3PF1A

E. coli fadl asp348ala mutant
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
424
structure length
424
Chain Sequence
AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFADSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAFHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords Long-chain fatty acid transport protein
publication title From the Cover: Ligand-gated diffusion across the bacterial outer membrane.
pubmed doi rcsb
source organism Escherichia coli
total genus 117
structure length 424
sequence length 424
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3pf1A00
2R4PA 1T16A 2R4OA 3BS0A 2R4NA 1T1LA 3PGUA 3DWOX 2R4LA 3BRZA 3PF1A 2R88A 3DWNA 3BRYA 2R89A 3PGRA 2R8AA 3PGSA
chains in the Genus database with same CATH superfamily
3PQSA 4K3BA 3VY8X 4RL9A 2ZLDA 2W81C 1QJPA 4C4VB 2OMFA 4AYMC 4N58A 3POXA 2R88A 3JCUO 4AKRA 4F4BA 3O0EA 3QRAA 3LK41 1BT9A 2WJQA 3EMNX 3HOEA 4LSIA 4LSHA 4O49A 4D65A 5AFUL 1BH3A 4GF4A 1P4TA 2LFUA 2XTRA 3AAEB 1ZHWA 3LK3B 3WU2O 3WI4A 2MNHA 4UB6O 4FSOA 4FT6A 2PRNA 2R4NA 1BXWA 1QJ9A 2IWVA 2KZ7B 2XE5A 4FSPA 5ADXK 5G3AA 2YNKA 4LSFA 3PGSA 3VZUX 1ZHZA 2XE1A 3AAEA 3UAQA 2PORA 1ZHXA 3AA6B 3DWOX 4KR8A 3PQUA 3BRZA 3NJTA 4UB8O 3GP6A 5G39A 2K0LA 4BUMX 4O4XA 5JDPA 3T20A 3UU2A 3KVDD 4G76A 1IZNB 4GCSA 3DWNA 4O3WA 4FMSA 3AA0A 3JTYA 2XE2A 4AUIA 5ADXL 2Y0HA 4GCQA 3AA1A 2F1TA 2MHLA 2XMXA 3UPGA 1HXTA 1ZHYA 2AXTO 4FZLA 3BRYA 3POQA 3POUA 5EE2A 1THQA 3G7GA 3VZTX 1QJ8A 4AFKA 4FRXA 4C4VA 5IYUA 3NSGA 3QRCA 3V8UA 1T16A 2Y2XA 3AA7B 4D64A 5G38A 2O4VA 3DA4A 2N2LA 2Y0LA 1MPFA 1PHOA 4XNLA 1S5LO 1Q9FA 2XE3A 4PUXA 3SYSA 2KDYA 5G26A 3VE2A 4C00A 4FQEA 5T5FA 1GFQA 3VE1A 3LK3A 4N75A 4U9CA 3RBHA 1Q9GA 1E54A 3LK42 3KZIO 4D5UA 2W80C 5KAIO 2KZ7A 3LK2B 1GFOA 4O3ZA 4RLBA 5H2FO 1PRNA 2F1CX 4QQ1A 4RLCA 5FVNA 5D5DA 5GTIO 3SY9A 4Z3TA 5GV0A 2R8AA 3FYXA 3SZDA 4IL6O 4FESA 4JCHA 4K3CA 2XTQA 5KAFO 6PRNA 2JQYA 2ZFGA 3A2SX 3AA6A 3BS0A 1T1LA 7PRNA 5DL5A 4E1TA 3AAAB 4RJXA 3PF1A 3DA3A 5B5EO 4AYID 2KC0A 2Y7SA 3LK2A 4FUVA 4O4UA 2QTKA 4AYEC 4AZLA 2J4UP 2YPVA 4JFBA 1IZNA 3PGUA 5TISO 1GFNA 