3AA0B

Crystal structure of actin capping protein in complex with the cp-binding motif derived from carmil
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
243
structure length
243
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
total genus 85
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aa0B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aa0B02
1IZNA 1IZNB 2KZ7B 3LK3B 2KXPB 3AA7A 3LK42 2KZ7A 3LK2B 3AAEA 3AA6B 3AA0A 5ADXL 5ADXK 3AAAB 3AA1B 4AKRB 3AA0B 5AFUL 5AFUK 4AKRA 3AA1A 3AAEB 3AAAA 3LK2A 3AA7B 3LK41 2KXPA 3AA6A 3LK3A
chains in the Genus database with same CATH superfamily
4GCPA 5JDMA 1IBLT 4U2YA 3FHNA 3B13A 3IHRA 2D0UA 4OYKA 4LF9T 3ZSTA 3C5OA 2W67A 4Z8XA 4A56A 2XAGB 4PJNA 4LSIA 4H63H 5T5FA 3PURA 1XWMA 2D9DA 5AQGB 1Z0PA 2FJAA 3WAJA 4C4VA 4YFSA 4E1TA 5LA6E 3HKEE 4YSXA 1N34T 3QOFA 5LG3A 4DIDB 3DZMA 4EYUA 2JQQA 2XHEB 4DV0T 3RYHE 1FJGT 4AQFA 3W15B 4TNWA 2RP4A 3GMIA 3NSGA 1KFYA 3PUYF 2IHR1 4FRTA 5GV0A 2UUBT 4NXNT 3T24A 4DV2T 1ZHWA 1U5PA 3U78A 1G73A 4FJOA 3VHLA 1KEYA 3I1AA 4FOZA 4JI2T 1I6ZA 3KZIO 5L3DB 4YTMA 1VOMA 3E22E 3UPGA 4EB6E 1XMOT 3LJCA 3EUHA 2CBJA 1GQEA 4NPPA 2NW8A 2VURA 2LM9A 4ASKA 4JEUB 3ZT5A 4GOUA 2Y7SA 4TUYE 4U2ZA 3P4PA 2BZBA 4FMSA 1NENA 2X67A 1YW0A 3KV6A 5IYUA 4CI1B 1Y64B 1VCSA 2Z6EA 1MM4A 2VKHA 2WU2A 4DV5T 2WP9A 2QTKA 3QC9A 2UXCT 4FQEA 1G90A 5KX5E 2I0MA 3UULA 3B57A 2BG9A 5ABEA 2ES0A 3UAQA 4CI3B 2MNHA 3N9LA 3DP7A 3N9MA 2IAKA 4DR1T 4UVBB 1Z8UA 4HE8A 4Q25A 3O1IA 4RL9A 3EDUA 1W09A 4JLEA 4TV9E 2V26A 3FBZA 2FJBA 4DUYT 3ZC0A 4WW0A 4EAHA 2W63A 3QNUA 4ZI2C 1EZ3A 4JFBA 1BR2A 4TWDA 2J1DG 5HEOA 2CBIA 2QRXA 5J2TE 3EDVA 2CWYA 3VU7H 2NP9A 4ZI3D 4N78D 2VKJA 4QX8B 1FIOA 5TISO 2OV9A 3LFMA 3FBLA 1G8XA 5FVNA 4I50E 2CCQA 1ZOYA 3SZVA 5H2FO 5HXHA 2M6IA 4AQYT 2H88A 5EK4A 2P9BA 2H7VC 4UR9A 4GKJT 3AXJA 1S94A 5HXEA 2HPJA 3V8UA 2LM2A 4IDOA 5AQTB 2OA5A 3PU3A 2Y0LA 3MK7C 1BR0A 3X1DA 4RJXA 4F8HA 3UUBA 2X9YA 4P0BA 5AQOB 4FT6A 4U9CA 4KUMB 3AEBA 2CLYB 4AYDC 3UU6A 2WZIA 1LVFA 4UELA 5LOVE 3ZMVB 4HTEA 2M6BA 3GP6A 2VK9A 1UK5A 2FUPA 3C98B 5DJQC 5H6QB 2WZHA 4EEDA 5CGMA 2WSSV 3CIRA 3ZMUB 1MMAA 4DVDA 2YDRA 2NTYA 4C69X 2YDSA 1X79A 2F1VA 4G76A 1UGOA 4IDQA 5HEHA 2ODJA 3MXZA 2IW5B 2XASB 3ZKRA 1OEDB 3E0ZA 2BVLA 5JDGA 3TKLB 4O4XA 3I9YA 3RIUC 3UUMA 4KR4A 3VKGA 4LF4T 4PK4A 2IWWA 4DMVA 2VVSA 3JC6D 3V5UA 5A1LA 3Q9DA 4IDPA 1ZHZA 1KF6A 3C4WA 2NWBA 1D1AA 3L3PA 3KVDD 2E9XD 2DHRA 5L3EB 3C64A 5C3JA 2VL0A 5F3JA 2LKHA 2WS3A 4HKAA 3RF1A 2EHOB 4HFDA 2A72A 2VL8A 3VZWX 1IZNB 1YKHB 3A7MA 2KZ7B 2YK0A 3LBXB 2HPLA 3LDQB 2C5JA 2K5BB 5GTIO 5HXSA 5JREA 5LGNB 4LFAT 1W0BA 2ODVA 3PGRA 4ADZA 3NZPA 5FXWA 4HWIB 2Q9QD 1FEWA 3LK3A 3QRCA 5JTGA 3CMLA 5KMGP 3J9X1 4D5UA 2Q9QB 1BR1A 3VRBA 3HW9A 2SPCA 4HFIA 4HFCA 4IL9A 2C5IT 3AE7A 4TWFA 2WU5A 2BKOA 3POQA 4CI2B 3ZN1B 2XTLA 4H9QC 5J1GA 1HCIA 2FGRA 4ILAA 3FB2A 2AXDS 4DO0A 4TZ4C 4YTNA 4J2CA 2CRBA 4M1PA 2J4UP 2E8IA 1E1HB 2L9QA 3EHZA 2ZM0A 3KDSE 3RIUA 2R8AA 3CX8B 2KXPB 2WMNA 1J1JA 2H89A 5JR9A 3EAMA 4WBNE 3G06A 3PUGA 5C2TA 3AA0A 5L3GB 1W9RA 3UUXB 2MOZA 3RI5A 4IREA 5LBMA 4YSYA 2I59A 2V7JA 2DWGA 1T1LA 2LFUA 3AAAA 4IT4A 3FZLB 3Q5XA 2Y0KA 1E7PA 3N9PA 2JQ9A 2K48A 3R6NA 4XBFB 4CXWA 2V8SV 4H9SE 3Q5EA 2JQKA 3WAKA 1YQ3A 4DV7T 4NXMT 2PORA 1KK7A 4EV6A 2LE8A 3U3IA 2VKDA 4GK0E 4DR7T 2EHOD 2R88A 2LSKA 3KVAA 1SA0E 2RPAA 4QX7B 3I0OA 4AFKA 2Y8DA 5LMUT 2ZLDA 1HF8A 5CFBA 5HAXA 3F57A 4XZCA 3DJBA 2HN2A 4U31A 3AA1B 1UX5A 1HG2A 2PFVA 4ILBA 3OYZA 2LHFA 2E5VA 5L3CB 3SWHA 3AA6A 3RIFA 3N9OA 2XQ3A 3IEEA 3TZGA 3CKDA 3PUXF 2KT9A 3AAEA 3R84B 3WI5A 2N2LA 3PGSA 3ZT6A 2XM2A 1UUSA 4PUXA 2XSBA 2LKGA 2YEVC 4GCQA 4EIWA 5FVKA 2WWVA 1M62A 1CUNA 3Q5DA 4O4LE 2CPTA 4B3TT 2V1DB 4AYEC 5FYMA 1Y01A 2IWVA 3JADA 4IL6O 3FZKB 4AUIA 1M7KA 3GN5A 4A97A 3FXDB 4CQIA 5JRCB 2KLQA 3LK2A 4K3BA 2F1CX 5LMNT 2ZM8A 4HGAA 2JRKA 4MLKA 4XNLA 3MKDA 1T98A 5FXVA 3QK6A 4I4TE 4MHCA 3UTKA 4X5TA 1UCUA 4PW8A 4Z91A 5JDHA 1N33T 2BVMA 1IJ6A 3O1HA 4CN1A 2AXTO 3K1SA 5ABFA 4Z3TA 1HG5A 4KHZF 3FZFB 4YJ2E 4X1KE 2QA7A 3CQCB 4HFHA 5LCYA 3PUSA 1UURA 3ZMZB 1YXRA 4KP3C 3NJTA 5DL8A 5LJMA 3UQ7A 5JQGE 1VCTA 4HFEA 4QXBB 4GHBA 4EEBA 3VE1A 2LJLA 3RYIE 2WDQA 1OWAA 4UIGA 1NWMX 2W61A 1ZP0A 3DTOA 3PJAJ 4O49A 3IF8B 1XDOA 2MPKA 4DBQA 4JV5T 2BG9C 4FUVA 3PUAA 2CM0A 3OYXA 3JCUO 5ABGA 3QRAA 4JCHA 3LK2B 3BRYA 2UU9T 2WMOA 4JI0T 3PQSA 3GN5B 4LMLA 1XZYA 2BS4A 2X0YA 3F31A 1QLBA 4MALA 4HFVA 2K3WA 2YDQA 4AI6A 5HEJA 2G0UA 4GCSA 1H7CA 4U33A 3FZHB 4X1YE 3P50A 2HH7A 1WR0A 3N9QA 2V5CA 4H9NC 3AAEB 1GFNA 5EE2A 5FNVE 4B3MT 4JI5T 4PJMA 3K3QC 2LHRA 3DWOX 4UXNB 3ANWA 5JDFA 2IUBA 5AQFB 2WBLA 1ZHTA 2BS2A 2X9WA 3C51A 4TV8E 3P7IA 4IL4A 3UFGA 3SS1A 4H9OC 1E54A 2CHOA 4ZI2D 2WDVA 5CA0E 1DU2A 3F2EA 4L0RA 5F5WA 2PG8A 2Y6XA 3UU3A 2EHOA 3ANWB 3O4XE 3H3MA 1YD8G 3RQUA 4N74A 2X68A 3PUQA 2X9HA 5ADXL 1T7SA 5ADXK 5G3AA 1O3XA 4QXCB 4WZXA 4O3XB 3UUNA 4FESA 4UB8O 2XQ5A 4GYRA 1T16A 4UB6O 1JNZA 3KV5A 4IE5A 5AQUB 2IDOB 5L2LA 5LBQB 4EYYR 2KWHA 3P8CD 4YT0A 4K3CA 4ANJA 3AE1A 5IUXA 1MMGA 3RGLA 5D5DA 2M67A 2LHNA 5GTHO 4DR2T 3KBUA 2CA5A 2V5DA 5C8YE 3Q5WA 5DL6A 2F4VT 2ACZA 5HXRA 4PFPA 4UF0B 3SYSA 4IE0A 4I43B 1NAFA 1GFOA 1T72A 2XTQA 3VR8A 1UX4A 4O4UA 4CN4A 4B3ST 1I94T 4UV9B 4C91A 2VQFT 4N58A 3O9XA 3AE3A 1E2AA 2HN1A 2K4TA 3LG7A 3ONLC 2PBIA 3VY9X 2BBHA 2MBGA 2XAQB 4FSOA 1OXZA 3MJXA 3A0BO 4G75A 4UV8B 4YSZA 3UU2A 3POUA 