1PHOA

Crystal structures explain functional properties of two e. coli porins
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
330
structure length
330
Chain Sequence
AEIYNKDGNKLDVYGKVKAMHYMSDNASKDGDQSYIRFGFKGETQINDQLTGYGRWEAEFAGNKAESDTAQQKTRLAFAGLKYKDLGSFDYGRNLGALYDVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFGVIDGLNLTLQYQGKNENRDVKKQNGDGFGTSLTYDFGGSDFAISGAYTNSDRTNEQNLQSRGTGKRAEAWATGLKYDANNIYLATFYSETRKMTPITGGFANKTQNFEAVAQYQFDFGLRPSLGYVLSKGKDIEGIGDEDLVNYIDVGATYYFNKNMSAFVDYKINQLDSDNKLNINNDDIVAVGMTYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Outer membrane protein
molecule keywords PHOSPHOPORIN
publication title Crystal structures explain functional properties of two E. coli porins.
pubmed doi rcsb
source organism Escherichia coli
total genus 77
structure length 330
sequence length 330
ec nomenclature
pdb deposition date 1993-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1phoA00
4JFBA 2XE3A 1HXXA 4FSPA 4GCQA 4LSHA 3K19A 3VY8X 5DL6A 2XG6A 4BUMX 1GFMA 2ODJA 4GCPA 2PORA 4KR8A 4D65A 2XE5A 3A2SX 2Y0KA 3SZDA 2FGRA 3NSGA 3VZTX 3EMNX 4LSEA 5FVNA 1BT9A 3POUA 3SY9A 1GFNA 3T24A 3UPGA 7PRNA 2J4UP 8PRNA 2PRNA 4GCSA 3SYBA 2O4VA 3O0EA 2FGQX 3VZWX 4FRTA 4KR4A 1MPFA 1GFOA 3VZUX 3WI4A 2XE1A 3FYXA 2Y2XA 3POXA 4KRAA 3WI5A 2XE2A 5DL7A 3SY7A 4RJWA 4LSIA 1PRNA 2K4TA 3HW9A 2Y0LA 5PRNA 4FSOA 6PRNA 4D5UA 1H6S1 2ZLDA 5JDPA 4C69X 5DL5A 2QTKA 4FOZA 3SYSA 3POQA 4LSFA 1E54A 4RJXA 1OSMA 4D64A 2OMFA 3UU2A 3VY9X 3PORA 1GFQA 2J1NA 3PRNA 3HWBA 1GFPA 4FRXA 1HXTA 1PHOA 4FMSA 1HXUA 3T20A 2Y0HA 1BH3A 5DL8A 3SZVA 1OPFA 3T0SA 3JTYA 4AUIA 2ZFGA 4FT6A
chains in the Genus database with same CATH superfamily
4U9CA 4O3WA 4RL9A 3T20A 2M06A 2WJRA 3DA3A 4AYNA 2IWWA 2K0LA 4N75A 2WVPA 4JFBA 3AA6B 2XE3A 4FUVA 1HXXA 4FSPA 4O3YA 4GCQA 4C00A 4LSHA 3JCUO 2MNHA 2KXPA 3DZMA 4UB8O 4C4VB 3AA7B 2R4NA 2N2MA 3PGRA 3K19A 3VY8X 3QRAA 4XNKA 5AFUK 4B61A 5DL6A 4FZLA 2KC0A 1T1LA 2XG6A 2GE4A 2JQYA 5ADXK 4AKRA 1IZNB 1ZHZA 3PF1A 3DWOX 1GFMA 1P4TA 2ODJA 2R4LA 3LK3A 4GCPA 4QQ1A 2PORA 4BUMX 1BXWA 4KR8A 4D65A 2XE5A 3A2SX 1MM4A 2Y0KA 3RBHA 3SZDA 2FGRA 3NSGA 4Z3TA 5KAIO 2X27X 3VZTX 4N74A 2N2LA 4PR7A 5AFUL 1ZHTA 1MM5A 3AA1B 1T16A 3C5OA 3DA4A 3KVDD 3AAAB 3EMNX 5IYUA 4LSEA 5FVNA 1BT9A 2XMXA 3PGUA 3POUA 4G76A 1Q9FA 4O3ZA 5GV0A 3SY9A 