3AA0B

Crystal structure of actin capping protein in complex with the cp-binding motif derived from carmil
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
243
structure length
243
Chain Sequence
b'SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-1
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 85
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aa0B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aa0B02
3AAEB 5AFUL 3AAAB 3LK2A 3AA7B 3AA1B 5ADXL 2KXPA 3AA6B 1IZNB 3AA6A 3AA0B 4AKRA 3LK42 3LK3A 2KZ7A 3LK2B 3AAEA 3LK41 2KXPB 5AFUK 4AKRB 3AAAA 3AA7A 3AA1A 3LK3B 1IZNA 5ADXK 3AA0A 2KZ7B
chains in the Genus database with same CATH superfamily
2ODUA 4GKJT 3HOLA 2LE8A 4LF5T 4AYDC 4XNKA 4G75A 2CWOA 5H6QB 2LM2A 2Y48B 3IBPA 3FXDB 1WCRA 2CLYB 4HKAA 3KVAA 4EIWA 3AAEA 2GE4A 5LBQB 4M1PA 4YJ2E 4CZZB 2QYWA 3QC9A 1D0XA 5EK3A 3BQLA 3SZVA 2UXCT 5LG4A 3HKDE 2YKSA 5ABFA 4DR5T 2W81C 3RF1A 2ZM6T 3WI4A 5DABA 3GWHA 4DIDB 1VCTA 1L0VA 3TLSA 4DUZT 3T8OA 2N1GA 4UXNB 4UR9A 4N78D 2WM9A 4PAGA 4O2AE 4B61A 5L4EA 2O4VA 2XJ7A 1W09A 2JPFA 5DJQC 2M07A 3LSVA 2ZLDA 2XQ5A 3POQA 4JCHA 2H3RA 4XZCA 3WI5A 2KC0A 2NW8A 2B76A 5F5WA 1NWMX 3ZKRA 4O4JE 5LB7B 2YDQA 4JFBA 4JI1T 2CPTA 2E9XA 1WFDA 3KFWX 4LMJA 4K0KT 4QX7B 4QHOA 3IHRA 4A98A 2IWVA 2RPAA 2D0UA 4V1Av 5DL7A 2AXTO 4CXYA 2WQYA 1MIWA 4U2ZA 2QTKA 3FBLA 1W0BA 5IWAT 2LHFA 2MYSA 4UF0A 3A0BO 5LCYA 3VU7H 4QQ1A 2P9BA 1Y64B 4K3CA 4KHZF 4ILUA 3UUMA 3EUHA 3RHWA 4ILBA 4ZI7E 2E9XC 3RC3A 2CEAA 3NJTA 1KFYA 3O1IA 2W62A 4NUVA 2YDSA 5GTIO 1PHOA 3HA4A 2ODJA 2XQAA 4ILCA 4ADZA 2IC6A 3LDQB 4IDOA 4LSFA 5DQWA 4UB6O 1T1LA 4IL9A 2OA5A 2X66A 4COFA 1SUMB 2K5BB 1O3XA 4DV2T 3K3QC 4WW0A 1WR0A 1BR4A 2LOSA 2K48A 4JUYA 4LMLA 2ACZA 3CQCB 4X20E 2G0UA 5J1GA 5L3CB 3H3MA 4KHPT 3NKZA 5JDFA 2XE3A 2M6BA 3UULA 2LEHA 2XPKA 4CI1B 4HGAA 3RYCE 4BJMA 4FOZA 3ETUA 3DZMA 5FL0A 5D5DA 5DL5A 1GFOA 1QJ9A 2E5VA 1XNRT 3VR8A 1BR0A 1SHZC 4IL6O 1UUSA 2YNKA 4XBFB 5LMUT 4HFIA 4DV6T 4N75A 1LVKA 4DV7T 3ZMUB 2K3WA 3G7GA 2V1DB 5HCMA 4X64T 2EHOA 4IE7A 3LBXA 4AYID 2W2UA 3ZT7A 1QSDA 3HI2A 2C0SA 4N74A 5G38A 2WJRA 1YKEB 3JC6D 5AQUB 1QJPA 2XAGB 5H6RB 4YHJA 5AQSB 4AI6A 2XM1A 5JTGA 5TAOA 2UXNB 2UUCT 3O0EA 4JI4T 5FNVE 3AAEB 1VOMA 4I4TE 4KUMB 3JAFA 1Z8UA 3VE2A 2AXDS 4QX8B 2F4VT 2HHHT 3DA4A 1XNQT 1P4TA 3PQUA 3TLTA 4ZOLE 5ABFB 2PBIA 3UPGA 3VKGA 5LGNB 3PQSA 1Q9FA 3QOFA 4BUMX 4ISSA 3CX7B 2JQ9A 3ANWB 2XTLA 2YDRA 2XAQB 4B3MT 3RH3A 3UFEA 4DR3T 2PFVA 2IW5B 1KNZA 1LKXA 4OYJA 4DVDA 2VQFT 2X9WA 5JDMA 1T72A 3DJBA 2L9QA 2XAHB 2CWYA 2DWGA 4CN4A 5LYJE 2JJ9A 4WBNE 3I0OA 3P4SA 5DL6A 4YSZA 3IA3A 2BS3A 2WZHA 4QXBB 2C5KT 3KDSE 3HWBA 2Y6XA 1H7CA 2VURA 3NRXA 4U31A 4FRXA 2YK0A 1MM5A 3FHNA 1QUUA 1H6S1 3K1SA 3VKHA 2LSJA 3UT5E 3K19A 2HPLA 4JEUB 4AXPA 2ZLYA 3FZKB 3RRCA 2WY2A 3OJAA 3PGRA 3C98B 2HN2A 5HEUA 2CXDA 2LSYA 3P8CD 4LSEA 1R8IA 1NEKA 2W66A 3X1DA 5FKYA 2VWAA 3FXEB 3Q5DA 2X68A 5LHGB 3W15B 2CHNA 3SYSA 2V7IA 1HXUA 4CTDA 1S94A 4I50E 4YTMA 4JEHB 4LF9T 3N5LA 2XQ3A 1OSMA 1IBKT 1UX4A 2BS4A 1HFAA 2KZ7A 3EHZA 3BK9A 3TLUA 1WYCA 3RYFE 4AQFA 3HKCE 4KR4A 4AKRB 2ZM2A 5KAFO 2CRBA 2WMNA 3G06A 2K9AA 1NENA 3OYZA 5DL8A 3IEEA 3SY9A 2R4NA 1BR1A 4BA9A 4KR8A 4HWFA 5E79O 5G26A 1ZOYA 2W61A 1QJ8A 3CX8B 3N2GE 1FMWA 2Y0HA 4UVBB 2QA7A 4AQFC 2A2FX 4LF4T 3N9LA 3ZJ2A 2BG9A 4QWNB 5AQMB 2Y0KA 3J7Yq 3OTOT 5FY7A 3AE5A 2NW9A 2LT3A 2VVSA 2IDOB 3LBXB 3AE3A 4FJOA 2XE5A 3M3ZB 4LSIA 2KXPB 4X66T 3AA0A 4TV9E 2OV9A 4FZMA 5KX5E 3UTKA 3L3PA 4WYVA 4N58A 2BG9C 3RRWA 3MKDA 4HWHA 3QB5A 3N9MA 5G39A 4O3YA 2XQ9A 1ZHYA 4Q25A 1S5LO 3KV9A 3MA9A 5L3GB 2XQ8A 2BKNA 2F1TA 5ABHA 2J1DG 3SYBA 5BMVE 5JDGA 1B7TA 3AAIA 1IBMT 2NW7A 1UCUA 2K24A 3BS0A 2AE9A 4HFDA 2VKOA 3I1AA 4LFBT 2PTFA 3AXJA 3ZMVB 1T7SA 3PU3A 3E0ZA 2NP9A 5HXHA 1XDPA 1IZNA 2X27X 4MFRA 5C8YE 3PGUA 5AQJB 4GHBA 2BKOA 5HEHA 5CJ5A 3PDYA 4QH4A 4IL4A 1X79A 5LA6E 2WS3A 1OWAA 1KEYA 5CGMA 4YSXA 1YW0A 4DO0A 3RLFF 4A5XA 2CMRA 3KV5A 4RJXA 2FUPA 5FP3A 3A8YC 3EVYA 4H63V 5J0ZA 4HFCA 2XQ6A 3N9NA 3Q5WA 3KBUA 2V5CA 3PORA 2ZM8A 2FJDA 2BS2A 4UB8O 2UUAT 4PUXA 2CHOA 3FZLB 2JRKA 2XZEA 7PRNA 3VY9X 3I0QA 3VRBA 2XM2A 5JREA 4Z3TA 3PGSA 4IDPA 4FESA 5AQNB 5B66O 3Q9DA 4EEDA 4PJLA 3ZYLA 4IE0A 2V7JA 1ZHTA 4FT6A 5JDHA 2KZ7B 4CI2B 3ANWA 2N9DA 1GFQA 2LSGA 2ZMAA 1D1AA 4PFPA 5AQOB 4UV8B 3KBTA 5HAXA 3RKOA 2ZFGA 4ZZCA 4DR6T 2WZIA 2BZBA 4C69X 4CXWA 1IBLT 1W9RA 3RIAA 3AA6A 5JR9A 4TZ4C 3B5MA 3KINB 1M62A 3K3NA 2UU9T 2Y8DA 3EMNX 3CPZA 4KMCA 2LSKA 1YKHB 3ONJA 3DWOX 2IC9A 1FIOA 1T16A 2BG9B 5T5FA 1OXZA 2VK9A 3NVOA 4C90A 1MMGA 2X0YA 5LJNA 3PUZF 4JV5T 3VZWX 5L2LA 2KWHA 3T24A 5HEOA 1GFNA 1D1BA 3HL6A 2CCQA 2Q9QD 5JR9C 3CMLA 3JC6C 4YXDA 3AA0B 3UFGA 5EZYE 2V7MA 4HFHA 4A97A 3ZT5A 4E7ZA 4RL9A 2XQ7A 2F1CX 2CM0A 2W4XA 2WDRA 3VE1A 2FJAA 4WBOA 2F1VA 5AQHB 3I9YA 2DCFA 2I59A 3JADA 4DV5T 4QXHB 4WNKA 3B57A 4K0UA 2VB6A 1MIVA 2FBWA 2BVMA 3PUWF 3PJAA 3FBZA 5JVDE 2JQQA 1I94T 4ZXLA 5F3JA 2H89A 4QXCB 1HNZT 4HWDA 3VR9A 5AQTB 5LP6E 4JI2T 3RQWA 4O3WA 3CQGB 5AQIB 4O3ZA 4NPPA 4AKRA 4ISTA 3ZYKA 2M67A 4MBQA 3TZGA 3N9OA 4DUYT 2WCAA 3AXJB 1N34T 1AJ3A 3PU8A 2XTRA 2R4LA 1Q9GA 4KP3C 5L47A 1I6ZA 4RLCA 1UK5A 4AKGA 1FJGT 4CN1A 1J5ET 3T0SA 1IZNB 2VL8A 3JAEA 5JH7E 3NRYA 4CN6A 5FY1A 4DV1T 4GK5E 1GQEA 1MM4A 1YS5A 2ES0A 3UQ4A 4FUVA 3FB2A 4PFOA 2E2AA 3OVUA 4I0UA 3ZJ1A 1J1JA 2IIUA 4B3RT 4I55E 3TKLB 2LKHA 4FI5A 2VKDA 4O8SA 