2ZFGA

Structure of ompf porin
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
340
structure length
339
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein F
publication title Crystal structures of the OmpF porin: function in a colicin translocon.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 106
structure length 339
sequence length 340
ec nomenclature
pdb deposition date 2008-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2zfgA00
4GCPA 1HXXA 4FRTA 1H6S1 3PRNA 3SZVA 3VY9X 2ZFGA 3FYXA 5DL5A 1GFMA 3POXA 2OMFA 1HXUA 2J1NA 3T24A 6PRNA 3VY8X 4KRAA 4KR8A 3SYBA 2Y0LA 2Y2XA 2Y0HA 3VZWX 2XE2A 4FMSA 3WI4A 1GFNA 3VZUX 7PRNA 4FOZA 5DL7A 3SY9A 3HWBA 4RJWA 2QTKA 3VZTX 3POQA 2ODJA 4FT6A 8PRNA 4LSFA 2XE5A 4AUIA 4KR4A 1OSMA 4LSHA 2XG6A 3NSGA 3O0EA 4FSPA 3SYSA 1E54A 3K19A 3WI5A 2XE3A 2K4TA 1GFOA 3PORA 4BUMX 5FVNA 3A2SX 2ZLDA 4JFBA 5JDPA 1PRNA 3JTYA 3HW9A 3UU2A 1OPFA 5DL6A 1GFQA 1BH3A 2FGRA 4C69X 4D5UA 4FSOA 1GFPA 3T20A 2PORA 2XE1A 2Y0KA 3SZDA 2J4UP 4LSEA 3EMNX 1BT9A 3SY7A 4FRXA 3UPGA 1MPFA 2FGQX 4D64A 4GCSA 1HXTA 3T0SA 5PRNA 4LSIA 4RJXA 2PRNA 5DL8A 2O4VA 4D65A 4GCQA 1PHOA 3POUA
chains in the Genus database with same CATH superfamily
4O3XB 3BS0A 4GCPA 5AFUK 1HXXA 4FRTA 1H6S1 3DA3A 3AA6B 3PRNA 5B66O 4FZLA 3SZVA 3PQUA 4AFKA 3LK3A 1THQA 3PGRA 3VY9X 1ORMA 2ZFGA 3FYXA 1IZNB 4K3BA 4XNLA 3KVDD 4FQEA 3LK2B 3RBHA 1ZHZA 4FZNA 4N75A 3V8UA 4AYID 4C4VB 3PQSA 3AA1A 3AA0B 2YNKA 1GFMA 3PF1A 4XNKA 1ZHTA 5DL5A 1ZHYA 5EE2A 1QJ8A 4AYMC 3POXA 5IYUA 4PJ0O 2OMFA 4AYDC 5GV0A 2IWVA 1HXUA 2J1NA 2W81C 3T24A 5AFUL 3QRCA 3VY8X 4AYEC 2R4LA 2X9KA 4IL6O 4KRAA 4O3ZA 6PRNA 4KR8A 3SYBA 4QQ1A 2Y0LA 5H2FO 2M07A 2KXPA 2Y0HA 2R4NA 2Y2XA 3BRZA 3QRAA 4O3YA 3VZWX 2XE2A 4FMSA 3WI4A 3TZGA 4E1SA 1GFNA 5ADXK 3DWOX 3DWNA 3KZIO 2F1VA 4GF4A 4C00A 3LK2A 4PR7A 1MM4A 3DA4A 4FESA 5D5DA 3VZUX 7PRNA 4FOZA 3VE1A 4E1TA 5DL7A 2N2LA 3AAEA 2AXTO 3SY9A 2ERVA 1G90A 1QJPA 2JMMA 2K0LA 3HWBA 4RJWA 2QTKA 3LK41 3VZTX 3POQA 5B5EO 2N2MA 2ODJA 2GE4A 4FT6A 3AAAB 8PRNA 4LSFA 2XE5A 4AUIA 4KR4A 1OSMA 4LSHA 2XG6A 5ADXL 5G39A 2R4PA 2W80C 2LFUA 3NSGA 3O0EA 3PGSA 4FSPA 4PUXA 4U9CA 4AKMA 2IWWA 3AA6A 3A0BO 3SYSA 1E54A 2JQYA 4CTDA 2R88A 2F1TA 2MHLA 3K19A 3WI5A 