3PF1A

E. coli fadl asp348ala mutant
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
424
structure length
424
Chain Sequence
b'AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFADSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAFHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Long-chain fatty acid transport protein
publication title From the Cover: Ligand-gated diffusion across the bacterial outer membrane.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid transport
total genus 117
structure length 424
sequence length 424
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3pf1A00
3PGRA 2R8AA 1T16A 3DWNA 3BRYA 2R4OA 3PF1A 2R4PA 3DWOX 2R4NA 3BRZA 3PGUA 3BS0A 2R88A 2R89A 3PGSA 2R4LA 1T1LA
chains in the Genus database with same CATH superfamily
1H6S1 3PF1A 5G39A 3V8UA 5AFUK 3UU2A 2R4NA 1BH3A 3GP6A 3SY7A 4BUMX 3BRZA 2WJRA 4FRXA 3VZUX 4O4XA 2J1NA 2YNKA 3LK42 5ADXL 4FOZA 4IL6O 1ZHZA 2J4UP 5EE2A 2JQYA 4AYNA 4K3CA 2ZFGA 5PRNA 4N75A 4AYEC 2N2MA 4C00A 1BXWA 3AA1B 2XE2A 2XMXA 3KZIO 5DL5A 3SZDA 3BS0A 2W81C 2R4LA 4RJXA 4AUIA 1T1LA 3A0BO 2PORA 4GCQA 5G3AA 4N59A 1HXTA 3AA1A 4AKMA 4LSIA 4QQ1A 4LSEA 3T24A 1ORMA 3HW9A 4Z3TA 3AAAB 3KVDD 1ZHTA 4D65A 3PQUA 4GHBA 4N58A 3A0HO 2KZ7B 1P4TA 2Y0KA 4FT6A 4KR8A 4O3ZA 1G90A 3LK2B 5IYUA 4GCSA 4C4VB 1PHOA 3AAAA 3K19A 4FQEA 1GFQA 2IWWA 2WVPA 5DL6A 3PRNA 4AYDC 3HOLA 4E1TA 1HXUA 4FUVA 4G76A 4CTDA 2KZ7A 3LK3B 1OSMA 5FVNA 2R88A 2XE1A 1S5LO 3AA0B 3LK2A 4C4VA 1BT9A 2AXTO 2ZLDA 6PRNA 1ZHWA 2F1CX 2PRNA 3DWNA 3DZMA 2FGQX 3HWBA 4N74A 3WI5A 4FSPA 3WU2O 2ERVA 3LK3A 3JTYA 3POUA 1HXXA 2YPVA 3AA0A 2IWVA 4FZNA 4G75A 4O3YA 1MM4A 4PR7A 5TISO 3VE1A 5GTHO 4RL9A 2X9KA 4FESA 2F1VA 2MHLA 3VE2A 4C69X 5DL7A 2WJQA 1GFOA 2KXPB 3DA3A 2GE4A 8PRNA 2LHFA 3C5OA 4AKRB 1QJ8A 1E54A 5ADXK 1IZNB 5KAFO 2X27X 2KC0A 2F1TA 5B66O 5T5FA 2KXPA 1PRNA 4GF4A 3VZTX 1GFMA 2R8AA 4KR4A 4AKRA 1YS5A 5GTIO 4O3XB 1IZNA 5AFUL 7PRNA 1QJPA 3PORA 5GV0A 4LSFA 3AA7B 3G7GA 5G26A 1OPFA 3DA4A 3PQSA 5DL8A 3SYBA 4B61A 4D64A 4UB8O 3SYSA 3QRCA 2XE3A 4RJWA 2O4VA 1ZHYA 4K3BA 3POXA 3DWOX 3VY9X 3NSGA 3AA7A 