4AZLA 1N36T 2W66A 3N2OA 1YS5A 3EMNX 4O4IE 2CXFA 2YOEA 3P4QA 5JRCA 4QXHB 5L3FB 4JI6T 1QJ9A 3KV4A 2E9XA 3HOEA 4H63V 2E9XC 2VB6A 5B66O 1HNXT 3P4RA 3RQWA 5JVDE 3RHWA 3PTRB 1MIYA 1MNEA 2IMLA 3NWIA 3CPZA 1ZV4X 5DL5A 2Q9QA 4PK6A 2OMFA 4QH4A 1IZNA 5HEGA 3HWBA 2ODUA 1ZKEA 4Z90A 5JDNA 4ERRA 4X64T 3PU8A 2Q9QC 4U3CA 3QB5K 3PJAA 2BG9B 3I9WA 4WYVA 3HL6A 3AEFA 1D1CA 1H6S1 5DL7A 3PRNA 3O1JA 4RJWA 4O4JE 4ZHQE 3FXEB 4IDZA 3A5XA 5AQMB 3AEEA 4U7YA 2XY8B 2JQYA 1JNRA 5FKYA 3L8RA 4B6XA 4JUYA 4EGWA 5BR8T 4DUZT 5AQVB 1BT9A 3H3AA 2KC0A 1BH3A 1S5LO 3E08A 3K19A 1LKXA 4IE7A 4WNKA 5JDLA 4KR8A 3Q2MA 3SFDA 3AAIA 2Y48B 4AYID 4JI4T 2V6XA 3AEAA 5JH7E 3BRZA 3HKDE 3K8PC 4BJMA 2KWIB 2J47A 3V5SA 3SOLA 4G63A 4O8SA 3SY9A 4UEMA 4ZI7E 4PJ0O 2X0HA 5DQWA 5FMNA 3AAAB 4MFRA 3T8OA 3ZJ1A 5JR9C 4C4VB 5CB4E 5CJ5A 3OBVE 2XQ4A 4FZMA 2L8KA 5ETWA 3T0SA 1N32T 5HEUA 2JIWA 2LSIA 4P0AA 4AXPA 2X51A 3ZMSB 3AE2A 3T20A 3D0TA 1THQA 4FZLA 5HXCA 2CLYC 3AXJB 2W80C 4O3WA 3DA3A 5LYJE 3NBXX 3VZUX 2BKPA 3ZN0B 4DBRA 2XG6A 3J7Yq 4FZNA 4HEAA 2DI4A 2CXDA 2GK9A 4F6RC 3PUWF 2R4LA 5AQJB 4EXTA 2OLTA 3FZMB 1J5WA 3P4SA 3N2GE 2WM9A 1SE7A 4PR7A 3ONJA 3WI3A 1LVKA 4JI7T 3CWZB 4JYAT 1MMDA 5F8PA 2ERVA 3KV9A 3C4ZA 3CX7B 4BJNA 1WFDA 1FMWA 5H6RB 4YLHA 4ILUA 2XPKA 2CMRA 3OVUA 6PRNA 5G38A 3LK42 2KZ7A 4OX9T 2J1NA 2V7MA 3KINB 3UU8A 4I0UA 3ABVA 5AQNB 2N9DA 3TLVA 3JC6C 4A5XA 2R89A 4IE4A 3SFEA 1QJ8A 2PTFA 3MACA 4ZS2A 3DA4A 3C4XA 2PJQA 3HKBE 2C5KT 4HWDA 5FP3A 5FY0A 2X9KA 5HYAA 3ZSSA 2R6GF 4LFCT 3VZTX 2XQ8A 3UU4A 1OEDA 1HNZT 3CVRA 3CX6B 3VKHA 2XZEA 5KDMC 1US7B 5FY7A 2XAFB 3JAEA 4IE6A 2B76A 3VRAA 4IIJE 1ZHYA 2W00A 2X0LB 4F4BA 5LG4A 3RRCA 3CQXC 2YN6A 3ZEFB 5DQVA 1V9DA 5IWAT 1HR0T 2XAHB 4PK5A 4ISSA 5FXXA 3EI0A 3IA3A 2IC6A 5IHYA 3BQKA 3LK41 2MHLA 2M07A 4H9RC 4YHHT 3C50A 3GA8A 5AQIB 2UXNB 5G39A 3HKCE 4AKLA 5LB7B 5AQHB 4IDNA 4AYMC 4CN6A 2UXDT 4QH1A 1ZEEA 1BR4A 2YU1A 4PAGA 2V7LA 4ZI3C 2L3LA 3P4WA 5AQQB 2NW7A 4V1Av 4QQ1A 2D5UA 5LXTE 3PDYA 3RC8A 1CHUA 3KFWX 3AEGA 4DR6T 2BKNA 1MIWA 4YHJA 5TAOA 4EOZB 2C0SA 3AE9A 4X62T 4DR3T 3T1HT 4KMCA 3AEDA 3EVYA 5PRNA 4E1SA 5KAIO 2KDYA 4DV4T 4HN9A 4NUVA 3ETVA 2O4VA 3L39A 2B1EA 4AIUA 5KAFO 1XNQT 1WLXA 2XE2A 2W4XA 4ZS3A 4LSFA 4K0KT 4PJJA 3ETUA 4O3ZA 2MYSA 4LF7T 4DR4T 2ACXA 5FY1A 1MM5A 2QYWA 3ZCJA 2XQ9A 4P1NA 2ZM6T 4XNKA 5FL1A 4BUMX 3ZC1A 2EHOC 4MBQA 5ABHA 3PORA 5JDQA 4X65T 4HWCA 4YTPA 2FJEA 2W0GA 4P09A 3G7GA 2HHHT 2BG9E 2VKOA 3M65A 3PQUA 5AQRB 3AB3B 1XMQT 4CTDA 4E7SA 5LJNA 3SYBA 2WQYA 3ZJ2A 1SHZC 3OTOT 3ZPOA 4AKGA 4RLBA 3AE8A 2W81C 1ZHCA 4TN7B 3TLTA 2Y2XA 1MPFA 3CK6A 8PRNA 1T8BA 4U72A 4D64A 3ZYMA 1NEKA 2LOSA 3AA7B 3M3ZB 2YINA 4TWHA 4LMKA 2UUAT 2NTXA 5KXJA 1MMNA 1W0AA 2W2UA 1LRZA 5FVLA 2R4NA 4L9IA 3ESLA 3L09A 2Y0HA 4GK5E 2LRKA 4LMJA 2A9UA 2X9XA 3ZLIA 1R8IA 2IIUA 1L0VA 4UF0A 2K9AA 2VQET 2F1TA 2LT3A 4UVCB 2X27X 4JI1T 2KINB 1IJ5A 2DCFA 2KSRA 2AE9A 3AVRA 3N5LA 1D0XA 5L3BB 3N2KE 3JTYA 4WBOA 3WI4A 3RLFF 2JQHA 3LSVA 3K3OA 2LLYA 2GE4A 5HCJA 2LOPA 4LF8T 4LSEA 4U7IA 2JMKA 1ZHXA 4IHJE 1B7TA 2XM1A 2DLRA 4OYJA 2XQ7A 4D65A 2XTRA 4OFZA 3HA4A 4KX6A 1GFMA 1OSMA 3A8YC 5LNKA 4IGUA 1X9BA 2DNXA 2MTQA 2XQAA 1HX8A 2A3DA 4FSPA 4X20E 2N2MA 1MNDA 2QGSA 4ISTA 4X1IE 5LGTB 5E79O 5AQSB 4BA9A 3DWNA 5HWYA 2PRNA 2E2AA 5B5EO 3RX6A 3RBHA 2XUEA 4LF5T 2N2NA 4QH5A 2E9XB 2V7IA 2RA1A 3BS0A 4RLCA 3RKOA 3ZYKA 2YKSA 1P4TA 2VWAA 1S35A 3RKGA 4ZEYA 3UU5A 1HTJF 2E5LT 4K0UA 2J62A 2K24A 3RRWA 3RH3A 5LHIB 1XNRT 4EZHA 3VR9A 1IAPA 2MAWA 5LHHB 2V6YB 2KMFA 5G26A 3HI2A 2R4OA 1HX1B 4FRXA 2BS3A 2WY2A 2LEHA 1QSDA 3H37A 4X66T 4GYSA 4PFOA 2WAUA 5FXZA 3ZYLA 1AJ3A 5M4YA 4GKKT 2CE7A 2XE5A 2XAJB 1BXWA 3NRXA 4AKRB 1ORMA 5DABA 1WRDA 4L5GA 4KRAA 1YKEB 4ZZCA 3A0HO 5GONE 2WWUA 1WYCA 1FMVA 5JDPA 3PV0F 5EK3A 3RYCE 4E7ZA 1OPFA 4ZZBA 2QVAA 2XE3A 2ZFGA 3PUVF 3QB5A 5LP6E 4NUUA 1WCRA 4XAXB 3AE6A 3AE4A 3NRYA 4EZ4A 3MA9A 3TLSA 4ZXLA 2KXPA 3B5MA 2ZMAA 1KNRA 4O4HE 4O3YA 4PJLA 3MZKB 5LHGB 2BBJA 5IYZE 5J0ZA 4COFA 4KBMB 4UVAB 3O0EA 4B61A 5ABFB 5AQKB 2FGQX 4AKRA 4DV6T 2WJRA 1KNPA 3AVSA 5AQLB 4JI8T 5EK2A 1SUMB 2FBWA 1GFQA 4ZOLE 3UQ4A 2FJDA 2UXXB 3SY7A 1HXTA 2JMMA 3KVBA 1HXXA 5HCMA 2CWOA 1HS7A 2LSGA 2K0LA 4KHPT 4LSHA 1Q9GA 2D0TA 1WR6A 2WJQA 3TLUA 1IBMT 3BK9A 2BDEA 2YU2A 2KNDA 1XDPA 2UXBT 4TX5A 4O2BE 3UT5E 4CXYA 3JAFA 2DWKA 4N75A 1PRNA 5BMVE 4LFBT 4YXDA 4AKIA 3PE0A 3POXA 3EABA 4GF4A 4ILCA 4NIQA 1YQ4A 4AQGA 2NOXA 2XQ6A 2A2FX 3SRZA 2ZLYA 2YNKA 2JPFA 2N1GA 5LGUB 4C00A 2W62A 3ONXA 3VY8X 4HWHA 3ZCIA 2YPVA 2JJ9A 2JMHA 1OEDC 3T1YT 2H3RA 2CXLA 2XMXA 4DMWA 2H7OA 4G2AA 2XJ7A 4DV1T 3RYFE 3OJAA 1MIVA 2IC9A 2XE1A 4JI3T 2CHNA 3HR0A 3UFEA 3BQIA 3GWHA 2V7KA 1IBKT 3AA7A 4AYNA 2CEAA 4JBWF 2ZM2A 5FL0A 1HFAA 3AA0B 3ZMTB 4AQFC 3JCFA 1HXUA 4OK0A 1OEDE 1D0YA 4PNIA 3S4UA 4AKMA 1U4QA 3IBPA 4OHFA 3OKQA 4U74A 2NR4A 1VRBA 4B3RT 4CXXA 2D2SA 1HNWT 3K3NA 4BAYB 1QUUA 1KNZA 3RPUA 2M06A 2I6HA 1Q9FA 1D1BA 3KBTA 4H9PC 3RC3A 5E0OA 5AFUL 5AFUK 5AQPB 4A98A 3VE2A 1PHOA 5L4EA 4N59A 5JR9B 4JEHB 4TNVA 5CA1E 3NKZA 2DL1A 4YJ3E 2R4PA 3QUJA 5J2UE 4DR5T 2LRLA 1J5ET 2V6YA 4KI0F 3RIAA 4YY3T 3PGUA 3AE5A 2WDRA 3SZDA 1QJPA 3WU2O 4AKHA 3HOLA 1GFPA 7PRNA 3BQLA 4HFBA 4AISA 2UUCT 4GIWA 3LK3B 1D0ZA 3N9NA 3AECA 2NW9A 3OPCA 2X66A 4HWFA 5L47A 2XQYA 2VASA 4DV3T 5HWXA 3CQGB 2J4GA 1WYBA 3PUZF 3I0QA 3LBXA 4FI5A 2VVNA 2WCAA 3NVOA 4QWNB 5L4HA 4DNDA 3ZT7A 4O2AE 4C90A 3A2SX 2LSJA 3AA6B 2WVPA 5EZYE 4LF6T 2XSAA 2LSYA 3FYXA 2WB5A 4CZZB 3NZQA 3AA1A 3TLWA 4QHOA 3PF1A 4I55E 4QKNA