2XE3A 4Z3TA 1IZNA 4JCHA 4O4UA 4B61A 2X27X 2XMXA 4RLBA 4C4VA 5G38A 3HOEA 2K4TA 5GTIO 1GFOA 3AA0A 2WJQA 2LHFA 3LK42 3A2SX 1YS5A 3PORA 5FVNA 4BUMX 2ZLDA 3BRYA 4AKRB 5GTHO 4G76A 4GHBA 4JFBA 4AZLA 2Y7SA 5JDPA 1PRNA 3JTYA 4F4BA 3HW9A 3UAQA 1T16A 4FUVA 3AA7B 1MM5A 3UU2A 3C5OA 1OPFA 4FZMA 2KDYA 3DZMA 2KZ7B 3GP6A 2YPVA 5DL6A 1GFQA 1BH3A 2FGRA 3AA1B 4C69X 5KAIO 1P4TA 2R8AA 4D5UA 1ZHWA 2M06A 1Q9GA 4FSOA 4N58A 1ZHXA 2WVPA 3A0HO 4AYNA 1GFPA 3T20A 1BXWA 2PORA 2XE1A 2Y0KA 2KC0A 3SZDA 4N74A 4LSEA 5G26A 2J4UP 5T5FA 4AKRA 2KXPB 3EMNX 4UB8O 1BT9A 4G75A 1QJ9A 3SY7A 4FRXA 3AA7A 1S5LO 4O4XA 3UPGA 1MPFA 2FGQX 5E79O 3AAAA 1Q9FA 2KZ7A 2R89A 4N59A 3POUA 4UB6O 3G7GA 4D64A 3LK3B 4GCSA 3AAEB 1HXTA 3T0SA 2WJRA 4O3WA 2XTQA 3JCUO 5TISO 2R4OA 3VE2A 2XTRA 4O49A 4LSIA 4RJXA 5PRNA 4K3CA 4RL9A 2PRNA 3HOLA 5DL8A 4RLCA 2O4VA 5G3AA 2MNHA 1T1LA 2F1CX 4GCQA 1PHOA 3PGUA 3WU2O 4D65A 5KAFO 3NJTA
chains in the Genus database with same CATH topology
4O3XB 4GCPA 5AFUK 1HXXA 4FRTA 1H6S1 3DA3A 3AA6B 3PRNA 4FZLA 3SZVA 3PQUA 4AFKA 3LK3A 1THQA 3VY9X 1ORMA 2ZFGA 3FYXA 1IZNB 4XNLA 3KVDD 3LK2B 3RBHA 1ZHZA 4FZNA 3V8UA 4AYID 3PQSA 3AA1A 3AA0B 2YNKA 1GFMA 4XNKA 5DL5A 1ZHTA 1ZHYA 5EE2A 1QJ8A 4AYMC 3POXA 5IYUA 2OMFA 4AYDC 5GV0A 1HXUA 2J1NA 2W81C 3T24A 5AFUL 3QRCA 3VY8X 4AYEC 4KRAA 6PRNA 4O3ZA 4KR8A 3SYBA 2Y0LA 2M07A 2KXPA 2Y0HA 2Y2XA 3QRAA 4O3YA 3VZWX 2XE2A 4FMSA 3WI4A 3TZGA 4E1SA 1GFNA 5ADXK 4GF4A 2F1VA 3LK2A 1MM4A 3DA4A 4FESA 5D5DA 3VZUX 7PRNA 4FOZA 3VE1A 4E1TA 5DL7A 2N2LA 3AAEA 3SY9A 1G90A 2ERVA 1QJPA 2JMMA 2K0LA 3HWBA 4RJWA 2QTKA 3LK41 3VZTX 3POQA 2N2MA 2ODJA 2GE4A 4FT6A 3AAAB 8PRNA 4LSFA 2XE5A 4AUIA 4KR4A 1OSMA 4LSHA 2XG6A 5ADXL 4PUXA 2W80C 2LFUA 3NSGA 3O0EA 4FSPA 4U9CA 4AKMA 3AA6A 3SYSA 1E54A 2F1TA 2MHLA 3K19A 3WI5A 2XE3A 4Z3TA 1IZNA 4JCHA 4O4UA 4B61A 2X27X 2XMXA 4RLBA 3HOEA 2K4TA 1GFOA 3AA0A 3LK42 2LHFA 3PORA 3A2SX 1YS5A 5FVNA 4BUMX 2ZLDA 4AKRB 4G76A 4GHBA 4JFBA 4AZLA 2Y7SA 5JDPA 1PRNA 3JTYA 4F4BA 3HW9A 3UAQA 4FUVA 3AA7B 1MM5A 3UU2A 3C5OA 1OPFA 4FZMA 2KDYA 2KZ7B 3GP6A 2YPVA 5DL6A 1GFQA 1BH3A 2FGRA 3AA1B 4C69X 1P4TA 4D5UA 1ZHWA 2M06A 1Q9GA 4FSOA 4N58A 1ZHXA 4AYNA 1GFPA 3T20A 1BXWA 2PORA 2XE1A 2Y0KA 2KC0A 3SZDA 2J4UP 4LSEA 5G26A 5T5FA 4AKRA 