 B;  4MHC A;  2MHL A;  1FMV A;  3CML A;  4NUV A;  2HH7 A;  3KVB A;  4H9O C;  3F2E A;  1NWM X;  3AVR A;  5IYZ E;  3ETU A;  4FZN A;  4IDZ A;  3J9X 1;  3ZLI A;  4GYS A;  2HPL A;  4JEU B;  3ZCJ A;  1EZ3 A;  3KVA A;  2JMM A;  5JRE A;  4O3Z A;  4FRX A;  2Y8D A;  3CQG B;  3RYF E;  3MK7 C;  1S94 A;  4U74 A;  3GA8 A;  5L3C B;  2X9Y A;  4A56 A;  4I50 E;  3DP7 A;  5L2L A;  3PUS A;  4O3X B;  5LBQ B;  5FY7 A;  1G73 A;  4LSI A;  2V7K A;  4MLK A;  4QHO A;  3C5O A;  4OYK A;  3U78 A;  5D5D A;  2ODU A;  2BDE A;  3ZJ1 A;  2CXD A;  5F3J A;  2VL8 A;  3WI4 A;  2Z6E A;  5DL6 A;  5JQG E;  2JMH A;  3I9Y A;  3LK3 A;  3RYH E;  3C4W A;  4UVC B;  5JR9 B;  2XTR A;  4FZL A;  3IF8 B;  4PFP A;  3C64 A;  3CQC B;  4G2A A;  3DA3 A;  3IBP A;  4AYN A;  4J2C A;  5CA1 E;  3PDY A;  5DL5 A;  2CE7 A;  3N9N A;  4LSF A;  3PUA A;  2I59 A;  4BA9 A;  4CZZ B;  5DL8 A;  3CQX C;  4GYR A;  1ZHC A;  2MNH A;  4JLE A;  4KRA A;  5LCY A;  4AYD C;  4ZI7 E;  3O1I A;  2CXL A;  1HXT A;  3F57 A;  5AFU K;  3HOE A;  1CUN A;  3K19 A;  3PUG A;  2X66 A;  3B13 A;  1G90 A;  2PBI A;  4BUM X;  5KDM C;  2B1E A;  3FYX A;  2KWH A;  2UXN B;  4X1Y E;  2KND A;  3QRC A;  1Z0P A;  2L8K A;  5L3G B;  2E9X B;  3HI2 A;  4AKL A;  1BR1 A;  2ACX A;  4PK4 A;  1PHO A;  1ZHW A;  3VE2 A;  4CXW A;  3N5L A;  4KR4 A;  4P0A A;  3ZCI A;  2DCF A;  2Q9Q C;  5EK2 A;  1IJ5 A;  1E54 A;  1MND A;  4FUV A;  4H63 H;  2CXF A;  4PJL A;  4AUI A;  5ETW A;  3S4U A;  3SS1 A;  4FZM A;  3N9L A;  2WMO A;  3C51 A;  3SY9 A;  4AQF A;  2Q9Q B;  1GFN A;  4O3Y A;  3VZU X;  5EK3 A;  3Q2M A;  5FXZ A;  2CA5 A;  1US7 B;  1D1C A;  3R6N A;  3SWH A;  3AAA B;  4AFK A;  3UTK A;  5FVN A;  2L3L A;  4ZI2 D;  3JC6 D;  3HR0 A;  1MNE A;  2KIN B;  3QK6 A;  5F8P A;  4PAG A;  2XTL A;  4FRT A;  4U72 A;  3RX6 A;  1HG5 A;  3UU2 A;  1IJ6 A;  3N9O A;  3VU7 H;  2K5B B;  2LEH A;  4L5G A;  3RC3 A;  4AXP A;  5LNK A;  3KIN B;  1MPF A;  1HF8 A;  2KXP A;  3B57 A;  4ERR A;  2K0L A;  4BJM A;  2QA7 A;  3LBX B;  2Y2X A;  2PG8 A;  1FIO A;  3T20 A;  1VRB A;  5HXE A;  1OPF A;  2NW7 A;  5L3F B;  2A2F X;  2DNX A;  2XUE A;  2WM9 A;  3F31 A;  4P0B A;  1MIY A;  2K24 A;  4MBQ A;  3MXZ A;  2V7J A;  4O2B E;  3WI3 A;  4AKR B;  3CKD A;  3AA1 B;  3SRZ A;  4B6X A;  5JH7 E;  1O3X A;  1QJ9 A;  5L3E B;  3A2S X;  2YK0 A;  4TN7 B;  1HCI A;  4XAX B;  2LT3 A;  3ESL A;  3RYC E;  2QGS A;  5JR9 A;  3RRC A;  4CI2 B;  5JDL A;  2ERV A;  1QJ8 A;  2CLY C;  4X1I E;  2YIN A;  5ADX L;  4IST A;  2LSI A;  2NTY A;  3HOL A;  3AA7 B;  4CQI A;  3CX8 B;  3NRY A;  4IGU A;  1PRN A;  1QJP A;  3HWB A;  3POX A;  3V8U A;  1BR4 A;  2XMX A;  2DHR A;  2CLY B;  2ES0 A;  2E9X D;  4ZS3 A;  2W80 C;  4MAL A;  5HYA A;  2XHE B;  5HXC A;  2V1D B;  1WYC A;  4UVB B;  3IHR A;  4I55 E;  4PFO A;  3MKD A;  5JDF A;  3M65 A;  3K3O A;  4QX8 B;  4JEH B;  4D5U A;  1OWA A;  3N9P A;  2XE2 A;  2YNK A;  4RJX A;  5E0O A;  5FXX A;  4FT6 A;  2D0T A;  2GK9 A;  3HKC E;  5JDG A;  4ZHQ E;  3ZYM A;  3Q9D A;  2A72 A;  2E9X A;  3UUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...