4JFBA

Crystal structure of ompf in c2 with tncs
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
340
structure length
340
Chain Sequence
b'AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein F
publication title Stubborn contaminants: influence of detergents on the purity of the multidrug ABC transporter BmrA
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 92
structure length 340
sequence length 340
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4jfbA00
4FOZA 2QTKA 2XE2A 3O0EA 2FGRA 4GCQA 4LSFA 5DL7A 8PRNA 6PRNA 2XG6A 4LSIA 3POQA 3SZVA 2Y2XA 1HXXA 4FSOA 3JTYA 3SZDA 4KR8A 1GFPA 4FT6A 4FRTA 4FRXA 2J4UP 3POXA 2ODJA 3PORA 3SY7A 4BUMX 1HXTA 3VZTX 3SYSA 4AUIA 2J1NA 2Y0HA 2Y0LA 7PRNA 3T20A 1OPFA 1MPFA 5DL5A 4FSPA 3HWBA 4RJXA 1PRNA 5PRNA 4LSEA 4KR4A 2OMFA 2XE1A 4GCPA 3VY9X 3VZUX 2FGQX 4C69X 5DL6A 3PRNA 1GFQA 1GFMA 5DL8A 2K4TA 3K19A 3HW9A 1H6S1 4GCSA 4D65A 4RJWA 3VY8X 3WI4A 2Y0KA 1PHOA 1BH3A 4D5UA 3VZWX 2PRNA 4LSHA 2O4VA 4FMSA 1HXUA 2XE3A 4D64A 3T24A 3A2SX 2PORA 4KRAA 3FYXA 3WI5A 1OSMA 3SY9A 1E54A 2ZFGA 5JDPA 1GFOA 1GFNA 5FVNA 3T0SA 3EMNX 4JFBA 3SYBA 2XE5A 3UPGA 2ZLDA 3POUA 1BT9A 3UU2A 3NSGA
chains in the Genus database with same CATH superfamily
1S5LO 4FOZA 2N2MA 3LK2A 5H2FO 4FZLA 4GF4A 4RLBA 2QTKA 3NJTA 3VY9X 4O4XA 5TISO 3BRYA 2XE2A 3PQSA 2GE4A 2R4OA 1BXWA 2X27X 2F1TA 2FGRA 3O0EA 4O3WA 4GCQA 4LSFA 5DL7A 8PRNA 6PRNA 2R89A 1QJPA 2XG6A 2JQYA 3PGSA 3V8UA 3PGRA 4LSIA 1IZNB 3POQA 4AFKA 1MM5A 4O3XB 4FQEA 1ZHWA 4PR7A 3SZVA 2Y2XA 3DWNA 5B5EO 1HXXA 4AKRB 2JMMA 3JTYA 2WJRA 4FSOA 4KR8A 2MHLA 3DZMA 3SZDA 1GFPA 4FT6A 4N58A 4C4VB 2R88A 1ZHZA 5GTIO 2R8AA 4FRTA 3VE2A 4N74A 4FRXA 3DWOX 1T1LA 4O4UA 2LHFA 2YNKA 3AA6A 2KZ7B 2J4UP 3POXA 4G76A 2ODJA 4PJ0O 4XNKA 3BRZA 3KVDD 4QQ1A 3VZUX 2R4LA 3PORA 5AFUL 1ZHYA 4F4BA 2KXPA 3SY7A 2F1CX 2R4PA 3GP6A 1HXTA 3DA4A 3A0HO 3VZTX 3SYSA 4AUIA 1QJ8A 4BUMX 3AA7A 3AA1B 4AZLA 2J1NA 2Y0HA 3LK3B 2Y0LA 4UB8O 7PRNA 3HOLA 2W81C 3AAEA 1ORMA 3T20A 4K3CA 