3DZMA

Crystal structure of a major outer membrane protein from thermus thermophilus hb27
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
208
structure length
208
Chain Sequence
HAAKFSVEAGAGFYGGFGGQLAVVAEDLAPGLPLGVRLGVGFATSDALDDGYDLGGGTTWGDVKEAGKFSEWGQNVTLSLDVLYKPSGLGLPVEVAPYFGVRYNFFSGGYTDPEDNLTIKAQTISSNQLGLGLGVRAAYPLMPNLSLVGDLGVDYYFQACFTRVEEDDSGNKSQSSVCPGDSGYEDVNKFVTQPEWVLKLRLGAAYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a major outer membrane protein from Thermus thermophilus HB27
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Unknown function
molecule keywords Hypothetical conserved protein
total genus 44
structure length 208
sequence length 208
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.70 Mainly Beta Beta Barrel Porin outer membrane protein from Thermus thermophilus HB27. 3dzmA00
3DZMA
chains in the Genus database with same CATH superfamily
3VY8X 4RJXA 2JMMA 2WJRA 4AZLA 1GFOA 2WJQA 3AA7B 4C4VB 3VZUX 2XTQA 3POQA 3AA6A 4N58A 4LSFA 4F4BA 5GTIO 3HW9A 1OSMA 2OMFA 4PR7A 4RJWA 1GFMA 2K0LA 5KAIO 4N59A 7PRNA 3DWNA 1QJ9A 5G26A 6PRNA 2Y0LA 4O3ZA 1ZHWA 1S5LO 3AAEA 4O4XA 3UU2A 3UPGA 2Y0KA 3SZVA 2MHLA 2PRNA 3LK41 4G76A 4XNLA 3AA1B 1BT9A 3G7GA 3T24A 1MM5A 3HOEA 1ZHYA 4FZNA 4GCPA 2WVPA 2K4TA 1ORMA 4AYEC 1HXTA 3PRNA 2JQYA 3LK2A 4GCQA 4O49A 1H6S1 2KZ7B 4C69X 5D5DA 2F1TA 4FZMA 4D65A 5DL6A 4UB8O 2QTKA 5KAFO 5AFUL 4PUXA 4U9CA 1MM4A 1GFNA 1HXXA 1Q9GA 3AA7A 4AFKA 4C00A 4C4VA 2GE4A 2R4LA 8PRNA 5ADXL 4O3XB 5GTHO 4GF4A 3PGUA 4RL9A 2R4NA 3PQSA 3PGSA 2ERVA 4K3BA 2AXTO 4FSPA 4UB6O 4XNKA 1P4TA 1PRNA 2XE1A 4LSIA 4N74A 5G38A 5G39A 3UAQA 3DA3A 3C5OA 3PQUA 5JDPA 3FYXA 2KXPB 5H2FO 4CTDA 1T1LA 2PORA 5FVNA 3QRAA 3QRCA 3WI4A 2LFUA 4AKRB 2R4OA 1G90A 1ZHTA 3PGRA 1GFQA 2M07A 3SZDA 1IZNB 4FUVA 2ZLDA 3LK3A 5B5EO 4O3YA 3BRZA 2XE3A 5E79O 4JCHA 2FGRA 4GCSA 4FOZA 3EMNX 2N2LA 3SYBA 2J4UP 3T20A 2IWVA 1Q9FA 3V8UA 4AKRA 2YPVA 4BUMX 4E1SA 3LK42 2FGQX 2R88A 3LK3B 4G75A 3AA0A 3TZGA 3VE2A 2KXPA 4O3WA 4AYMC 3A0HO 3BRYA 3HWBA 3JCUO 3K19A 2Y0HA 3PF1A 3PORA 4QQ1A 4LSHA 3SYSA 2R4PA 2XTRA 4O4UA 5DL5A 5IYUA 2F1CX 1ZHXA 1THQA 4IL6O 4D64A 3KZIO 4E1TA 2ODJA 3WI5A 5T5FA 3SY7A 2W81C 3GP6A 1OPFA 2MNHA 3DZMA 2R8AA 3HOLA 5DL7A 3VZTX 4AYNA 5AFUK 4FESA 4FQEA 3RBHA 2X27X 2O4VA 2KZ7A 1E54A 3NSGA 4FMSA 5DL8A 4B61A 2J1NA 3AA0B 2M06A 2N2MA 5GV0A 3BS0A 3A2SX 3DWOX 4PJ0O 4AYDC 3VZWX 4FSOA 4KR8A 2XMXA 3A0BO 2KDYA 2ZFGA 1MPFA 4K3CA 1YS5A 2IWWA 4RLCA 2XE5A 1T16A 1BH3A 4AUIA 3O0EA 3SY9A 3T0SA 3LK2B 4GHBA 5ADXK 2YNKA 4N75A 2Y7SA 2X9KA 2XG6A 1HXUA 3WU2O 4Z3TA 4AYID 2Y2XA 4RLBA 3AA1A 2F1VA 1BXWA 2LHFA 3AAEB 3KVDD 3JTYA 3POXA 4FZLA 4KRAA 5TISO 3VE1A 3VY9X 2R89A 4AKMA 4FT6A 3NJTA 1QJPA 2KC0A 1ZHZA 4FRXA 4JFBA 1IZNA 4KR4A 3AAAB 1GFPA 5EE2A 4D5UA 2XE2A 4LSEA 5B66O 1QJ8A 2W80C 5G3AA 3AAAA 3AA6B 3DA4A 4FRTA 5PRNA 3POUA 1PHOA
chains in the Genus database with same CATH topology
3DZMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DZM A; 
#chains in the Genus database with same CATH topology