5FVNA 1G73A 2BVLA 2KXPA 2I0MA 5AQVB 4G2AA 2LFUA 3UUNA 4HWCA 4PK6A 4ZS3A 4AYNA 1HNXT 1G8XA 2R8AA 3DA3A 2V6XA 4H9OC 4KRAA 4FSPA 3ZYMA 2UUBT 2KWIB 3AE4A 4PJJA 4U7YA 4DR4T 1ZHXA 3RGLA 4NIQA 3P4WA 4JI6T 2VL0A 5LHHB 4ASKA 3C64A 5LXTE 3J9X1 4P1NA 5FXZA 2J62A 4ILAA 1ZHWA 3AEEA 3AEDA 5EE2A 3E08A 3AE6A 3PUQA 3RIFA 3TLVA 1KNRA 1HX8A 5KAIO 4P0BA 3GN5B 3O9XA 2FGRA 3D0TA 5KMGP 5F8PA 3PV0F 1VCSA 2K4TA 2ERVA 3T1YT 2BBJA 5M4YA 4PJ0O 3AA7A 5IUXA 4O2BE 4HWIB 4TWFA 2D9DA 3C4WA 3WI3A 3IF8B 5FXVA 3AA6B 5JR9B 3CK6A 2IAKA 2MPKA 2A3DA 3AEBA 4YT0A 4DMWA 5JDQA 4GCSA 2MAWA 3O1JA 3T1HT 2MOZA 4HE8A 2E8IA 4BAYB 5HXCA 3QB5K 3VZTX 5L3FB 4X62T 1HG2A 5LOVE 2CE7A 4H9QC 3JCFA 3LG7A 5G3AA 2BKPA 4H9NC 4DV0T 2WMOA 5JQGE 5JDPA 2LOPA 4DBQA 4X65T 2J47A 4X5TA 2Y0LA 4X1KE 4DNDA 3HOEA 3JCUO 8PRNA 3PTRB 1HX1B 2R88A 5L4HA 2YU1A 2BG9E 3LK41 2QGSA 4GK0E 3AE2A 2KT9A 3FZFB 2X67A 2IMLA 4JI0T 5DQVA 3PRNA 2L3LA 4IDQA 3ZPOA 3RKGA 4X1YE 5AQQB 4J2CA 4UVAB 4U3CA 3CKDA 1KNPA 1IJ6A 5IYUA 4LFCT 1YD8G 2XQ4A 1Y01A 2XG6A 1FEWA 1MMDA 4FZNA 3AA1B 2SPCA 4PNIA 5CA0E 2YN6A 4AQYT 1ZKEA 5IYZE 2VKJA 5C3JA 3VRAA 4JI8T 4O4XA 4IIJE 4GIWA 5LBMA 2MBGA 3BQKA 3UU4A 3NZPA 1T8BA 1V9DA 4L5GA 1WRDA 4PW8A 1CHUA 4KBMB 3ZT6A 3WAKA 1KK7A 4B6XA 3OPCA 4Z91A 4GYSA 2JMHA 4YLHA 3B13A 1E54A 4IE6A 2BDEA 5EK4A 4U33A 3A5XA 3L39A 1MIYA 5ADXK 1ZEEA 1HF8A 1HXXA 2WU5A 4O4IE 2PJQA 5BR8T 2KLQA 5FXWA 2JQHA 5HEGA 3SFEA 2FJBA 1HS7A 4C00A 1N36T 2OLTA 4PK4A 4N59A 1ORMA 5HWXA 4YHHT 2XSAA 4U72A 3UU3A 2R4OA 2N2NA 1YXRA 1US7B 4F8HA 1VRBA 2N2MA 4JYAT 2FGQX 3C50A 4TX5A 2GK9A 3N2KE 4HTEA 4YFSA 3ZMSB 2DHRA 3QK6A 3AA7B 1WR6A 5PRNA 5ETWA 5AQFB 3LK2B 1MMNA 1SE7A 3M65A 3RQUA 4KI0F 4DR1T 2Q9QA 3RYHE 4EB6E 4RJWA 2JMKA 4IHJE 2JQKA 5JDLA 3PUAA 1T98A 3AVSA 3N9PA 3ZSTA 5GTHO 5HEJA 4FMSA 4XNLA 3C4XA 3AVRA 3O1HA 2DI4A 2C5JA 4YTNA 4OX9T 2W63A 1IJ5A 4AISA 4ZHQE 1HCIA 4MALA 5ABGA 3PJAJ 3PUSA 3EDUA 3JTYA 4HN9A 2Q9QC 2XE2A 4EXTA 3UUXB 5JRCA 5L3BB 3AE8A 3SOLA 4D65A 3ONXA 2V6YA 4UVCB 4TV8E 2KINB 2X0LB 4DV3T 4RLBA 2W80C 3R84B 3MJXA 4AKIA 1J5WA 1HR0T 2PRNA 3A7MA 2CXLA 1LRZA 5ADXL 4JBWF 3LFMA 3Q5XA 2MHLA 3CIRA 2PG8A 1NAFA 4JI7T 2LHNA 1SA0E 4ZZBA 1HG5A 4TWDA 4IREA 2JIWA 3Q2MA 5J2UE 4B3TT 4GCQA 4CQIA 5JDNA 2UXDT 2NR4A 3KVDD 3GN5A 2XQYA 3F2EA 4ERRA 2HPJA 4DR7T 3R6NA 3C5OA 2QRXA 2WU2A 5IHYA 4IDNA 1BR2A 3C51A 1ZV4X 4QKNA 4K3BA 3QRAA 4GYRA 4G76A 5ABEA 3V5SA 2VASA 1UURA 3QNUA 1WYBA 2X9YA 2IUBA 5FYMA 3SWHA 5AFUK 3NWIA 5LGTB 2W67A 2NTXA 3VHLA 5AQGB 2DLRA 2I6HA 2H7OA 5LJMA 4EZ4A 4IE5A 4AKHA 2H88A 3FZHB 4C91A 1S35A 2XY8B 4EV6A 3SY7A 4LF8T 2KMFA 4LF7T 5L3EB 3UU8A 2R6GF 2X0HA 3AB3B 4HFBA 3GP6A 1JNRA 1ZHCA 3H3AA 2V7LA 1E2AA 4A56A 4I43B 4LSHA 4H9SE 2WB5A 3OYXA 4AIUA 4O4UA 4PK5A 3CQXC 3ABVA 2VQET 2PORA 5GV0A 4HFEA 4H63H 3KV6A 5AQRB 4LFAT 2QVAA 1YQ4A 1JNZA 2XHEB 4O4LE 5L3DB 1MPFA 1ZHZA 3AE1A 3P4QA 2UXBT 2ZM0A 3GA8A 1D0ZA 3HKEE 3WU2O 4FRTA 5FVLA 2WAUA 4ZI3C 4YJ3E 4ZEYA 4GOUA 3AA1A 1OPFA 4ZI2C 3P4PA 3ETVA 1UX5A 5AQLB 4QH5A 4X1IE 4OHFA 1OEDE 2Q9QB 1BXWA 4AYMC 3KVBA 4U2YA 1MNDA 2XMXA 2RP4A 3A2SX 5FVKA 1YQ3A 4YTPA 5H2FO 3UAQA 3GMIA 2R4PA 1N33T 1THQA 4O49A 5AQKB 4DV4T 3LK3B 4EAHA 3UQ7A 4GKKT 2B1EA 2NOXA 2L8KA 2XASB 2LRKA 3H37A 2V5DA 3AEAA 5FMNA 2MNHA 2WVPA 2WP9A 5JRCB 3DTOA 3N2OA 3PE0A 4JLEA 4C4VB 2V6YB 4O4HE 3PUVF 3V5UA 5KXJA 2V7KA 2ODVA 5AFUL 3WAJA 4NXMT 3AAAB 4HEAA 4CI3B 3NSGA 4UELA 2E9XD 1IAPA 2J4UP 4IGUA 3PUYF 1M7KA 4CXXA 4D5UA 5HXEA 2ACXA 3EABA 3RBHA 1QLBA 3QUJA 1OEDA 5LHIB 4HFVA 1MMAA 1HNWT 4AYEC 3VZUX 1D1CA 3P50A 2IWWA 2WBLA 3RIUA 3F57A 2EHOC 3P7IA 3ONLC 4EGWA 4GCPA 4L9IA 2Y2XA 4EZHA 3HW9A 2J1NA 5E0OA 2LHRA 2JQYA 3ZCJA 3BRYA 1E7PA 1Z0PA 4ZI3D 2X9HA 5AQPB 1GFMA 1OEDC 3A0HO 3O4XE 2YPVA 4ZI2D 4FQEA 4TN7B 3MACA 3POUA 3LK2A 3MK7C 2FJEA 4LMKA 3RIUC 3AEGA 4TNVA 5HXSA 1LVFA 3BQIA 3CVRA 2HH7A 4LF6T 2Y7SA 4PR7A 2D2SA 3F31A 3N9QA 3Q5EA 4JI3T 3VY8X 3AE9A 4KX6A 2YEVC 4D64A 4AKLA 4AQGA 3K3OA 1MNEA 2J4GA 1G90A 2E9XB 3QRCA 4U7IA 4Z90A 2CA5A 2LSIA 4EEBA 2W00A 2V8SV 4AFKA 5KDMC 3KZIO 4NUUA 2A72A 2XAJB 1WLXA 4XAXB 4P09A 4UF0B 5HXRA 2LM9A 3KV4A 4F6RC 3L09A 3E22E 3MZKB 5HCJA 3OBVE 3UU2A 2DL1A 5A1LA 1E1HB 1N32T 3LK42 2WDVA 1XWMA 1BH3A 1U4QA 3FYXA 2LLYA 2WWUA 3RI5A 2RA1A 4FSOA 2MTQA 4PJNA 3U3IA 2WWVA 2EHOD 5EK2A 1XZYA 3ZEFB 1X9BA 3ZLIA 4AUIA 3LJCA 3UUBA 4JI5T 4H9RC 2NWBA 3MXZA 4IT4A 4O3XB 3RX6A 3ZN1B 2C5IT 4Z8XA 2CLYC 4IDZA 4AKMA 1XDOA 4FZLA 3ZCIA 3DWNA 3NZQA 1UGOA 4YSYA 3SS1A 2D5UA 2XSBA 2XUEA 3ZC1A 2D0TA 1GFPA 4DR2T 3L8RA 3SRZA 2YU2A 3FZMB 4MHCA 2E5LT 1CUNA 2KNDA 5HYAA 4MLKA 1U5PA 3POXA 4EOZB 3SFDA 3S4UA 1PRNA 1FMVA 3HR0A 1XMQT 1ZP0A 2WJQA 1BT9A 5CB4E 2HN1A 4B3ST 3UU5A 4AZLA 3RYIE 4G63A 6PRNA 2EHOB 4ZS2A 1DU2A 4TNWA 5LGUB 2M06A 4UEMA 3EAMA 4U74A 2IHR1 3PUGA 4PJMA 3U78A 3ESLA 4UIGA 2WDQA 4TUYE 3K8PC 2M6IA 4UV9B 5LMNT 2XTQA 3T20A 1OEDB 3ZMTB 4ANJA 2H7VC 3SZDA 5J2TE 5CFBA 1D0YA 4QH1A 2XE1A 3PURA 2VKHA 3PF1A 3TLWA 4OYKA 4U9CA 5LG3A 2X9XA 4YY3T 2CXFA 2LJLA 2KDYA 5FL1A 3P4RA 2KSRA 2V26A 3CWZB 4WZXA 4H9PC 1XMOT 2LRLA 2BBHA 2K0LA 3HKBE 4OFZA 2W0GA 1EZ3A 3ZC0A 3V8UA 2OMFA 3ZMZB 3NBXX 2DNXA 4EYUA 2DWKA 1HTJF 2YOEA 2UXXB 3EDVA 4BJNA 3AEFA 2CBIA 3RC8A 2Z6EA 3CX6B 4DMVA 2N2LA 2NTYA 2WSSV 3AECA 1HXTA 2X9KA 2A9UA 3EI0A 4F4BA 3OKQA 3BRZA 4TWHA 1W0AA 2CBJA 2YINA 4IE4A 5GONE 2XAFB 3LK3A 4GF4A 3ZSSA 4NXNT 3AE7A 5FXXA 5B5EO 5TISO 1KF6A 5LNKA 4OK0A 2X51A 3UU6A 3RPUA 5CA1E 3ZN0B 3DP7A 3I9WA 2VVNA 3C4ZA 5HWYA 2R89A 4C4VA 4P0AA 4E1TA 5FY0A 2LKGA 4EYYR 5C2TA 2JMMA 4L0RA 3AAAA 4E7SA 4DBRA 3PUXF 4E1SA
