3PF1A

E. coli fadl asp348ala mutant
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
424
structure length
424
Chain Sequence
AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFADSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAFHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From the Cover: Ligand-gated diffusion across the bacterial outer membrane.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid transport
molecule keywords Long-chain fatty acid transport protein
total genus 117
structure length 424
sequence length 424
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3pf1A00
2R4LA 3PGRA 2R4PA 1T1LA 2R8AA 3BRZA 3BRYA 3PF1A 3BS0A 2R4OA 2R89A 3DWOX 3PGUA 3DWNA 2R88A 3PGSA 1T16A 2R4NA
chains in the Genus database with same CATH superfamily
2MNHA 3LK3A 4O3WA 4E1SA 4O49A 2GE4A 5GTIO 5B66O 3PGSA 4G76A 4FMSA 4O3XB 3WI4A 2XG6A 2R4PA 3C5OA 2Y0KA 4O3YA 5E79O 3SY9A 2AXTO 2M06A 4KR4A 4LSHA 3EMNX 2PORA 1GFNA 2W80C 3HWBA 1BH3A 4AKRB 2FGQX 5TISO 3LK2A 2KZ7A 3SZDA 4UB6O 1S5LO 3AAEA 3BRZA 4AFKA 6PRNA 5ADXL 2LFUA 1MPFA 3DA4A 3A0HO 3AAEB 4FSOA 5DL8A 4C4VA 3POXA 4D64A 4C69X 3JCUO 3JTYA 5JDPA 4KR8A 2MHLA 4JFBA 4FZLA 1G90A 1HXXA 4GCQA 2R4OA 2ODJA 3RBHA 3PQSA 3AA0B 4Z3TA 1QJPA 5T5FA 2W81C 1ZHXA 3HOEA 3PQUA 3UAQA 4C4VB 2F1VA 4CTDA 4U9CA 1QJ9A 3G7GA 3PGUA 1GFMA 4PUXA 4RL9A 1E54A 1Q9FA 2R4LA 5B5EO 2XMXA 3FYXA 2LHFA 1OSMA 4RJWA 2WJQA 1GFQA 2K0LA 2N2MA 3AA7A 2WJRA 3BS0A 4O3ZA 5EE2A 3VZTX 4AZLA 5H2FO 4FOZA 4G75A 2O4VA 5G38A 2IWVA 2X9KA 5GTHO 2J4UP 4FRTA 1MM4A 3PGRA 1T1LA 3VY9X 3DA3A 4JCHA 4LSEA 4F4BA 2K4TA 2XTQA 3K19A 4GCSA 5G39A 5DL5A 4AYNA 3TZGA 1GFOA 5KAFO 4FUVA 2R8AA 3AA6A 4AYID 2Y2XA 4AYDC 1BXWA 2Y7SA 8PRNA 4O4UA 5DL7A 3AA1A 5FVNA 2FGRA 2M07A 2N2LA 3GP6A 3LK2B 1ZHZA 3WU2O 2YPVA 3A2SX 1PHOA 3NSGA 3NJTA 4O4XA 1YS5A 3PF1A 3SZVA 4AYMC 5AFUL 2XE2A 3AAAA 4RLCA 1IZNA 3AA6B 3KVDD 2XE5A 3SYSA 1OPFA 2ZLDA 3WI5A 1HXUA 2F1TA 4B61A 2ERVA 2Y0HA 5ADXK 1ZHYA 1ORMA 4AYEC 3HOLA 3SY7A 4E1TA 1QJ8A 7PRNA 3AA7B 2YNKA 2Y0LA 4K3CA 2PRNA 4N59A 4PJ0O 2KZ7B 5AFUK 5G3AA 2KDYA 3T0SA 1ZHWA 5IYUA 4FZMA 