1GFNA 3A0BO 3AA6A 3T24A 3UPGA 7PRNA 4RLCA 2J4UP 8PRNA 5B5EO 1THQA 2PRNA 3PGSA 4FZMA 1ZHXA 4GCSA 3SYBA 4FESA 3G7GA 3AA7A 4C4VA 2O4VA 4FQEA 3O0EA 2W81C 2FGQX 3VZWX 1ORMA 4K3CA 5H2FO 5G38A 4FRTA 5G3AA 2R8AA 6PRNA 2LHFA 4O49A 2MHLA 2WJQA 1IZNA 4FZNA 2F1CX 3LK42 4GHBA 1MPFA 4KR4A 1Q9GA 1GFOA 4O4UA 3VZUX 3WI4A 2XE1A 2X9KA 5G39A 4IL6O 2R4PA 5G26A 3WU2O 4E1SA 3BRYA 3FYXA 2Y2XA 3KZIO 3QRCA 3POXA 2LFUA 1QJPA 4AKMA 2YPVA 3AA1A 2XTQA 4KRAA 3TZGA 3WI5A 2R88A 2XE2A 3HOLA 3AAAA 4RLBA 3PQSA 5DL7A 5ADXL 2AXTO 3SY7A 4RJWA 4LSIA 3BS0A 1PRNA 2K4TA 3AAEB 2Y0LA 3HW9A 3PQUA 3BRZA 4FSOA 5KAFO 1QJ9A 5PRNA 3JTYA 5TISO 1H6S1 3AAEA 4D5UA 4F4BA 2ZLDA 4O3XB 2ERVA 5JDPA 3AA0B 4G75A 3V8UA 3HOEA 4C69X 4XNLA 5DL5A 1ZHWA 2QTKA 2F1VA 2XTRA 4FOZA 2R4OA 2F1TA 4AZLA 2KZ7B 3SYSA 3UAQA 3POQA 2YNKA 2KZ7A 1YS5A 5D5DA 3DWNA 4K3BA 2R89A 4PUXA 4LSFA 5E79O 5GTHO 1E54A 1G90A 4RJXA 1OSMA 2KXPB 5GTIO 4D64A 4UB6O 2M07A 2Y7SA 4N58A 2OMFA 4O4XA 3UU2A 2JMMA 3VY9X 3PORA 3VE2A 5EE2A 1GFQA 2J1NA 3PRNA 4PJ0O 3HWBA 1QJ8A 4AKRB 1GFPA 3LK3B 4FRXA 4AYMC 1HXTA 3LK41 1PHOA 4FMSA 3LK2B 1ZHYA 1HXUA 4AYEC 2IWVA 3NJTA 2Y0HA 3LK2A 4AFKA 1BH3A 5DL8A 3SZVA 4GF4A 3A0HO 4AYID 4CTDA 5B66O 1OPFA 3AA0A 1S5LO 4JCHA 3VE1A 4E1TA 4N59A 2W80C 2KDYA 5T5FA 3T0SA 3GP6A 4AUIA 2ZFGA 4AYDC 4FT6A
chains in the Genus database with same CATH topology
4U9CA 4O3WA 4RL9A 2M06A 3DA3A 4AYNA 2K0LA 4JFBA 3AA6B 2XE3A 4FUVA 1HXXA 4FSPA 4O3YA 4GCQA 4LSHA 4Z3TA 2MNHA 2KXPA 3AA7B 5AFUK 2N2MA 3K19A 3VY8X 3QRAA 4XNKA 4B61A 5DL6A 4FZLA 2KC0A 2XG6A 2GE4A 5ADXK 4AKRA 1IZNB 1ZHZA 4BUMX 1GFMA 1P4TA 2ODJA 3LK3A 4GCPA 4QQ1A 2PORA 1BXWA 4KR8A 4D65A 2XE5A 3A2SX 1MM4A 2Y0KA 3RBHA 3SZDA 2FGRA 3NSGA 2X27X 3VZTX 2N2LA 5AFUL 1ZHTA 1MM5A 3AA1B 3C5OA 3DA4A 3KVDD 3AAAB 3EMNX 5IYUA 4LSEA 5FVNA 1BT9A 2XMXA 3POUA 4G76A 4O3ZA 1Q9FA 5GV0A 3SY9A 1GFNA 3AA6A 3T24A 3UPGA 7PRNA 4RLCA 2J4UP 8PRNA 1THQA 2PRNA 4FZMA 4GCSA 1ZHXA 3SYBA 4FESA 3G7GA 3AA7A 2O4VA 3O0EA 2W81C 2FGQX 3VZWX 1ORMA 4FRTA 2LHFA 4O49A 2MHLA 1IZNA 4FZNA 3LK42 4GHBA 4KR4A 1MPFA 1Q9GA 1GFOA 4O4UA 3VZUX 3WI4A 2XE1A 5G26A 4E1SA 3FYXA 2Y2XA 3QRCA 3POXA 2LFUA 1QJPA 4AKMA 2YPVA 3AA1A 2XTQA 4KRAA 3TZGA 3WI5A 3HOLA 2XE2A 3AAAA 4RLBA 3PQSA 5DL7A 5ADXL 3SY7A 4RJWA 4LSIA 1PRNA 2K4TA 3AAEB 2Y0LA 3HW9A 3PQUA 4FSOA 5PRNA 4D5UA 1QJ9A 6PRNA 3JTYA 1H6S1 