3DZMA

Crystal structure of a major outer membrane protein from thermus thermophilus hb27
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
208
structure length
208
Chain Sequence
HAAKFSVEAGAGFYGGFGGQLAVVAEDLAPGLPLGVRLGVGFATSDALDDGYDLGGGTTWGDVKEAGKFSEWGQNVTLSLDVLYKPSGLGLPVEVAPYFGVRYNFFSGGYTDPEDNLTIKAQTISSNQLGLGLGVRAAYPLMPNLSLVGDLGVDYYFQACFTRVEEDDSGNKSQSSVCPGDSGYEDVNKFVTQPEWVLKLRLGAAYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Hypothetical conserved protein
publication title Crystal structure of a major outer membrane protein from Thermus thermophilus HB27
pubmed doi rcsb
source organism Thermus thermophilus
total genus 44
structure length 208
sequence length 208
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.70 Mainly Beta Beta Barrel Porin outer membrane protein from Thermus thermophilus HB27. 3dzmA00
3DZMA
chains in the Genus database with same CATH superfamily
4D64A 3DA4A 4G75A 2XE5A 3POUA 5DL8A 2J1NA 2JQYA 5AFUK 1H6S1 4O3YA 2KC0A 1OSMA 3GP6A 4PR7A 2KXPA 4K3BA 3WU2O 1MM5A 4AYID 2XE1A 2O4VA 5DL6A 1GFMA 1BXWA 3DWNA 3LK3A 2LFUA 5DL5A 1YS5A 1GFNA 3BRYA 3QRAA 3AA7B 4AYEC 3A0BO 4O3WA 4RJWA 4C4VB 3QRCA 2F1TA 2IWWA 3EMNX 3DWOX 1PRNA 4RLBA 1Q9GA 3PORA 5JDPA 3T20A 4N59A 4UB8O 2GE4A 3KZIO 1T16A 2XTQA 3SZDA 3NJTA 3UU2A 4O3XB 1ZHWA 1IZNB 4IL6O 5KAIO 2W81C 4FUVA 3VZUX 5E79O 3SY7A 3PQSA 5PRNA 2WVPA 2LHFA 2XG6A 3AA0A 2R4PA 4AUIA 3DA3A 2XE2A 5ADXL 2F1CX 2R8AA 3BS0A 4N75A 3AA1B 4FSOA 4RLCA 2MHLA 2Y0LA 4E1SA 5GV0A 1PHOA 1S5LO 2Y0HA 4KRAA 4PUXA 5G38A 2IWVA 3VY8X 3RBHA 2Y7SA 2YNKA 2M07A 4BUMX 1MPFA 3AAEB 4FQEA 2OMFA 3LK2A 5D5DA 4G76A 4UB6O 2YPVA 3AA6B 4GCQA 4AKRA 1G90A 2KZ7A 1HXXA 4O4UA 2WJRA 3HOLA 4AYNA 1BH3A 2QTKA 3O0EA 2FGRA 4RL9A 4XNKA 3AAAA 5B5EO 4E1TA 3PGUA 3WI4A 2AXTO 5GTHO 5T5FA 1ZHTA 1QJPA 1OPFA 2F1VA 4U9CA 5EE2A 3UPGA 4D5UA 2Y0KA 3FYXA 2N2LA 4PJ0O 2XMXA 4GF4A 3AA1A 4N74A 5AFUL 6PRNA 3A0HO 4FZLA 1ORMA 4FMSA 4O49A 4O3ZA 2KXPB 2R89A 4QQ1A 5DL7A 3PGRA 4K3CA 4O4XA 3LK3B 3AA7A 4XNLA 2JMMA 4N58A 2K0LA 3VZWX 3SY9A 1MM4A 4C4VA 7PRNA 1BT9A 3LK42 1E54A 1GFQA 4B61A 2XTRA 3UAQA 3SYSA 4AYDC 2ODJA 2MNHA 2PORA 3G7GA 3HWBA 3POXA 5GTIO 4CTDA 5H2FO 4FZMA 8PRNA 2ZFGA 3LK41 1IZNA 1ZHZA 2X9KA 3VE1A 3SYBA 3JCUO 3POQA 4RJXA 2N2MA 2R4OA 4F4BA 3JTYA 3WI5A 1ZHXA 4JFBA 3VE2A 3HOEA 4LSFA 4LSIA 5B66O 1Q9FA 2FGQX 4AYMC 3AA0B 5G26A 5FVNA 2ZLDA 3SZVA 2J4UP 1P4TA 2R4LA 5G39A 2Y2XA 4KR8A 4C69X 1T1LA 4Z3TA 3PGSA 5ADXK 1GFOA 3C5OA 2M06A 4FSPA 3K19A 4FRXA 4GHBA 3TZGA 1GFPA 2K4TA 3A2SX 3AAEA 4AFKA 2R4NA 3KVDD 1HXTA 2R88A 4FZNA 3BRZA 1QJ8A 4KR4A 2W80C 3AA6A 5G3AA 3VY9X 4FESA 5KAFO 4D65A 5IYUA 3LK2B 3PF1A 2ERVA 4GCPA 2XE3A 4AZLA 4LSHA 5TISO 2WJQA 2KDYA 2X27X 3NSGA 4FT6A 4FRTA 3T0SA 2KZ7B 4AKRB 1ZHYA 3PQUA 1QJ9A 4LSEA 3PRNA 3V8UA 3DZMA 4AKMA 4C00A 1HXUA 2PRNA 3AAAB 3T24A 3HW9A 4FOZA 4JCHA 1THQA 3VZTX 4GCSA
chains in the Genus database with same CATH topology
3DZMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DZM A; 
#chains in the Genus database with same CATH topology