2WJQA 1OPFA 2M06A 5E79O 1MPFA 3LK2B 5DL5A 2KC0A 4FSPA 4B61A 5ADXL 3AAAA 2WVPA 4O3ZA 4PUXA 3HWBA 2KXPB 3QRAA 4RL9A 5IYUA 1Q9GA 4RJXA 1PRNA 4N59A 5PRNA 3UAQA 4FESA 2IWVA 2ERVA 2OMFA 2XE1A 4GCPA 4KR4A 4LSEA 2FGQX 5G26A 3AAEB 2X9KA 3JCUO 4GHBA 5DL6A 5KAFO 5KAIO 4AYEC 3PRNA 4AYMC 2XTQA 1GFQA 1GFMA 1THQA 5DL8A 2K4TA 3DA3A 3HW9A 3K19A 1H6S1 2IWWA 2K0LA 4GCSA 3PGUA 4D65A 2F1VA 4RLCA 1YS5A 2Y7SA 2W80C 4RJWA 3VY8X 4CTDA 3AA0A 3A0BO 2AXTO 3WI4A 2Y0KA 1PHOA 1BH3A 2XMXA 3AA6B 4AYID 3VZWX 4D5UA 2PRNA 3LK42 4Z3TA 4LSHA 2O4VA 1ZHXA 5GTHO 4FMSA 2KDYA 5AFUK 1HXUA 2XE3A 2YPVA 3C5OA 4FZNA 4K3BA 3LK41 4D64A 5G3AA 3T24A 4O3YA 3A2SX 2PORA 4JCHA 4UB6O 3AA7B 4O49A 4KRAA 4AKRA 3AA0B 4C4VA 3FYXA 5T5FA 4U9CA 3WI5A 4AKMA 5G39A 1OSMA 3HOEA 1P4TA 3QRCA 3SY9A 4N75A 4E1TA 4AYDC 3PF1A 1E54A 4IL6O 1MM4A 4E1SA 2ZFGA 1T16A 2KZ7A 3AAAB 3UU2A 1GFOA 5ADXK 4FZMA 3G7GA 1GFNA 5FVNA 3T0SA 5JDPA 3NSGA 3EMNX 1QJ9A 4JFBA 5EE2A 3SYBA 1G90A 3BS0A 2XE5A 4C00A 3UPGA 3RBHA 2R4NA 5G38A 1ZHTA 3TZGA 2XTRA 4XNLA 4C69X 2LFUA 2ZLDA 4AYNA 2N2LA 3AA1A 3LK3A 4FUVA 3POUA 3VE1A 5D5DA 3WU2O 5B66O 1IZNA 1BT9A 4G75A 3PQUA 1Q9FA 5GV0A 2M07A 3KZIO 2MNHA
chains in the Genus database with same CATH topology
4FOZA 2N2MA 3LK2A 4FZLA 4GF4A 4RLBA 2QTKA 4O4XA 2XE2A 3PQSA 2GE4A 1BXWA 2X27X 2F1TA 2FGRA 3O0EA 4O3WA 4GCQA 4LSFA 5DL7A 8PRNA 6PRNA 1QJPA 2XG6A 3V8UA 4LSIA 1IZNB 3POQA 4AFKA 1MM5A 4O3XB 1ZHWA 3SZVA 2Y2XA 1HXXA 4AKRB 2JMMA 3JTYA 4FSOA 3SZDA 4KR8A 2MHLA 1GFPA 4FT6A 4N58A 1ZHZA 4FRTA 3VE2A 4FRXA 4O4UA 2LHFA 2YNKA 3AA6A 2KZ7B 2J4UP 3POXA 4G76A 2ODJA 4XNKA 3KVDD 4QQ1A 3VZUX 3PORA 5AFUL 1ZHYA 4F4BA 2KXPA 3SY7A 4BUMX 3GP6A 1HXTA 3DA4A 3VZTX 3SYSA 4AUIA 1QJ8A 3AA7A 3AA1B 4AZLA 2J1NA 2Y0HA 3LK3B 2Y0LA 7PRNA 3HOLA 2W81C 3AAEA 1ORMA 3T20A 1OPFA 2M06A 1MPFA 3LK2B 5DL5A 2KC0A 4FSPA 4B61A 5ADXL 3AAAA 4O3ZA 4PUXA 3HWBA 2KXPB 3QRAA 4RL9A 5IYUA 1Q9GA 4RJXA 1PRNA 4N59A 5PRNA 3UAQA 4FESA 4LSEA 2ERVA 2OMFA 2XE1A 4GCPA 4KR4A 5G26A 2FGQX 3VY9X 3AAEB 4C69X 4GHBA 