chains in the Genus database with same CATH topology
2ODUA 2XHEB 3N9LA 4O4LE 3ZJ2A 5L3DB 1MPFA 1ZHZA 3C4WA 3WI3A 2LE8A 3HOLA 4AYDC 4XNKA 4G75A 2CWOA 4QWNB 2Y0KA 5H6QB 3IF8B 3J7Yq 5FXVA 3AA6B 2ZM0A 2Y48B 5JR9B 2IAKA 3IBPA 5FY7A 3FXDB 2NW9A 3GA8A 1D0ZA 2LT3A 2CLYB 2A3DA 3HKEE 3LBXB 4HKAA 4FJOA 2XE5A 3KVAA 4EIWA 4FRTA 3AAEA 4LSIA 2GE4A 2KXPB 4DMWA 2WAUA 5JDQA 4ZI3C 4GCSA 5LBQB 4M1PA 4YJ3E 4YJ2E 4GOUA 4CZZB 3AA1A 1OPFA 4ZI2C 3O1JA 3AA0A 3QC9A 1D0XA 2MOZA 3ETVA 5EK3A 1UX5A 4HE8A 4TV9E 2E8IA 3BQLA 4X1IE 5HXCA 4OHFA 4BAYB 5LG4A 3SZVA 3VZTX 3HKDE 2Q9QB 1BXWA 2W81C 4FZMA 4AYMC 5L3FB 3KVBA 5KX5E 1HG2A 3UTKA 5LOVE 3WI4A 5DABA 2CE7A 3L3PA 4H9QC 1MNDA 3GWHA 2XMXA 4N58A 3RRWA 3LG7A 2RP4A 3A2SX 3MKDA 4H9NC 3UAQA 2WMOA 3T8OA 2N1GA 3GMIA 3N9MA 4UXNB 5JQGE 4N78D 1THQA 4O49A 5JDPA 2LOPA 2WM9A 4DBQA 4PAGA 3LK3B 4EAHA 4O2AE 4B61A 4O3YA 2O4VA 2Y0LA 2B1EA 2NOXA 4X1KE 4DNDA 3HOEA 1ZHYA 8PRNA 2JPFA 5DJQC 2L8KA 3PTRB 2M07A 2ZLDA 3POQA 2XASB 4JCHA 2H3RA 3H37A 4XZCA 3KV9A 3WI5A 2KC0A 2YU1A 2NW8A 5FMNA 2MNHA 3MA9A 5L3GB 3LK41 1NWMX 5JRCB 4O4JE 2QGSA 2F1TA 3DTOA 2J1DG 3N2OA 3PE0A 4JLEA 4GK0E 4JFBA 3SYBA 5BMVE 5JDGA 2E9XA 1B7TA 3AAIA 3KFWX 2NW7A 4O4HE 1UCUA 4QX7B 4QHOA 3IHRA 3V5UA 2KT9A 2V7KA 2ODVA 5AFUL 3WAJA 2X67A 2K24A 3AAAB 4HEAA 2D0UA 4CI3B 3NSGA 2VKOA 2E9XD 4UELA 5DQVA 4V1Av 1IAPA 3PRNA 5DL7A 2J4UP 3I1AA 2L3LA 4IGUA 4CXYA 3ZPOA 4CXXA 1MIWA 4D5UA 4X1YE 2QTKA 5HXEA 3FBLA 2LHFA 2ACXA 2MYSA 4J2CA 4UF0A 3RBHA 4UVAB 3QUJA 5LCYA 3ZMVB 3CKDA 3PU3A 3E0ZA 2NP9A 3VU7H 5LHIB 4HFVA 5HXHA 1IJ6A 1MMAA 4QQ1A 4AYEC 5IYUA 2P9BA 1IZNA 3VZUX 1D1CA 1YD8G 1Y64B 2X27X 4MFRA 4ILUA 3UUMA 5C8YE 3EUHA 2WBLA 2XG6A 1FEWA 3F57A 4ZI7E 4GHBA 2E9XC 1MMDA 2EHOC 3RC3A 4FZNA 2CEAA 1GFNA 3AA1B 3PDYA 3P7IA 2SPCA 4PNIA 4GCPA 5CA0E 3O1IA 1X79A 2W62A 4L9IA 5LA6E 4NUVA 2Y2XA 4EZHA 3HW9A 1OWAA 1ZKEA 1PHOA 5IYZE 2VKJA 2J1NA 1YW0A 5E0OA 3HA4A 2ODJA 2LHRA 4DO0A 3ZCJA 4ADZA 2IC6A 1Z0PA 4ZI3D 4O4XA 4LSFA 2X9HA 4IIJE 1GFMA 5DQWA 2CMRA 3KV5A 4GIWA 5LBMA 2MBGA 4RJXA 3BQKA 2OA5A 3O4XE 3EVYA 3NZPA 5FP3A 4TN7B 2X66A 4ZI2D 3MACA 1V9DA 4L5GA 3MK7C 1WRDA 3LK2A 3POUA 4PW8A 4H63V 4KBMB 3WAKA 1KK7A 2K5BB 1O3XA 4B6XA 3N9NA 5HXSA 1LVFA 3BQIA 3Q5WA 4GYSA 2JMHA 3CVRA 2HH7A 3KBUA 4YLHA 2Y7SA 3B13A 1E54A 2D2SA 3F31A 2BDEA 3N9QA 2ZM8A 4IE6A 3K3QC 3PORA 4WW0A 5EK4A 3A5XA 1BR4A 3VY8X 1MIYA 5ADXK 1ZEEA 2LOSA 2K48A 4JUYA 4PUXA 2YEVC 4D64A 4AKLA 4AQGA 1HF8A 3CQCB 3K3OA 4X20E 2G0UA 2JRKA 1HXXA 1MNEA 7PRNA 1G90A 5J1GA 4O4IE 2E9XB 2PJQA 3I0QA 5L3CB 3QRCA 3VY9X 5JDFA 2CA5A 2KLQA 2LSIA 2W00A 2XE3A 5FXWA 5JREA 4Z3TA 4FESA 1HS7A 4AFKA 3UULA 2LEHA 3Q9DA 5KDMC 4PJLA 4CI1B 3ZYLA 4HGAA 4IE0A 3RYCE 4BJMA 4NUUA 4PK4A 4FOZA 4N59A 2A72A 2V7JA 1ORMA 1ZHTA 2XAJB 5JDHA 4FT6A 1WLXA 4XAXB 5HWXA 3ETUA 2KZ7B 4P09A 4CI2B 3ANWA 4UF0B 2N9DA 5HXRA 1GFQA 2LM9A 3KV4A 4U72A 4F6RC 3L09A 5D5DA 3E22E 5DL5A 2N2NA 3MZKB 2LSGA 2ZMAA 1GFOA 1US7B 1QJ9A 3OBVE 3UU2A 1D1AA 5A1LA 1E1HB 1BR0A 1SHZC 4PFPA 3LK42 4UV8B 1VRBA 3KBTA 5HAXA 3RKOA 4XBFB 2YNKA 2ZFGA 2N2MA 2FGQX 1BH3A 1LVKA 1U4QA 3FYXA 2BZBA 3C50A 4TX5A 3ZMUB 4C69X 2GK9A 3G7GA 4CXWA 2V1DB 2WWUA 4FSOA 2RA1A 3N2KE 3AA6A 5JR9A 4HTEA 4TZ4C 2MTQA 2EHOA 4PJNA 4YFSA 3U3IA 4IE7A 3KINB 3ZMSB 3K3NA 3LBXA 4AYID 2DHRA 1QSDA 2Y8DA 3QK6A 3EMNX 3AA7B 2C0SA 3CPZA 3HI2A 1WR6A 4KMCA 2EHOD 5PRNA 2LSKA 1YKHB 1YKEB 5EK2A 2IC9A 3JC6D 5ETWA 1FIOA 3ZEFB 1QJPA 2XAGB 3ZLIA 3LK2B 1MMNA 4YHJA 3LJCA 5H6RB 5T5FA 4AUIA 3M65A 4AI6A 1OXZA 2Q9QA 4H9RC 3RYHE 2VK9A 4EB6E 4C90A 4RJWA 2NWBA 2JMKA 5TAOA 1MMGA 2UXNB 4IHJE 5LJNA 3MXZA 3VZWX 5JDLA 3O0EA 3PUAA 5L2LA 1T98A 2KWHA 5FNVE 3AAEB 4O3XB 3AVSA 3T24A 1VOMA 1D1BA 3HL6A 2CCQA 3N9PA 4I4TE 4KUMB 2Q9QD 3RX6A 3ZN1B 2C5IT 5JR9C 3VE2A 4Z8XA 4FMSA 3CMLA 4QX8B 4XNLA 3JC6C 2CLYC 3DA4A 4IDZA 3AA0B 3C4XA 1P4TA 3AVRA 3PQUA 4AKMA 5EZYE 3O1HA 2DI4A 2C5JA 4ZOLE 3ZCIA 4FZLA 2W63A 1IJ5A 2PBIA 2V7MA 3UPGA 3NZQA 4ZHQE 3VKGA 1HCIA 4MALA 3SS1A 2D5UA 3PUSA 4E7ZA 4RL9A 3EDUA 2XUEA 2CM0A 3ZC1A 3JTYA 4HN9A 3VE1A 5LGNB 2D0TA 1GFPA 2Q9QC 3SRZA 2XE2A 3PQSA 2YU2A 4EXTA 1Q9FA 4WBOA 2F1VA 4BUMX 4MHCA 4ISSA 3UUXB 3I9YA 2DCFA 2I59A 5JRCA 5L3BB 1CUNA 2KNDA 3CX7B 4QXHB 4WNKA 5HYAA 4MLKA 3B57A 4K0UA 3ANWB 2VB6A 3SOLA 1MIVA 2XTLA 3ONXA 4D65A 2XAQB 1U5PA 2BVMA 3POXA 3RH3A 3UFEA 4EOZB 4UVCB 1PRNA 3S4UA 1FMVA 4TV8E 3FBZA 3HR0A 2PFVA 2IW5B 1KNZA 5JVDE 2KINB 1LKXA 2X0LB 2JQQA 4OYJA 4RLBA 2W80C 4DVDA 1BT9A 3R84B 5F3JA 5CB4E 4QXCB 2X9WA 5JDMA 3MJXA 3DJBA 4AKIA 2L9QA 2XAHB 4AZLA 2CWYA 2PRNA 3RYIE 2DWGA 2CXLA 5LP6E 4G63A 1LRZA 5ADXL 5LYJE 4O3WA 6PRNA 2EHOB 3CQGB 4ZS2A 2JJ9A 4WBNE 5LGUB 3LFMA 3I0OA 4O3ZA 5DL6A 2M06A 4AKRA 4ISTA 3ZYKA 3Q5XA 4UEMA 4U74A 2MHLA 2M67A 4MBQA 4QXBB 2C5KT 3PUGA 4PJMA 3KDSE 3TZGA 2PG8A 3HWBA 3U78A 1NAFA 2Y6XA 3N9OA 1H7CA 1SA0E 2LHNA 3NRXA 3ESLA 4UIGA 1HG5A 3Q2MA 1AJ3A 3PU8A 4TUYE 3K8PC 5J2UE 2XTRA 2YK0A 4UV9B 4FRXA 1MM5A 1Q9GA 4GCQA 4CQIA 4KP3C 3FHNA 2XTQA 1QUUA 1H6S1 3T20A 5JDNA 4RLCA 4AKGA 3KVDD 3GN5A 2XQYA 3F2EA 3VKHA 4ERRA 3ZMTB 2LSJA 4ANJA 2H7VC 2HPJA 3C5OA 3R6NA 3UT5E 5J2TE 2HPLA 3K19A 3SZDA 3T0SA 1D0YA 1IZNB 2ZLYA 4JEUB 2VL8A 3PURA 4AXPA 5JH7E 2VKHA 3NRYA 2XE1A 5FY1A 5IHYA 3RRCA 1MM4A 4GK5E 1YS5A 2ES0A 1BR2A 