3DZMA

Crystal structure of a major outer membrane protein from thermus thermophilus hb27
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
208
structure length
208
Chain Sequence
HAAKFSVEAGAGFYGGFGGQLAVVAEDLAPGLPLGVRLGVGFATSDALDDGYDLGGGTTWGDVKEAGKFSEWGQNVTLSLDVLYKPSGLGLPVEVAPYFGVRYNFFSGGYTDPEDNLTIKAQTISSNQLGLGLGVRAAYPLMPNLSLVGDLGVDYYFQACFTRVEEDDSGNKSQSSVCPGDSGYEDVNKFVTQPEWVLKLRLGAAYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical conserved protein
publication title Crystal structure of a major outer membrane protein from Thermus thermophilus HB27
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Unknown function
total genus 44
structure length 208
sequence length 208
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.70 Mainly Beta Beta Barrel Porin outer membrane protein from Thermus thermophilus HB27. 3dzmA00
3DZMA
chains in the Genus database with same CATH superfamily
1IZNB 5GTIO 2Y2XA 3AA1B 2AXTO 3SY7A 2QTKA 3PGRA 4FSOA 2F1CX 3KZIO 2WVPA 4FQEA 4UB8O 4B61A 4PJ0O 5DL6A 3VY8X 1BXWA 7PRNA 1ZHTA 5ADXL 8PRNA 5DL5A 2X27X 3LK41 3DWOX 4O3ZA 3WU2O 2MNHA 4BUMX 4FT6A 4C69X 4C4VA 5AFUK 2XE1A 3DWNA 1ZHWA 4KR8A 3UU2A 4D5UA 2XMXA 4O3YA 2IWWA 1S5LO 3NJTA 1T1LA 4QQ1A 1IZNA 2WJQA 1GFPA 4D65A 1MPFA 2R88A 4AYEC 5T5FA 2Y7SA 2JQYA 5G38A 3LK3B 4FRXA 6PRNA 4FSPA 4N58A 3BS0A 3JTYA 2PORA 3WI4A 4F4BA 1ORMA 2W81C 4GCSA 2XE3A 3GP6A 2XE2A 3AA6B 4IL6O 5AFUL 3O0EA 4K3BA 2F1TA 2N2MA 2XTRA 3AA0A 3QRAA 1GFOA 3A0BO 2LHFA 2IWVA 1H6S1 1QJ9A 3G7GA 4N59A 4O49A 2LFUA 1GFQA 2OMFA 5G3AA 4O4UA 4AYID 4FZLA 2XE5A 3LK42 3T0SA 3WI5A 1PHOA 4XNLA 1OSMA 3LK3A 4PR7A 1OPFA 2N2LA 2R4OA 4RJWA 5GV0A 3HW9A 3UAQA 4LSIA 2YPVA 3AA6A 3AA0B 4LSEA 1MM5A 3SYSA 2R4LA 4RLBA 1ZHYA 4D64A 1G90A 4AYMC 4GCPA 3AA7B 5KAFO 3T20A 2FGQX 2O4VA 3AAEB 3DA4A 5TISO 3VY9X 2J1NA 3LK2B 4GF4A 5PRNA 5B66O 3BRZA 2KZ7B 2R89A 3C5OA 4FZMA 4G76A 4GHBA 4AKRB 3VZWX 3POXA 1THQA 3PGUA 4PUXA 3QRCA 2FGRA 3RBHA 4RL9A 3T24A 1E54A 2Y0HA 2ZFGA 4AYDC 1ZHZA 4XNKA 1Q9GA 3HOLA 2X9KA 3PQSA 5H2FO 4G75A 5EE2A 3PGSA 3SY9A 3VZTX 3BRYA 4AKMA 2KXPB 3AA7A 3A0HO 3VE1A 3AAEA 3PQUA 2JMMA 3LK2A 3DA3A 4FZNA 4JCHA 5DL8A 2XG6A 5G39A 3AAAB 2KZ7A 1BH3A 1ZHXA 1HXTA 4FUVA 4N74A 5E79O 5G26A 4AKRA 1QJ8A 4E1SA 2PRNA 1YS5A 4O3WA 3PF1A 3TZGA 3VE2A 4FESA 2Y0LA 4AFKA 2XTQA 2K4TA 2R4PA 2R4NA 4Z3TA 3PRNA 3JCUO 4K3CA 3EMNX 1Q9FA 2Y0KA 3K19A 4E1TA 4UB6O 4CTDA 1PRNA 4LSFA 2KXPA 2MHLA 5JDPA 4AYNA 4O4XA 3PORA 4JFBA 3AAAA 1HXXA 3KVDD 1QJPA 3NSGA 1P4TA 2M06A 1T16A 2ZLDA 4GCQA 2R8AA 3DZMA 4O3XB 4LSHA 4U9CA 5FVNA 3VZUX 5GTHO 5B5EO 1GFNA 1HXUA 3UPGA 2KC0A 4KRAA 3SZVA 3HWBA 5D5DA 1GFMA 5IYUA 3A2SX 3HOEA 4N75A 1BT9A 3POQA 4FMSA 3AA1A 4FRTA 2ERVA 3FYXA 5DL7A 4AUIA 2ODJA 2YNKA 4C00A 2F1VA 5ADXK 4FOZA 2J4UP 4AZLA 2KDYA 4KR4A 4C4VB 2WJRA 3SYBA 3POUA 3V8UA 4RJXA 4RLCA 3SZDA 1MM4A 2W80C 5KAIO 2GE4A 2M07A 2K0LA
chains in the Genus database with same CATH topology
3DZMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DZM A; 
#chains in the Genus database with same CATH topology
