1PHOA

Crystal structures explain functional properties of two e. coli porins
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
330
structure length
330
Chain Sequence
AEIYNKDGNKLDVYGKVKAMHYMSDNASKDGDQSYIRFGFKGETQINDQLTGYGRWEAEFAGNKAESDTAQQKTRLAFAGLKYKDLGSFDYGRNLGALYDVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFGVIDGLNLTLQYQGKNENRDVKKQNGDGFGTSLTYDFGGSDFAISGAYTNSDRTNEQNLQSRGTGKRAEAWATGLKYDANNIYLATFYSETRKMTPITGGFANKTQNFEAVAQYQFDFGLRPSLGYVLSKGKDIEGIGDEDLVNYIDVGATYYFNKNMSAFVDYKINQLDSDNKLNINNDDIVAVGMTYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOPORIN
publication title Crystal structures explain functional properties of two E. coli porins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Outer membrane protein
total genus 77
structure length 330
sequence length 330
ec nomenclature
pdb deposition date 1993-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1phoA00
1PRNA 3HWBA 2ODJA 1GFQA 2XE3A 3UPGA 2J4UP 1BT9A 3EMNX 2OMFA 3T24A 3VY8X 2XG6A 3UU2A 4D64A 3POQA 1GFNA 3SYSA 2PORA 3WI5A 3O0EA 4RJWA 2ZLDA 3SYBA 3SZVA 2FGQX 4D65A 5DL6A 2J1NA 4GCSA 4RJXA 2XE2A 5DL8A 2PRNA 5JDPA 3A2SX 3POXA 2FGRA 1GFPA 2O4VA 4KR4A 3PRNA 4AUIA 2Y0LA 3VZUX 3VY9X 4FT6A 1GFOA 4FRTA 1PHOA 1HXTA 2Y0KA 5DL7A 2Y0HA 3NSGA 4GCPA 4LSHA 2XE1A 4LSFA 4FOZA 4JFBA 4C69X 1BH3A 3PORA 4LSIA 1HXUA 8PRNA 4KR8A 2XE5A 3HW9A 3VZWX 1OPFA 3SY7A 5PRNA 4KRAA 3WI4A 5FVNA 2QTKA 3FYXA 1E54A 4FRXA 4BUMX 2ZFGA 3POUA 3SZDA 3T0SA 1MPFA 7PRNA 4FSOA 4LSEA 1HXXA 3JTYA 4FMSA 3K19A 4D5UA 2Y2XA 5DL5A 4FSPA 1H6S1 3VZTX 2K4TA 4GCQA 3T20A 1OSMA 3SY9A 6PRNA 1GFMA
chains in the Genus database with same CATH superfamily
4AKRA 1PRNA 3WU2O 2WVPA 4K3CA 3HWBA 2ODJA 1GFQA 2R88A 4O3ZA 2XE3A 1G90A 3UPGA 3AAAB 4C4VB 4UB6O 1BT9A 4XNLA 2LHFA 2J4UP 1T1LA 2OMFA 3EMNX 3T24A 1MM4A 3VY8X 4O49A 1MM5A 3BS0A 2XG6A 3LK41 4CTDA 4O3YA 4AYNA 1Q9FA 3DWOX 3UU2A 4D64A 3AAEA 4GF4A 2X9KA 2YPVA 3POQA 4AYID 1GFNA 3SYSA 2X27X 2PORA 3BRZA 2XTRA 3AA1B 3WI5A 4GHBA 1QJ8A 3AA0A 3O0EA 4RJWA 2WJRA 4AKRB 2ZLDA 3DA4A 3SYBA 3SZVA 2FGQX 3G7GA 4D65A 5GTHO 3PQUA 3NJTA 3DZMA 3AA6A 5D5DA 5DL6A 3A0HO 5TISO 4QQ1A 4U9CA 2J1NA 3DWNA 4GCSA 4RJXA 2XE2A 2XTQA 3LK3B 4O4XA 4B61A 5DL8A 2XMXA 2K0LA 2WJQA 5AFUK 2PRNA 4K3BA 5JDPA 5G3AA 5ADXL 3A2SX 2KXPA 5E79O 5B66O 3AAEB 2R4LA 