5DL6A 4AYEC 3PRNA 4AYMC 2XTQA 1GFQA 1GFMA 1THQA 5DL8A 2K4TA 3DA3A 3HW9A 3K19A 1H6S1 2K0LA 4GCSA 4D65A 2F1VA 4RLCA 1YS5A 2Y7SA 2W80C 4RJWA 3VY8X 3AA0A 3WI4A 2Y0KA 1PHOA 1BH3A 2XMXA 3AA6B 4AYID 3VZWX 4D5UA 2PRNA 3LK42 4Z3TA 4LSHA 2O4VA 1ZHXA 4FMSA 2KDYA 5AFUK 1HXUA 2XE3A 2YPVA 3C5OA 4FZNA 3LK41 4D64A 3T24A 4O3YA 3A2SX 2PORA 4JCHA 3AA7B 4O49A 4KRAA 4AKRA 3AA0B 3FYXA 5T5FA 4U9CA 3WI5A 4AKMA 1OSMA 3HOEA 1P4TA 3QRCA 3SY9A 4E1TA 4AYDC 1E54A 1MM4A 4E1SA 2ZFGA 3UU2A 2KZ7A 3AAAB 5ADXK 1GFOA 5JDPA 4FZMA 3G7GA 1GFNA 5FVNA 3T0SA 3NSGA 3EMNX 1QJ9A 4JFBA 5EE2A 3SYBA 1G90A 2XE5A 3UPGA 3RBHA 1ZHTA 3TZGA 2XTRA 4XNLA 2LFUA 2ZLDA 4AYNA 2N2LA 3AA1A 3LK3A 4FUVA 3POUA 3VE1A 5D5DA 1IZNA 1BT9A 4G75A 3PQUA 1Q9FA 5GV0A 2M07A 2MNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FOZ A;  2QTK A;  2XE2 A;  3O0E A;  2FGR A;  4GCQ A;  4LSF A;  5DL7 A;  8PRN A;  6PRN A;  2XG6 A;  4LSI A;  3POQ A;  3SZV A;  2Y2X A;  1HXX A;  4FSO A;  3JTY A;  3SZD A;  4KR8 A;  1GFP A;  4FT6 A;  4FRT A;  4FRX A;  2J4U P;  3POX A;  2ODJ A;  3POR A;  3SY7 A;  4BUM X;  1HXT A;  3VZT X;  3SYS A;  4AUI A;  2J1N A;  2Y0H A;  2Y0L A;  7PRN A;  3T20 A;  1OPF A;  1MPF A;  5DL5 A;  4FSP A;  3HWB A;  4RJX A;  1PRN A;  5PRN A;  4LSE A;  4KR4 A;  2OMF A;  2XE1 A;  4GCP A;  3VY9 X;  3VZU X;  2FGQ X;  4C69 X;  5DL6 A;  3PRN A;  1GFQ A;  1GFM A;  5DL8 A;  2K4T A;  3K19 A;  3HW9 A;  1H6S 1;  4GCS A;  4D65 A;  4RJW A;  3VY8 X;  3WI4 A;  2Y0K A;  1PHO A;  1BH3 A;  4D5U A;  3VZW X;  2PRN A;  4LSH A;  2O4V A;  4FMS A;  1HXU A;  2XE3 A;  4D64 A;  3T24 A;  3A2S X;  2POR A;  4KRA A;  3FYX A;  3WI5 A;  1OSM A;  3SY9 A;  1E54 A;  2ZFG A;  5JDP A;  1GFO A;  1GFN A;  5FVN A;  3T0S A;  3EMN X;  4JFB A;  3SYB A;  2XE5 A;  3UPG A;  2ZLD A;  3POU A;  1BT9 A;  3UU2 A;  3NSG A; 
#chains in the Genus database with same CATH topology
