2ZFGA

Structure of ompf porin
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
340
structure length
339
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the OmpF porin: function in a colicin translocon.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Outer membrane protein F
total genus 106
structure length 339
sequence length 340
ec nomenclature
pdb deposition date 2008-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2zfgA00
4KR4A 3VZWX 2XE3A 1BT9A 3SY7A 1GFPA 3POXA 3SZVA 3K19A 2ODJA 2Y0HA 2PORA 4RJXA 2J1NA 1GFNA 3T24A 5PRNA 1HXXA 3POUA 2FGQX 2K4TA 7PRNA 3PRNA 4GCSA 2Y0KA 4RJWA 2Y2XA 3UU2A 4FSOA 5DL7A 4LSIA 1BH3A 5FVNA 4FRTA 3POQA 3T20A 1GFQA 3VZUX 1HXUA 1PRNA 1PHOA 5DL6A 5JDPA 3SYSA 4D65A 2QTKA 5DL8A 3PORA 3WI4A 2XE2A 3FYXA 4FMSA 4C69X 4LSHA 5DL5A 4KRAA 4KR8A 2FGRA 4FSPA 4FOZA 3VY8X 2ZLDA 3VZTX 3WI5A 1HXTA 3HW9A 2XG6A 1GFOA 3EMNX 1E54A 1GFMA 1OPFA 4JFBA 3O0EA 4D64A 2O4VA 4D5UA 3UPGA 4LSEA 2PRNA 4FT6A 6PRNA 2Y0LA 2ZFGA 3JTYA 4BUMX 2OMFA 3T0SA 3SY9A 3NSGA 4GCPA 2XE1A 3SYBA 1MPFA 4LSFA 4AUIA 8PRNA 4GCQA 3A2SX 3VY9X 2XE5A 3SZDA 4FRXA 2J4UP 3HWBA 1H6S1 1OSMA
chains in the Genus database with same CATH superfamily
4K3CA 4KR4A 4XNLA 3AAEB 1ZHWA 2WJQA 2KXPA 3VZWX 3WU2O 2XTQA 2MHLA 1ZHXA 4AYNA 2XE3A 4RLBA 1BT9A 4N59A 2YPVA 4UB8O 3LK2A 3SY7A 3PGRA 3QRCA 5D5DA 3VE1A 2N2MA 1GFPA 2XMXA 3POXA 5H2FO 3G7GA 3SZVA 3K19A 4FESA 2ODJA 3LK3A 2Y0HA 4AYMC 5B66O 2PORA 3LK41 4RJXA 3PQUA 1QJPA 2J1NA 1GFNA 3T24A 1IZNA 5PRNA 4AFKA 4JCHA 5TISO 5G3AA 1HXXA 2X27X 3KVDD 3POUA 2FGQX 3BRZA 3DWNA 5GV0A 2K4TA 2R4NA 3AA6B 3JCUO 2LHFA 4FQEA 4O4XA 4RL9A 3PRNA 2W80C 3AA0A 3HOLA 2KXPB 4GCSA 4G75A 5ADXL 2Y0KA 3AAAA 4K3BA 3AAEA 3AA0B 4RJWA 2Y2XA 3UU2A 5T5FA 3UAQA 4B61A 4Z3TA 4F4BA 4FSOA 5DL7A 4N58A 5GTHO 4LSIA 1BH3A 4U9CA 2YNKA 4E1SA 4C4VB 2M06A 4G76A 5FVNA 3A0HO 1T1LA 3AA7B 2AXTO 4FRTA 2K0LA 3POQA 2X9KA 1GFQA 2IWVA 3VZUX 3T20A 2R4LA 1HXUA 2WJRA 3AA1B 4UB6O 1PRNA 1PHOA 3LK3B 5DL6A 5ADXK 2W81C 5JDPA 1QJ9A 3SYSA 5EE2A 4D65A 5KAIO 2QTKA 5DL8A 2KZ7B 4PUXA 1MM4A 4GF4A 3PORA 5E79O 3WI4A 4AYDC 1ORMA 1ZHTA 3PGUA 2F1CX 1ZHZA 2WVPA 3PQSA 3DA4A 2XE2A 3FYXA 4FMSA 2JMMA 4IL6O 4C69X 4LSHA 7PRNA 2MNHA 5DL5A 4O3ZA 3QRAA 