3POXA 2FGRA 5KAFO 1GFPA 2O4VA 4AYEC 3LK42 4UB8O 3QRCA 2Y7SA 3PRNA 4FESA 3PGRA 4KR4A 5KAIO 1ZHTA 2M07A 3AA0B 2F1TA 2W81C 2Y0LA 4AUIA 1QJ9A 1QJPA 3VY9X 3VZUX 2AXTO 4FT6A 5AFUL 5B5EO 1GFOA 4FZMA 2R8AA 4FRTA 1PHOA 3AA6B 4AYMC 5ADXK 2R89A 2M06A 1HXTA 4E1TA 2IWVA 2Y0KA 5DL7A 2R4NA 1T16A 2Y0HA 3NSGA 4GCPA 3VE1A 4LSHA 4AKMA 2XE1A 4LSFA 2KXPB 4FOZA 4JFBA 2LFUA 1IZNA 3GP6A 3LK2A 4C69X 4G75A 1BH3A 5G38A 3PORA 3AAAA 4LSIA 4N58A 3AA7A 2IWWA 1HXUA 1ZHZA 2GE4A 3DA3A 3KVDD 4N75A 4AZLA 4C00A 2F1CX 4IL6O 2MHLA 4KR8A 4O3XB 8PRNA 2N2MA 2XE5A 2JQYA 3HW9A 1ZHYA 3A0BO 5EE2A 5G26A 3PGSA 3RBHA 3VZWX 2R4PA 1YS5A 4E1SA 2ERVA 1OPFA 3SY7A 3PF1A 3JCUO 2N2LA 5PRNA 1S5LO 3PGUA 1ZHWA 4KRAA 4N59A 3WI4A 4O3WA 5FVNA 3TZGA 4RLBA 2KZ7A 2QTKA 2W80C 4AFKA 5G39A 3KZIO 2KDYA 5IYUA 5H2FO 4FQEA 3FYXA 1E54A 1IZNB 4FRXA 2R4OA 3LK2B 4JCHA 3C5OA 2ZFGA 4BUMX 3POUA 3SZDA 3BRYA 4FZLA 3T0SA 3HOLA 3AA7B 4Z3TA 1P4TA 1MPFA 3LK3A 7PRNA 5GTIO 1THQA 4FSOA 3QRAA 1ZHXA 4LSEA 4O4UA 1HXXA 3JTYA 4FUVA 4C4VA 4FMSA 3K19A 3PQSA 2MNHA 2KC0A 3UAQA 4D5UA 2Y2XA 5DL5A 4FSPA 1BXWA 4PR7A 3V8UA 1H6S1 4PJ0O 4RL9A 3VZTX 4G76A 4FZNA 5GV0A 4F4BA 2KZ7B 2K4TA 4GCQA 4XNKA 2F1VA 1Q9GA 3T20A 4PUXA 3HOEA 3VE2A 5T5FA 1OSMA 4N74A 2YNKA 3AA1A 3SY9A 6PRNA 1ORMA 1GFMA 4RLCA 4AYDC 2JMMA
chains in the Genus database with same CATH topology
4AKRA 1PRNA 3HWBA 2ODJA 1GFQA 4O3ZA 2XE3A 1G90A 3UPGA 3AAAB 2J4UP 4XNLA 1BT9A 2LHFA 3EMNX 2OMFA 3T24A 1MM4A 3VY8X 4O49A 1MM5A 2XG6A 3LK41 4O3YA 4AYNA 1Q9FA 3UU2A 4D64A 3AAEA 4GF4A 2YPVA 4AYID 3POQA 1GFNA 3SYSA 2X27X 2PORA 2XTRA 3AA1B 3WI5A 4GHBA 1QJ8A 3AA0A 3O0EA 4RJWA 4AKRB 2ZLDA 3DA4A 3SYBA 3SZVA 2FGQX 3G7GA 4D65A 3PQUA 3AA6A 5D5DA 5DL6A 4QQ1A 4U9CA 2J1NA 4GCSA 4RJXA 2XE2A 2XTQA 3LK3B 4O4XA 4B61A 5DL8A 2XMXA 2K0LA 5AFUK 2PRNA 5JDPA 5ADXL 3A2SX 2KXPA 3AAEB 3POXA 2FGRA 1GFPA 2O4VA 4AYEC 3LK42 3QRCA 2Y7SA 3PRNA 4FESA 4KR4A 1ZHTA 2M07A 3AA0B 2F1TA 2W81C 2Y0LA 4AUIA 1QJ9A 1QJPA 3VY9X 3VZUX 4FT6A 5AFUL 1GFOA 4FZMA 4FRTA 4AYMC 1PHOA 3AA6B 5ADXK 2M06A 1HXTA 4E1TA 2Y0KA 5DL7A 2Y0HA 3NSGA 3VE1A 4GCPA 4AKMA 4LSHA 2XE1A 4LSFA 2KXPB 4FOZA 4JFBA 2LFUA 1IZNA 3GP6A 3LK2A 4C69X 4G75A 1BH3A 3PORA 3AAAA 4LSIA 4N58A 3AA7A 1HXUA 1ZHZA 2GE4A 3DA3A 3KVDD 4AZLA 8PRNA 2MHLA 4KR8A 4O3XB 2N2MA 2XE5A 3HW9A 1ZHYA 5EE2A 5G26A 3VZWX 3RBHA 4E1SA 1YS5A 2ERVA 