3AAEA 4F4BA 2ZLDA 4O3XB 2ERVA 5JDPA 3AA0B 4G75A 3V8UA 3HOEA 4C69X 4XNLA 5DL5A 1ZHWA 2QTKA 2F1VA 2XTRA 4FOZA 2F1TA 4AZLA 2KZ7B 3SYSA 3UAQA 3POQA 2YNKA 2KZ7A 1YS5A 5D5DA 4PUXA 4LSFA 1E54A 1G90A 4RJXA 1OSMA 2KXPB 4D64A 2M07A 2Y7SA 4N58A 2OMFA 4O4XA 3UU2A 2JMMA 3VY9X 3PORA 3VE2A 5EE2A 1GFQA 2J1NA 3PRNA 3HWBA 1QJ8A 4AKRB 1GFPA 3LK3B 4FRXA 4AYMC 1HXTA 3LK41 1PHOA 4FMSA 3LK2B 1ZHYA 1HXUA 4AYEC 3T20A 2Y0HA 3LK2A 4AFKA 1BH3A 5DL8A 3SZVA 4GF4A 4AYID 1OPFA 3AA0A 4JCHA 4E1TA 3VE1A 4N59A 2W80C 2KDYA 5T5FA 3T0SA 3GP6A 4AUIA 2ZFGA 4AYDC 4FT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JFB A;  2XE3 A;  1HXX A;  4FSP A;  4GCQ A;  4LSH A;  3K19 A;  3VY8 X;  5DL6 A;  2XG6 A;  4BUM X;  1GFM A;  2ODJ A;  4GCP A;  2POR A;  4KR8 A;  4D65 A;  2XE5 A;  3A2S X;  2Y0K A;  3SZD A;  2FGR A;  3NSG A;  3VZT X;  3EMN X;  4LSE A;  5FVN A;  1BT9 A;  3POU A;  3SY9 A;  1GFN A;  3T24 A;  3UPG A;  7PRN A;  2J4U P;  8PRN A;  2PRN A;  4GCS A;  3SYB A;  2O4V A;  3O0E A;  2FGQ X;  3VZW X;  4FRT A;  4KR4 A;  1MPF A;  1GFO A;  3VZU X;  3WI4 A;  2XE1 A;  3FYX A;  2Y2X A;  3POX A;  4KRA A;  3WI5 A;  2XE2 A;  5DL7 A;  3SY7 A;  4RJW A;  4LSI A;  1PRN A;  2K4T A;  3HW9 A;  2Y0L A;  5PRN A;  4FSO A;  6PRN A;  4D5U A;  1H6S 1;  2ZLD A;  5JDP A;  4C69 X;  5DL5 A;  2QTK A;  4FOZ A;  3SYS A;  3POQ A;  4LSF A;  1E54 A;  4RJX A;  1OSM A;  4D64 A;  2OMF A;  3UU2 A;  3VY9 X;  3POR A;  1GFQ A;  2J1N A;  3PRN A;  3HWB A;  1GFP A;  4FRX A;  1HXT A;  1PHO A;  4FMS A;  1HXU A;  3T20 A;  2Y0H A;  1BH3 A;  5DL8 A;  3SZV A;  1OPF A;  3T0S A;  3JTY A;  4AUI A;  2ZFG A;  4FT6 A; 
#chains in the Genus database with same CATH topology
 4U9C A;  4O3W A;  4RL9 A;  3T20 A;  2M06 A;  2WJR A;  3DA3 A;  4AYN A;  2IWW A;  2K0L A;  4N75 A;  2WVP A;  4JFB A;  3AA6 B;  2XE3 A;  4FUV A;  1HXX A;  4FSP A;  4O3Y A;  4GCQ A;  4C00 A;  4LSH A;  3JCU O;  2MNH A;  2KXP A;  3DZM A;  4UB8 O;  4C4V B;  3AA7 B;  2R4N A;  2N2M A;  3PGR A;  3K19 A;  3VY8 X;  3QRA A;  4XNK A;  5AFU K;  4B61 A;  5DL6 A;  4FZL A;  2KC0 A;  1T1L A;  2XG6 A;  2GE4 A;  2JQY A;  5ADX K;  4AKR A;  1IZN B;  1ZHZ A;  3PF1 A;  3DWO X;  1GFM A;  1P4T A;  2ODJ A;  2R4L A;  3LK3 A;  4GCP A;  4QQ1 A;  2POR A;  4BUM X;  1BXW A;  4KR8 A;  4D65 A;  2XE5 A;  3A2S X;  1MM4 A;  2Y0K A;  3RBH A;  3SZD