2M07A 4KRAA 4KR8A 4O3WA 5AFUK 2FGRA 2IWWA 5G26A 4FSPA 1P4TA 4CTDA 4FOZA 4N74A 2ERVA 3A0BO 1BXWA 2R4OA 2ZLDA 4FZNA 3VY8X 2F1VA 2Y7SA 3AA1A 4O3XB 1HXTA 3VZTX 3WI5A 3HW9A 1QJ8A 2XG6A 1Q9FA 4O4UA 1MM5A 2R88A 2KDYA 3PGSA 1GFOA 4PJ0O 4AKRA 4AKMA 3EMNX 1E54A 5G39A 1THQA 1GFMA 1G90A 1OPFA 1T16A 4JFBA 4O3YA 3VE2A 4AKRB 5AFUL 2R8AA 3O0EA 4PR7A 4D64A 3HOEA 3DA3A 3GP6A 2O4VA 2XTRA 4D5UA 4E1TA 2GE4A 2F1TA 4C00A 3NJTA 3AA6A 3UPGA 1ZHYA 4LSEA 2R89A 4GHBA 2PRNA 4FT6A 2N2LA 5G38A 6PRNA 4C4VA 3TZGA 4FUVA 3AAAB 2Y0LA 3V8UA 5GTIO 2ZFGA 4FZMA 3DZMA 3KZIO 3LK2B 2LFUA 3JTYA 2R4PA 3LK42 3BRYA 4XNKA 4AYEC 2OMFA 3T0SA 3C5OA 4AYID 4BUMX 5B5EO 3SY9A 3NSGA 3RBHA 2JQYA 3PF1A 4GCPA 2XE1A 3SYBA 1MPFA 1S5LO 4LSFA 3AA7A 4AUIA 2KZ7A 4N75A 8PRNA 1YS5A 4GCQA 3A2SX 3BS0A 1IZNB 4RLCA 3VY9X 4O49A 2KC0A 2XE5A 3DWOX 4AZLA 5IYUA 3SZDA 1Q9GA 4FRXA 4FZLA 5KAFO 4QQ1A 2J4UP 3HWBA 1H6S1 1OSMA
chains in the Genus database with same CATH topology
4KR4A 4XNLA 3AAEB 1ZHWA 2KXPA 3VZWX 2XTQA 2MHLA 1ZHXA 4AYNA 2XE3A 4RLBA 1BT9A 4N59A 2YPVA 3SY7A 3LK2A 3QRCA 5D5DA 3VE1A 2N2MA 1GFPA 2XMXA 3POXA 3G7GA 3SZVA 3K19A 4FESA 2ODJA 3LK3A 2Y0HA 4AYMC 2PORA 3LK41 4RJXA 3PQUA 1QJPA 2J1NA 1GFNA 3T24A 1IZNA 5PRNA 4AFKA 4JCHA 1HXXA 2X27X 3KVDD 3POUA 2FGQX 5GV0A 2K4TA 3AA6B 4O4XA 7PRNA 2LHFA 4RL9A 3PRNA 2W80C 3AA0A 3HOLA 2KXPB 4GCSA 4G75A 5ADXL 2Y0KA 3AAAA 3AAEA 3AA0B 4RJWA 2Y2XA 3UU2A 5T5FA 3UAQA 4B61A 4Z3TA 4F4BA 4FSOA 5DL7A 4N58A 4LSIA 1BH3A 4U9CA 2YNKA 4E1SA 2M06A 4G76A 5FVNA 3AA7B 4FRTA 2K0LA 3POQA 3T20A 1GFQA 3VZUX 3AA1B 1HXUA 1PRNA 1PHOA 3LK3B 5DL6A 5ADXK 2W81C 5JDPA 1QJ9A 3SYSA 5EE2A 4D65A 2QTKA 5DL8A 2KZ7B 4PUXA 1MM4A 4GF4A 3PORA 3WI4A 4AYDC 1ORMA 1ZHTA 1ZHZA 3PQSA 3DA4A 2XE2A 3FYXA 4FMSA 2JMMA 4C69X 4LSHA 2MNHA 5DL5A 4O3ZA 3QRAA 2M07A 4KRAA 4KR8A 4O3WA 5AFUK 2FGRA 5G26A 4FSPA 1P4TA 4FOZA 2ERVA 1BXWA 4FZNA 2ZLDA 3VY8X 2F1VA 2Y7SA 3AA1A 4O3XB 1HXTA 3VZTX 3WI5A 3HW9A 1QJ8A 2XG6A 1Q9FA 4O4UA 1MM5A 4AKMA 2KDYA 4AKRA 1GFOA 3EMNX 1E54A 1THQA 1GFMA 1G90A 1OPFA 4JFBA 4O3YA 4AKRB 3VE2A 5AFUL 3O0EA 4D64A 3HOEA 3DA3A 3GP6A 2XTRA 2O4VA 4D5UA 4E1TA 2GE4A 2F1TA 3AA6A 3UPGA 1ZHYA 4LSEA 4GHBA 2PRNA 4FT6A 2N2LA 6PRNA 3TZGA 4FUVA 3AAAB 2Y0LA 3V8UA 2ZFGA 4FZMA 3LK2B 