 4D64 A;  3DA4 A;  4G75 A;  2XE5 A;  3POU A;  5DL8 A;  2J1N A;  2JQY A;  5AFU K;  1H6S 1;  4O3Y A;  2KC0 A;  1OSM A;  3GP6 A;  4PR7 A;  2KXP A;  4K3B A;  3WU2 O;  1MM5 A;  4AYI D;  2XE1 A;  2O4V A;  5DL6 A;  1GFM A;  1BXW A;  3DWN A;  3LK3 A;  2LFU A;  5DL5 A;  1YS5 A;  1GFN A;  3BRY A;  3QRA A;  3AA7 B;  4AYE C;  3A0B O;  4O3W A;  4RJW A;  4C4V B;  3QRC A;  2F1T A;  2IWW A;  3EMN X;  3DWO X;  1PRN A;  4RLB A;  1Q9G A;  3POR A;  5JDP A;  3T20 A;  4N59 A;  4UB8 O;  2GE4 A;  3KZI O;  1T16 A;  2XTQ A;  3SZD A;  3NJT A;  3UU2 A;  4O3X B;  1ZHW A;  1IZN B;  4IL6 O;  5KAI O;  2W81 C;  4FUV A;  3VZU X;  5E79 O;  3SY7 A;  3PQS A;  5PRN A;  2WVP A;  2LHF A;  2XG6 A;  3AA0 A;  2R4P A;  4AUI A;  3DA3 A;  2XE2 A;  5ADX L;  2F1C X;  2R8A A;  3BS0 A;  4N75 A;  3AA1 B;  4FSO A;  4RLC A;  2MHL A;  2Y0L A;  4E1S A;  5GV0 A;  1PHO A;  1S5L O;  2Y0H A;  4KRA A;  4PUX A;  5G38 A;  2IWV A;  3VY8 X;  3RBH A;  2Y7S A;  2YNK A;  2M07 A;  4BUM X;  1MPF A;  3AAE B;  4FQE A;  2OMF A;  3LK2 A;  5D5D A;  4G76 A;  4UB6 O;  2YPV A;  3AA6 B;  4GCQ A;  4AKR A;  1G90 A;  2KZ7 A;  1HXX A;  4O4U A;  2WJR A;  3HOL A;  4AYN A;  1BH3 A;  2QTK A;  3O0E A;  2FGR A;  4RL9 A;  4XNK A;  3AAA A;  5B5E O;  4E1T A;  3PGU A;  3WI4 A;  2AXT O;  5GTH O;  5T5F A;  1ZHT A;  1QJP A;  1OPF A;  2F1V A;  4U9C A;  5EE2 A;  3UPG A;  4D5U A;  2Y0K A;  3FYX A;  2N2L A;  4PJ0 O;  2XMX A;  4GF4 A;  3AA1 A;  4N74 A;  5AFU L;  6PRN A;  3A0H O;  4FZL A;  1ORM A;  4FMS A;  4O49 A;  4O3Z A;  2KXP B;  2R89 A;  4QQ1 A;  5DL7 A;  3PGR A;  4K3C A;  4O4X A;  3LK3 B;  3AA7 A;  4XNL A;  2JMM A;  4N58 A;  2K0L A;  3VZW X;  3SY9 A;  1MM4 A;  4C4V A;  7PRN A;  1BT9 A;  3LK4 2;  1E54 A;  1GFQ A;  4B61 A;  2XTR A;  3UAQ A;  3SYS A;  4AYD C;  2ODJ A;  2MNH A;  2POR A;  3G7G A;  3HWB A;  3POX A;  5GTI O;  4CTD A;  5H2F O;  4FZM A;  8PRN A;  2ZFG A;  3LK4 1;  1IZN A;  1ZHZ A;  2X9K A;  3VE1 A;  3SYB A;  3JCU O;  3POQ A;  4RJX A;  2N2M A;  2R4O A;  4F4B A;  3JTY A;  3WI5 A;  1ZHX A;  4JFB A;  3VE2 A;  3HOE A;  4LSF A;  4LSI A;  5B66 O;  1Q9F A;  2FGQ X;  4AYM C;  3AA0 B;  5G26 A;  5FVN A;  2ZLD A;  3SZV A;  2J4U P;  1P4T A;  2R4L A;  5G39 A;  2Y2X A;  4KR8 A;  4C69 X;  1T1L A;  4Z3T A;  3PGS A;  5ADX K;  1GFO A;  3C5O A;  2M06 A;  4FSP A;  3K19 A;  4FRX A;  4GHB A;  3TZG A;  1GFP A;  2K4T A;  3A2S X;  3AAE A;  4AFK A;  2R4N A;  3KVD D;  1HXT A;  2R88 A;  4FZN A;  3BRZ A;  1QJ8 A;  4KR4 A;  2W80 C;  3AA6 A;  5G3A A;  3VY9 X;  4FES A;  5KAF O;  4D65 A;  5IYU A;  3LK2 B;  3PF1 A;  2ERV A;  4GCP A;  2XE3 A;  4AZL A;  4LSH A;  5TIS O;  2WJQ A;  2KDY A;  2X27 X;  3NSG A;  4FT6 A;  4FRT A;  3T0S A;  2KZ7 B;  4AKR B;  1ZHY A;  3PQU A;  1QJ9 A;  4LSE A;  3PRN A;  3V8U A;  3DZM A;  4AKM A;  4C00 A;  1HXU A;  2PRN A;  3AAA B;  3T24 A;  3HW9 A;  4FOZ A;  4JCH A;  1THQ A;  3VZT X;  4GCS A; 
#chains in the Genus database with same CATH homology
 3DZM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...