 1S5L O;  4FOZ A;  2N2M A;  3LK2 A;  5H2F O;  4FZL A;  4GF4 A;  4RLB A;  2QTK A;  3NJT A;  3VY9 X;  4O4X A;  5TIS O;  3BRY A;  2XE2 A;  3PQS A;  2GE4 A;  2R4O A;  1BXW A;  2X27 X;  2F1T A;  2FGR A;  3O0E A;  4O3W A;  4GCQ A;  4LSF A;  5DL7 A;  8PRN A;  6PRN A;  2R89 A;  1QJP A;  2XG6 A;  2JQY A;  3PGS A;  3V8U A;  3PGR A;  4LSI A;  1IZN B;  3POQ A;  4AFK A;  1MM5 A;  4O3X B;  4FQE A;  1ZHW A;  4PR7 A;  3SZV A;  2Y2X A;  3DWN A;  5B5E O;  1HXX A;  4AKR B;  2JMM A;  3JTY A;  2WJR A;  4FSO A;  4KR8 A;  2MHL A;  3DZM A;  3SZD A;  1GFP A;  4FT6 A;  4N58 A;  4C4V B;  2R88 A;  1ZHZ A;  5GTI O;  2R8A A;  4FRT A;  3VE2 A;  4N74 A;  4FRX A;  3DWO X;  1T1L A;  4O4U A;  2LHF A;  2YNK A;  3AA6 A;  2KZ7 B;  2J4U P;  3POX A;  4G76 A;  2ODJ A;  4PJ0 O;  4XNK A;  3BRZ A;  3KVD D;  4QQ1 A;  3VZU X;  2R4L A;  3POR A;  5AFU L;  1ZHY A;  4F4B A;  2KXP A;  3SY7 A;  2F1C X;  2R4P A;  3GP6 A;  1HXT A;  3DA4 A;  3A0H O;  3VZT X;  3SYS A;  4AUI A;  1QJ8 A;  4BUM X;  3AA7 A;  3AA1 B;  4AZL A;  2J1N A;  2Y0H A;  3LK3 B;  2Y0L A;  4UB8 O;  7PRN A;  3HOL A;  2W81 C;  3AAE A;  1ORM A;  3T20 A;  4K3C A;  2WJQ A;  1OPF A;  2M06 A;  5E79 O;  1MPF A;  3LK2 B;  5DL5 A;  2KC0 A;  4FSP A;  4B61 A;  5ADX L;  3AAA A;  2WVP A;  4O3Z A;  4PUX A;  3HWB A;  2KXP B;  3QRA A;  4RL9 A;  5IYU A;  1Q9G A;  4RJX A;  1PRN A;  4N59 A;  5PRN A;  3UAQ A;  4FES A;  2IWV A;  2ERV A;  2OMF A;  2XE1 A;  4GCP A;  4KR4 A;  4LSE A;  2FGQ X;  5G26 A;  3AAE B;  2X9K A;  3JCU O;  4GHB A;  5DL6 A;  5KAF O;  5KAI O;  4AYE C;  3PRN A;  4AYM C;  2XTQ A;  1GFQ A;  1GFM A;  1THQ A;  5DL8 A;  2K4T A;  3DA3 A;  3HW9 A;  3K19 A;  1H6S 1;  2IWW A;  2K0L A;  4GCS A;  3PGU A;  4D65 A;  2F1V A;  4RLC A;  1YS5 A;  2Y7S A;  2W80 C;  4RJW A;  3VY8 X;  4CTD A;  3AA0 A;  3A0B O;  2AXT O;  3WI4 A;  2Y0K A;  1PHO A;  1BH3 A;  2XMX A;  3AA6 B;  4AYI D;  3VZW X;  4D5U A;  2PRN A;  3LK4 2;  4Z3T A;  4LSH A;  2O4V A;  1ZHX A;  5GTH O;  4FMS A;  2KDY A;  5AFU K;  1HXU A;  2XE3 A;  2YPV A;  3C5O A;  4FZN A;  4K3B A;  3LK4 1;  4D64 A;  5G3A A;  3T24 A;  4O3Y A;  3A2S X;  2POR A;  