2LFUA 3JTYA 3LK42 4XNKA 4BUMX 4AYEC 2OMFA 3T0SA 3C5OA 4AYID 3SY9A 3NSGA 3RBHA 4GCPA 2XE1A 3SYBA 1MPFA 4LSFA 4AUIA 3AA7A 2KZ7A 8PRNA 1YS5A 4GCQA 3A2SX 1IZNB 4RLCA 3VY9X 4O49A 2KC0A 2XE5A 4AZLA 5IYUA 3SZDA 1Q9GA 4FRXA 4FZLA 4QQ1A 2J4UP 3HWBA 1H6S1 1OSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KR4 A;  3VZW X;  2XE3 A;  1BT9 A;  3SY7 A;  1GFP A;  3POX A;  3SZV A;  3K19 A;  2ODJ A;  2Y0H A;  2POR A;  4RJX A;  2J1N A;  1GFN A;  3T24 A;  5PRN A;  1HXX A;  3POU A;  2FGQ X;  2K4T A;  7PRN A;  3PRN A;  4GCS A;  2Y0K A;  4RJW A;  2Y2X A;  3UU2 A;  4FSO A;  5DL7 A;  4LSI A;  1BH3 A;  5FVN A;  4FRT A;  3POQ A;  3T20 A;  1GFQ A;  3VZU X;  1HXU A;  1PRN A;  1PHO A;  5DL6 A;  5JDP A;  3SYS A;  4D65 A;  2QTK A;  5DL8 A;  3POR A;  3WI4 A;  2XE2 A;  3FYX A;  4FMS A;  4C69 X;  4LSH A;  5DL5 A;  4KRA A;  4KR8 A;  2FGR A;  4FSP A;  4FOZ A;  3VY8 X;  2ZLD A;  3VZT X;  3WI5 A;  1HXT A;  3HW9 A;  2XG6 A;  1GFO A;  3EMN X;  1E54 A;  1GFM A;  1OPF A;  4JFB A;  3O0E A;  4D64 A;  2O4V A;  4D5U A;  3UPG A;  4LSE A;  2PRN A;  4FT6 A;  6PRN A;  2Y0L A;  2ZFG A;  3JTY A;  4BUM X;  2OMF A;  3T0S A;  3SY9 A;  3NSG A;  4GCP A;  2XE1 A;  3SYB A;  1MPF A;  4LSF A;  4AUI A;  8PRN A;  4GCQ A;  3A2S X;  3VY9 X;  2XE5 A;  3SZD A;  4FRX A;  2J4U P;  3HWB A;  1H6S 1;  1OSM A; 
#chains in the Genus database with same CATH topology
 4K3C A;  4KR4 A;  4XNL A;  3AAE B;  1ZHW A;  2WJQ A;  2KXP A;  3VZW X;  3WU2 O;  2XTQ A;  2MHL A;  1ZHX A;  4AYN A;  2XE3 A;  4RLB A;  1BT9 A;  4N59 A;  2YPV A;  4UB8 O;  3LK2 A;  3SY7 A;  3PGR A;  3QRC A;  5D5D A;  3VE1 A;  2N2M A;  1GFP A;  2XMX A;  3POX A;  5H2F O;  3G7G A;  3SZV A;  3K19 A;  4FES A;  2ODJ A;  3LK3 A;  2Y0H A;  4AYM C;  5B66 O;  2POR A;  3LK4 1;  4RJX A;  3PQU A;  1QJP A;  2J1N A;  1GFN A;  3T24 A;  1IZN A;  5PRN A;  4AFK A;  4JCH A;  5TIS O;  5G3A A;  1HXX A;  2X27 X;  3KVD D;  3POU A;  2FGQ X;  3BRZ A;  3DWN A;  5GV0 A;  2K4T A;  2R4N A;  3AA6 B;  3JCU O;  2LHF A;  4FQE A;  4O4X A;  4RL9 A;  3PRN A;  2W80 C;  3AA0 A;  3HOL A;  2KXP B;  4GCS A;  4G75 A;  5ADX L;  2Y0K A;  3AAA A;  4K3B A;  3AAE A;  3AA0 B;  4RJW A;  2Y2X A;  3UU2 A;  5T5F A;  3UAQ A;  4B61 A;  4Z3T A;  