4FESA 3VE2A 3A0BO 4KRAA 3DZMA 3V8UA 4PR7A 4FSPA 4RJXA 4XNKA 3LK41 5D5DA 2JMMA 4GF4A 4N58A 3VZUX 4N75A 3BRYA 4IL6O 3T20A 3DWOX 4FRXA 2XE1A 3PRNA 1GFPA 2J1NA 1H6S1 2R88A 3DWNA 3LK3B 2R4NA 2OMFA 3POQA 4GCPA 4XNLA 5PRNA 3UU2A 4D5UA 4GHBA 3KZIO 4AKRA 4UB8O 3T24A 3UPGA 1HXTA 4LSFA 5DL6A 1BT9A 4QQ1A 1P4TA 1PRNA 4C00A 4D65A 3O0EA 2XTRA 4BUMX 2F1CX 2IWWA 3QRAA 4N74A 3LK42 2JQYA 3AA0A 3PORA 3QRCA 1MM5A 2KXPA 1T16A 1THQA 3VE1A 3VZWX 2XE3A 3POUA 4FZNA 2KXPB 5KAIO 1IZNB 2WVPA 3AAAB 2R89A 5GV0A 4RLBA 4FQEA 4FT6A 2KC0A 5G26A 2QTKA 4AUIA 3VY8X 1Q9GA 4K3BA 1ZHTA 2X27X 2ZFGA 3AA1B 4LSIA 4AKMA 3HW9A 3SYBA
chains in the Genus database with same CATH topology
2R4LA 3PGRA 2R4PA 1T1LA 2R8AA 3BRZA 3BRYA 3PF1A 3BS0A 2R4OA 2R89A 3DWOX 3PGUA 3DWNA 2R88A 3PGSA 1T16A 2R4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4L A;  3PGR A;  2R4P A;  1T1L A;  2R8A A;  3BRZ A;  3BRY A;  3PF1 A;  3BS0 A;  2R4O A;  2R89 A;  3DWO X;  3PGU A;  3DWN A;  2R88 A;  3PGS A;  1T16 A;  2R4N A; 
#chains in the Genus database with same CATH topology
 2MNH A;  3LK3 A;  4O3W A;  4E1S A;  4O49 A;  2GE4 A;  5GTI O;  5B66 O;  3PGS A;  4G76 A;  4FMS A;  4O3X B;  3WI4 A;  2XG6 A;  2R4P A;  3C5O A;  2Y0K A;  4O3Y A;  5E79 O;  3SY9 A;  2AXT O;  2M06 A;  4KR4 A;  4LSH A;  3EMN X;  2POR A;  1GFN A;  2W80 C;  3HWB A;  1BH3 A;  4AKR B;  2FGQ X;  5TIS O;  3LK2 A;  2KZ7 A;  3SZD A;  4UB6 O;  1S5L O;  3AAE A;  3BRZ A;  4AFK A;  6PRN A;  5ADX L;  2LFU A;  1MPF A;  3DA4 A;  3A0H O;  3AAE B;  4FSO A;  5DL8 A;  4C4V A;  3POX A;  4D64 A;  4C69 X;  3JCU O;  3JTY A;  5JDP A;  4KR8 A;  2MHL A;  4JFB A;  4FZL A;  1G90 A;  1HXX A;  4GCQ A;  2R4O A;  2ODJ A;  3RBH A;  3PQS A;  3AA0 B;  4Z3T A;  1QJP A;  5T5F A;  2W81 C;  1ZHX A;  3HOE A;  3PQU A;  3UAQ A;  4C4V B;  2F1V A;  4CTD A;  4U9C A;  1QJ9 A;  3G7G A;  3PGU A;  1GFM A;  4PUX A;  4RL9 A;  1E54 A;  1Q9F A;  2R4L A;  5B5E O;  2XMX A;  3FYX A;  2LHF A;  1OSM A;  4RJW A;  2WJQ A;  1GFQ A;  2K0L A;  2N2M A;  3AA7 A;  2WJR A;  3BS0 A;  4O3Z A;  5EE2 A;  3VZT X;  4AZL A;  5H2F O;  4FOZ A;  4G75 A;  2O4V