3OJAA 4OYKA 3C51A 4FUVA 4U9CA 3FB2A 4PFOA 2X9XA 3C98B 1ZV4X 4QKNA 2CXDA 2LSYA 2CXFA 2LJLA 3P8CD 4LSEA 2KDYA 3QRAA 3ZJ1A 4GYRA 4G76A 4I55E 2V26A 3TKLB 4FI5A 3CWZB 2VKDA 4O8SA 5FVNA 4H9PC 3V5SA 2K0LA 1G73A 3HKBE 2BVLA 2YPVA 2VASA 2KXPA 4OFZA 2VWAA 3FXEB 4G2AA 1WYBA 2W0GA 3UUNA 1EZ3A 2LFUA 4PK6A 3ZC0A 3V8UA 2X68A 4ZS3A 5LHGB 2OMFA 2X9YA 3W15B 3ZMZB 4AYNA 3NBXX 5FYMA 1G8XA 2DNXA 4EYUA 2DWKA 1HTJF 3SWHA 3SYSA 2UXXB 5AFUK 3EDVA 4BJNA 2V7IA 5LGTB 3DA3A 1HXUA 3RC8A 2Z6EA 1S94A 4I50E 3CX6B 2NTXA 4DMVA 3VHLA 4H9OC 4KRAA 2DLRA 4JEHB 2N2LA 2NTYA 4FSPA 2H7OA 3N5LA 3ZYMA 2WSSV 2KWIB 4IE5A 4PJJA 4EZ4A 5LJMA 4AKHA 1HXTA 1ZHXA 4F4BA 1OSMA 3OKQA 1UX4A 4C91A 2YINA 1S35A 5LHHB 4IE4A 5GONE 1HFAA 2XAFB 4ASKA 3LK3A 2KZ7A 3C64A 5LXTE 3SY7A 3J9X1 3BK9A 1WYCA 2KMFA 3RYFE 4AQFA 4GF4A 3HKCE 5L3EB 5FXZA 4KR4A 4AKRB 2ZM2A 5FXXA 3AB3B 3GP6A 1ZHWA 1ZHCA 3H3AA 2V7LA 2WMNA 4OK0A 5LNKA 2X51A 4A56A 5EE2A 3E08A 4I43B 4LSHA 3RPUA 4H9SE 3PUQA 2K9AA 3OYXA 5CA1E 3ZN0B 3OYZA 5DL8A 3DP7A 3IEEA 3I9WA 4O4UA 4PK5A 3CQXC 3SY9A 3C4ZA 5HWYA 1BR1A 4BA9A 1HX8A 4P0AA 4KR8A 4E1TA 4P0BA 5G26A 3GN5B 3O9XA 5FY0A 2W61A 3D0TA 5F8PA 4EYYR 5KMGP 3CX8B 1QJ8A 2FGRA 2JMMA 2PORA 2K4TA 2ERVA 4L0RA 5GV0A 5M4YA 4H63H 3N2GE 1FMWA 3AAAA 3KV6A 3AA7A 4O2BE 4E7SA 2Y0HA 4UVBB 4DBRA 2QA7A 4AQFC 2A2FX 4E1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAE B;  5AFU L;  3AAA B;  3LK2 A;  3AA7 B;  3AA1 B;  5ADX L;  2KXP A;  3AA6 B;  1IZN B;  3AA6 A;  3AA0 B;  4AKR A;  3LK4 2;  3LK3 A;  2KZ7 A;  3LK2 B;  3AAE A;  3LK4 1;  2KXP B;  5AFU K;  4AKR B;  3AAA A;  3AA7 A;  3AA1 A;  3LK3 B;  1IZN A;  5ADX K;  3AA0 A;  2KZ7 B; 
#chains in the Genus database with same CATH topology
 2ODU A;  4GKJ T;  3HOL A;  2LE8 A;  4LF5 T;  4AYD C;  4XNK A;  4G75 A;  2CWO A;  5H6Q B;  2LM2 A;  2Y48 B;  3IBP A;  3FXD B;  1WCR A;  2CLY B;  4HKA A;  3KVA A;  4EIW A;  3AAE A;  2GE4 A;  5LBQ B;  4M1P A;  4YJ2 E;  4CZZ B;  2QYW A;  3QC9 A;  1D0X A;  5EK3 A;  3BQL A;  3SZV A;  2UXC T;  5LG4 A;  3HKD E;  2YKS A;  5ABF A;  4DR5 T;  2W81 C;  3RF1 A;  2ZM6 T;  3WI4 A;  5DAB A;  3GWH A;  4DID B;  1VCT A;  1L0V A;  3TLS A;  4DUZ T;  3T8O A;  2N1G A;  4UXN B;  4UR9 A;  4N78 D;  2WM9 A;  4PAG A;  4O2A E;  4B61 A;  5L4E A;  2O4V A;  2XJ7 A;  1W09 A;  2JPF A;  5DJQ C;  2M07 A;  3LSV A;  2ZLD A;  2XQ5 A;  3POQ A;  4JCH A;  2H3R A;  4XZC A;  3WI5 A;  2KC0 A;  2NW8 A;  2B76 A;  5F5W A;  1NWM X;  3ZKR A;  4O4J E;  5LB7 B;  2YDQ A;  4JFB A;  4JI1 T;  2CPT A;  2E9X A;  1WFD A;  3KFW X;  4LMJ A;  4K0K T;  4QX7 B;  4QHO A;  3IHR A;  4A98 A;  2IWV A;  2RPA A;  2D0U A;  4V1A v;  5DL7 A;  2AXT O;  4CXY A;  2WQY A;  1MIW A;  4U2Z A;  2QTK A;  3FBL A;  1W0B A;  5IWA T;  2LHF A;  2MYS A;  4UF0 A;  3A0B O;  5LCY A;  3VU7 H;  4QQ1 A;  2P9B A;  1Y64 B;  4K3C A;  4KHZ F;  4ILU A;  3UUM A;  3EUH A;  3RHW A;  4ILB A;  4ZI7 E;  2E9X C;  3RC3 A;  2CEA A;  3NJT A;  1KFY A;  3O1I A;  2W62 A;  4NUV A;  2YDS A;  5GTI O;  1PHO A;  3HA4 A;  2ODJ A;  2XQA A;  4ILC A;  4ADZ A;  2IC6 A;  3LDQ B;  4IDO A;  4LSF A;  5DQW A;  4UB6 O;  1T1L A;  4IL9 A;  2OA5 A;  2X66 A;  4COF A;  1SUM B;  2K5B B;  1O3X A;  4DV2 T;  3K3Q C;  4WW0 A;  1WR0 A;  1BR4 A;  2LOS A;  2K48 A;  4JUY A;  4LML A;  2ACZ A;  3CQC B;  4X20 E;  2G0U A;  5J1G A;  5L3C B;  3H3M A;  4KHP T;  3NKZ A;  5JDF A;  2XE3 A;  2M6B A;  3UUL A;  2LEH A;  2XPK A;  4CI1 B;  4HGA A;  3RYC E;  4BJM A;  4FOZ A;  3ETU A;  3DZM A;  5FL0 A;  5D5D A;  5DL5 A;  1GFO A;  1QJ9 A;  2E5V A;  1XNR T;  3VR8 A;  1BR0 A;  1SHZ C;  4IL6 O;  1UUS A;  2YNK A;  4XBF B;  5LMU T;  4HFI A;  4DV6 T;  4N75 A;  1LVK A;  4DV7 T;  3ZMU B;  2K3W A;  3G7G A;  2V1D B;  5HCM A;  4X64 T;  2EHO A;  4IE7 A;  3LBX A;  4AYI D;  2W2U A;  3ZT7 A;  1QSD A;  3HI2 A;  2C0S A;  4N74 A;  5G38 A;  2WJR A;  1YKE B;  3JC6 D;  5AQU B;  1QJP A;  2XAG B;  5H6R B;  4YHJ A;  5AQS B;  4AI6 A;  2XM1 A;  5JTG A;  5TAO A;  2UXN B;  2UUC T;  3O0E A;  4JI4 T;  5FNV E;  3AAE B;  1VOM A;  4I4T E;  4KUM B;  3JAF A;  1Z8U A;  3VE2 A;  2AXD S;  4QX8 B;  2F4V T;  2HHH T;  3DA4 A;  1XNQ T;  1P4T A;  3PQU A;  3TLT A;  4ZOL E;  5ABF B;  2PBI A;  3UPG A;  3VKG A;  5LGN B;  3PQS A;  1Q9F A;  3QOF A;  4BUM X;  4ISS A;  3CX7 B;  2JQ9 A;  3ANW B;  2XTL A;  2YDR A;  2XAQ B;  4B3M T;  3RH3 A;  3UFE A;  4DR3 T;  2PFV A;  2IW5 B;  1KNZ A;  1LKX A;  4OYJ A;  4DVD A;  2VQF T;  2X9W A;  5JDM A;  1T72 A;  3DJB A;  2L9Q A;  2XAH B;  2CWY A;  2DWG A;  4CN4 A;  5LYJ E;  2JJ9 A;  4WBN E;  3I0O A;  3P4S A;  5DL6 A;  4YSZ A;  3IA3 A;  2BS3 A;  2WZH A;  4QXB B;  2C5K T;  3KDS E;  3HWB A;  2Y6X A;  1H7C A;  2VUR A;  3NRX A;  4U31 A;  4FRX A;  2YK0 A;  1MM5 A;  3FHN A;  1QUU A;  1H6S 1;  3K1S A;  3VKH A;  2LSJ A;  3UT5 E;  3K19 A;  2HPL A;  4JEU B;  4AXP A;  2ZLY A;  3FZK B;  3RRC A;  2WY2 A;  3OJA A;  3PGR A;  3C98 B;  2HN2 A;  5HEU A;  2CXD A;  2LSY A;  3P8C D;  4LSE A;  1R8I A;  1NEK A;  2W66 A;  3X1D A;  5FKY A;  2VWA A;  3FXE B;  3Q5D A;  2X68 A;  5LHG B;  3W15 B;  2CHN A;  3SYS A;  2V7I A;  1HXU A;  4CTD A;  1S94 A;  4I50 E;  4YTM A;  4JEH B;  4LF9 T;  3N5L A;  2XQ3 A;  1OSM A;  1IBK T;  1UX4 A;  2BS4 A;  1HFA A;  2KZ7 A;  3EHZ A;  3BK9 A;  3TLU A;  1WYC A;  3RYF E;  4AQF A;  3HKC E;  4KR4 A;  4AKR B;  2ZM2 A;  5KAF O;  2CRB A;  2WMN A;  