chains in the Genus database with same CATH topology
4GCPA 3FXEB 5JDMA 4IDZA 2PORA 4UF0A 3A5XA 3FHNA 3B13A 1KK7A 3IHRA 2D0UA 2K9AA 2LE8A 4OYKA 3U3IA 2F1TA 3C5OA 2LT3A 2VKDA 4GK0E 4UVCB 4JUYA 4B6XA 2EHOD 2X27X 2LSKA 3KVAA 2KINB 1SA0E 1IJ5A 4Z8XA 4A56A 2XAGB 4PJNA 4QX7B 1BT9A 2DCFA 4LSIA 3I0OA 3H3AA 4H63H 5T5FA 3PURA 2KC0A 1BH3A 4AFKA 3E08A 3K19A 2Y8DA 1Z0PA 2ZLDA 1HF8A 3AVRA 1LKXA 3N5LA 4IE7A 4WNKA 5JDLA 1D0XA 4KR8A 3Q2MA 5L3BB 5HAXA 3WAJA 3N2KE 3AAIA 2Y48B 3F57A 4WBOA 4YFSA 3JTYA 4AYID 4E1TA 5LA6E 3WI4A 3HKEE 3K3OA 4XZCA 3DJBA 2GE4A 5JH7E 2LOPA 4LSEA 3AA1B 1UX5A 2JMKA 3HKDE 3K8PC 1ZHXA 4EYUA 1HG2A 2JQQA 2PFVA 2XHEB 3OYZA 4IHJE 1B7TA 3RYHE 2LHFA 4BJMA 4AQFA 3W15B 2DLRA 4OYJA 2KWIB 2RP4A 3V5SA 3SOLA 3SWHA 4G63A 5L3CB 3AA6A 3GMIA 3NSGA 4O8SA 4FRTA 4D65A 5GV0A 3N9OA 2XTRA 4OFZA 3SY9A 3IEEA 3TZGA 4UEMA 3CKDA 4ZI7E 2KT9A 3AAEA 3HA4A 1GFMA 3T24A 5DQWA 5FMNA 1OSMA 5LNKA 4IGUA 2DNXA 2MTQA 3R84B 1ZHWA 2N2LA 3WI5A 1HX8A 2A3DA 3AAAB 4FSPA 4MFRA 4PUXA 4X20E 2YEVC 4GCQA 2N2MA 4EIWA 1MNDA 2QGSA 1U5PA 4ISTA 3T8OA 4X1IE 5LGTB 3U78A 1G73A 1CUNA 4FJOA 3ZJ1A 3VHLA 4BA9A 5JR9C 5CB4E 5HWYA 5LG4A 2PRNA 3I1AA 3OBVE 4FOZA 4FZMA 4O4LE 5L3DB 3RX6A 3RBHA 2XUEA 2L8KA 3E22E 1VOMA 2N2NA 2V7IA 2E9XB 2RA1A 2V1DB 2LSIA 5ETWA 5FYMA 4RLCA 3RKOA 4EB6E 3UPGA 4P0AA 4AXPA 2X51A 3LJCA 3ZMSB 3EUHA 3ZYKA 3T20A 3D0TA 1P4TA 2VWAA 2NW8A 1THQA 1S35A 2LM9A 4AUIA 4ASKA 1HTJF 4JEUB 3GN5A 4K0UA 4GOUA 2Y7SA 4FZLA 3FXDB 2K24A 4TUYE 5HXCA 3RRWA 4CQIA 5JRCB 2CLYC 3RH3A 5LHIB 4EZHA 1IAPA 2KLQA 5LHHB 3LK2A 2BZBA 2W80C 4FMSA 4O3WA 2X67A 3DA3A 2KMFA 2ZM8A 4HGAA 5LYJE 2JRKA 1YW0A 3KV6A 4MLKA 3HI2A 3NBXX 5G26A 4XNLA 1AJ3A 3VZUX 5IYUA 3ZN0B 4CI1B 1Y64B 4DBRA 2XG6A 2Z6EA 1MM4A 2VKHA 3J7Yq 4FZNA 4HEAA 2DI4A 3MKDA 2CXDA 4FRXA 2GK9A 1T98A 4F6RC 2QTKA 4EXTA 2LEHA 1QSDA 3H37A 3QC9A 5FXVA 4GYSA 1G90A 4PFOA 5KX5E 2WAUA 3QK6A 5FXZA 4I4TE 3ZYLA 4MHCA 2CE7A 3B57A 3UTKA 3UULA 5M4YA 1UCUA 2XAJB 2XE5A 1BXWA 3N2GE 2ES0A 3NRXA 4PW8A 4AKRB 2WM9A 3UAQA 5JDHA 1ORMA 4CI3B 2BVMA 5DABA 1IJ6A 1WRDA 3O1HA 3N9LA 4L5GA 2MNHA 4Z3TA 1HG5A 3DP7A 1LVKA 3WI3A 3N9MA 4KRAA 1YKEB 2IAKA 4YJ2E 4X1KE 5GONE 3CWZB 2QA7A 2WWUA 3CQCB 1WYCA 1FMVA 5JDPA 4UVBB 5LCYA 4HE8A 5EK3A 3PUSA 1MMDA 3O1IA 3RYCE 4RL9A 4E7ZA 5F8PA 3ZMZB 3KV9A 3C4ZA 2ERVA 4KP3C 3EDUA 1OPFA 5LJMA 5DL8A 5JQGE 3CX7B 4JLEA 4QXBB 4TV9E 4GHBA 3VE1A 2LJLA 2XE3A 4BJNA 2ZFGA 3RYIE 1OWAA 4UIGA 1NWMX 2V26A 2W61A 4NUUA 5LP6E 3FBZA 3DTOA 3ZC0A 4XAXB 4WW0A 3NRYA 4EAHA 2W63A 4O49A 3IF8B 4EZ4A 4DBQA 4ZI2C 3MA9A 1EZ3A 1FMWA 2KXPA 4FUVA 4JFBA 3PUAA 2ZMAA 1BR2A 2CM0A 3OYXA 5H6RB 4O4HE 4YLHA 2J1DG 4ILUA 4O3YA 4PJLA 4JCHA 2CMRA 3QRAA 5J2TE 3MZKB 5LHGB 6PRNA 3EDVA 3LK42 2KZ7A 3LK2B 2CWYA 5IYZE 3VU7H 2WMOA 4KBMB 2J1NA 2V7MA 3KINB 3PQSA 2NP9A 3GN5B 4UVAB 4ZI3D 4N78D 3O0EA 2VKJA 4B61A 3F31A 4QX8B 2FGQX 2N9DA 4AKRA 1FIOA 4MALA 4HFVA 3AVSA 3JC6C 3LFMA 3FBLA 4IE4A 4AYEC 1QJ8A 1G8XA 5EK2A 3MACA 5FVNA 4I50E 2CCQA 4ZS2A 3DA4A 3SZVA 1GFQA 4ZOLE 3C4XA 5HXHA 4AI6A 2PJQA 2G0UA 3HKBE 2C5KT 2UXXB 5FP3A 5FY0A 4GCSA 3SY7A 1H7CA 5EK4A 5HYAA 1HXTA 2JMMA 4X1YE 3KVBA 2P9BA 2H7VC 3VZTX 1HXXA 2HH7A 3N9QA 2CWOA 1HS7A 3CVRA 3CX6B 3VKHA 2LSGA 1S94A 5HXEA 2HPJA 4QKNA 1US7B 5FY7A 5KDMC 2K0LA 3V8UA 2OA5A 3PU3A 3AAEB 4H9NC 1GFNA 2Y0LA 5EE2A 5FNVE 2XAFB 3MK7C 1BR0A 4LSHA 1Q9GA 4RJXA 4PJMA 3K3QC 2D0TA 4IE6A 2LHRA 2X9YA 4P0BA 4FT6A 4IIJE 1ZHYA 4UXNB 1WR6A 4KUMB 2W00A 4U9CA 3ANWA 2CLYB 5JDFA 3BK9A 2BDEA 2X0LB 2WBLA 2YU2A 1ZHTA 4AYDC 4F4BA 2X9WA 2KNDA 3C51A 1LVFA 4TV8E 4UELA 3CQXC 5LOVE 3RRCA 3ZMVB 4HTEA 4TX5A 3GP6A 3P7IA 4O2BE 3UT5E 3ZEFB 4CXYA 2VK9A 5DQVA 1V9DA 3SS1A 4H9OC 1E54A 4ZI2D 3C98B 2DWKA 5CA0E 2XAHB 3F2EA 4PK5A 4ISSA 5DJQC 5FXXA 2IC6A 1PRNA 5H6QB 4L0RA 5IHYA 5BMVE 3BQKA 3LK41 2PG8A 2WSSV 2Y6XA 4AKIA 3PE0A 2M07A 2MHLA 4H9RC 3ZMUB 1MMAA 4DVDA 2EHOA 2NTYA 3C50A 3POXA 4GF4A 3ANWB 3O4XE 4C69X 1YD8G 3GA8A 4AQGA 1X79A 2F1VA 2NOXA 2UXNB 4G76A 2A2FX 3HKCE 3SRZA 2X68A 3PUQA 2X9HA 4AKLA 2ODJA 5ADXL 5ADXK 3MXZA 2IW5B 2ZLYA 1O3XA 4QXCB 4AYMC 2XASB 2YNKA 4O3XB 2JPFA 3UUNA 3E0ZA 4FESA 2BVLA 5JDGA 1ZEEA 2N1GA 1BR4A 5LGUB 3TKLB 2W62A 4GYRA 2YU1A 4PAGA 3I9YA 2V7LA 3UUMA 4O4XA 4ZI3C 2L3LA 3KV5A 4KR4A 3VKGA 3ONXA 3VY8X 4IE5A 2NW7A 4PK4A 4V1Av 3ZCIA 2YPVA 4QQ1A 2JJ9A 4DMVA 2D5UA 5LXTE 2JMHA 3PDYA 5L2LA 2H3RA 3JC6D 3V5UA 5A1LA 2CXLA 5LBQB 2XMXA 4EYYR 3Q9DA 2KWHA 3P8CD 4DMWA 2H7OA 4G2AA 1ZHZA 3RC8A 3C4WA 4ANJA 3KFWX 2NWBA 1D1AA 3L3PA 1MIWA 1MMGA 3KVDD 5D5DA 2E9XD 4YHJA 5TAOA 2DHRA 2LHNA 2M67A 5L3EB 3C64A 3RYFE 4EOZB 2C0SA 5F3JA 3OJAA 4HKAA 1MIVA 2IC9A 2EHOB 3KBUA 2XE1A 2A72A 2CA5A 2VL8A 3HR0A 1IZNB 1YKHB 4KMCA 5C8YE 2KZ7B 3UFEA 2YK0A 3BQIA 3Q5WA 3EVYA 3GWHA 5DL6A 2V7KA 3LBXB 5HXRA 2HPLA 3AA7A 5PRNA 4PFPA 4UF0B 3SYSA 4E1SA 2C5JA 2K5BB 2KDYA 4HN9A 4NUVA 4AYNA 2CEAA 3ETVA 5HXSA 4IE0A 4I43B 1NAFA 1GFOA 5JREA 2O4VA 5LGNB 2XTQA 2ZM2A 1HFAA 1UX4A 3AA0B 4O4UA 3ZMTB 4AQFC 2ODVA 2B1EA 1HXUA 4ADZA 3NZPA 4OK0A 5FXWA 4UV9B 4C91A 1D0YA 4PNIA 1WLXA 2Q9QD 2XE2A 1FEWA 3S4UA 3LK3A 4AKMA 1U4QA 4ZS3A 4N58A 3IBPA 4OHFA 3O9XA 4LSFA 3QRCA 3OKQA 4PJJA 4U74A 3CMLA 3ETUA 1VRBA 4CXXA 4O3ZA 2MYSA 5KMGP 2D2SA 3K3NA 4BAYB 3J9X1 1QUUA 2K4TA 1KNZA 3LG7A 3RPUA 2M06A 2ACXA 5FY1A 2PBIA 3VY9X 1MM5A 