 1IZN B;  5GTI O;  2Y2X A;  3AA1 B;  2AXT O;  3SY7 A;  2QTK A;  3PGR A;  4FSO A;  2F1C X;  3KZI O;  2WVP A;  4FQE A;  4UB8 O;  4B61 A;  4PJ0 O;  5DL6 A;  3VY8 X;  1BXW A;  7PRN A;  1ZHT A;  5ADX L;  8PRN A;  5DL5 A;  2X27 X;  3LK4 1;  3DWO X;  4O3Z A;  3WU2 O;  2MNH A;  4BUM X;  4FT6 A;  4C69 X;  4C4V A;  5AFU K;  2XE1 A;  3DWN A;  1ZHW A;  4KR8 A;  3UU2 A;  4D5U A;  2XMX A;  4O3Y A;  2IWW A;  1S5L O;  3NJT A;  1T1L A;  4QQ1 A;  1IZN A;  2WJQ A;  1GFP A;  4D65 A;  1MPF A;  2R88 A;  4AYE C;  5T5F A;  2Y7S A;  2JQY A;  5G38 A;  3LK3 B;  4FRX A;  6PRN A;  4FSP A;  4N58 A;  3BS0 A;  3JTY A;  2POR A;  3WI4 A;  4F4B A;  1ORM A;  2W81 C;  4GCS A;  2XE3 A;  3GP6 A;  2XE2 A;  3AA6 B;  4IL6 O;  5AFU L;  3O0E A;  4K3B A;  2F1T A;  2N2M A;  2XTR A;  3AA0 A;  3QRA A;  1GFO A;  3A0B O;  2LHF A;  2IWV A;  1H6S 1;  1QJ9 A;  3G7G A;  4N59 A;  4O49 A;  2LFU A;  1GFQ A;  2OMF A;  5G3A A;  4O4U A;  4AYI D;  4FZL A;  2XE5 A;  3LK4 2;  3T0S A;  3WI5 A;  1PHO A;  4XNL A;  1OSM A;  3LK3 A;  4PR7 A;  1OPF A;  2N2L A;  2R4O A;  4RJW A;  5GV0 A;  3HW9 A;  3UAQ A;  4LSI A;  2YPV A;  3AA6 A;  3AA0 B;  4LSE A;  1MM5 A;  3SYS A;  2R4L A;  4RLB A;  1ZHY A;  4D64 A;  1G90 A;  4AYM C;  4GCP A;  3AA7 B;  5KAF O;  3T20 A;  2FGQ X;  2O4V A;  3AAE B;  3DA4 A;  5TIS O;  3VY9 X;  2J1N A;  3LK2 B;  4GF4 A;  5PRN A;  5B66 O;  3BRZ A;  2KZ7 B;  2R89 A;  3C5O A;  4FZM A;  4G76 A;  4GHB A;  4AKR B;  3VZW X;  3POX A;  1THQ A;  3PGU A;  4PUX A;  3QRC A;  2FGR A;  3RBH A;  4RL9 A;  3T24 A;  1E54 A;  2Y0H A;  2ZFG A;  4AYD C;  1ZHZ A;  4XNK A;  1Q9G A;  3HOL A;  2X9K A;  3PQS A;  5H2F O;  4G75 A;  5EE2 A;  3PGS A;  3SY9 A;  3VZT X;  3BRY A;  4AKM A;  2KXP B;  3AA7 A;  3A0H O;  3VE1 A;  3AAE A;  3PQU A;  2JMM A;  3LK2 A;  3DA3 A;  4FZN A;  4JCH A;  5DL8 A;  2XG6 A;  5G39 A;  3AAA B;  2KZ7 A;  1BH3 A;  1ZHX A;  1HXT A;  4FUV A;  4N74 A;  5E79 O;  5G26 A;  4AKR A;  1QJ8 A;  4E1S A;  2PRN A;  1YS5 A;  4O3W A;  3PF1 A;  3TZG A;  3VE2 A;  4FES A;  2Y0L A;  4AFK A;  2XTQ A;  2K4T A;  2R4P A;  2R4N A;  4Z3T A;  3PRN A;  3JCU O;  4K3C A;  3EMN X;  1Q9F A;  2Y0K A;  3K19 A;  4E1T A;  4UB6 O;  4CTD A;  1PRN A;  4LSF A;  2KXP A;  2MHL A;  5JDP A;  4AYN A;  4O4X A;  3POR A;  4JFB A;  3AAA A;  1HXX A;  3KVD D;  1QJP A;  3NSG A;  1P4T A;  2M06 A;  1T16 A;  2ZLD A;  4GCQ A;  2R8A A;  3DZM A;  4O3X B;  4LSH A;  4U9C A;  5FVN A;  3VZU X;  5GTH O;  5B5E O;  1GFN A;  1HXU A;  3UPG A;  2KC0 A;  4KRA A;  3SZV A;  3HWB A;  5D5D A;  1GFM A;  5IYU A;  3A2S X;  3HOE A;  4N75 A;  1BT9 A;  3POQ A;  4FMS A;  3AA1 A;  4FRT A;  2ERV A;  3FYX A;  5DL7 A;  4AUI A;  2ODJ A;  2YNK A;  4C00 A;  2F1V A;  5ADX K;  4FOZ A;  2J4U P;  4AZL A;  2KDY A;  4KR4 A;  4C4V B;  2WJR A;  3SYB A;  3POU A;  3V8U A;  4RJX A;  4RLC A;  3SZD A;  1MM4 A;  2W80 C;  5KAI O;  2GE4 A;  2M07 A;  2K0L A; 
#chains in the Genus database with same CATH homology
 3DZM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...