1OPFA 3SY7A 2N2LA 5PRNA 4KRAA 3WI4A 1ZHWA 4N59A 4O3WA 5FVNA 3TZGA 4RLBA 2KZ7A 2QTKA 2W80C 4AFKA 2KDYA 5IYUA 3FYXA 1E54A 1IZNB 4FRXA 3LK2B 4JCHA 4BUMX 3C5OA 2ZFGA 3POUA 3SZDA 4FZLA 3T0SA 3HOLA 3AA7B 4Z3TA 1P4TA 1MPFA 3LK3A 7PRNA 1THQA 4FSOA 3QRAA 1ZHXA 4LSEA 4O4UA 1HXXA 3JTYA 4FUVA 4FMSA 3K19A 3PQSA 2MNHA 2KC0A 3UAQA 4D5UA 2Y2XA 5DL5A 4FSPA 1BXWA 3V8UA 1H6S1 4RL9A 3VZTX 4G76A 4FZNA 5GV0A 4F4BA 2KZ7B 2K4TA 4GCQA 4XNKA 2F1VA 1Q9GA 3T20A 4PUXA 3HOEA 3VE2A 5T5FA 1OSMA 2YNKA 3AA1A 3SY9A 6PRNA 1ORMA 1GFMA 4RLCA 4AYDC 2JMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRN A;  3HWB A;  2ODJ A;  1GFQ A;  2XE3 A;  3UPG A;  2J4U P;  1BT9 A;  3EMN X;  2OMF A;  3T24 A;  3VY8 X;  2XG6 A;  3UU2 A;  4D64 A;  3POQ A;  1GFN A;  3SYS A;  2POR A;  3WI5 A;  3O0E A;  4RJW A;  2ZLD A;  3SYB A;  3SZV A;  2FGQ X;  4D65 A;  5DL6 A;  2J1N A;  4GCS A;  4RJX A;  2XE2 A;  5DL8 A;  2PRN A;  5JDP A;  3A2S X;  3POX A;  2FGR A;  1GFP A;  2O4V A;  4KR4 A;  3PRN A;  4AUI A;  2Y0L A;  3VZU X;  3VY9 X;  4FT6 A;  1GFO A;  4FRT A;  1PHO A;  1HXT A;  2Y0K A;  5DL7 A;  2Y0H A;  3NSG A;  4GCP A;  4LSH A;  2XE1 A;  4LSF A;  4FOZ A;  4JFB A;  4C69 X;  1BH3 A;  3POR A;  4LSI A;  1HXU A;  8PRN A;  4KR8 A;  2XE5 A;  3HW9 A;  3VZW X;  1OPF A;  3SY7 A;  5PRN A;  4KRA A;  3WI4 A;  5FVN A;  2QTK A;  3FYX A;  1E54 A;  4FRX A;  4BUM X;  2ZFG A;  3POU A;  3SZD A;  3T0S A;  1MPF A;  7PRN A;  4FSO A;  4LSE A;  1HXX A;  3JTY A;  4FMS A;  3K19 A;  4D5U A;  2Y2X A;  5DL5 A;  4FSP A;  1H6S 1;  3VZT X;  2K4T A;  4GCQ A;  3T20 A;  1OSM A;  3SY9 A;  6PRN A;  1GFM A; 
#chains in the Genus database with same CATH topology
 4AKR A;  1PRN A;  3WU2 O;  2WVP A;  4K3C A;  3HWB A;  2ODJ A;  1GFQ A;  2R88 A;  4O3Z A;  2XE3 A;  1G90 A;  3UPG A;  3AAA B;  4C4V B;  4UB6 O;  1BT9 A;  4XNL A;  2LHF A;  2J4U P;  1T1L A;  2OMF A;  3EMN X;  3T24 A;  1MM4 A;  3VY8 X;  4O49 A;  1MM5 A;  3BS0 A;  2XG6 A;  3LK4 1;  4CTD A;  4O3Y A;  4AYN A;  1Q9F A;  3DWO X;  3UU2 A;  4D64 A;  3AAE A;  4GF4 A;  2X9K A;  2YPV A;  3POQ A;  4AYI D;  1GFN A;  3SYS A;  2X27 X;  2POR A;  3BRZ A;  2XTR A;  3AA1 B;  3WI5 A;  4GHB A;  1QJ8 A;  3AA0 A;  3O0E A;  4RJW A;  2WJR A;  4AKR B;  2ZLD A;  3DA4 A;  3SYB A;  3SZV A;  2FGQ X;  3G7G A;  4D65 A;  5GTH O;  3PQU A;  3NJT A;  3DZM