4D5UA 2Q9QB 1BR1A 1Q9FA 3ZCJA 1D1BA 3KBTA 4H9PC 3HW9A 2SPCA 5E0OA 2MBGA 2XAQB 3RC3A 5AFUL 1OXZA 3MJXA 4FSOA 5AFUK 4XNKA 4G75A 4UV8B 2C5IT 3VE2A 1PHOA 4N59A 3UU2A 3POUA 4BUMX 3ZC1A 2EHOC 4MBQA 4AZLA 3POQA 4CI2B 3PORA 3ZN1B 5JR9B 4JEHB 2XTLA 4H9QC 5JDQA 5CA1E 5J1GA 1HCIA 3N2OA 2FGRA 4YJ3E 2W0GA 4P09A 3FB2A 3G7GA 3QUJA 1YS5A 5J2UE 3EMNX 4O4IE 3M65A 2CXFA 2VKOA 4DO0A 4TZ4C 3PQUA 3AB3B 3VZWX 4J2CA 5JRCA 3SZDA 4E7SA 5LJNA 1QJPA 4QXHB 4AKHA 5L3FB 3HOLA 4M1PA 1GFPA 1QJ9A 3SYBA 7PRNA 2E8IA 3BQLA 1E1HB 2L9QA 2J4UP 2ZM0A 3KDSE 3ZJ2A 1SHZC 3ZPOA 3KV4A 2E9XA 4AKGA 4RLBA 4GIWA 3HOEA 3CX8B 3LK3B 1D0ZA 3N9NA 2KXPB 2WMNA 1ZHCA 4H63V 2E9XC 2W81C 4TN7B 2NW9A 2Y2XA 2VB6A 5JR9A 1MPFA 4WBNE 5JVDE 3PUGA 2X66A 3PTRB 8PRNA 1MIYA 5L3GB 3AA0A 3UUXB 1MNEA 2MOZA 4U72A 4D64A 2XQYA 2VASA 5LBMA 2I59A 3CPZA 1ZV4X 5DL5A 2V7JA 2DWGA 5HWXA 3CQGB 3ZYMA 2Q9QA 2LFUA 3AAAA 2LOSA 1WYBA 3AA7B 4PK6A 2OMFA 3I0QA 2YINA 3LBXA 4FI5A 3Q5XA 2Y0KA 1IZNA 3HWBA 2NTXA 1MMNA 3N9PA 2ODUA 1ZKEA 2K48A 5JDNA 4ERRA 4QWNB 3R6NA 3PU8A 4DNDA 4XBFB 4CXWA 3T0SA 4O2AE 4C90A 1LRZA 3A2SX 2LSJA 2Q9QC 3AA6B 4H9SE 5EZYE 4L9IA 3I9WA 2LSYA 3FYXA 3ESLA 3HL6A 3L09A 4CZZB 3NZQA 4GK5E 1D1CA 3WAKA 1H6S1 2Y0HA 3AA1A 5DL7A 4QHOA 3PRNA 3O1JA 2X9XA 4I55E 4O4JE 4ZHQE 3ZLIA 4RJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IZN A;  1IZN B;  2KZ7 B;  3LK3 B;  2KXP B;  3AA7 A;  3LK4 2;  2KZ7 A;  3LK2 B;  3AAE A;  3AA6 B;  3AA0 A;  5ADX L;  5ADX K;  3AAA B;  3AA1 B;  4AKR B;  3AA0 B;  5AFU L;  5AFU K;  4AKR A;  3AA1 A;  3AAE B;  3AAA A;  3LK2 A;  3AA7 B;  3LK4 1;  2KXP A;  3AA6 A;  3LK3 A; 
#chains in the Genus database with same CATH topology
 4GCP A;  5JDM A;  1IBL T;  4U2Y A;  3FHN A;  3B13 A;  3IHR A;  2D0U A;  4OYK A;  4LF9 T;  3ZST A;  3C5O A;  2W67 A;  4Z8X A;  4A56 A;  2XAG B;  4PJN A;  4LSI A;  4H63 H;  5T5F A;  3PUR A;  1XWM A;  2D9D A;  5AQG B;  1Z0P A;  2FJA A;  3WAJ A;  4C4V A;  4YFS A;  4E1T A;  5LA6 E;  3HKE E;  4YSX A;  1N34 T;  3QOF A;  5LG3 A;  4DID B;  3DZM A;  4EYU A;  2JQQ A;  2XHE B;  4DV0 T;  3RYH E;  1FJG T;  4AQF A;  3W15 B;  4TNW A;  2RP4 A;  3GMI A;  3NSG A;  1KFY A;  3PUY F;  2IHR 1;  4FRT A;  5GV0 A;  2UUB T;  4NXN T;  3T24 A;  4DV2 T;  1ZHW A;  1U5P A;  3U78 A;  1G73 A;  4FJO A;  3VHL A;  1KEY A;  3I1A A;  4FOZ A;  4JI2 T;  1I6Z A;  3KZI O;  5L3D B;  4YTM A;  1VOM A;  3E22 E;  3UPG A;  4EB6 E;  1XMO T;  3LJC A;  3EUH A;  2CBJ A;  1GQE A;  4NPP A;  2NW8 A;  2VUR A;  2LM9 A;  4ASK A;  4JEU B;  3ZT5 A;  4GOU A;  2Y7S A;  4TUY E;  4U2Z A;  3P4P A;  2BZB A;  4FMS A;  1NEN A;  2X67 A;  1YW0 A;  3KV6 A;  5IYU A;  4CI1 B;  1Y64 B;  1VCS A;  2Z6E A;  1MM4 A;  2VKH A;  2WU2 A;  4DV5 T;  2WP9 A;  2QTK A;  3QC9 A;  2UXC T;  4FQE A;  1G90 A;  5KX5 E;  2I0M A;  3UUL A;  3B57 A;  2BG9 A;  5ABE A;  2ES0 A;  3UAQ A;  4CI3 B;  2MNH A;  3N9L A;  3DP7 A;  3N9M A;  2IAK A;  4DR1 T;  4UVB B;  1Z8U A;  4HE8 A;  4Q25 A;  3O1I A;  4RL9 A;  3EDU A;  1W09 A;  4JLE A;  4TV9 E;  2V26 A;  3FBZ A;  2FJB A;  4DUY T;  3ZC0 A;  4WW0 A;  4EAH A;  2W63 A;  3QNU A;  4ZI2 C;  1EZ3 A;  4JFB A;  1BR2 A;  4TWD A;  2J1D G;  5HEO A;  2CBI A;  2QRX A;  5J2T E;  3EDV A;  2CWY A;  3VU7 H;  2NP9 A;  4ZI3 D;  4N78 D;  2VKJ A;  4QX8 B;  1FIO A;  5TIS O;  2OV9 A;  3LFM A;  3FBL A;  1G8X A;  5FVN A;  4I50 E;  2CCQ A;  1ZOY A;  3SZV A;  5H2F O;  5HXH A;  2M6I A;  4AQY T;  2H88 A;  5EK4 A;  2P9B A;  2H7V C;  4UR9 A;  4GKJ T;  3AXJ A;  1S94 A;  5HXE A;  2HPJ A;  3V8U A;  2LM2 A;  4IDO A;  5AQT B;  2OA5 A;  3PU3 A;  2Y0L A;  3MK7 C;  1BR0 A;  3X1D A;  4RJX A;  4F8H A;  3UUB A;  2X9Y A;  4P0B A;  5AQO B;  4FT6 A;  4U9C A;  4KUM B;  3AEB A;  2CLY B;  4AYD C;  3UU6 A;  2WZI A;  1LVF A;  4UEL A;  5LOV E;  3ZMV B;  4HTE A;  2M6B A;  3GP6 A;  2VK9 A;  1UK5 A;  2FUP A;  3C98 B;  5DJQ C;  5H6Q B;  2WZH A;  4EED A;  5CGM A;  2WSS V;  3CIR A;  3ZMU B;  1MMA A;  4DVD A;  2YDR A;  2NTY A;  4C69 X;  2YDS A;  1X79 A;  2F1V A;  4G76 A;  1UGO A;  4IDQ A;  5HEH A;  2ODJ A;  3MXZ A;  2IW5 B;  2XAS B;  3ZKR A;  1OED B;  3E0Z A;  2BVL A;  5JDG A;  3TKL B;  4O4X A;  3I9Y A;  3RIU C;  3UUM A;  4KR4 A;  3VKG A;  4LF4 T;  4PK4 A;  2IWW A;  4DMV A;  2VVS A;  3JC6 D;  3V5U A;  5A1L A;  3Q9D A;  4IDP A;  1ZHZ A;  1KF6 A;  3C4W A;  2NWB A;  1D1A A;  3L3P A;  3KVD D;  2E9X D;  2DHR A;  5L3E B;  3C64 A;  5C3J A;  2VL0 A;  5F3J A;  2LKH A;  2WS3 A;  4HKA A;  3RF1 A;  2EHO B;  4HFD A;  2A72 A;  2VL8 A;  3VZW X;  1IZN B;  1YKH B;  3A7M A;  2KZ7 B;  2YK0 A;  3LBX B;  2HPL A;  3LDQ B;  2C5J A;  2K5B B;  5GTI O;  5HXS A;  5JRE A;  5LGN B;  4LFA T;  1W0B A;  2ODV A;  3PGR A;  4ADZ A;  3NZP A;  5FXW A;  4HWI B;  2Q9Q D;  1FEW A;  3LK3 A;  3QRC A;  5JTG A;  3CML A;  5KMG P;  3J9X 1;  4D5U A;  2Q9Q B;  1BR1 A;  3VRB A;  3HW9 A;  2SPC A;  4HFI A;  4HFC A;  4IL9 A;  2C5I T;  3AE7 A;  4TWF A;  2WU5 A;  2BKO A;  3POQ A;  4CI2 B;  3ZN1 B;  2XTL A;  4H9Q C;  5J1G A;  1HCI A;  2FGR A;  4ILA A;  3FB2 A;  2AXD S;  4DO0 A;  4TZ4 C;  4YTN A;  4J2C A;  2CRB A;  4M1P A;  2J4U P;  2E8I A;  1E1H B;  2L9Q A;  3EHZ A;  2ZM0 A;  3KDS E;  3RIU A;  2R8A A;  3CX8 B;  2KXP B;  2WMN A;  1J1J A;  2H89 A;  5JR9 A;  3EAM A;  4WBN E;  3G06 A;  3PUG A;  5C2T A;  3AA0 A;  5L3G B;  1W9R A;  3UUX B;  2MOZ A;  3RI5 A;  4IRE A;  5LBM