2KXPB 3EMNX 1BT9A 4G75A 1QJ9A 3SY7A 4FRXA 3AA7A 4O4XA 3UPGA 1MPFA 2FGQX 3AAAA 1Q9FA 2KZ7A 4D64A 4N59A 3G7GA 3LK3B 4GCSA 3AAEB 1HXTA 3T0SA 4O3WA 2XTQA 3VE2A 2XTRA 4O49A 4LSIA 4RJXA 5PRNA 4RL9A 2PRNA 3HOLA 5DL8A 4RLCA 2O4VA 4D65A 2MNHA 4GCQA 4QQ1A 1PHOA 3POUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GCP A;  1HXX A;  4FRT A;  1H6S 1;  3PRN A;  3SZV A;  3VY9 X;  2ZFG A;  3FYX A;  5DL5 A;  1GFM A;  3POX A;  2OMF A;  1HXU A;  2J1N A;  3T24 A;  6PRN A;  3VY8 X;  4KRA A;  4KR8 A;  3SYB A;  2Y0L A;  2Y2X A;  2Y0H A;  3VZW X;  2XE2 A;  4FMS A;  3WI4 A;  1GFN A;  3VZU X;  7PRN A;  4FOZ A;  5DL7 A;  3SY9 A;  3HWB A;  4RJW A;  2QTK A;  3VZT X;  3POQ A;  2ODJ A;  4FT6 A;  8PRN A;  4LSF A;  2XE5 A;  4AUI A;  4KR4 A;  1OSM A;  4LSH A;  2XG6 A;  3NSG A;  3O0E A;  4FSP A;  3SYS A;  1E54 A;  3K19 A;  3WI5 A;  2XE3 A;  2K4T A;  1GFO A;  3POR A;  4BUM X;  5FVN A;  3A2S X;  2ZLD A;  4JFB A;  5JDP A;  1PRN A;  3JTY A;  3HW9 A;  3UU2 A;  1OPF A;  5DL6 A;  1GFQ A;  1BH3 A;  2FGR A;  4C69 X;  4D5U A;  4FSO A;  1GFP A;  3T20 A;  2POR A;  2XE1 A;  2Y0K A;  3SZD A;  2J4U P;  4LSE A;  3EMN X;  1BT9 A;  3SY7 A;  4FRX A;  3UPG A;  1MPF A;  2FGQ X;  4D64 A;  4GCS A;  1HXT A;  3T0S A;  5PRN A;  4LSI A;  4RJX A;  2PRN A;  5DL8 A;  2O4V A;  4D65 A;  4GCQ A;  1PHO A;  3POU A; 
#chains in the Genus database with same CATH topology
 4O3X B;  3BS0 A;  4GCP A;  5AFU K;  1HXX A;  4FRT A;  1H6S 1;  3DA3 A;  3AA6 B;  3PRN A;  5B66 O;  4FZL A;  3SZV A;  3PQU A;  4AFK A;  3LK3 A;  1THQ A;  3PGR A;  3VY9 X;  1ORM A;  2ZFG A;  3FYX A;  1IZN B;  4K3B A;  4XNL A;  3KVD D;  4FQE A;  3LK2 B;  3RBH A;  1ZHZ A;  4FZN A;  4N75 A;  3V8U A;  4AYI D;  4C4V B;  3PQS A;  3AA1 A;  3AA0 B;  2YNK A;  1GFM A;  3PF1 A;  4XNK A;  1ZHT A;  5DL5 A;  1ZHY A;  5EE2 A;  1QJ8 A;  4AYM C;  3POX A;  5IYU A;  4PJ0 O;  2OMF A;  4AYD C;  5GV0 A;  2IWV A;  1HXU A;  2J1N A;  2W81 C;  3T24 A;  5AFU L;  3QRC A;  3VY8 X;  4AYE C;  2R4L A;  2X9K A;  4IL6 O;  4KRA A;  4O3Z A;  6PRN A;  4KR8 A;  3SYB A;  4QQ1 A;  2Y0L A;  5H2F O;  2M07 A;  2KXP A;  2Y0H A;  2R4N A;  2Y2X A;  3BRZ A;  3QRA A;  4O3Y A;  3VZW X;  2XE2 A;  4FMS A;  3WI4 A;  3TZG A;  4E1S A;  1GFN A;  