A;  5G38 A;  2IWV A;  2X9K A;  5GTH O;  2J4U P;  4FRT A;  1MM4 A;  3PGR A;  1T1L A;  3VY9 X;  3DA3 A;  4JCH A;  4LSE A;  4F4B A;  2K4T A;  2XTQ A;  3K19 A;  4GCS A;  5G39 A;  5DL5 A;  4AYN A;  3TZG A;  1GFO A;  5KAF O;  4FUV A;  2R8A A;  3AA6 A;  4AYI D;  2Y2X A;  4AYD C;  1BXW A;  2Y7S A;  8PRN A;  4O4U A;  5DL7 A;  3AA1 A;  5FVN A;  2FGR A;  2M07 A;  2N2L A;  3GP6 A;  3LK2 B;  1ZHZ A;  3WU2 O;  2YPV A;  3A2S X;  1PHO A;  3NSG A;  3NJT A;  4O4X A;  1YS5 A;  3PF1 A;  3SZV A;  4AYM C;  5AFU L;  2XE2 A;  3AAA A;  4RLC A;  1IZN A;  3AA6 B;  3KVD D;  2XE5 A;  3SYS A;  1OPF A;  2ZLD A;  3WI5 A;  1HXU A;  2F1T A;  4B61 A;  2ERV A;  2Y0H A;  5ADX K;  1ZHY A;  1ORM A;  4AYE C;  3HOL A;  3SY7 A;  4E1T A;  1QJ8 A;  7PRN A;  3AA7 B;  2YNK A;  2Y0L A;  4K3C A;  2PRN A;  4N59 A;  4PJ0 O;  2KZ7 B;  5AFU K;  5G3A A;  2KDY A;  3T0S A;  1ZHW A;  5IYU A;  4FZM A;  4FES A;  3VE2 A;  3A0B O;  4KRA A;  3DZM A;  3V8U A;  4PR7 A;  4FSP A;  4RJX A;  4XNK A;  3LK4 1;  5D5D A;  2JMM A;  4GF4 A;  4N58 A;  3VZU X;  4N75 A;  3BRY A;  4IL6 O;  3T20 A;  3DWO X;  4FRX A;  2XE1 A;  3PRN A;  1GFP A;  2J1N A;  1H6S 1;  2R88 A;  3DWN A;  3LK3 B;  2R4N A;  2OMF A;  3POQ A;  4GCP A;  4XNL A;  5PRN A;  3UU2 A;  4D5U A;  4GHB A;  3KZI O;  4AKR A;  4UB8 O;  3T24 A;  3UPG A;  1HXT A;  4LSF A;  5DL6 A;  1BT9 A;  4QQ1 A;  1P4T A;  1PRN A;  4C00 A;  4D65 A;  3O0E A;  2XTR A;  4BUM X;  2F1C X;  2IWW A;  3QRA A;  4N74 A;  3LK4 2;  2JQY A;  3AA0 A;  3POR A;  3QRC A;  1MM5 A;  2KXP A;  1T16 A;  1THQ A;  3VE1 A;  3VZW X;  2XE3 A;  3POU A;  4FZN A;  2KXP B;  5KAI O;  1IZN B;  2WVP A;  3AAA B;  2R89 A;  5GV0 A;  4RLB A;  4FQE A;  4FT6 A;  2KC0 A;  5G26 A;  2QTK A;  4AUI A;  3VY8 X;  1Q9G A;  4K3B A;  1ZHT A;  2X27 X;  2ZFG A;  3AA1 B;  4LSI A;  4AKM A;  3HW9 A;  3SYB A; 
#chains in the Genus database with same CATH homology
 2R4L A;  3PGR A;  2R4P A;  1T1L A;  2R8A A;  3BRZ A;  3BRY A;  3PF1 A;  3BS0 A;  2R4O A;  2R89 A;  3DWO X;  3PGU A;  3DWN A;  2R88 A;  3PGS A;  1T16 A;  2R4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...