A;  4YSY A;  2I59 A;  2V7J A;  2DWG A;  1T1L A;  2LFU A;  3AAA A;  4IT4 A;  3FZL B;  3Q5X A;  2Y0K A;  1E7P A;  3N9P A;  2JQ9 A;  2K48 A;  3R6N A;  4XBF B;  4CXW A;  2V8S V;  4H9S E;  3Q5E A;  2JQK A;  3WAK A;  1YQ3 A;  4DV7 T;  4NXM T;  2POR A;  1KK7 A;  4EV6 A;  2LE8 A;  3U3I A;  2VKD A;  4GK0 E;  4DR7 T;  2EHO D;  2R88 A;  2LSK A;  3KVA A;  1SA0 E;  2RPA A;  4QX7 B;  3I0O A;  4AFK A;  2Y8D A;  5LMU T;  2ZLD A;  1HF8 A;  5CFB A;  5HAX A;  3F57 A;  4XZC A;  3DJB A;  2HN2 A;  4U31 A;  3AA1 B;  1UX5 A;  1HG2 A;  2PFV A;  4ILB A;  3OYZ A;  2LHF A;  2E5V A;  5L3C B;  3SWH A;  3AA6 A;  3RIF A;  3N9O A;  2XQ3 A;  3IEE A;  3TZG A;  3CKD A;  3PUX F;  2KT9 A;  3AAE A;  3R84 B;  3WI5 A;  2N2L A;  3PGS A;  3ZT6 A;  2XM2 A;  1UUS A;  4PUX A;  2XSB A;  2LKG A;  2YEV C;  4GCQ A;  4EIW A;  5FVK A;  2WWV A;  1M62 A;  1CUN A;  3Q5D A;  4O4L E;  2CPT A;  4B3T T;  2V1D B;  4AYE C;  5FYM A;  1Y01 A;  2IWV A;  3JAD A;  4IL6 O;  3FZK B;  4AUI A;  1M7K A;  3GN5 A;  4A97 A;  3FXD B;  4CQI A;  5JRC B;  2KLQ A;  3LK2 A;  4K3B A;  2F1C X;  5LMN T;  2ZM8 A;  4HGA A;  2JRK A;  4MLK A;  4XNL A;  3MKD A;  1T98 A;  5FXV A;  3QK6 A;  4I4T E;  4MHC A;  3UTK A;  4X5T A;  1UCU A;  4PW8 A;  4Z91 A;  5JDH A;  1N33 T;  2BVM A;  1IJ6 A;  3O1H A;  4CN1 A;  2AXT O;  3K1S A;  5ABF A;  4Z3T A;  1HG5 A;  4KHZ F;  3FZF B;  4YJ2 E;  4X1K E;  2QA7 A;  3CQC B;  4HFH A;  5LCY A;  3PUS A;  1UUR A;  3ZMZ B;  1YXR A;  4KP3 C;  3NJT A;  5DL8 A;  5LJM A;  3UQ7 A;  5JQG E;  1VCT A;  4HFE A;  4QXB B;  4GHB A;  4EEB A;  3VE1 A;  2LJL A;  3RYI E;  2WDQ A;  1OWA A;  4UIG A;  1NWM X;  2W61 A;  1ZP0 A;  3DTO A;  3PJA J;  4O49 A;  3IF8 B;  1XDO A;  2MPK A;  4DBQ A;  4JV5 T;  2BG9 C;  4FUV A;  3PUA A;  2CM0 A;  3OYX A;  3JCU O;  5ABG A;  3QRA A;  4JCH A;  3LK2 B;  3BRY A;  2UU9 T;  2WMO A;  4JI0 T;  3PQS A;  3GN5 B;  4LML A;  1XZY A;  2BS4 A;  2X0Y A;  3F31 A;  1QLB A;  4MAL A;  4HFV A;  2K3W A;  2YDQ A;  4AI6 A;  5HEJ A;  2G0U A;  4GCS A;  1H7C A;  4U33 A;  3FZH B;  4X1Y E;  3P50 A;  2HH7 A;  1WR0 A;  3N9Q A;  2V5C A;  4H9N C;  3AAE B;  1GFN A;  5EE2 A;  5FNV E;  4B3M T;  4JI5 T;  4PJM A;  3K3Q C;  2LHR A;  3DWO X;  4UXN B;  3ANW A;  5JDF A;  2IUB A;  5AQF B;  2WBL A;  1ZHT A;  2BS2 A;  2X9W A;  3C51 A;  4TV8 E;  3P7I A;  4IL4 A;  3UFG A;  3SS1 A;  4H9O C;  1E54 A;  2CHO A;  4ZI2 D;  2WDV A;  5CA0 E;  1DU2 A;  3F2E A;  4L0R A;  5F5W A;  2PG8 A;  2Y6X A;  3UU3 A;  2EHO A;  3ANW B;  3O4X E;  3H3M A;  1YD8 G;  3RQU A;  4N74 A;  2X68 A;  3PUQ A;  2X9H A;  5ADX L;  1T7S A;  5ADX K;  5G3A A;  1O3X A;  4QXC B;  4WZX A;  4O3X B;  3UUN A;  4FES A;  4UB8 O;  2XQ5 A;  4GYR A;  1T16 A;  4UB6 O;  1JNZ A;  3KV5 A;  4IE5 A;  5AQU B;  2IDO B;  5L2L A;  5LBQ B;  4EYY R;  2KWH A;  3P8C D;  4YT0 A;  4K3C A;  4ANJ A;  3AE1 A;  5IUX A;  1MMG A;  3RGL A;  5D5D A;  2M67 A;  2LHN A;  5GTH O;  4DR2 T;  3KBU A;  2CA5 A;  2V5D A;  5C8Y E;  3Q5W A;  5DL6 A;  2F4V T;  2ACZ A;  5HXR A;  4PFP A;  4UF0 B;  3SYS A;  4IE0 A;  4I43 B;  1NAF A;  1GFO A;  1T72 A;  2XTQ A;  3VR8 A;  1UX4 A;  4O4U A;  4CN4 A;  4B3S T;  1I94 T;  4UV9 B;  4C91 A;  2VQF T;  4N58 A;  3O9X A;  3AE3 A;  1E2A A;  2HN1 A;  2K4T A;  3LG7 A;  3ONL C;  2PBI A;  3VY9 X;  2BBH A;  2MBG A;  2XAQ B;  4FSO A;  1OXZ A;  3MJX A;  3A0B O;  4G75 A;  4UV8 B;  4YSZ A;  3UU2 A;  3POU A;  4AZL A;  1N36 T;  2W66 A;  3N2O A;  1YS5 A;  3EMN X;  4O4I E;  2CXF A;  2YOE A;  3P4Q A;  5JRC A;  4QXH B;  5L3F B;  4JI6 T;  1QJ9 A;  3KV4 A;  2E9X A;  3HOE A;  4H63 V;  2E9X C;  2VB6 A;  5B66 O;  1HNX T;  3P4R A;  3RQW A;  5JVD E;  3RHW A;  3PTR B;  1MIY A;  1MNE A;  2IML A;  3NWI A;  3CPZ A;  1ZV4 X;  5DL5 A;  2Q9Q A;  4PK6 A;  2OMF A;  4QH4 A;  1IZN A;  5HEG A;  3HWB A;  2ODU A;  1ZKE A;  4Z90 A;  5JDN A;  4ERR A;  4X64 T;  3PU8 A;  2Q9Q C;  4U3C A;  3QB5 K;  3PJA A;  2BG9 B;  3I9W A;  4WYV A;  3HL6 A;  3AEF A;  1D1C A;  1H6S 1;  5DL7 A;  3PRN A;  3O1J A;  4RJW A;  4O4J E;  4ZHQ E;  3FXE B;  4IDZ A;  3A5X A;  5AQM B;  3AEE A;  4U7Y A;  2XY8 B;  2JQY A;  1JNR A;  5FKY A;  3L8R A;  4B6X A;  4JUY A;  4EGW A;  5BR8 T;  4DUZ T;  5AQV B;  1BT9 A;  3H3A A;  2KC0 A;  1BH3 A;  1S5L O;  3E08 A;  3K19 A;  1LKX A;  4IE7 A;  4WNK A;  5JDL A;  4KR8 A;  3Q2M A;  3SFD A;  3AAI A;  2Y48 B;  4AYI D;  4JI4 T;  2V6X A;  3AEA A;  5JH7 E;  3BRZ A;  3HKD E;  3K8P C;  4BJM A;  2KWI B;  2J47 A;  3V5S A;  3SOL A;  4G63 A;  4O8S A;  3SY9 A;  4UEM A;  4ZI7 E;  4PJ0 O;  2X0H A;  5DQW A;  5FMN A;  3AAA B;  4MFR A;  3T8O A;  3ZJ1 A;  5JR9 C;  4C4V B;  5CB4 E;  5CJ5 A;  3OBV E;  2XQ4 A;  4FZM A;  2L8K A;  5ETW A;  3T0S A;  1N32 T;  5HEU A;  2JIW A;  2LSI A;  4P0A A;  4AXP A;  2X51 A;  3ZMS B;  3AE2 A;  3T20 A;  3D0T A;  1THQ A;  4FZL A;  5HXC A;  2CLY C;  3AXJ B;  2W80 C;  4O3W A;  3DA3 A;  5LYJ E;  3NBX X;  3VZU X;  2BKP A;  3ZN0 B;  4DBR A;  2XG6 A;  3J7Y q;  4FZN A;  4HEA A;  2DI4 A;  2CXD A;  2GK9 A;  4F6R C;  3PUW F;  2R4L A;  5AQJ B;  4EXT A;  2OLT A;  3FZM B;  1J5W A;  3P4S A;  3N2G E;  2WM9 A;  1SE7 A;  4PR7 A;  3ONJ A;  3WI3 A;  1LVK A;  4JI7 T;  3CWZ B;  4JYA T;  1MMD A;  5F8P A;  2ERV A;  3KV9 A;  3C4Z A;  3CX7 B;  4BJN A;  1WFD A;  1FMW A;  5H6R B;  4YLH A;  4ILU A;  2XPK A;  2CMR A;  3OVU A;  6PRN A;  5G38 A;  3LK4 2;  2KZ7 A;  