3G06 A;  2K9A A;  1NEN A;  3OYZ A;  5DL8 A;  3IEE A;  3SY9 A;  2R4N A;  1BR1 A;  4BA9 A;  4KR8 A;  4HWF A;  5E79 O;  5G26 A;  1ZOY A;  2W61 A;  1QJ8 A;  3CX8 B;  3N2G E;  1FMW A;  2Y0H A;  4UVB B;  2QA7 A;  4AQF C;  2A2F X;  4LF4 T;  3N9L A;  3ZJ2 A;  2BG9 A;  4QWN B;  5AQM B;  2Y0K A;  3J7Y q;  3OTO T;  5FY7 A;  3AE5 A;  2NW9 A;  2LT3 A;  2VVS A;  2IDO B;  3LBX B;  3AE3 A;  4FJO A;  2XE5 A;  3M3Z B;  4LSI A;  2KXP B;  4X66 T;  3AA0 A;  4TV9 E;  2OV9 A;  4FZM A;  5KX5 E;  3UTK A;  3L3P A;  4WYV A;  4N58 A;  2BG9 C;  3RRW A;  3MKD A;  4HWH A;  3QB5 A;  3N9M A;  5G39 A;  4O3Y A;  2XQ9 A;  1ZHY A;  4Q25 A;  1S5L O;  3KV9 A;  3MA9 A;  5L3G B;  2XQ8 A;  2BKN A;  2F1T A;  5ABH A;  2J1D G;  3SYB A;  5BMV E;  5JDG A;  1B7T A;  3AAI A;  1IBM T;  2NW7 A;  1UCU A;  2K24 A;  3BS0 A;  2AE9 A;  4HFD A;  2VKO A;  3I1A A;  4LFB T;  2PTF A;  3AXJ A;  3ZMV B;  1T7S A;  3PU3 A;  3E0Z A;  2NP9 A;  5HXH A;  1XDP A;  1IZN A;  2X27 X;  4MFR A;  5C8Y E;  3PGU A;  5AQJ B;  4GHB A;  2BKO A;  5HEH A;  5CJ5 A;  3PDY A;  4QH4 A;  4IL4 A;  1X79 A;  5LA6 E;  2WS3 A;  1OWA A;  1KEY A;  5CGM A;  4YSX A;  1YW0 A;  4DO0 A;  3RLF F;  4A5X A;  2CMR A;  3KV5 A;  4RJX A;  2FUP A;  5FP3 A;  3A8Y C;  3EVY A;  4H63 V;  5J0Z A;  4HFC A;  2XQ6 A;  3N9N A;  3Q5W A;  3KBU A;  2V5C A;  3POR A;  2ZM8 A;  2FJD A;  2BS2 A;  4UB8 O;  2UUA T;  4PUX A;  2CHO A;  3FZL B;  2JRK A;  2XZE A;  7PRN A;  3VY9 X;  3I0Q A;  3VRB A;  2XM2 A;  5JRE A;  4Z3T A;  3PGS A;  4IDP A;  4FES A;  5AQN B;  5B66 O;  3Q9D A;  4EED A;  4PJL A;  3ZYL A;  4IE0 A;  2V7J A;  1ZHT A;  4FT6 A;  5JDH A;  2KZ7 B;  4CI2 B;  3ANW A;  2N9D A;  1GFQ A;  2LSG A;  2ZMA A;  1D1A A;  4PFP A;  5AQO B;  4UV8 B;  3KBT A;  5HAX A;  3RKO A;  2ZFG A;  4ZZC A;  4DR6 T;  2WZI A;  2BZB A;  4C69 X;  4CXW A;  1IBL T;  1W9R A;  3RIA A;  3AA6 A;  5JR9 A;  4TZ4 C;  3B5M A;  3KIN B;  1M62 A;  3K3N A;  2UU9 T;  2Y8D A;  3EMN X;  3CPZ A;  4KMC A;  2LSK A;  1YKH B;  3ONJ A;  3DWO X;  2IC9 A;  1FIO A;  1T16 A;  2BG9 B;  5T5F A;  1OXZ A;  2VK9 A;  3NVO A;  4C90 A;  1MMG A;  2X0Y A;  5LJN A;  3PUZ F;  4JV5 T;  3VZW X;  5L2L A;  2KWH A;  3T24 A;  5HEO A;  1GFN A;  1D1B A;  3HL6 A;  2CCQ A;  2Q9Q D;  5JR9 C;  3CML A;  3JC6 C;  4YXD A;  3AA0 B;  3UFG A;  5EZY E;  2V7M A;  4HFH A;  4A97 A;  3ZT5 A;  4E7Z A;  4RL9 A;  2XQ7 A;  2F1C X;  2CM0 A;  2W4X A;  2WDR A;  3VE1 A;  2FJA A;  4WBO A;  2F1V A;  5AQH B;  3I9Y A;  2DCF A;  2I59 A;  3JAD A;  4DV5 T;  4QXH B;  4WNK A;  3B57 A;  4K0U A;  2VB6 A;  1MIV A;  2FBW A;  2BVM A;  3PUW F;  3PJA A;  3FBZ A;  5JVD E;  2JQQ A;  1I94 T;  4ZXL A;  5F3J A;  2H89 A;  4QXC B;  1HNZ T;  4HWD A;  3VR9 A;  5AQT B;  5LP6 E;  4JI2 T;  3RQW A;  4O3W A;  3CQG B;  5AQI B;  4O3Z A;  4NPP A;  4AKR A;  4IST A;  3ZYK A;  2M67 A;  4MBQ A;  3TZG A;  3N9O A;  4DUY T;  2WCA A;  3AXJ B;  1N34 T;  1AJ3 A;  3PU8 A;  2XTR A;  2R4L A;  1Q9G A;  4KP3 C;  5L47 A;  1I6Z A;  4RLC A;  1UK5 A;  4AKG A;  1FJG T;  4CN1 A;  1J5E T;  3T0S A;  1IZN B;  2VL8 A;  3JAE A;  5JH7 E;  3NRY A;  4CN6 A;  5FY1 A;  4DV1 T;  4GK5 E;  1GQE A;  1MM4 A;  1YS5 A;  2ES0 A;  3UQ4 A;  4FUV A;  3FB2 A;  4PFO A;  2E2A A;  3OVU A;  4I0U A;  3ZJ1 A;  1J1J A;  2IIU A;  4B3R T;  4I55 E;  3TKL B;  2LKH A;  4FI5 A;  2VKD A;  4O8S A;  5FVN A;  1G73 A;  2BVL A;  2KXP A;  2I0M A;  5AQV B;  4G2A A;  2LFU A;  3UUN A;  4HWC A;  4PK6 A;  4ZS3 A;  4AYN A;  1HNX T;  1G8X A;  2R8A A;  3DA3 A;  2V6X A;  4H9O C;  4KRA A;  4FSP A;  3ZYM A;  2UUB T;  2KWI B;  3AE4 A;  4PJJ A;  4U7Y A;  4DR4 T;  1ZHX A;  3RGL A;  4NIQ A;  3P4W A;  4JI6 T;  2VL0 A;  5LHH B;  4ASK A;  3C64 A;  5LXT E;  3J9X 1;  4P1N A;  5FXZ A;  2J62 A;  4ILA A;  1ZHW A;  3AEE A;  3AED A;  5EE2 A;  3E08 A;  3AE6 A;  3PUQ A;  3RIF A;  3TLV A;  1KNR A;  1HX8 A;  5KAI O;  4P0B A;  3GN5 B;  3O9X A;  2FGR A;  3D0T A;  5KMG P;  5F8P A;  3PV0 F;  1VCS A;  2K4T A;  2ERV A;  3T1Y T;  2BBJ A;  5M4Y A;  4PJ0 O;  3AA7 A;  5IUX A;  4O2B E;  4HWI B;  4TWF A;  2D9D A;  3C4W A;  3WI3 A;  3IF8 B;  5FXV A;  3AA6 B;  5JR9 B;  3CK6 A;  2IAK A;  2MPK A;  2A3D A;  3AEB A;  4YT0 A;  4DMW A;  5JDQ A;  4GCS A;  2MAW A;  3O1J A;  3T1H T;  2MOZ A;  4HE8 A;  2E8I A;  4BAY B;  5HXC A;  3QB5 K;  3VZT X;  5L3F B;  4X62 T;  1HG2 A;  5LOV E;  2CE7 A;  4H9Q C;  3JCF A;  3LG7 A;  5G3A A;  2BKP A;  4H9N C;  4DV0 T;  2WMO A;  5JQG E;  5JDP A;  2LOP A;  4DBQ A;  4X65 T;  2J47 A;  4X5T A;  2Y0L A;  4X1K E;  4DND A;  3HOE A;  3JCU O;  8PRN A;  3PTR B;  1HX1 B;  2R88 A;  5L4H A;  2YU1 A;  2BG9 E;  3LK4 1;  2QGS A;  4GK0 E;  3AE2 A;  2KT9 A;  3FZF B;  2X67 A;  2IML A;  4JI0 T;  5DQV A;  3PRN A;  2L3L A;  4IDQ A;  3ZPO A;  3RKG A;  4X1Y E;  5AQQ B;  4J2C A;  4UVA B;  4U3C A;  3CKD A;  1KNP A;  1IJ6 A;  5IYU A;  4LFC T;  1YD8 G;  2XQ4 A;  1Y01 A;  2XG6 A;  1FEW A;  1MMD A;  4FZN A;  3AA1 B;  2SPC A;  4PNI A;  5CA0 E;  2YN6 A;  4AQY T;  1ZKE A;  5IYZ E;  2VKJ A;  5C3J A;  3VRA A;  4JI8 T;  4O4X A;  4IIJ E;  4GIW A;  5LBM A;  2MBG A;  3BQK A;  3UU4 A;  3NZP A;  1T8B A;  1V9D A;  4L5G A;  1WRD A;  4PW8 A;  1CHU A;  4KBM B;  3ZT6 A;  3WAK A;  1KK7 A;  4B6X A;  3OPC A;  4Z91 A;  4GYS A;  2JMH A;  4YLH A;  3B13 A;  1E54 A;  4IE6 A;  2BDE A;  5EK4 A;  4U33 A;  3A5X A;  3L39 A;  1MIY A;  5ADX K;  1ZEE A;  1HF8 