A;  2FGR A;  3NSG A;  4Z3T A;  5KAI O;  2X27 X;  3VZT X;  4N74 A;  2N2L A;  4PR7 A;  5AFU L;  1ZHT A;  1MM5 A;  3AA1 B;  1T16 A;  3C5O A;  3DA4 A;  3KVD D;  3AAA B;  3EMN X;  5IYU A;  4LSE A;  5FVN A;  1BT9 A;  2XMX A;  3PGU A;  3POU A;  4G76 A;  1Q9F A;  4O3Z A;  5GV0 A;  3SY9 A;  1GFN A;  3A0B O;  3AA6 A;  3T24 A;  3UPG A;  7PRN A;  4RLC A;  2J4U P;  8PRN A;  5B5E O;  1THQ A;  2PRN A;  3PGS A;  4FZM A;  1ZHX A;  4GCS A;  3SYB A;  4FES A;  3G7G A;  3AA7 A;  4C4V A;  2O4V A;  4FQE A;  3O0E A;  2W81 C;  2FGQ X;  3VZW X;  1ORM A;  4K3C A;  5H2F O;  5G38 A;  4FRT A;  5G3A A;  2R8A A;  6PRN A;  2LHF A;  4O49 A;  2MHL A;  2WJQ A;  1IZN A;  4FZN A;  2F1C X;  3LK4 2;  4GHB A;  1MPF A;  4KR4 A;  1Q9G A;  1GFO A;  4O4U A;  3VZU X;  3WI4 A;  2XE1 A;  2X9K A;  5G39 A;  4IL6 O;  2R4P A;  5G26 A;  3WU2 O;  4E1S A;  3BRY A;  3FYX A;  2Y2X A;  3KZI O;  3QRC A;  3POX A;  2LFU A;  1QJP A;  4AKM A;  2YPV A;  3AA1 A;  2XTQ A;  4KRA A;  3TZG A;  3WI5 A;  2R88 A;  2XE2 A;  3HOL A;  3AAA A;  4RLB A;  3PQS A;  5DL7 A;  5ADX L;  2AXT O;  3SY7 A;  4RJW A;  4LSI A;  3BS0 A;  1PRN A;  2K4T A;  3AAE B;  2Y0L A;  3HW9 A;  3PQU A;  3BRZ A;  4FSO A;  5KAF O;  1QJ9 A;  5PRN A;  3JTY A;  5TIS O;  1H6S 1;  3AAE A;  4D5U A;  4F4B A;  2ZLD A;  4O3X B;  2ERV A;  5JDP A;  3AA0 B;  4G75 A;  3V8U A;  3HOE A;  4C69 X;  4XNL A;  5DL5 A;  1ZHW A;  2QTK A;  2F1V A;  2XTR A;  4FOZ A;  2R4O A;  2F1T A;  4AZL A;  2KZ7 B;  3SYS A;  3UAQ A;  3POQ A;  2YNK A;  2KZ7 A;  1YS5 A;  5D5D A;  3DWN A;  4K3B A;  2R89 A;  4PUX A;  4LSF A;  5E79 O;  5GTH O;  1E54 A;  1G90 A;  4RJX A;  1OSM A;  2KXP B;  5GTI O;  4D64 A;  4UB6 O;  2M07 A;  2Y7S A;  4N58 A;  2OMF A;  4O4X A;  3UU2 A;  2JMM A;  3VY9 X;  3POR A;  3VE2 A;  5EE2 A;  1GFQ A;  2J1N A;  3PRN A;  4PJ0 O;  3HWB A;  1QJ8 A;  4AKR B;  1GFP A;  3LK3 B;  4FRX A;  4AYM C;  1HXT A;  3LK4 1;  1PHO A;  4FMS A;  3LK2 B;  1ZHY A;  1HXU A;  4AYE C;  2IWV A;  3NJT A;  2Y0H A;  3LK2 A;  4AFK A;  1BH3 A;  5DL8 A;  3SZV A;  4GF4 A;  3A0H O;  4AYI D;  4CTD A;  5B66 O;  1OPF A;  3AA0 A;  1S5L O;  4JCH A;  3VE1 A;  4E1T A;  4N59 A;  2W80 C;  2KDY A;  5T5F A;  3T0S A;  3GP6 A;  4AUI A;  2ZFG A;  4AYD C;  4FT6 A; 
#chains in the Genus database with same CATH homology