4OX9 T;  2J1N A;  2V7M A;  3KIN B;  3UU8 A;  4I0U A;  3ABV A;  5AQN B;  2N9D A;  3TLV A;  3JC6 C;  4A5X A;  2R89 A;  4IE4 A;  3SFE A;  1QJ8 A;  2PTF A;  3MAC A;  4ZS2 A;  3DA4 A;  3C4X A;  2PJQ A;  3HKB E;  2C5K T;  4HWD A;  5FP3 A;  5FY0 A;  2X9K A;  5HYA A;  3ZSS A;  2R6G F;  4LFC T;  3VZT X;  2XQ8 A;  3UU4 A;  1OED A;  1HNZ T;  3CVR A;  3CX6 B;  3VKH A;  2XZE A;  5KDM C;  1US7 B;  5FY7 A;  2XAF B;  3JAE A;  4IE6 A;  2B76 A;  3VRA A;  4IIJ E;  1ZHY A;  2W00 A;  2X0L B;  4F4B A;  5LG4 A;  3RRC A;  3CQX C;  2YN6 A;  3ZEF B;  5DQV A;  1V9D A;  5IWA T;  1HR0 T;  2XAH B;  4PK5 A;  4ISS A;  5FXX A;  3EI0 A;  3IA3 A;  2IC6 A;  5IHY A;  3BQK A;  3LK4 1;  2MHL A;  2M07 A;  4H9R C;  4YHH T;  3C50 A;  3GA8 A;  5AQI B;  2UXN B;  5G39 A;  3HKC E;  4AKL A;  5LB7 B;  5AQH B;  4IDN A;  4AYM C;  4CN6 A;  2UXD T;  4QH1 A;  1ZEE A;  1BR4 A;  2YU1 A;  4PAG A;  2V7L A;  4ZI3 C;  2L3L A;  3P4W A;  5AQQ B;  2NW7 A;  4V1A v;  4QQ1 A;  2D5U A;  5LXT E;  3PDY A;  3RC8 A;  1CHU A;  3KFW X;  3AEG A;  4DR6 T;  2BKN A;  1MIW A;  4YHJ A;  5TAO A;  4EOZ B;  2C0S A;  3AE9 A;  4X62 T;  4DR3 T;  3T1H T;  4KMC A;  3AED A;  3EVY A;  5PRN A;  4E1S A;  5KAI O;  2KDY A;  4DV4 T;  4HN9 A;  4NUV A;  3ETV A;  2O4V A;  3L39 A;  2B1E A;  4AIU A;  5KAF O;  1XNQ T;  1WLX A;  2XE2 A;  2W4X A;  4ZS3 A;  4LSF A;  4K0K T;  4PJJ A;  3ETU A;  4O3Z A;  2MYS A;  4LF7 T;  4DR4 T;  2ACX A;  5FY1 A;  1MM5 A;  2QYW A;  3ZCJ A;  2XQ9 A;  4P1N A;  2ZM6 T;  4XNK A;  5FL1 A;  4BUM X;  3ZC1 A;  2EHO C;  4MBQ A;  5ABH A;  3POR A;  5JDQ A;  4X65 T;  4HWC A;  4YTP A;  2FJE A;  2W0G A;  4P09 A;  3G7G A;  2HHH T;  2BG9 E;  2VKO A;  3M65 A;  3PQU A;  5AQR B;  3AB3 B;  1XMQ T;  4CTD A;  4E7S A;  5LJN A;  3SYB A;  2WQY A;  3ZJ2 A;  1SHZ C;  3OTO T;  3ZPO A;  4AKG A;  4RLB A;  3AE8 A;  2W81 C;  1ZHC A;  4TN7 B;  3TLT A;  2Y2X A;  1MPF A;  3CK6 A;  8PRN A;  1T8B A;  4U72 A;  4D64 A;  3ZYM A;  1NEK A;  2LOS A;  3AA7 B;  3M3Z B;  2YIN A;  4TWH A;  4LMK A;  2UUA T;  2NTX A;  5KXJ A;  1MMN A;  1W0A A;  2W2U A;  1LRZ A;  5FVL A;  2R4N A;  4L9I A;  3ESL A;  3L09 A;  2Y0H A;  4GK5 E;  2LRK A;  4LMJ A;  2A9U A;  2X9X A;  3ZLI A;  1R8I A;  2IIU A;  1L0V A;  4UF0 A;  2K9A A;  2VQE T;  2F1T A;  2LT3 A;  4UVC B;  2X27 X;  4JI1 T;  2KIN B;  1IJ5 A;  2DCF A;  2KSR A;  2AE9 A;  3AVR A;  3N5L A;  1D0X A;  5L3B B;  3N2K E;  3JTY A;  4WBO A;  3WI4 A;  3RLF F;  2JQH A;  3LSV A;  3K3O A;  2LLY A;  2GE4 A;  5HCJ A;  2LOP A;  4LF8 T;  4LSE A;  4U7I A;  2JMK A;  1ZHX A;  4IHJ E;  1B7T A;  2XM1 A;  2DLR A;  4OYJ A;  2XQ7 A;  4D65 A;  2XTR A;  4OFZ A;  3HA4 A;  4KX6 A;  1GFM A;  1OSM A;  3A8Y C;  5LNK A;  4IGU A;  1X9B A;  2DNX A;  2MTQ A;  2XQA A;  1HX8 A;  2A3D A;  4FSP A;  4X20 E;  2N2M A;  1MND A;  2QGS A;  4IST A;  4X1I E;  5LGT B;  5E79 O;  5AQS B;  4BA9 A;  3DWN A;  5HWY A;  2PRN A;  2E2A A;  5B5E O;  3RX6 A;  3RBH A;  2XUE A;  4LF5 T;  2N2N A;  4QH5 A;  2E9X B;  2V7I A;  2RA1 A;  3BS0 A;  4RLC A;  3RKO A;  3ZYK A;  2YKS A;  1P4T A;  2VWA A;  1S35 A;  3RKG A;  4ZEY A;  3UU5 A;  1HTJ F;  2E5L T;  4K0U A;  2J62 A;  2K24 A;  3RRW A;  3RH3 A;  5LHI B;  1XNR T;  4EZH A;  3VR9 A;  1IAP A;  2MAW A;  5LHH B;  2V6Y B;  2KMF A;  5G26 A;  3HI2 A;  2R4O A;  1HX1 B;  4FRX A;  2BS3 A;  2WY2 A;  2LEH A;  1QSD A;  3H37 A;  4X66 T;  4GYS A;  4PFO A;  2WAU A;  5FXZ A;  3ZYL A;  1AJ3 A;  5M4Y A;  4GKK T;  2CE7 A;  2XE5 A;  2XAJ B;  1BXW A;  3NRX A;  4AKR B;  1ORM A;  5DAB A;  1WRD A;  4L5G A;  4KRA A;  1YKE B;  4ZZC A;  3A0H O;  5GON E;  2WWU A;  1WYC A;  1FMV A;  5JDP A;  3PV0 F;  5EK3 A;  3RYC E;  4E7Z A;  1OPF A;  4ZZB A;  2QVA A;  2XE3 A;  2ZFG A;  3PUV F;  3QB5 A;  5LP6 E;  4NUU A;  1WCR A;  4XAX B;  3AE6 A;  3AE4 A;  3NRY A;  4EZ4 A;  3MA9 A;  3TLS A;  4ZXL A;  2KXP A;  3B5M A;  2ZMA A;  1KNR A;  4O4H E;  4O3Y A;  4PJL A;  3MZK B;  5LHG B;  2BBJ A;  5IYZ E;  5J0Z A;  4COF A;  4KBM B;  4UVA B;  3O0E A;  4B61 A;  5ABF B;  5AQK B;  2FGQ X;  4AKR A;  4DV6 T;  2WJR A;  1KNP A;  3AVS A;  5AQL B;  4JI8 T;  5EK2 A;  1SUM B;  2FBW A;  1GFQ A;  4ZOL E;  3UQ4 A;  2FJD A;  2UXX B;  3SY7 A;  1HXT A;  2JMM A;  3KVB A;  1HXX A;  5HCM A;  2CWO A;  1HS7 A;  2LSG A;  2K0L A;  4KHP T;  4LSH A;  1Q9G A;  2D0T A;  1WR6 A;  2WJQ A;  3TLU A;  1IBM T;  3BK9 A;  2BDE A;  2YU2 A;  2KND A;  1XDP A;  2UXB T;  4TX5 A;  4O2B E;  3UT5 E;  4CXY A;  3JAF A;  2DWK A;  4N75 A;  1PRN A;  5BMV E;  4LFB T;  4YXD A;  4AKI A;  3PE0 A;  3POX A;  3EAB A;  4GF4 A;  4ILC A;  4NIQ A;  1YQ4 A;  4AQG A;  2NOX A;  2XQ6 A;  2A2F X;  3SRZ A;  2ZLY A;  2YNK A;  2JPF A;  2N1G A;  5LGU B;  4C00 A;  2W62 A;  3ONX A;  3VY8 X;  4HWH A;  3ZCI A;  2YPV A;  2JJ9 A;  2JMH A;  1OED C;  3T1Y T;  2H3R A;  2CXL A;  2XMX A;  4DMW A;  2H7O A;  4G2A A;  2XJ7 A;  4DV1 T;  3RYF E;  3OJA A;  1MIV A;  2IC9 A;  2XE1 A;  4JI3 T;  2CHN A;  3HR0 A;  3UFE A;  3BQI A;  3GWH A;  2V7K A;  1IBK T;  3AA7 A;  4AYN A;  2CEA A;  4JBW F;  2ZM2 A;  5FL0 A;  1HFA A;  3AA0 B;  3ZMT B;  4AQF C;  3JCF A;  1HXU A;  4OK0 A;  1OED E;  1D0Y A;  4PNI A;  3S4U A;  4AKM A;  1U4Q A;  3IBP A;  4OHF A;  3OKQ A;  4U74 A;  2NR4 A;  1VRB A;  4B3R T;  4CXX A;  2D2S A;  1HNW T;  3K3N A;  4BAY B;  1QUU A;  1KNZ A;  3RPU A;  2M06 A;  2I6H A;  1Q9F A;  1D1B A;  