4F4B A;  4FSO A;  5DL7 A;  4N58 A;  5GTH O;  4LSI A;  1BH3 A;  4U9C A;  2YNK A;  4E1S A;  4C4V B;  2M06 A;  4G76 A;  5FVN A;  3A0H O;  1T1L A;  3AA7 B;  2AXT O;  4FRT A;  2K0L A;  3POQ A;  2X9K A;  1GFQ A;  2IWV A;  3VZU X;  3T20 A;  2R4L A;  1HXU A;  2WJR A;  3AA1 B;  4UB6 O;  1PRN A;  1PHO A;  3LK3 B;  5DL6 A;  5ADX K;  2W81 C;  5JDP A;  1QJ9 A;  3SYS A;  5EE2 A;  4D65 A;  5KAI O;  2QTK A;  5DL8 A;  2KZ7 B;  4PUX A;  1MM4 A;  4GF4 A;  3POR A;  5E79 O;  3WI4 A;  4AYD C;  1ORM A;  1ZHT A;  3PGU A;  2F1C X;  1ZHZ A;  2WVP A;  3PQS A;  3DA4 A;  2XE2 A;  3FYX A;  4FMS A;  2JMM A;  4IL6 O;  4C69 X;  4LSH A;  7PRN A;  2MNH A;  5DL5 A;  4O3Z A;  3QRA A;  2M07 A;  4KRA A;  4KR8 A;  4O3W A;  5AFU K;  2FGR A;  2IWW A;  5G26 A;  4FSP A;  1P4T A;  4CTD A;  4FOZ A;  4N74 A;  2ERV A;  3A0B O;  1BXW A;  2R4O A;  2ZLD A;  4FZN A;  3VY8 X;  2F1V A;  2Y7S A;  3AA1 A;  4O3X B;  1HXT A;  3VZT X;  3WI5 A;  3HW9 A;  1QJ8 A;  2XG6 A;  1Q9F A;  4O4U A;  1MM5 A;  2R88 A;  2KDY A;  3PGS A;  1GFO A;  4PJ0 O;  4AKR A;  4AKM A;  3EMN X;  1E54 A;  5G39 A;  1THQ A;  1GFM A;  1G90 A;  1OPF A;  1T16 A;  4JFB A;  4O3Y A;  3VE2 A;  4AKR B;  5AFU L;  2R8A A;  3O0E A;  4PR7 A;  4D64 A;  3HOE A;  3DA3 A;  3GP6 A;  2O4V A;  2XTR A;  4D5U A;  4E1T A;  2GE4 A;  2F1T A;  4C00 A;  3NJT A;  3AA6 A;  3UPG A;  1ZHY A;  4LSE A;  2R89 A;  4GHB A;  2PRN A;  4FT6 A;  2N2L A;  5G38 A;  6PRN A;  4C4V A;  3TZG A;  4FUV A;  3AAA B;  2Y0L A;  3V8U A;  5GTI O;  2ZFG A;  4FZM A;  3DZM A;  3KZI O;  3LK2 B;  2LFU A;  3JTY A;  2R4P A;  3LK4 2;  3BRY A;  4XNK A;  4AYE C;  2OMF A;  3T0S A;  3C5O A;  4AYI D;  4BUM X;  5B5E O;  3SY9 A;  3NSG A;  3RBH A;  2JQY A;  3PF1 A;  4GCP A;  2XE1 A;  3SYB A;  1MPF A;  1S5L O;  4LSF A;  3AA7 A;  4AUI A;  2KZ7 A;  4N75 A;  8PRN A;  1YS5 A;  4GCQ A;  3A2S X;  3BS0 A;  1IZN B;  4RLC A;  3VY9 X;  4O49 A;  2KC0 A;  2XE5 A;  3DWO X;  4AZL A;  5IYU A;  3SZD A;  1Q9G A;  4FRX A;  4FZL A;  5KAF O;  4QQ1 A;  2J4U P;  3HWB A;  1H6S 1;  1OSM A; 
#chains in the Genus database with same CATH homology