A;  1HXX A;  2WU5 A;  4O4I E;  2PJQ A;  5BR8 T;  2KLQ A;  5FXW A;  2JQH A;  5HEG A;  3SFE A;  2FJB A;  1HS7 A;  4C00 A;  1N36 T;  2OLT A;  4PK4 A;  4N59 A;  1ORM A;  5HWX A;  4YHH T;  2XSA A;  4U72 A;  3UU3 A;  2R4O A;  2N2N A;  1YXR A;  1US7 B;  4F8H A;  1VRB A;  2N2M A;  4JYA T;  2FGQ X;  3C50 A;  4TX5 A;  2GK9 A;  3N2K E;  4HTE A;  4YFS A;  3ZMS B;  2DHR A;  3QK6 A;  3AA7 B;  1WR6 A;  5PRN A;  5ETW A;  5AQF B;  3LK2 B;  1MMN A;  1SE7 A;  3M65 A;  3RQU A;  4KI0 F;  4DR1 T;  2Q9Q A;  3RYH E;  4EB6 E;  4RJW A;  2JMK A;  4IHJ E;  2JQK A;  5JDL A;  3PUA A;  1T98 A;  3AVS A;  3N9P A;  3ZST A;  5GTH O;  5HEJ A;  4FMS A;  4XNL A;  3C4X A;  3AVR A;  3O1H A;  2DI4 A;  2C5J A;  4YTN A;  4OX9 T;  2W63 A;  1IJ5 A;  4AIS A;  4ZHQ E;  1HCI A;  4MAL A;  5ABG A;  3PJA J;  3PUS A;  3EDU A;  3JTY A;  4HN9 A;  2Q9Q C;  2XE2 A;  4EXT A;  3UUX B;  5JRC A;  5L3B B;  3AE8 A;  3SOL A;  4D65 A;  3ONX A;  2V6Y A;  4UVC B;  4TV8 E;  2KIN B;  2X0L B;  4DV3 T;  4RLB A;  2W80 C;  3R84 B;  3MJX A;  4AKI A;  1J5W A;  1HR0 T;  2PRN A;  3A7M A;  2CXL A;  1LRZ A;  5ADX L;  4JBW F;  3LFM A;  3Q5X A;  2MHL A;  3CIR A;  2PG8 A;  1NAF A;  4JI7 T;  2LHN A;  1SA0 E;  4ZZB A;  1HG5 A;  4TWD A;  4IRE A;  2JIW A;  3Q2M A;  5J2U E;  4B3T T;  4GCQ A;  4CQI A;  5JDN A;  2UXD T;  2NR4 A;  3KVD D;  3GN5 A;  2XQY A;  3F2E A;  4ERR A;  2HPJ A;  4DR7 T;  3R6N A;  3C5O A;  2QRX A;  2WU2 A;  5IHY A;  4IDN A;  1BR2 A;  3C51 A;  1ZV4 X;  4QKN A;  4K3B A;  3QRA A;  4GYR A;  4G76 A;  5ABE A;  3V5S A;  2VAS A;  1UUR A;  3QNU A;  1WYB A;  2X9Y A;  2IUB A;  5FYM A;  3SWH A;  5AFU K;  3NWI A;  5LGT B;  2W67 A;  2NTX A;  3VHL A;  5AQG B;  2DLR A;  2I6H A;  2H7O A;  5LJM A;  4EZ4 A;  4IE5 A;  4AKH A;  2H88 A;  3FZH B;  4C91 A;  1S35 A;  2XY8 B;  4EV6 A;  3SY7 A;  4LF8 T;  2KMF A;  4LF7 T;  5L3E B;  3UU8 A;  2R6G F;  2X0H A;  3AB3 B;  4HFB A;  3GP6 A;  1JNR A;  1ZHC A;  3H3A A;  2V7L A;  1E2A A;  4A56 A;  4I43 B;  4LSH A;  4H9S E;  2WB5 A;  3OYX A;  4AIU A;  4O4U A;  4PK5 A;  3CQX C;  3ABV A;  2VQE T;  2POR A;  5GV0 A;  4HFE A;  4H63 H;  3KV6 A;  5AQR B;  4LFA T;  2QVA A;  1YQ4 A;  1JNZ A;  2XHE B;  4O4L E;  5L3D B;  1MPF A;  1ZHZ A;  3AE1 A;  3P4Q A;  2UXB T;  2ZM0 A;  3GA8 A;  1D0Z A;  3HKE E;  3WU2 O;  4FRT A;  5FVL A;  2WAU A;  4ZI3 C;  4YJ3 E;  4ZEY A;  4GOU A;  3AA1 A;  1OPF A;  4ZI2 C;  3P4P A;  3ETV A;  1UX5 A;  5AQL B;  4QH5 A;  4X1I E;  4OHF A;  1OED E;  2Q9Q B;  1BXW A;  4AYM C;  3KVB A;  4U2Y A;  1MND A;  2XMX A;  2RP4 A;  3A2S X;  5FVK A;  1YQ3 A;  4YTP A;  5H2F O;  3UAQ A;  3GMI A;  2R4P A;  1N33 T;  1THQ A;  4O49 A;  5AQK B;  4DV4 T;  3LK3 B;  4EAH A;  3UQ7 A;  4GKK T;  2B1E A;  2NOX A;  2L8K A;  2XAS B;  2LRK A;  3H37 A;  2V5D A;  3AEA A;  5FMN A;  2MNH A;  2WVP A;  2WP9 A;  5JRC B;  3DTO A;  3N2O A;  3PE0 A;  4JLE A;  4C4V B;  2V6Y B;  4O4H E;  3PUV F;  3V5U A;  5KXJ A;  2V7K A;  2ODV A;  5AFU L;  3WAJ A;  4NXM T;  3AAA B;  4HEA A;  4CI3 B;  3NSG A;  4UEL A;  2E9X D;  1IAP A;  2J4U P;  4IGU A;  3PUY F;  1M7K A;  4CXX A;  4D5U A;  5HXE A;  2ACX A;  3EAB A;  3RBH A;  1QLB A;  3QUJ A;  1OED A;  5LHI B;  4HFV A;  1MMA A;  1HNW T;  4AYE C;  3VZU X;  1D1C A;  3P50 A;  2IWW A;  2WBL A;  3RIU A;  3F57 A;  2EHO C;  3P7I A;  3ONL C;  4EGW A;  4GCP A;  4L9I A;  2Y2X A;  4EZH A;  3HW9 A;  2J1N A;  5E0O A;  2LHR A;  2JQY A;  3ZCJ A;  3BRY A;  1E7P A;  1Z0P A;  4ZI3 D;  2X9H A;  5AQP B;  1GFM A;  1OED C;  3A0H O;  3O4X E;  2YPV A;  4ZI2 D;  4FQE A;  4TN7 B;  3MAC A;  3POU A;  3LK2 A;  3MK7 C;  2FJE A;  4LMK A;  3RIU C;  3AEG A;  4TNV A;  5HXS A;  1LVF A;  3BQI A;  3CVR A;  2HH7 A;  4LF6 T;  2Y7S A;  4PR7 A;  2D2S A;  3F31 A;  3N9Q A;  3Q5E A;  4JI3 T;  3VY8 X;  3AE9 A;  4KX6 A;  2YEV C;  4D64 A;  4AKL A;  4AQG A;  3K3O A;  1MNE A;  2J4G A;  1G90 A;  2E9X B;  3QRC A;  4U7I A;  4Z90 A;  2CA5 A;  2LSI A;  4EEB A;  2W00 A;  2V8S V;  4AFK A;  5KDM C;  3KZI O;  4NUU A;  2A72 A;  2XAJ B;  1WLX A;  4XAX B;  4P09 A;  4UF0 B;  5HXR A;  2LM9 A;  3KV4 A;  4F6R C;  3L09 A;  3E22 E;  3MZK B;  5HCJ A;  3OBV E;  3UU2 A;  2DL1 A;  5A1L A;  1E1H B;  1N32 T;  3LK4 2;  2WDV A;  1XWM A;  1BH3 A;  1U4Q A;  3FYX A;  2LLY A;  2WWU A;  3RI5 A;  2RA1 A;  4FSO A;  2MTQ A;  4PJN A;  3U3I A;  2WWV A;  2EHO D;  5EK2 A;  1XZY A;  3ZEF B;  1X9B A;  3ZLI A;  4AUI A;  3LJC A;  3UUB A;  4JI5 T;  4H9R C;  2NWB A;  3MXZ A;  4IT4 A;  4O3X B;  3RX6 A;  3ZN1 B;  2C5I T;  4Z8X A;  2CLY C;  4IDZ A;  4AKM A;  1XDO A;  4FZL A;  3ZCI A;  3DWN A;  3NZQ A;  1UGO A;  4YSY A;  3SS1 A;  2D5U A;  2XSB A;  2XUE A;  3ZC1 A;  2D0T A;  1GFP A;  4DR2 T;  3L8R A;  3SRZ A;  2YU2 A;  3FZM B;  4MHC A;  2E5L T;  1CUN A;  2KND A;  5HYA A;  4MLK A;  1U5P A;  3POX A;  4EOZ B;  3SFD A;  3S4U A;  1PRN A;  1FMV A;  3HR0 A;  1XMQ T;  1ZP0 A;  2WJQ A;  1BT9 A;  5CB4 E;  2HN1 A;  4B3S T;  3UU5 A;  4AZL A;  3RYI E;  4G63 A;  6PRN A;  2EHO B;  4ZS2 A;  1DU2 A;  4TNW A;  5LGU B;  2M06 A;  4UEM A;  3EAM A;  4U74 A;  2IHR 1;  3PUG A;  4PJM A;  3U78 A;  3ESL A;  4UIG A;  2WDQ A;  4TUY E;  3K8P C;  2M6I A;  4UV9 B;  5LMN T;  2XTQ A;  3T20 A;  1OED B;  3ZMT B;  4ANJ A;  2H7V C;  3SZD A;  5J2T E;  5CFB A;  1D0Y A;  4QH1 A;  2XE1 A;  3PUR A;  2VKH A;  3PF1 A;  3TLW A;  4OYK A;  4U9C A;  5LG3 A;  2X9X