3KBT A;  4H9P C;  3RC3 A;  5E0O A;  5AFU L;  5AFU K;  5AQP B;  4A98 A;  3VE2 A;  1PHO A;  5L4E A;  4N59 A;  5JR9 B;  4JEH B;  4TNV A;  5CA1 E;  3NKZ A;  2DL1 A;  4YJ3 E;  2R4P A;  3QUJ A;  5J2U E;  4DR5 T;  2LRL A;  1J5E T;  2V6Y A;  4KI0 F;  3RIA A;  4YY3 T;  3PGU A;  3AE5 A;  2WDR A;  3SZD A;  1QJP A;  3WU2 O;  4AKH A;  3HOL A;  1GFP A;  7PRN A;  3BQL A;  4HFB A;  4AIS A;  2UUC T;  4GIW A;  3LK3 B;  1D0Z A;  3N9N A;  3AEC A;  2NW9 A;  3OPC A;  2X66 A;  4HWF A;  5L47 A;  2XQY A;  2VAS A;  4DV3 T;  5HWX A;  3CQG B;  2J4G A;  1WYB A;  3PUZ F;  3I0Q A;  3LBX A;  4FI5 A;  2VVN A;  2WCA A;  3NVO A;  4QWN B;  5L4H A;  4DND A;  3ZT7 A;  4O2A E;  4C90 A;  3A2S X;  2LSJ A;  3AA6 B;  2WVP A;  5EZY E;  4LF6 T;  2XSA A;  2LSY A;  3FYX A;  2WB5 A;  4CZZ B;  3NZQ A;  3AA1 A;  3TLW A;  4QHO A;  3PF1 A;  4I55 E;  4QKN A; 
#chains in the Genus database with same CATH homology
 4GCP A;  3FXE B;  5JDM A;  4IDZ A;  2POR A;  4UF0 A;  3A5X A;  3FHN A;  3B13 A;  1KK7 A;  3IHR A;  2D0U A;  2K9A A;  2LE8 A;  4OYK A;  3U3I A;  2F1T A;  3C5O A;  2LT3 A;  2VKD A;  4GK0 E;  4UVC B;  4JUY A;  4B6X A;  2EHO D;  2X27 X;  2LSK A;  3KVA A;  2KIN B;  1SA0 E;  1IJ5 A;  4Z8X A;  4A56 A;  2XAG B;  4PJN A;  4QX7 B;  1BT9 A;  2DCF A;  4LSI A;  3I0O A;  3H3A A;  4H63 H;  5T5F A;  3PUR A;  2KC0 A;  1BH3 A;  4AFK A;  3E08 A;  3K19 A;  2Y8D A;  1Z0P A;  2ZLD A;  1HF8 A;  3AVR A;  1LKX A;  3N5L A;  4IE7 A;  4WNK A;  5JDL A;  1D0X A;  4KR8 A;  3Q2M A;  5L3B B;  5HAX A;  3WAJ A;  3N2K E;  3AAI A;  2Y48 B;  3F57 A;  4WBO A;  4YFS A;  3JTY A;  4AYI D;  4E1T A;  5LA6 E;  3WI4 A;  3HKE E;  3K3O A;  4XZC A;  3DJB A;  2GE4 A;  5JH7 E;  2LOP A;  4LSE A;  3AA1 B;  1UX5 A;  2JMK A;  3HKD E;  3K8P C;  1ZHX A;  4EYU A;  1HG2 A;  2JQQ A;  2PFV A;  2XHE B;  3OYZ A;  4IHJ E;  1B7T A;  3RYH E;  2LHF A;  4BJM A;  4AQF A;  3W15 B;  2DLR A;  4OYJ A;  2KWI B;  2RP4 A;  3V5S A;  3SOL A;  3SWH A;  4G63 A;  5L3C B;  3AA6 A;  3GMI A;  3NSG A;  4O8S A;  4FRT A;  4D65 A;  5GV0 A;  3N9O A;  2XTR A;  4OFZ A;  3SY9 A;  3IEE A;  3TZG A;  4UEM A;  3CKD A;  4ZI7 E;  2KT9 A;  3AAE A;  3HA4 A;  1GFM A;  3T24 A;  5DQW A;  5FMN A;  1OSM A;  5LNK A;  4IGU A;  2DNX A;  2MTQ A;  3R84 B;  1ZHW A;  2N2L A;  3WI5 A;  1HX8 A;  2A3D A;  3AAA B;  4FSP A;  4MFR A;  4PUX A;  4X20 E;  2YEV C;  4GCQ A;  2N2M A;  4EIW A;  1MND A;  2QGS A;  1U5P A;  4IST A;  3T8O A;  4X1I E;  5LGT B;  3U78 A;  1G73 A;  1CUN A;  4FJO A;  3ZJ1 A;  3VHL A;  4BA9 A;  5JR9 C;  5CB4 E;  5HWY A;  5LG4 A;  2PRN A;  3I1A A;  3OBV E;  4FOZ A;  4FZM A;  4O4L E;  5L3D B;  3RX6 A;  3RBH A;  2XUE A;  2L8K A;  3E22 E;  1VOM A;  2N2N A;  2V7I A;  2E9X B;  2RA1 A;  2V1D B;  2LSI A;  5ETW A;  5FYM A;  4RLC A;  3RKO A;  4EB6 E;  3UPG A;  4P0A A;  4AXP A;  2X51 A;  3LJC A;  3ZMS B;  3EUH A;  3ZYK A;  3T20 A;  3D0T A;  1P4T A;  2VWA A;  2NW8 A;  1THQ A;  1S35 A;  2LM9 A;  4AUI A;  4ASK A;  1HTJ F;  4JEU B;  3GN5 A;  4K0U A;  4GOU A;  2Y7S A;  4FZL A;  3FXD B;  2K24 A;  4TUY E;  5HXC A;  3RRW A;  4CQI A;  5JRC B;  2CLY C;  3RH3 A;  5LHI B;  4EZH A;  1IAP A;  2KLQ A;  5LHH B;  3LK2 A;  2BZB A;  2W80 C;  4FMS A;  4O3W A;  2X67 A;  3DA3 A;  2KMF A;  2ZM8 A;  4HGA A;  5LYJ E;  2JRK A;  1YW0 A;  3KV6 A;  4MLK A;  3HI2 A;  3NBX X;  5G26 A;  4XNL A;  1AJ3 A;  3VZU X;  5IYU A;  3ZN0 B;  4CI1 B;  1Y64 B;  4DBR A;  2XG6 A;  2Z6E A;  1MM4 A;  2VKH A;  3J7Y q;  4FZN A;  4HEA A;  2DI4 A;  3MKD A;  2CXD A;  4FRX A;  2GK9 A;  1T98 A;  4F6R C;  2QTK A;  4EXT A;  2LEH A;  1QSD A;  3H37 A;  3QC9 A;  5FXV A;  4GYS A;  1G90 A;  4PFO A;  5KX5 E;  2WAU A;  3QK6 A;  5FXZ A;  4I4T E;  3ZYL A;  4MHC A;  2CE7 A;  3B57 A;  3UTK A;  3UUL A;  5M4Y A;  1UCU A;  2XAJ B;  2XE5 A;  1BXW A;  3N2G E;  2ES0 A;  3NRX A;  4PW8 A;  4AKR B;  2WM9 A;  3UAQ A;  5JDH A;  1ORM A;  4CI3 B;  2BVM A;  5DAB A;  1IJ6 A;  1WRD A;  3O1H A;  3N9L A;  4L5G A;  2MNH A;  4Z3T A;  1HG5 A;  3DP7 A;  1LVK A;  3WI3 A;  3N9M A;  4KRA A;  1YKE B;  2IAK A;  4YJ2 E;  4X1K E;  5GON E;  3CWZ B;  2QA7 A;  2WWU A;  3CQC B;  1WYC A;  1FMV A;  5JDP A;  4UVB B;  5LCY A;  4HE8 A;  5EK3 A;  3PUS A;  1MMD A;  3O1I A;  3RYC E;  4RL9 A;  4E7Z A;  5F8P A;  3ZMZ B;  3KV9 A;  3C4Z A;  2ERV A;  4KP3 C;  3EDU A;  1OPF A;  5LJM A;  5DL8 A;  5JQG E;  3CX7 B;  4JLE A;  4QXB B;  4TV9 E;  4GHB A;  3VE1 A;  2LJL A;  2XE3 A;  4BJN A;  2ZFG A;  3RYI E;  1OWA A;  4UIG A;  1NWM X;  2V26 A;  2W61 A;  4NUU A;  5LP6 E;  3FBZ A;  3DTO A;  3ZC0 A;  4XAX B;  4WW0 A;  3NRY A;  4EAH A;  2W63 A;  4O49 A;  3IF8 B;  4EZ4 A;  4DBQ A;  4ZI2 C;  3MA9 A;  1EZ3 A;  1FMW A;  2KXP A;  4FUV A;  4JFB A;  3PUA A;  2ZMA A;  1BR2 A;  2CM0 A;  3OYX A;  5H6R B;  4O4H E;  4YLH A;  2J1D G;  4ILU A;  4O3Y A;  4PJL A;  4JCH A;  2CMR A;  3QRA A;  5J2T E;  3MZK B;  5LHG B;  6PRN A;  3EDV A;  3LK4 2;  2KZ7 A;  3LK2 B;  2CWY A;  5IYZ E;  3VU7 H;  2WMO A;  4KBM B;  2J1N A;  2V7M A;  3KIN B;  3PQS A;  2NP9 A;  3GN5 B;  4UVA B;  4ZI3 D;  4N78 D;  3O0E A;  2VKJ A;  4B61 A;  3F31 A;  4QX8 B;  2FGQ X;  2N9D A;  4AKR A;  1FIO A;  4MAL A;  4HFV A;  3AVS A;  3JC6 C;  3LFM A;  3FBL A;  4IE4 A;  4AYE C;  1QJ8 A;  1G8X A;  5EK2 A;  3MAC A;  5FVN A;  4I50 E;  2CCQ A;  4ZS2 A;  3DA4 A;  3SZV A;  1GFQ A;  4ZOL E;  3C4X A;  5HXH