A;  3AA6 A;  5D5D A;  5DL6 A;  3A0H O;  5TIS O;  4QQ1 A;  4U9C A;  2J1N A;  3DWN A;  4GCS A;  4RJX A;  2XE2 A;  2XTQ A;  3LK3 B;  4O4X A;  4B61 A;  5DL8 A;  2XMX A;  2K0L A;  2WJQ A;  5AFU K;  2PRN A;  4K3B A;  5JDP A;  5G3A A;  5ADX L;  3A2S X;  2KXP A;  5E79 O;  5B66 O;  3AAE B;  2R4L A;  3POX A;  2FGR A;  5KAF O;  1GFP A;  2O4V A;  4AYE C;  3LK4 2;  4UB8 O;  3QRC A;  2Y7S A;  3PRN A;  4FES A;  3PGR A;  4KR4 A;  5KAI O;  1ZHT A;  2M07 A;  3AA0 B;  2F1T A;  2W81 C;  2Y0L A;  4AUI A;  1QJ9 A;  1QJP A;  3VY9 X;  3VZU X;  2AXT O;  4FT6 A;  5AFU L;  5B5E O;  1GFO A;  4FZM A;  2R8A A;  4FRT A;  1PHO A;  3AA6 B;  4AYM C;  5ADX K;  2R89 A;  2M06 A;  1HXT A;  4E1T A;  2IWV A;  2Y0K A;  5DL7 A;  2R4N A;  1T16 A;  2Y0H A;  3NSG A;  4GCP A;  3VE1 A;  4LSH A;  4AKM A;  2XE1 A;  4LSF A;  2KXP B;  4FOZ A;  4JFB A;  2LFU A;  1IZN A;  3GP6 A;  3LK2 A;  4C69 X;  4G75 A;  1BH3 A;  5G38 A;  3POR A;  3AAA A;  4LSI A;  4N58 A;  3AA7 A;  2IWW A;  1HXU A;  1ZHZ A;  2GE4 A;  3DA3 A;  3KVD D;  4N75 A;  4AZL A;  4C00 A;  2F1C X;  4IL6 O;  2MHL A;  4KR8 A;  4O3X B;  8PRN A;  2N2M A;  2XE5 A;  2JQY A;  3HW9 A;  1ZHY A;  3A0B O;  5EE2 A;  5G26 A;  3PGS A;  3RBH A;  3VZW X;  2R4P A;  1YS5 A;  4E1S A;  2ERV A;  1OPF A;  3SY7 A;  3PF1 A;  3JCU O;  2N2L A;  5PRN A;  1S5L O;  3PGU A;  1ZHW A;  4KRA A;  4N59 A;  3WI4 A;  4O3W A;  5FVN A;  3TZG A;  4RLB A;  2KZ7 A;  2QTK A;  2W80 C;  4AFK A;  5G39 A;  3KZI O;  2KDY A;  5IYU A;  5H2F O;  4FQE A;  3FYX A;  1E54 A;  1IZN B;  4FRX A;  2R4O A;  3LK2 B;  4JCH A;  3C5O A;  2ZFG A;  4BUM X;  3POU A;  3SZD A;  3BRY A;  4FZL A;  3T0S A;  3HOL A;  3AA7 B;  4Z3T A;  1P4T A;  1MPF A;  3LK3 A;  7PRN A;  5GTI O;  1THQ A;  4FSO A;  3QRA A;  1ZHX A;  4LSE A;  4O4U A;  1HXX A;  3JTY A;  4FUV A;  4C4V A;  4FMS A;  3K19 A;  3PQS A;  2MNH A;  2KC0 A;  3UAQ A;  4D5U A;  2Y2X A;  5DL5 A;  4FSP A;  1BXW A;  4PR7 A;  3V8U A;  1H6S 1;  4PJ0 O;  4RL9 A;  3VZT X;  4G76 A;  4FZN A;  5GV0 A;  4F4B A;  2KZ7 B;  2K4T A;  4GCQ A;  4XNK A;  2F1V A;  1Q9G A;  3T20 A;  4PUX A;  3HOE A;  3VE2 A;  5T5F A;  1OSM A;  4N74 A;  2YNK A;  3AA1 A;  3SY9 A;  6PRN A;  1ORM A;  1GFM A;  4RLC A;  4AYD C;  2JMM A; 
#chains in the Genus database with same CATH homology