A;  4YY3 T;  2CXF A;  2LJL A;  2KDY A;  5FL1 A;  3P4R A;  2KSR A;  2V26 A;  3CWZ B;  4WZX A;  4H9P C;  1XMO T;  2LRL A;  2BBH A;  2K0L A;  3HKB E;  4OFZ A;  2W0G A;  1EZ3 A;  3ZC0 A;  3V8U A;  2OMF A;  3ZMZ B;  3NBX X;  2DNX A;  4EYU A;  2DWK A;  1HTJ F;  2YOE A;  2UXX B;  3EDV A;  4BJN A;  3AEF A;  2CBI A;  3RC8 A;  2Z6E A;  3CX6 B;  4DMV A;  2N2L A;  2NTY A;  2WSS V;  3AEC A;  1HXT A;  2X9K A;  2A9U A;  3EI0 A;  4F4B A;  3OKQ A;  3BRZ A;  4TWH A;  1W0A A;  2CBJ A;  2YIN A;  4IE4 A;  5GON E;  2XAF B;  3LK3 A;  4GF4 A;  3ZSS A;  4NXN T;  3AE7 A;  5FXX A;  5B5E O;  5TIS O;  1KF6 A;  5LNK A;  4OK0 A;  2X51 A;  3UU6 A;  3RPU A;  5CA1 E;  3ZN0 B;  3DP7 A;  3I9W A;  2VVN A;  3C4Z A;  5HWY A;  2R89 A;  4C4V A;  4P0A A;  4E1T A;  5FY0 A;  2LKG A;  4EYY R;  5C2T A;  2JMM A;  4L0R A;  3AAA A;  4E7S A;  4DBR A;  3PUX F;  4E1S A; 
#chains in the Genus database with same CATH homology
 2ODU A;  2XHE B;  3N9L A;  4O4L E;  3ZJ2 A;  5L3D B;  1MPF A;  1ZHZ A;  3C4W A;  3WI3 A;  2LE8 A;  3HOL A;  4AYD C;  4XNK A;  4G75 A;  2CWO A;  4QWN B;  2Y0K A;  5H6Q B;  3IF8 B;  3J7Y q;  5FXV A;  3AA6 B;  2ZM0 A;  2Y48 B;  5JR9 B;  2IAK A;  3IBP A;  5FY7 A;  3FXD B;  2NW9 A;  3GA8 A;  1D0Z A;  2LT3 A;  2CLY B;  2A3D A;  3HKE E;  3LBX B;  4HKA A;  4FJO A;  2XE5 A;  3KVA A;  4EIW A;  4FRT A;  3AAE A;  4LSI A;  2GE4 A;  2KXP B;  4DMW A;  2WAU A;  5JDQ A;  4ZI3 C;  4GCS A;  5LBQ B;  4M1P A;  4YJ3 E;  4YJ2 E;  4GOU A;  4CZZ B;  3AA1 A;  1OPF A;  4ZI2 C;  3O1J A;  3AA0 A;  3QC9 A;  1D0X A;  2MOZ A;  3ETV A;  5EK3 A;  1UX5 A;  4HE8 A;  4TV9 E;  2E8I A;  3BQL A;  4X1I E;  5HXC A;  4OHF A;  4BAY B;  5LG4 A;  3SZV A;  3VZT X;  3HKD E;  2Q9Q B;  1BXW A;  2W81 C;  4FZM A;  4AYM C;  5L3F B;  3KVB A;  5KX5 E;  1HG2 A;  3UTK A;  5LOV E;  3WI4 A;  5DAB A;  2CE7 A;  3L3P A;  4H9Q C;  1MND A;  3GWH A;  2XMX A;  4N58 A;  3RRW A;  3LG7 A;  2RP4 A;  3A2S X;  3MKD A;  4H9N C;  3UAQ A;  2WMO A;  3T8O A;  2N1G A;  3GMI A;  3N9M A;  4UXN B;  5JQG E;  4N78 D;  1THQ A;  4O49 A;  5JDP A;  2LOP A;  2WM9 A;  4DBQ A;  4PAG A;  3LK3 B;  4EAH A;  4O2A E;  4B61 A;  4O3Y A;  2O4V A;  2Y0L A;  2B1E A;  2NOX A;  4X1K E;  4DND A;  3HOE A;  1ZHY A;  8PRN A;  2JPF A;  5DJQ C;  2L8K A;  3PTR B;  2M07 A;  2ZLD A;  3POQ A;  2XAS B;  4JCH A;  2H3R A;  3H37 A;  4XZC A;  3KV9 A;  3WI5 A;  2KC0 A;  2YU1 A;  2NW8 A;  5FMN A;  2MNH A;  3MA9 A;  5L3G B;  3LK4 1;  1NWM X;  5JRC B;  4O4J E;  2QGS A;  2F1T A;  3DTO A;  2J1D G;  3N2O A;  3PE0 A;  4JLE A;  4GK0 E;  4JFB A;  3SYB A;  5BMV E;  5JDG A;  2E9X A;  1B7T A;  3AAI A;  3KFW X;  2NW7 A;  4O4H E;  1UCU A;  4QX7 B;  4QHO A;  3IHR A;  3V5U A;  2KT9 A;  2V7K A;  2ODV A;  5AFU L;  3WAJ A;  2X67 A;  2K24 A;  3AAA B;  4HEA A;  2D0U A;  4CI3 B;  3NSG A;  2VKO A;  2E9X D;  4UEL A;  5DQV A;  4V1A v;  1IAP A;  3PRN A;  5DL7 A;  2J4U P;  3I1A A;  2L3L A;  4IGU A;  4CXY A;  3ZPO A;  4CXX A;  1MIW A;  4D5U A;  4X1Y E;  2QTK A;  5HXE A;  3FBL A;  2LHF A;  2ACX A;  2MYS A;  4J2C A;  4UF0 A;  3RBH A;  4UVA B;  3QUJ A;  5LCY A;  3ZMV B;  3CKD A;  3PU3 A;  3E0Z A;  2NP9 A;  3VU7 H;  5LHI B;  4HFV A;  5HXH A;  1IJ6 A;  1MMA A;  4QQ1 A;  4AYE C;  5IYU A;  2P9B A;  1IZN A;  3VZU X;  1D1C A;  1YD8 G;  1Y64 B;  2X27 X;  4MFR A;  4ILU A;  3UUM A;  5C8Y E;  3EUH A;  2WBL A;  2XG6 A;  1FEW A;  3F57 A;  4ZI7 E;  4GHB A;  2E9X C;  1MMD A;  2EHO C;  3RC3 A;  4FZN A;  2CEA A;  1GFN A;  3AA1 B;  3PDY A;  3P7I A;  2SPC A;  4PNI A;  4GCP A;  5CA0 E;  3O1I A;  1X79 A;  2W62 A;  4L9I A;  5LA6 E;  4NUV A;  2Y2X A;  4EZH A;  3HW9 A;  1OWA A;  1ZKE A;  1PHO A;  5IYZ E;  2VKJ A;  2J1N A;  1YW0 A;  5E0O A;  3HA4 A;  2ODJ A;  2LHR A;  4DO0 A;  3ZCJ A;  4ADZ A;  2IC6 A;  1Z0P A;  4ZI3 D;  4O4X A;  4LSF A;  2X9H A;  4IIJ E;  1GFM A;  5DQW A;  2CMR A;  3KV5 A;  4GIW A;  5LBM A;  2MBG A;  4RJX A;  3BQK A;  2OA5 A;  3O4X E;  3EVY A;  3NZP A;  5FP3 A;  4TN7 B;  2X66 A;  4ZI2 D;  3MAC A;  1V9D A;  4L5G A;  3MK7 C;  1WRD A;  3LK2 A;  3POU A;  4PW8 A;  4H63 V;  4KBM B;  3WAK A;  1KK7 A;  2K5B B;  1O3X A;  4B6X A;  3N9N A;  5HXS A;  1LVF A;  3BQI A;  3Q5W A;  4GYS A;  2JMH A;  3CVR A;  2HH7 A;  3KBU A;  4YLH A;  2Y7S A;  3B13 A;  1E54 A;  2D2S A;  3F31 A;  2BDE A;  3N9Q A;  2ZM8 A;  4IE6 A;  3K3Q C;  3POR A;  4WW0 A;  5EK4 A;  3A5X A;  1BR4 A;  3VY8 X;  1MIY A;  5ADX K;  1ZEE A;  2LOS A;  2K48 A;  4JUY A;  4PUX A;  2YEV C;  4D64 A;  4AKL A;  4AQG A;  1HF8 A;  3CQC B;  3K3O A;  4X20 E;  2G0U A;  2JRK A;  1HXX A;  1MNE A;  7PRN A;  1G90 A;  5J1G A;  4O4I E;  2E9X B;  2PJQ A;  3I0Q A;  5L3C B;  3QRC A;  3VY9 X;  5JDF A;  2CA5 A;  2KLQ A;  2LSI A;  2W00 A;  2XE3 A;  5FXW A;  5JRE A;  4Z3T A;  4FES A;  1HS7 A;  4AFK A;  3UUL A;  2LEH A;  3Q9D A;  5KDM C;  4PJL A;  4CI1 B;  3ZYL A;  4HGA A;  4IE0 A;  3RYC E;  4BJM A;  4NUU A;  4PK4 A;  4FOZ A;  4N59 A;  2A72 A;  2V7J A;  1ORM A;  1ZHT A;  2XAJ B;  5JDH A;  4FT6 A;  1WLX A;  4XAX B;  5HWX A;  3ETU A;  2KZ7 B;  4P09 A;  4CI2 B;  3ANW A;  4UF0 B;  2N9D A;  5HXR A;  1GFQ A;  2LM9 A;  3KV4 A;  4U72 A;  4F6R C;  3L09 A;  5D5D A;  3E22 E;  5DL5 A;  2N2N A;  3MZK B;  2LSG A;  2ZMA A;  1GFO A;  1US7 B;  1QJ9 A;  3OBV E;  3UU2 A;  1D1A A;  5A1L A;  1E1H B;  1BR0 A;  1SHZ C;  4PFP A;  3LK4 2;  4UV8 B;  1VRB