1OPFA 2M06A 2WVPA 3C5OA 4PJ0O 5E79O 2KXPB 2R89A 4KRAA 2WJRA 3HOLA 4O3XB 2J1NA 4E1SA 3HWBA 2GE4A 3TZGA 4O3YA 3A0BO 1ORMA 2F1VA 2ODJA 3A0HO 3HW9A 4FZNA 5DL7A 4KR4A 3T24A 1ZHTA 4XNKA 1MM4A 3AA7A 1YS5A 2XG6A 2R4PA 4FZMA 2N2MA 2Y0KA 2KXPA 2ERVA 4AYNA 1G90A 3WI5A 2IWWA 3VY9X 2K4TA 5B66O 3SY7A 1MM5A 2FGQX 3K19A 4C69X 8PRNA 4LSEA 4AYDC 1HXUA 3VZWX 2FGRA 3PORA 4B61A 3SYBA 2R4LA 4N59A 1GFMA 3PGRA 4PR7A 3SZVA 4GHBA 2LHFA 1OSMA 4N74A 1GFPA 3T0SA 1HXXA 2X9KA 5DL6A 4G75A 4RJWA 2X27X 5GTHO 5PRNA 5AFUK 5DL8A 4AKMA 4AKRB 3AA0B 2R4OA 3DZMA 3AAAA 4GCPA 3AA1B 3PRNA 2M07A 4CTDA 4FOZA 4FRTA 2JMMA 1H6S1
chains in the Genus database with same CATH topology
2R4PA 1T16A 2R4OA 3BS0A 2R4NA 1T1LA 3PGUA 3DWOX 2R4LA 3BRZA 3PF1A 2R88A 3DWNA 3BRYA 2R89A 3PGRA 2R8AA 3PGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4P A;  1T16 A;  2R4O A;  3BS0 A;  2R4N A;  1T1L A;  3PGU A;  3DWO X;  2R4L A;  3BRZ A;  3PF1 A;  2R88 A;  3DWN A;  3BRY A;  2R89 A;  3PGR A;  2R8A A;  3PGS A; 
#chains in the Genus database with same CATH topology
 3PQS A;  4K3B A;  3VY8 X;  4RL9 A;  2ZLD A;  2W81 C;  1QJP A;  4C4V B;  2OMF A;  4AYM C;  4N58 A;  3POX A;  2R88 A;  3JCU O;  4AKR A;  4F4B A;  3O0E A;  3QRA A;  3LK4 1;  1BT9 A;  2WJQ A;  3EMN X;  3HOE A;  4LSI A;  4LSH A;  4O49 A;  4D65 A;  5AFU L;  1BH3 A;  4GF4 A;  1P4T A;  2LFU A;  2XTR A;  3AAE B;  1ZHW A;  3LK3 B;  3WU2 O;  3WI4 A;  2MNH A;  4UB6 O;  4FSO A;  4FT6 A;  2PRN A;  2R4N A;  1BXW A;  1QJ9 A;  2IWV A;  2KZ7 B;  2XE5 A;  4FSP A;  5ADX K;  5G3A A;  2YNK A;  4LSF A;  3PGS A;  3VZU X;  1ZHZ A;  2XE1 A;  3AAE A;  3UAQ A;  2POR A;  1ZHX A;  3AA6 B;  3DWO X;  4KR8 A;  3PQU A;  3BRZ A;  3NJT A;  4UB8 O;  3GP6 A;  5G39 A;  2K0L A;  4BUM X;  4O4X A;  5JDP A;  3T20 A;  3UU2 A;  3KVD D;  4G76 A;  1IZN B;  4GCS A;  3DWN A;  4O3W A;  4FMS A;  3AA0 A;  3JTY A;  2XE2 A;  4AUI A;  5ADX L;  2Y0H A;  4GCQ A;  3AA1 A;  2F1T A;  2MHL A;  2XMX A;  3UPG A;  1HXT A;  1ZHY A;  2AXT O;  4FZL A;  3BRY A;  3POQ A;  3POU A;  5EE2 A;  1THQ A;  3G7G A;  3VZT X;  1QJ8 A;  4AFK A;  4FRX A;  4C4V A;  