 4KR4 A;  4XNL A;  3AAE B;  1ZHW A;  2KXP A;  3VZW X;  2XTQ A;  2MHL A;  1ZHX A;  4AYN A;  2XE3 A;  4RLB A;  1BT9 A;  4N59 A;  2YPV A;  3SY7 A;  3LK2 A;  3QRC A;  5D5D A;  3VE1 A;  2N2M A;  1GFP A;  2XMX A;  3POX A;  3G7G A;  3SZV A;  3K19 A;  4FES A;  2ODJ A;  3LK3 A;  2Y0H A;  4AYM C;  2POR A;  3LK4 1;  4RJX A;  3PQU A;  1QJP A;  2J1N A;  1GFN A;  3T24 A;  1IZN A;  5PRN A;  4AFK A;  4JCH A;  1HXX A;  2X27 X;  3KVD D;  3POU A;  2FGQ X;  5GV0 A;  2K4T A;  3AA6 B;  4O4X A;  7PRN A;  2LHF A;  4RL9 A;  3PRN A;  2W80 C;  3AA0 A;  3HOL A;  2KXP B;  4GCS A;  4G75 A;  5ADX L;  2Y0K A;  3AAA A;  3AAE A;  3AA0 B;  4RJW A;  2Y2X A;  3UU2 A;  5T5F A;  3UAQ A;  4B61 A;  4Z3T A;  4F4B A;  4FSO A;  5DL7 A;  4N58 A;  4LSI A;  1BH3 A;  4U9C A;  2YNK A;  4E1S A;  2M06 A;  4G76 A;  5FVN A;  3AA7 B;  4FRT A;  2K0L A;  3POQ A;  3T20 A;  1GFQ A;  3VZU X;  3AA1 B;  1HXU A;  1PRN A;  1PHO A;  3LK3 B;  5DL6 A;  5ADX K;  2W81 C;  5JDP A;  1QJ9 A;  3SYS A;  5EE2 A;  4D65 A;  2QTK A;  5DL8 A;  2KZ7 B;  4PUX A;  1MM4 A;  4GF4 A;  3POR A;  3WI4 A;  4AYD C;  1ORM A;  1ZHT A;  1ZHZ A;  3PQS A;  3DA4 A;  2XE2 A;  3FYX A;  4FMS A;  2JMM A;  4C69 X;  4LSH A;  2MNH A;  5DL5 A;  4O3Z A;  3QRA A;  2M07 A;  4KRA A;  4KR8 A;  4O3W A;  5AFU K;  2FGR A;  5G26 A;  4FSP A;  1P4T A;  4FOZ A;  2ERV A;  1BXW A;  4FZN A;  2ZLD A;  3VY8 X;  2F1V A;  2Y7S A;  3AA1 A;  4O3X B;  1HXT A;  3VZT X;  3WI5 A;  3HW9 A;  1QJ8 A;  2XG6 A;  1Q9F A;  4O4U A;  1MM5 A;  4AKM A;  2KDY A;  4AKR A;  1GFO A;  3EMN X;  1E54 A;  1THQ A;  1GFM A;  1G90 A;  1OPF A;  4JFB A;  4O3Y A;  4AKR B;  3VE2 A;  5AFU L;  3O0E A;  4D64 A;  3HOE A;  3DA3 A;  3GP6 A;  2XTR A;  2O4V A;  4D5U A;  4E1T A;  2GE4 A;  2F1T A;  3AA6 A;  3UPG A;  1ZHY A;  4LSE A;  4GHB A;  2PRN A;  4FT6 A;  2N2L A;  6PRN A;  3TZG A;  4FUV A;  3AAA B;  2Y0L A;  3V8U A;  2ZFG A;  4FZM A;  3LK2 B;  2LFU A;  3JTY A;  3LK4 2;  4XNK A;  4BUM X;  4AYE C;  2OMF A;  3T0S A;  3C5O A;  4AYI D;  3SY9 A;  3NSG A;  3RBH A;  4GCP A;  2XE1 A;  3SYB A;  1MPF A;  4LSF A;  4AUI A;  3AA7 A;  2KZ7 A;  8PRN A;  1YS5 A;  4GCQ A;  3A2S X;  1IZN B;  4RLC A;  3VY9 X;  4O49 A;  2KC0 A;  2XE5 A;  4AZL A;  5IYU A;  3SZD A;  1Q9G A;  4FRX A;  4FZL A;  4QQ1 A;  2J4U P;  3HWB A;  1H6S 1;  1OSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...