A;  4AI6 A;  2PJQ A;  2G0U A;  3HKB E;  2C5K T;  2UXX B;  5FP3 A;  5FY0 A;  4GCS A;  3SY7 A;  1H7C A;  5EK4 A;  5HYA A;  1HXT A;  2JMM A;  4X1Y E;  3KVB A;  2P9B A;  2H7V C;  3VZT X;  1HXX A;  2HH7 A;  3N9Q A;  2CWO A;  1HS7 A;  3CVR A;  3CX6 B;  3VKH A;  2LSG A;  1S94 A;  5HXE A;  2HPJ A;  4QKN A;  1US7 B;  5FY7 A;  5KDM C;  2K0L A;  3V8U A;  2OA5 A;  3PU3 A;  3AAE B;  4H9N C;  1GFN A;  2Y0L A;  5EE2 A;  5FNV E;  2XAF B;  3MK7 C;  1BR0 A;  4LSH A;  1Q9G A;  4RJX A;  4PJM A;  3K3Q C;  2D0T A;  4IE6 A;  2LHR A;  2X9Y A;  4P0B A;  4FT6 A;  4IIJ E;  1ZHY A;  4UXN B;  1WR6 A;  4KUM B;  2W00 A;  4U9C A;  3ANW A;  2CLY B;  5JDF A;  3BK9 A;  2BDE A;  2X0L B;  2WBL A;  2YU2 A;  1ZHT A;  4AYD C;  4F4B A;  2X9W A;  2KND A;  3C51 A;  1LVF A;  4TV8 E;  4UEL A;  3CQX C;  5LOV E;  3RRC A;  3ZMV B;  4HTE A;  4TX5 A;  3GP6 A;  3P7I A;  4O2B E;  3UT5 E;  3ZEF B;  4CXY A;  2VK9 A;  5DQV A;  1V9D A;  3SS1 A;  4H9O C;  1E54 A;  4ZI2 D;  3C98 B;  2DWK A;  5CA0 E;  2XAH B;  3F2E A;  4PK5 A;  4ISS A;  5DJQ C;  5FXX A;  2IC6 A;  1PRN A;  5H6Q B;  4L0R A;  5IHY A;  5BMV E;  3BQK A;  3LK4 1;  2PG8 A;  2WSS V;  2Y6X A;  4AKI A;  3PE0 A;  2M07 A;  2MHL A;  4H9R C;  3ZMU B;  1MMA A;  4DVD A;  2EHO A;  2NTY A;  3C50 A;  3POX A;  4GF4 A;  3ANW B;  3O4X E;  4C69 X;  1YD8 G;  3GA8 A;  4AQG A;  1X79 A;  2F1V A;  2NOX A;  2UXN B;  4G76 A;  2A2F X;  3HKC E;  3SRZ A;  2X68 A;  3PUQ A;  2X9H A;  4AKL A;  2ODJ A;  5ADX L;  5ADX K;  3MXZ A;  2IW5 B;  2ZLY A;  1O3X A;  4QXC B;  4AYM C;  2XAS B;  2YNK A;  4O3X B;  2JPF A;  3UUN A;  3E0Z A;  4FES A;  2BVL A;  5JDG A;  1ZEE A;  2N1G A;  1BR4 A;  5LGU B;  3TKL B;  2W62 A;  4GYR A;  2YU1 A;  4PAG A;  3I9Y A;  2V7L A;  3UUM A;  4O4X A;  4ZI3 C;  2L3L A;  3KV5 A;  4KR4 A;  3VKG A;  3ONX A;  3VY8 X;  4IE5 A;  2NW7 A;  4PK4 A;  4V1A v;  3ZCI A;  2YPV A;  4QQ1 A;  2JJ9 A;  4DMV A;  2D5U A;  5LXT E;  2JMH A;  3PDY A;  5L2L A;  2H3R A;  3JC6 D;  3V5U A;  5A1L A;  2CXL A;  5LBQ B;  2XMX A;  4EYY R;  3Q9D A;  2KWH A;  3P8C D;  4DMW A;  2H7O A;  4G2A A;  1ZHZ A;  3RC8 A;  3C4W A;  4ANJ A;  3KFW X;  2NWB A;  1D1A A;  3L3P A;  1MIW A;  1MMG A;  3KVD D;  5D5D A;  2E9X D;  4YHJ A;  5TAO A;  2DHR A;  2LHN A;  2M67 A;  5L3E B;  3C64 A;  3RYF E;  4EOZ B;  2C0S A;  5F3J A;  3OJA A;  4HKA A;  1MIV A;  2IC9 A;  2EHO B;  3KBU A;  2XE1 A;  2A72 A;  2CA5 A;  2VL8 A;  3HR0 A;  1IZN B;  1YKH B;  4KMC A;  5C8Y E;  2KZ7 B;  3UFE A;  2YK0 A;  3BQI A;  3Q5W A;  3EVY A;  3GWH A;  5DL6 A;  2V7K A;  3LBX B;  5HXR A;  2HPL A;  3AA7 A;  5PRN A;  4PFP A;  4UF0 B;  3SYS A;  4E1S A;  2C5J A;  2K5B B;  2KDY A;  4HN9 A;  4NUV A;  4AYN A;  2CEA A;  3ETV A;  5HXS A;  4IE0 A;  4I43 B;  1NAF A;  1GFO A;  5JRE A;  2O4V A;  5LGN B;  2XTQ A;  2ZM2 A;  1HFA A;  1UX4 A;  3AA0 B;  4O4U A;  3ZMT B;  4AQF C;  2ODV A;  2B1E A;  1HXU A;  4ADZ A;  3NZP A;  4OK0 A;  5FXW A;  4UV9 B;  4C91 A;  1D0Y A;  4PNI A;  1WLX A;  2Q9Q D;  2XE2 A;  1FEW A;  3S4U A;  3LK3 A;  4AKM A;  1U4Q A;  4ZS3 A;  4N58 A;  3IBP A;  4OHF A;  3O9X A;  4LSF A;  3QRC A;  3OKQ A;  4PJJ A;  4U74 A;  3CML A;  3ETU A;  1VRB A;  4CXX A;  4O3Z A;  2MYS A;  5KMG P;  2D2S A;  3K3N A;  4BAY B;  3J9X 1;  1QUU A;  2K4T A;  1KNZ A;  3LG7 A;  3RPU A;  2M06 A;  2ACX A;  5FY1 A;  2PBI A;  3VY9 X;  1MM5 A;  4D5U A;  2Q9Q B;  1BR1 A;  1Q9F A;  3ZCJ A;  1D1B A;  3KBT A;  4H9P C;  3HW9 A;  2SPC A;  5E0O A;  2MBG A;  2XAQ B;  3RC3 A;  5AFU L;  1OXZ A;  3MJX A;  4FSO A;  5AFU K;  4XNK A;  4G75 A;  4UV8 B;  2C5I T;  3VE2 A;  1PHO A;  4N59 A;  3UU2 A;  3POU A;  4BUM X;  3ZC1 A;  2EHO C;  4MBQ A;  4AZL A;  3POQ A;  4CI2 B;  3POR A;  3ZN1 B;  5JR9 B;  4JEH B;  2XTL A;  4H9Q C;  5JDQ A;  5CA1 E;  5J1G A;  1HCI A;  3N2O A;  2FGR A;  4YJ3 E;  2W0G A;  4P09 A;  3FB2 A;  3G7G A;  3QUJ A;  1YS5 A;  5J2U E;  3EMN X;  4O4I E;  3M65 A;  2CXF A;  2VKO A;  4DO0 A;  4TZ4 C;  3PQU A;  3AB3 B;  3VZW X;  4J2C A;  5JRC A;  3SZD A;  4E7S A;  5LJN A;  1QJP A;  4QXH B;  4AKH A;  5L3F B;  3HOL A;  4M1P A;  1GFP A;  1QJ9 A;  3SYB A;  7PRN A;  2E8I A;  3BQL A;  1E1H B;  2L9Q A;  2J4U P;  2ZM0 A;  3KDS E;  3ZJ2 A;  1SHZ C;  3ZPO A;  3KV4 A;  2E9X A;  4AKG A;  4RLB A;  4GIW A;  3HOE A;  3CX8 B;  3LK3 B;  1D0Z A;  3N9N A;  2KXP B;  2WMN A;  1ZHC A;  4H63 V;  2E9X C;  2W81 C;  4TN7 B;  2NW9 A;  2Y2X A;  2VB6 A;  5JR9 A;  1MPF A;  4WBN E;  5JVD E;  3PUG A;  2X66 A;  3PTR B;  8PRN A;  1MIY A;  5L3G B;  3AA0 A;  3UUX B;  1MNE A;  2MOZ A;  4U72 A;  4D64 A;  2XQY A;  2VAS A;  5LBM A;  2I59 A;  3CPZ A;  1ZV4 X;  5DL5 A;  2V7J A;  2DWG A;  5HWX A;  3CQG B;  3ZYM A;  2Q9Q A;  2LFU A;  3AAA A;  2LOS A;  1WYB A;  3AA7 B;  4PK6 A;  2OMF A;  3I0Q A;  2YIN A;  3LBX A;  4FI5 A;  3Q5X A;  2Y0K A;  1IZN A;  3HWB A;  2NTX A;  1MMN A;  3N9P A;  2ODU A;  1ZKE A;  2K48 A;  5JDN A;  4ERR A;  4QWN B;  3R6N A;  3PU8 A;  4DND A;  4XBF B;  4CXW A;  3T0S A;  4O2A E;  4C90 A;  1LRZ A;  3A2S X;  2LSJ A;  2Q9Q C;  3AA6 B;  4H9S E;  5EZY E;  4L9I A;  3I9W A;  2LSY A;  3FYX A;  3ESL A;  3HL6 A;  3L09 A;  4CZZ B;  3NZQ A;  4GK5 E;  1D1C A;  3WAK A;  1H6S 1;  2Y0H A;  3AA1 A;  5DL7 A;  4QHO A;  3PRN A;  3O1J A;  2X9X A;  4I55 E;  4O4J E;  4ZHQ E;  3ZLI A;  4RJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...