5ADX K;  3DWO X;  3DWN A;  3KZI O;  2F1V A;  4GF4 A;  4C00 A;  3LK2 A;  4PR7 A;  1MM4 A;  3DA4 A;  4FES A;  5D5D A;  3VZU X;  7PRN A;  4FOZ A;  3VE1 A;  4E1T A;  5DL7 A;  2N2L A;  3AAE A;  2AXT O;  3SY9 A;  2ERV A;  1G90 A;  1QJP A;  2JMM A;  2K0L A;  3HWB A;  4RJW A;  2QTK A;  3LK4 1;  3VZT X;  3POQ A;  5B5E O;  2N2M A;  2ODJ A;  2GE4 A;  4FT6 A;  3AAA B;  8PRN A;  4LSF A;  2XE5 A;  4AUI A;  4KR4 A;  1OSM A;  4LSH A;  2XG6 A;  5ADX L;  5G39 A;  2R4P A;  2W80 C;  2LFU A;  3NSG A;  3O0E A;  3PGS A;  4FSP A;  4PUX A;  4U9C A;  4AKM A;  2IWW A;  3AA6 A;  3A0B O;  3SYS A;  1E54 A;  2JQY A;  4CTD A;  2R88 A;  2F1T A;  2MHL A;  3K19 A;  3WI5 A;  2XE3 A;  4Z3T A;  1IZN A;  4JCH A;  4O4U A;  4B61 A;  2X27 X;  2XMX A;  4RLB A;  4C4V A;  5G38 A;  3HOE A;  2K4T A;  5GTI O;  1GFO A;  3AA0 A;  2WJQ A;  2LHF A;  3LK4 2;  3A2S X;  1YS5 A;  3POR A;  5FVN A;  4BUM X;  2ZLD A;  3BRY A;  4AKR B;  5GTH O;  4G76 A;  4GHB A;  4JFB A;  4AZL A;  2Y7S A;  5JDP A;  1PRN A;  3JTY A;  4F4B A;  3HW9 A;  3UAQ A;  1T16 A;  4FUV A;  3AA7 B;  1MM5 A;  3UU2 A;  3C5O A;  1OPF A;  4FZM A;  2KDY A;  3DZM A;  2KZ7 B;  3GP6 A;  2YPV A;  5DL6 A;  1GFQ A;  1BH3 A;  2FGR A;  3AA1 B;  4C69 X;  5KAI O;  1P4T A;  2R8A A;  4D5U A;  1ZHW A;  2M06 A;  1Q9G A;  4FSO A;  4N58 A;  1ZHX A;  2WVP A;  3A0H O;  4AYN A;  1GFP A;  3T20 A;  1BXW A;  2POR A;  2XE1 A;  2Y0K A;  2KC0 A;  3SZD A;  4N74 A;  4LSE A;  5G26 A;  2J4U P;  5T5F A;  4AKR A;  2KXP B;  3EMN X;  4UB8 O;  1BT9 A;  4G75 A;  1QJ9 A;  3SY7 A;  4FRX A;  3AA7 A;  1S5L O;  4O4X A;  3UPG A;  1MPF A;  2FGQ X;  5E79 O;  3AAA A;  1Q9F A;  2KZ7 A;  2R89 A;  4N59 A;  3POU A;  4UB6 O;  3G7G A;  4D64 A;  3LK3 B;  4GCS A;  3AAE B;  1HXT A;  3T0S A;  2WJR A;  4O3W A;  2XTQ A;  3JCU O;  5TIS O;  2R4O A;  3VE2 A;  2XTR A;  4O49 A;  4LSI A;  4RJX A;  5PRN A;  4K3C A;  4RL9 A;  2PRN A;  3HOL A;  5DL8 A;  4RLC A;  2O4V A;  5G3A A;  2MNH A;  1T1L A;  2F1C X;  4GCQ A;  1PHO A;  3PGU A;  3WU2 O;  4D65 A;  5KAF O;  3NJT A; 
#chains in the Genus database with same CATH homology