 3VY8 X;  4RJX A;  2JMM A;  2WJR A;  4AZL A;  1GFO A;  2WJQ A;  3AA7 B;  4C4V B;  3VZU X;  2XTQ A;  3POQ A;  3AA6 A;  4N58 A;  4LSF A;  4F4B A;  5GTI O;  3HW9 A;  1OSM A;  2OMF A;  4PR7 A;  4RJW A;  1GFM A;  2K0L A;  5KAI O;  4N59 A;  7PRN A;  3DWN A;  1QJ9 A;  5G26 A;  6PRN A;  2Y0L A;  4O3Z A;  1ZHW A;  1S5L O;  3AAE A;  4O4X A;  3UU2 A;  3UPG A;  2Y0K A;  3SZV A;  2MHL A;  2PRN A;  3LK4 1;  4G76 A;  4XNL A;  3AA1 B;  1BT9 A;  3G7G A;  3T24 A;  1MM5 A;  3HOE A;  1ZHY A;  4FZN A;  4GCP A;  2WVP A;  2K4T A;  1ORM A;  4AYE C;  1HXT A;  3PRN A;  2JQY A;  3LK2 A;  4GCQ A;  4O49 A;  1H6S 1;  2KZ7 B;  4C69 X;  5D5D A;  2F1T A;  4FZM A;  4D65 A;  5DL6 A;  4UB8 O;  2QTK A;  5KAF O;  5AFU L;  4PUX A;  4U9C A;  1MM4 A;  1GFN A;  1HXX A;  1Q9G A;  3AA7 A;  4AFK A;  4C00 A;  4C4V A;  2GE4 A;  2R4L A;  8PRN A;  5ADX L;  4O3X B;  5GTH O;  4GF4 A;  3PGU A;  4RL9 A;  2R4N A;  3PQS A;  3PGS A;  2ERV A;  4K3B A;  2AXT O;  4FSP A;  4UB6 O;  4XNK A;  1P4T A;  1PRN A;  2XE1 A;  4LSI A;  4N74 A;  5G38 A;  5G39 A;  3UAQ A;  3DA3 A;  3C5O A;  3PQU A;  5JDP A;  3FYX A;  2KXP B;  5H2F O;  4CTD A;  1T1L A;  2POR A;  5FVN A;  3QRA A;  3QRC A;  3WI4 A;  2LFU A;  4AKR B;  2R4O A;  1G90 A;  1ZHT A;  3PGR A;  1GFQ A;  2M07 A;  3SZD A;  1IZN B;  4FUV A;  2ZLD A;  3LK3 A;  5B5E O;  4O3Y A;  3BRZ A;  2XE3 A;  5E79 O;  4JCH A;  2FGR A;  4GCS A;  4FOZ A;  3EMN X;  2N2L A;  3SYB A;  2J4U P;  3T20 A;  2IWV A;  1Q9F A;  3V8U A;  4AKR A;  2YPV A;  4BUM X;  4E1S A;  3LK4 2;  2FGQ X;  2R88 A;  3LK3 B;  4G75 A;  3AA0 A;  3TZG A;  3VE2 A;  2KXP A;  4O3W A;  4AYM C;  3A0H O;  3BRY A;  3HWB A;  3JCU O;  3K19 A;  2Y0H A;  3PF1 A;  3POR A;  4QQ1 A;  4LSH A;  3SYS A;  2R4P A;  2XTR A;  4O4U A;  5DL5 A;  5IYU A;  2F1C X;  1ZHX A;  1THQ A;  4IL6 O;  4D64 A;  3KZI O;  4E1T A;  2ODJ A;  3WI5 A;  5T5F A;  3SY7 A;  2W81 C;  3GP6 A;  1OPF A;  2MNH A;  3DZM A;  2R8A A;  3HOL A;  5DL7 A;  3VZT X;  4AYN A;  5AFU K;  4FES A;  4FQE A;  3RBH A;  2X27 X;  2O4V A;  2KZ7 A;  1E54 A;  3NSG A;  4FMS A;  5DL8 A;  4B61 A;  2J1N A;  3AA0 B;  2M06 A;  2N2M A;  5GV0 A;  3BS0 A;  3A2S X;  3DWO X;  4PJ0 O;  4AYD C;  3VZW X;  4FSO A;  4KR8 A;  2XMX A;  3A0B O;  2KDY A;  2ZFG A;  1MPF A;  4K3C A;  1YS5 A;  2IWW A;  4RLC A;  2XE5 A;  1T16 A;  1BH3 A;  4AUI A;  3O0E A;  3SY9 A;  3T0S A;  3LK2 B;  4GHB A;  5ADX K;  2YNK A;  4N75 A;  2Y7S A;  2X9K A;  2XG6 A;  1HXU A;  3WU2 O;  4Z3T A;  4AYI D;  2Y2X A;  4RLB A;  3AA1 A;  2F1V A;  1BXW A;  2LHF A;  3AAE B;  3KVD D;  3JTY A;  3POX A;  4FZL A;  4KRA A;  5TIS O;  3VE1 A;  3VY9 X;  2R89 A;  4AKM A;  4FT6 A;  3NJT A;  1QJP A;  2KC0 A;  1ZHZ A;  4FRX A;  4JFB A;  1IZN A;  4KR4 A;  3AAA B;  1GFP A;  5EE2 A;  4D5U A;  2XE2 A;  4LSE A;  5B66 O;  1QJ8 A;  2W80 C;  5G3A A;  3AAA A;  3AA6 B;  3DA4 A;  4FRT A;  5PRN A;  3POU A;  1PHO A; 
#chains in the Genus database with same CATH homology
 3DZM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...