 4AKR A;  1PRN A;  3HWB A;  2ODJ A;  1GFQ A;  4O3Z A;  2XE3 A;  1G90 A;  3UPG A;  3AAA B;  2J4U P;  4XNL A;  1BT9 A;  2LHF A;  3EMN X;  2OMF A;  3T24 A;  1MM4 A;  3VY8 X;  4O49 A;  1MM5 A;  2XG6 A;  3LK4 1;  4O3Y A;  4AYN A;  1Q9F A;  3UU2 A;  4D64 A;  3AAE A;  4GF4 A;  2YPV A;  4AYI D;  3POQ A;  1GFN A;  3SYS A;  2X27 X;  2POR A;  2XTR A;  3AA1 B;  3WI5 A;  4GHB A;  1QJ8 A;  3AA0 A;  3O0E A;  4RJW A;  4AKR B;  2ZLD A;  3DA4 A;  3SYB A;  3SZV A;  2FGQ X;  3G7G A;  4D65 A;  3PQU A;  3AA6 A;  5D5D A;  5DL6 A;  4QQ1 A;  4U9C A;  2J1N A;  4GCS A;  4RJX A;  2XE2 A;  2XTQ A;  3LK3 B;  4O4X A;  4B61 A;  5DL8 A;  2XMX A;  2K0L A;  5AFU K;  2PRN A;  5JDP A;  5ADX L;  3A2S X;  2KXP A;  3AAE B;  3POX A;  2FGR A;  1GFP A;  2O4V A;  4AYE C;  3LK4 2;  3QRC A;  2Y7S A;  3PRN A;  4FES A;  4KR4 A;  1ZHT A;  2M07 A;  3AA0 B;  2F1T A;  2W81 C;  2Y0L A;  4AUI A;  1QJ9 A;  1QJP A;  3VY9 X;  3VZU X;  4FT6 A;  5AFU L;  1GFO A;  4FZM A;  4FRT A;  4AYM C;  1PHO A;  3AA6 B;  5ADX K;  2M06 A;  1HXT A;  4E1T A;  2Y0K A;  5DL7 A;  2Y0H A;  3NSG A;  3VE1 A;  4GCP A;  4AKM A;  4LSH A;  2XE1 A;  4LSF A;  2KXP B;  4FOZ A;  4JFB A;  2LFU A;  1IZN A;  3GP6 A;  3LK2 A;  4C69 X;  4G75 A;  1BH3 A;  3POR A;  3AAA A;  4LSI A;  4N58 A;  3AA7 A;  1HXU A;  1ZHZ A;  2GE4 A;  3DA3 A;  3KVD D;  4AZL A;  8PRN A;  2MHL A;  4KR8 A;  4O3X B;  2N2M A;  2XE5 A;  3HW9 A;  1ZHY A;  5EE2 A;  5G26 A;  3VZW X;  3RBH A;  4E1S A;  1YS5 A;  2ERV A;  1OPF A;  3SY7 A;  2N2L A;  5PRN A;  4KRA A;  3WI4 A;  1ZHW A;  4N59 A;  4O3W A;  5FVN A;  3TZG A;  4RLB A;  2KZ7 A;  2QTK A;  2W80 C;  4AFK A;  2KDY A;  5IYU A;  3FYX A;  1E54 A;  1IZN B;  4FRX A;  3LK2 B;  4JCH A;  4BUM X;  3C5O A;  2ZFG A;  3POU A;  3SZD A;  4FZL A;  3T0S A;  3HOL A;  3AA7 B;  4Z3T A;  1P4T A;  1MPF A;  3LK3 A;  7PRN A;  1THQ A;  4FSO A;  3QRA A;  1ZHX A;  4LSE A;  4O4U A;  1HXX A;  3JTY A;  4FUV A;  4FMS A;  3K19 A;  3PQS A;  2MNH A;  2KC0 A;  3UAQ A;  4D5U A;  2Y2X A;  5DL5 A;  4FSP A;  1BXW A;  3V8U A;  1H6S 1;  4RL9 A;  3VZT X;  4G76 A;  4FZN A;  5GV0 A;  4F4B A;  2KZ7 B;  2K4T A;  4GCQ A;  4XNK A;  2F1V A;  1Q9G A;  3T20 A;  4PUX A;  3HOE A;  3VE2 A;  5T5F A;  1OSM A;  2YNK A;  3AA1 A;  3SY9 A;  6PRN A;  1ORM A;  1GFM A;  4RLC A;  4AYD C;  2JMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...