4O3WA 2LFUA 1THQA 2KDYA 1QJ9A 4GCPA 4JFBA 5H2FO 4PJ0O 4FZMA 4AZLA 1Q9GA 3POQA 4JCHA 2R4PA 3UPGA 2OMFA 1GFPA 2M07A 2QTKA 4RLCA 1MPFA 3SZVA 4AYMC 3SY9A 2MNHA 1T16A 1ZHXA 2W80C 1GFNA 2Y0HA 2FGRA 3FYXA 3NJTA 3AA6B 4RLBA 4D5UA 2XTRA 4LSHA 3PGUA 2Y2XA 2R89A 3EMNX 5KAIO 3JCUO 3TZGA 3RBHA 4KRAA 4AYID 2XE5A 2XTQA 4FZLA 1Q9FA 2ODJA 3BRYA 2Y7SA 2K0LA 3AA6A 3A2SX 3HOEA 4XNKA 4XNLA 5D5DA 5JDPA 3PGSA 2M06A 3VY8X 3PGRA 4E1SA 3VZWX 2N2LA 2R4OA 3UAQA 2JMMA 4F4BA 5G38A 4O4UA 3O0EA 3AAEB 4FSOA 4PUXA 4FMSA 4AFKA 3QRAA 1MM5A 4UB6O 4FRTA 5B5EO 4U9CA 5E79O 3AAEA 2Y0LA 3T20A 3LK41 2XG6A 2K4TA 4O49A 3WI4A 3T0SA
chains in the Genus database with same CATH topology
3PGRA 2R8AA 1T16A 3DWNA 3BRYA 2R4OA 3PF1A 2R4PA 3DWOX 2R4NA 3BRZA 3PGUA 3BS0A 2R88A 2R89A 3PGSA 2R4LA 1T1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PGR A;  2R8A A;  1T16 A;  3DWN A;  3BRY A;  2R4O A;  3PF1 A;  2R4P A;  3DWO X;  2R4N A;  3BRZ A;  3PGU A;  3BS0 A;  2R88 A;  2R89 A;  3PGS A;  2R4L A;  1T1L A; 
#chains in the Genus database with same CATH topology
 1H6S 1;  3PF1 A;  5G39 A;  3V8U A;  5AFU K;  3UU2 A;  2R4N A;  1BH3 A;  3GP6 A;  3SY7 A;  4BUM X;  3BRZ A;  2WJR A;  4FRX A;  3VZU X;  4O4X A;  2J1N A;  2YNK A;  3LK4 2;  5ADX L;  4FOZ A;  4IL6 O;  1ZHZ A;  2J4U P;  5EE2 A;  2JQY A;  4AYN A;  4K3C A;  2ZFG A;  5PRN A;  4N75 A;  4AYE C;  2N2M A;  4C00 A;  1BXW A;  3AA1 B;  2XE2 A;  2XMX A;  3KZI O;  5DL5 A;  3SZD A;  3BS0 A;  2W81 C;  2R4L A;  4RJX A;  4AUI A;  1T1L A;  3A0B O;  2POR A;  4GCQ A;  5G3A A;  4N59 A;  1HXT A;  3AA1 A;  4AKM A;  4LSI A;  4QQ1 A;  4LSE A;  3T24 A;  1ORM A;  3HW9 A;  4Z3T A;  3AAA B;  3KVD D;  1ZHT A;  4D65 A;  3PQU A;  4GHB A;  4N58 A;  3A0H O;  2KZ7 B;  1P4T A;  2Y0K A;  4FT6 A;  4KR8 A;  4O3Z A;  1G90 A;  3LK2 B;  5IYU A;  4GCS A;  4C4V B;  1PHO A;  3AAA A;  3K19 A;  4FQE A;  1GFQ A;  2IWW A;  2WVP A;  5DL6 A;  3PRN A;  4AYD C;  3HOL A;  4E1T A;  1HXU A;  4FUV A;  4G76 A;  4CTD A;  2KZ7 A;  3LK3 B;  1OSM A;  5FVN A;  2R88 A;  2XE1 A;  1S5L O;  3AA0 B;  3LK2 A;  4C4V A;  1BT9 A;  2AXT O;  2ZLD A;  6PRN