 4U9C A;  4O3W A;  4RL9 A;  2M06 A;  3DA3 A;  4AYN A;  2K0L A;  4JFB A;  3AA6 B;  2XE3 A;  4FUV A;  1HXX A;  4FSP A;  4O3Y A;  4GCQ A;  4LSH A;  4Z3T A;  2MNH A;  2KXP A;  3AA7 B;  5AFU K;  2N2M A;  3K19 A;  3VY8 X;  3QRA A;  4XNK A;  4B61 A;  5DL6 A;  4FZL A;  2KC0 A;  2XG6 A;  2GE4 A;  5ADX K;  4AKR A;  1IZN B;  1ZHZ A;  4BUM X;  1GFM A;  1P4T A;  2ODJ A;  3LK3 A;  4GCP A;  4QQ1 A;  2POR A;  1BXW A;  4KR8 A;  4D65 A;  2XE5 A;  3A2S X;  1MM4 A;  2Y0K A;  3RBH A;  3SZD A;  2FGR A;  3NSG A;  2X27 X;  3VZT X;  2N2L A;  5AFU L;  1ZHT A;  1MM5 A;  3AA1 B;  3C5O A;  3DA4 A;  3KVD D;  3AAA B;  3EMN X;  5IYU A;  4LSE A;  5FVN A;  1BT9 A;  2XMX A;  3POU A;  4G76 A;  4O3Z A;  1Q9F A;  5GV0 A;  3SY9 A;  1GFN A;  3AA6 A;  3T24 A;  3UPG A;  7PRN A;  4RLC A;  2J4U P;  8PRN A;  1THQ A;  2PRN A;  4FZM A;  4GCS A;  1ZHX A;  3SYB A;  4FES A;  3G7G A;  3AA7 A;  2O4V A;  3O0E A;  2W81 C;  2FGQ X;  3VZW X;  1ORM A;  4FRT A;  2LHF A;  4O49 A;  2MHL A;  1IZN A;  4FZN A;  3LK4 2;  4GHB A;  4KR4 A;  1MPF A;  1Q9G A;  1GFO A;  4O4U A;  3VZU X;  3WI4 A;  2XE1 A;  5G26 A;  4E1S A;  3FYX A;  2Y2X A;  3QRC A;  3POX A;  2LFU A;  1QJP A;  4AKM A;  2YPV A;  3AA1 A;  2XTQ A;  4KRA A;  3TZG A;  3WI5 A;  3HOL A;  2XE2 A;  3AAA A;  4RLB A;  3PQS A;  5DL7 A;  5ADX L;  3SY7 A;  4RJW A;  4LSI A;  1PRN A;  2K4T A;  3AAE B;  2Y0L A;  3HW9 A;  3PQU A;  4FSO A;  5PRN A;  4D5U A;  1QJ9 A;  6PRN A;  3JTY A;  1H6S 1;  3AAE A;  4F4B A;  2ZLD A;  4O3X B;  2ERV A;  5JDP A;  3AA0 B;  4G75 A;  3V8U A;  3HOE A;  4C69 X;  4XNL A;  5DL5 A;  1ZHW A;  2QTK A;  2F1V A;  2XTR A;  4FOZ A;  2F1T A;  4AZL A;  2KZ7 B;  3SYS A;  3UAQ A;  3POQ A;  2YNK A;  2KZ7 A;  1YS5 A;  5D5D A;  4PUX A;  4LSF A;  1E54 A;  1G90 A;  4RJX A;  1OSM A;  2KXP B;  4D64 A;  2M07 A;  2Y7S A;  4N58 A;  2OMF A;  4O4X A;  3UU2 A;  2JMM A;  3VY9 X;  3POR A;  3VE2 A;  5EE2 A;  1GFQ A;  2J1N A;  3PRN A;  3HWB A;  1QJ8 A;  4AKR B;  1GFP A;  3LK3 B;  4FRX A;  4AYM C;  1HXT A;  3LK4 1;  1PHO A;  4FMS A;  3LK2 B;  1ZHY A;  1HXU A;  4AYE C;  3T20 A;  2Y0H A;  3LK2 A;  4AFK A;  1BH3 A;  5DL8 A;  3SZV A;  4GF4 A;  4AYI D;  1OPF A;  3AA0 A;  4JCH A;  4E1T A;  3VE1 A;  4N59 A;  2W80 C;  2KDY A;  5T5F A;  3T0S A;  3GP6 A;  4AUI A;  2ZFG A;  4AYD C;  4FT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...