 4O3X B;  4GCP A;  5AFU K;  1HXX A;  4FRT A;  1H6S 1;  3DA3 A;  3AA6 B;  3PRN A;  4FZL A;  3SZV A;  3PQU A;  4AFK A;  3LK3 A;  1THQ A;  3VY9 X;  1ORM A;  2ZFG A;  3FYX A;  1IZN B;  4XNL A;  3KVD D;  3LK2 B;  3RBH A;  1ZHZ A;  4FZN A;  3V8U A;  4AYI D;  3PQS A;  3AA1 A;  3AA0 B;  2YNK A;  1GFM A;  4XNK A;  5DL5 A;  1ZHT A;  1ZHY A;  5EE2 A;  1QJ8 A;  4AYM C;  3POX A;  5IYU A;  2OMF A;  4AYD C;  5GV0 A;  1HXU A;  2J1N A;  2W81 C;  3T24 A;  5AFU L;  3QRC A;  3VY8 X;  4AYE C;  4KRA A;  6PRN A;  4O3Z A;  4KR8 A;  3SYB A;  2Y0L A;  2M07 A;  2KXP A;  2Y0H A;  2Y2X A;  3QRA A;  4O3Y A;  3VZW X;  2XE2 A;  4FMS A;  3WI4 A;  3TZG A;  4E1S A;  1GFN A;  5ADX K;  4GF4 A;  2F1V A;  3LK2 A;  1MM4 A;  3DA4 A;  4FES A;  5D5D A;  3VZU X;  7PRN A;  4FOZ A;  3VE1 A;  4E1T A;  5DL7 A;  2N2L A;  3AAE A;  3SY9 A;  1G90 A;  2ERV A;  1QJP A;  2JMM A;  2K0L A;  3HWB A;  4RJW A;  2QTK A;  3LK4 1;  3VZT X;  3POQ A;  2N2M A;  2ODJ A;  2GE4 A;  4FT6 A;  3AAA B;  8PRN A;  4LSF A;  2XE5 A;  4AUI A;  4KR4 A;  1OSM A;  4LSH A;  2XG6 A;  5ADX L;  4PUX A;  2W80 C;  2LFU A;  3NSG A;  3O0E A;  4FSP A;  4U9C A;  4AKM A;  3AA6 A;  3SYS A;  1E54 A;  2F1T A;  2MHL A;  3K19 A;  3WI5 A;  2XE3 A;  4Z3T A;  1IZN A;  4JCH A;  4O4U A;  4B61 A;  2X27 X;  2XMX A;  4RLB A;  3HOE A;  2K4T A;  1GFO A;  3AA0 A;  3LK4 2;  2LHF A;  3POR A;  3A2S X;  1YS5 A;  5FVN A;  4BUM X;  2ZLD A;  4AKR B;  4G76 A;  4GHB A;  4JFB A;  4AZL A;  2Y7S A;  5JDP A;  1PRN A;  3JTY A;  4F4B A;  3HW9 A;  3UAQ A;  4FUV A;  3AA7 B;  1MM5 A;  3UU2 A;  3C5O A;  1OPF A;  4FZM A;  2KDY A;  2KZ7 B;  3GP6 A;  2YPV A;  5DL6 A;  1GFQ A;  1BH3 A;  2FGR A;  3AA1 B;  4C69 X;  1P4T A;  4D5U A;  1ZHW A;  2M06 A;  1Q9G A;  4FSO A;  4N58 A;  1ZHX A;  4AYN A;  1GFP A;  3T20 A;  1BXW A;  2POR A;  2XE1 A;  2Y0K A;  2KC0 A;  3SZD A;  2J4U P;  4LSE A;  5G26 A;  5T5F A;  4AKR A;  2KXP B;  3EMN X;  1BT9 A;  4G75 A;  1QJ9 A;  3SY7 A;  4FRX A;  3AA7 A;  4O4X A;  3UPG A;  1MPF A;  2FGQ X;  3AAA A;  1Q9F A;  2KZ7 A;  4D64 A;  4N59 A;  3G7G A;  3LK3 B;  4GCS A;  3AAE B;  1HXT A;  3T0S A;  4O3W A;  2XTQ A;  3VE2 A;  2XTR A;  4O49 A;  4LSI A;  4RJX A;  5PRN A;  4RL9 A;  2PRN A;  3HOL A;  5DL8 A;  4RLC A;  2O4V A;  4D65 A;  2MNH A;  4GCQ A;  4QQ1 A;  1PHO A;  3POU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...