A;  1ZHW A;  2F1C X;  2PRN A;  3DWN A;  3DZM A;  2FGQ X;  3HWB A;  4N74 A;  3WI5 A;  4FSP A;  3WU2 O;  2ERV A;  3LK3 A;  3JTY A;  3POU A;  1HXX A;  2YPV A;  3AA0 A;  2IWV A;  4FZN A;  4G75 A;  4O3Y A;  1MM4 A;  4PR7 A;  5TIS O;  3VE1 A;  5GTH O;  4RL9 A;  2X9K A;  4FES A;  2F1V A;  2MHL A;  3VE2 A;  4C69 X;  5DL7 A;  2WJQ A;  1GFO A;  2KXP B;  3DA3 A;  2GE4 A;  8PRN A;  2LHF A;  3C5O A;  4AKR B;  1QJ8 A;  1E54 A;  5ADX K;  1IZN B;  5KAF O;  2X27 X;  2KC0 A;  2F1T A;  5B66 O;  5T5F A;  2KXP A;  1PRN A;  4GF4 A;  3VZT X;  1GFM A;  2R8A A;  4KR4 A;  4AKR A;  1YS5 A;  5GTI O;  4O3X B;  1IZN A;  5AFU L;  7PRN A;  1QJP A;  3POR A;  5GV0 A;  4LSF A;  3AA7 B;  3G7G A;  5G26 A;  1OPF A;  3DA4 A;  3PQS A;  5DL8 A;  3SYB A;  4B61 A;  4D64 A;  4UB8 O;  3SYS A;  3QRC A;  2XE3 A;  4RJW A;  2O4V A;  1ZHY A;  4K3B A;  3POX A;  3DWO X;  3VY9 X;  3NSG A;  3AA7 A;  4O3W A;  2LFU A;  1THQ A;  2KDY A;  1QJ9 A;  4GCP A;  4JFB A;  5H2F O;  4PJ0 O;  4FZM A;  4AZL A;  1Q9G A;  3POQ A;  4JCH A;  2R4P A;  3UPG A;  2OMF A;  1GFP A;  2M07 A;  2QTK A;  4RLC A;  1MPF A;  3SZV A;  4AYM C;  3SY9 A;  2MNH A;  1T16 A;  1ZHX A;  2W80 C;  1GFN A;  2Y0H A;  2FGR A;  3FYX A;  3NJT A;  3AA6 B;  4RLB A;  4D5U A;  2XTR A;  4LSH A;  3PGU A;  2Y2X A;  2R89 A;  3EMN X;  5KAI O;  3JCU O;  3TZG A;  3RBH A;  4KRA A;  4AYI D;  2XE5 A;  2XTQ A;  4FZL A;  1Q9F A;  2ODJ A;  3BRY A;  2Y7S A;  2K0L A;  3AA6 A;  3A2S X;  3HOE A;  4XNK A;  4XNL A;  5D5D A;  5JDP A;  3PGS A;  2M06 A;  3VY8 X;  3PGR A;  4E1S A;  3VZW X;  2N2L A;  2R4O A;  3UAQ A;  2JMM A;  4F4B A;  5G38 A;  4O4U A;  3O0E A;  3AAE B;  4FSO A;  4PUX A;  4FMS A;  4AFK A;  3QRA A;  1MM5 A;  4UB6 O;  4FRT A;  5B5E O;  4U9C A;  5E79 O;  3AAE A;  2Y0L A;  3T20 A;  3LK4 1;  2XG6 A;  2K4T A;  4O49 A;  3WI4 A;  3T0S A; 
#chains in the Genus database with same CATH homology
 3PGR A;  2R8A A;  1T16 A;  3DWN A;  3BRY A;  2R4O A;  3PF1 A;  2R4P A;  3DWO X;  2R4N A;  3BRZ A;  3PGU A;  3BS0 A;  2R88 A;  2R89 A;  3PGS A;  2R4L A;  1T1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...