A;  3KBT A;  5HAX A;  3RKO A;  4XBF B;  2YNK A;  2ZFG A;  2N2M A;  2FGQ X;  1BH3 A;  1LVK A;  1U4Q A;  3FYX A;  2BZB A;  3C50 A;  4TX5 A;  3ZMU B;  4C69 X;  2GK9 A;  3G7G A;  4CXW A;  2V1D B;  2WWU A;  4FSO A;  2RA1 A;  3N2K E;  3AA6 A;  5JR9 A;  4HTE A;  4TZ4 C;  2MTQ A;  2EHO A;  4PJN A;  4YFS A;  3U3I A;  4IE7 A;  3KIN B;  3ZMS B;  3K3N A;  3LBX A;  4AYI D;  2DHR A;  1QSD A;  2Y8D A;  3QK6 A;  3EMN X;  3AA7 B;  2C0S A;  3CPZ A;  3HI2 A;  1WR6 A;  4KMC A;  2EHO D;  5PRN A;  2LSK A;  1YKH B;  1YKE B;  5EK2 A;  2IC9 A;  3JC6 D;  5ETW A;  1FIO A;  3ZEF B;  1QJP A;  2XAG B;  3ZLI A;  3LK2 B;  1MMN A;  4YHJ A;  3LJC A;  5H6R B;  5T5F A;  4AUI A;  3M65 A;  4AI6 A;  1OXZ A;  2Q9Q A;  4H9R C;  3RYH E;  2VK9 A;  4EB6 E;  4C90 A;  4RJW A;  2NWB A;  2JMK A;  5TAO A;  1MMG A;  2UXN B;  4IHJ E;  5LJN A;  3MXZ A;  3VZW X;  5JDL A;  3O0E A;  3PUA A;  5L2L A;  1T98 A;  2KWH A;  5FNV E;  3AAE B;  4O3X B;  3AVS A;  3T24 A;  1VOM A;  1D1B A;  3HL6 A;  2CCQ A;  3N9P A;  4I4T E;  4KUM B;  2Q9Q D;  3RX6 A;  3ZN1 B;  2C5I T;  5JR9 C;  3VE2 A;  4Z8X A;  4FMS A;  3CML A;  4QX8 B;  4XNL A;  3JC6 C;  2CLY C;  3DA4 A;  4IDZ A;  3AA0 B;  3C4X A;  1P4T A;  3AVR A;  3PQU A;  4AKM A;  5EZY E;  3O1H A;  2DI4 A;  2C5J A;  4ZOL E;  3ZCI A;  4FZL A;  2W63 A;  1IJ5 A;  2PBI A;  2V7M A;  3UPG A;  3NZQ A;  4ZHQ E;  3VKG A;  1HCI A;  4MAL A;  3SS1 A;  2D5U A;  3PUS A;  4E7Z A;  4RL9 A;  3EDU A;  2XUE A;  2CM0 A;  3ZC1 A;  3JTY A;  4HN9 A;  3VE1 A;  5LGN B;  2D0T A;  1GFP A;  2Q9Q C;  3SRZ A;  2XE2 A;  3PQS A;  2YU2 A;  4EXT A;  1Q9F A;  4WBO A;  2F1V A;  4BUM X;  4MHC A;  4ISS A;  3UUX B;  3I9Y A;  2DCF A;  2I59 A;  5JRC A;  5L3B B;  1CUN A;  2KND A;  3CX7 B;  4QXH B;  4WNK A;  5HYA A;  4MLK A;  3B57 A;  4K0U A;  3ANW B;  2VB6 A;  3SOL A;  1MIV A;  2XTL A;  3ONX A;  4D65 A;  2XAQ B;  1U5P A;  2BVM A;  3POX A;  3RH3 A;  3UFE A;  4EOZ B;  4UVC B;  1PRN A;  3S4U A;  1FMV A;  4TV8 E;  3FBZ A;  3HR0 A;  2PFV A;  2IW5 B;  1KNZ A;  5JVD E;  2KIN B;  1LKX A;  2X0L B;  2JQQ A;  4OYJ A;  4RLB A;  2W80 C;  4DVD A;  1BT9 A;  3R84 B;  5F3J A;  5CB4 E;  4QXC B;  2X9W A;  5JDM A;  3MJX A;  3DJB A;  4AKI A;  2L9Q A;  2XAH B;  4AZL A;  2CWY A;  2PRN A;  3RYI E;  2DWG A;  2CXL A;  5LP6 E;  4G63 A;  1LRZ A;  5ADX L;  5LYJ E;  4O3W A;  6PRN A;  2EHO B;  3CQG B;  4ZS2 A;  2JJ9 A;  4WBN E;  5LGU B;  3LFM A;  3I0O A;  4O3Z A;  5DL6 A;  2M06 A;  4AKR A;  4IST A;  3ZYK A;  3Q5X A;  4UEM A;  4U74 A;  2MHL A;  2M67 A;  4MBQ A;  4QXB B;  2C5K T;  3PUG A;  4PJM A;  3KDS E;  3TZG A;  2PG8 A;  3HWB A;  3U78 A;  1NAF A;  2Y6X A;  3N9O A;  1H7C A;  1SA0 E;  2LHN A;  3NRX A;  3ESL A;  4UIG A;  1HG5 A;  3Q2M A;  1AJ3 A;  3PU8 A;  4TUY E;  3K8P C;  5J2U E;  2XTR A;  2YK0 A;  4UV9 B;  4FRX A;  1MM5 A;  1Q9G A;  4GCQ A;  4CQI A;  4KP3 C;  3FHN A;  2XTQ A;  1QUU A;  1H6S 1;  3T20 A;  5JDN A;  4RLC A;  4AKG A;  3KVD D;  3GN5 A;  2XQY A;  3F2E A;  3VKH A;  4ERR A;  3ZMT B;  2LSJ A;  4ANJ A;  2H7V C;  2HPJ A;  3C5O A;  3R6N A;  3UT5 E;  5J2T E;  2HPL A;  3K19 A;  3SZD A;  3T0S A;  1D0Y A;  1IZN B;  2ZLY A;  4JEU B;  2VL8 A;  3PUR A;  4AXP A;  5JH7 E;  2VKH A;  3NRY A;  2XE1 A;  5FY1 A;  5IHY A;  3RRC A;  1MM4 A;  4GK5 E;  1YS5 A;  2ES0 A;  1BR2 A;  3OJA A;  4OYK A;  3C51 A;  4FUV A;  4U9C A;  3FB2 A;  4PFO A;  2X9X A;  3C98 B;  1ZV4 X;  4QKN A;  2CXD A;  2LSY A;  2CXF A;  2LJL A;  3P8C D;  4LSE A;  2KDY A;  3QRA A;  3ZJ1 A;  4GYR A;  4G76 A;  4I55 E;  2V26 A;  3TKL B;  4FI5 A;  3CWZ B;  2VKD A;  4O8S A;  5FVN A;  4H9P C;  3V5S A;  2K0L A;  1G73 A;  3HKB E;  2BVL A;  2YPV A;  2VAS A;  2KXP A;  4OFZ A;  2VWA A;  3FXE B;  4G2A A;  1WYB A;  2W0G A;  3UUN A;  1EZ3 A;  2LFU A;  4PK6 A;  3ZC0 A;  3V8U A;  2X68 A;  4ZS3 A;  5LHG B;  2OMF A;  2X9Y A;  3W15 B;  3ZMZ B;  4AYN A;  3NBX X;  5FYM A;  1G8X A;  2DNX A;  4EYU A;  2DWK A;  1HTJ F;  3SWH A;  3SYS A;  2UXX B;  5AFU K;  3EDV A;  4BJN A;  2V7I A;  5LGT B;  3DA3 A;  1HXU A;  3RC8 A;  2Z6E A;  1S94 A;  4I50 E;  3CX6 B;  2NTX A;  4DMV A;  3VHL A;  4H9O C;  4KRA A;  2DLR A;  4JEH B;  2N2L A;  2NTY A;  4FSP A;  2H7O A;  3N5L A;  3ZYM A;  2WSS V;  2KWI B;  4IE5 A;  4PJJ A;  4EZ4 A;  5LJM A;  4AKH A;  1HXT A;  1ZHX A;  4F4B A;  1OSM A;  3OKQ A;  1UX4 A;  4C91 A;  2YIN A;  1S35 A;  5LHH B;  4IE4 A;  5GON E;  1HFA A;  2XAF B;  4ASK A;  3LK3 A;  2KZ7 A;  3C64 A;  5LXT E;  3SY7 A;  3J9X 1;  3BK9 A;  1WYC A;  2KMF A;  3RYF E;  4AQF A;  4GF4 A;  3HKC E;  5L3E B;  5FXZ A;  4KR4 A;  4AKR B;  2ZM2 A;  5FXX A;  3AB3 B;  3GP6 A;  1ZHW A;  1ZHC A;  3H3A A;  2V7L A;  2WMN A;  4OK0 A;  5LNK A;  2X51 A;  4A56 A;  5EE2 A;  3E08 A;  4I43 B;  4LSH A;  3RPU A;  4H9S E;  3PUQ A;  2K9A A;  3OYX A;  5CA1 E;  3ZN0 B;  3OYZ A;  5DL8 A;  3DP7 A;  3IEE A;  3I9W A;  4O4U A;  4PK5 A;  3CQX C;  3SY9 A;  3C4Z A;  5HWY A;  1BR1 A;  4BA9 A;  1HX8 A;  4P0A A;  4KR8 A;  4E1T A;  4P0B A;  5G26 A;  3GN5 B;  3O9X A;  5FY0 A;  2W61 A;  3D0T A;  5F8P A;  4EYY R;  5KMG P;  3CX8 B;  1QJ8 A;  2FGR A;  2JMM A;  2POR A;  2K4T A;  2ERV A;  4L0R A;  5GV0 A;  5M4Y A;  4H63 H;  3N2G E;  1FMW A;  3AAA A;  3KV6 A;  3AA7 A;  4O2B E;  4E7S A;  2Y0H A;  4UVB B;  4DBR A;  2QA7 A;  4AQF C;  2A2F X;  4E1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...