5IYU A;  3NSG A;  3QRC A;  3V8U A;  1T16 A;  2Y2X A;  3AA7 B;  4D64 A;  5G38 A;  2O4V A;  3DA4 A;  2N2L A;  2Y0L A;  1MPF A;  1PHO A;  4XNL A;  1S5L O;  1Q9F A;  2XE3 A;  4PUX A;  3SYS A;  2KDY A;  5G26 A;  3VE2 A;  4C00 A;  4FQE A;  5T5F A;  1GFQ A;  3VE1 A;  3LK3 A;  4N75 A;  4U9C A;  3RBH A;  1Q9G A;  1E54 A;  3LK4 2;  3KZI O;  4D5U A;  2W80 C;  5KAI O;  2KZ7 A;  3LK2 B;  1GFO A;  4O3Z A;  4RLB A;  5H2F O;  1PRN A;  2F1C X;  4QQ1 A;  4RLC A;  5FVN A;  5D5D A;  5GTI O;  3SY9 A;  4Z3T A;  5GV0 A;  2R8A A;  3FYX A;  3SZD A;  4IL6 O;  4FES A;  4JCH A;  4K3C A;  2XTQ A;  5KAF O;  6PRN A;  2JQY A;  2ZFG A;  3A2S X;  3AA6 A;  3BS0 A;  1T1L A;  7PRN A;  5DL5 A;  4E1T A;  3AAA B;  4RJX A;  3PF1 A;  3DA3 A;  5B5E O;  4AYI D;  2KC0 A;  2Y7S A;  3LK2 A;  4FUV A;  4O4U A;  2QTK A;  4AYE C;  4AZL A;  2J4U P;  2YPV A;  4JFB A;  1IZN A;  3PGU A;  5TIS O;  1GFN A;  1OPF A;  2M06 A;  2WVP A;  3C5O A;  4PJ0 O;  5E79 O;  2KXP B;  2R89 A;  4KRA A;  2WJR A;  3HOL A;  4O3X B;  2J1N A;  4E1S A;  3HWB A;  2GE4 A;  3TZG A;  4O3Y A;  3A0B O;  1ORM A;  2F1V A;  2ODJ A;  3A0H O;  3HW9 A;  4FZN A;  5DL7 A;  4KR4 A;  3T24 A;  1ZHT A;  4XNK A;  1MM4 A;  3AA7 A;  1YS5 A;  2XG6 A;  2R4P A;  4FZM A;  2N2M A;  2Y0K A;  2KXP A;  2ERV A;  4AYN A;  1G90 A;  3WI5 A;  2IWW A;  3VY9 X;  2K4T A;  5B66 O;  3SY7 A;  1MM5 A;  2FGQ X;  3K19 A;  4C69 X;  8PRN A;  4LSE A;  4AYD C;  1HXU A;  3VZW X;  2FGR A;  3POR A;  4B61 A;  3SYB A;  2R4L A;  4N59 A;  1GFM A;  3PGR A;  4PR7 A;  3SZV A;  4GHB A;  2LHF A;  1OSM A;  4N74 A;  1GFP A;  3T0S A;  1HXX A;  2X9K A;  5DL6 A;  4G75 A;  4RJW A;  2X27 X;  5GTH O;  5PRN A;  5AFU K;  5DL8 A;  4AKM A;  4AKR B;  3AA0 B;  2R4O A;  3DZM A;  3AAA A;  4GCP A;  3AA1 B;  3PRN A;  2M07 A;  4CTD A;  4FOZ A;  4FRT A;  2JMM A;  1H6S 1; 
#chains in the Genus database with same CATH homology
 2R4P A;  1T16 A;  2R4O A;  3BS0 A;  2R4N A;  1T1L A;  3PGU A;  3DWO X;  2R4L A;  3BRZ A;  3PF1 A;  2R88 A;  3DWN A;  3BRY A;  2R89 A;  3PGR A;  2R8A A;  3PGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...