4JCH A;  4UB6 O;  3AA7 B;  4O49 A;  4KRA A;  4AKR A;  3AA0 B;  4C4V A;  3FYX A;  5T5F A;  4U9C A;  3WI5 A;  4AKM A;  5G39 A;  1OSM A;  3HOE A;  1P4T A;  3QRC A;  3SY9 A;  4N75 A;  4E1T A;  4AYD C;  3PF1 A;  1E54 A;  4IL6 O;  1MM4 A;  4E1S A;  2ZFG A;  1T16 A;  2KZ7 A;  3AAA B;  3UU2 A;  1GFO A;  5ADX K;  4FZM A;  3G7G A;  1GFN A;  5FVN A;  3T0S A;  5JDP A;  3NSG A;  3EMN X;  1QJ9 A;  4JFB A;  5EE2 A;  3SYB A;  1G90 A;  3BS0 A;  2XE5 A;  4C00 A;  3UPG A;  3RBH A;  2R4N A;  5G38 A;  1ZHT A;  3TZG A;  2XTR A;  4XNL A;  4C69 X;  2LFU A;  2ZLD A;  4AYN A;  2N2L A;  3AA1 A;  3LK3 A;  4FUV A;  3POU A;  3VE1 A;  5D5D A;  3WU2 O;  5B66 O;  1IZN A;  1BT9 A;  4G75 A;  3PQU A;  1Q9F A;  5GV0 A;  2M07 A;  3KZI O;  2MNH A; 
#chains in the Genus database with same CATH homology
 4FOZ A;  2N2M A;  3LK2 A;  4FZL A;  4GF4 A;  4RLB A;  2QTK A;  4O4X A;  2XE2 A;  3PQS A;  2GE4 A;  1BXW A;  2X27 X;  2F1T A;  2FGR A;  3O0E A;  4O3W A;  4GCQ A;  4LSF A;  5DL7 A;  8PRN A;  6PRN A;  1QJP A;  2XG6 A;  3V8U A;  4LSI A;  1IZN B;  3POQ A;  4AFK A;  1MM5 A;  4O3X B;  1ZHW A;  3SZV A;  2Y2X A;  1HXX A;  4AKR B;  2JMM A;  3JTY A;  4FSO A;  3SZD A;  4KR8 A;  2MHL A;  1GFP A;  4FT6 A;  4N58 A;  1ZHZ A;  4FRT A;  3VE2 A;  4FRX A;  4O4U A;  2LHF A;  2YNK A;  3AA6 A;  2KZ7 B;  2J4U P;  3POX A;  4G76 A;  2ODJ A;  4XNK A;  3KVD D;  4QQ1 A;  3VZU X;  3POR A;  5AFU L;  1ZHY A;  4F4B A;  2KXP A;  3SY7 A;  4BUM X;  3GP6 A;  1HXT A;  3DA4 A;  3VZT X;  3SYS A;  4AUI A;  1QJ8 A;  3AA7 A;  3AA1 B;  4AZL A;  2J1N A;  2Y0H A;  3LK3 B;  2Y0L A;  7PRN A;  3HOL A;  2W81 C;  3AAE A;  1ORM A;  3T20 A;  1OPF A;  2M06 A;  1MPF A;  3LK2 B;  5DL5 A;  2KC0 A;  4FSP A;  4B61 A;  5ADX L;  3AAA A;  4O3Z A;  4PUX A;  3HWB A;  2KXP B;  3QRA A;  4RL9 A;  5IYU A;  1Q9G A;  4RJX A;  1PRN A;  4N59 A;  5PRN A;  3UAQ A;  4FES A;  4LSE A;  2ERV A;  2OMF A;  2XE1 A;  4GCP A;  4KR4 A;  5G26 A;  2FGQ X;  3VY9 X;  3AAE B;  4C69 X;  4GHB A;  5DL6 A;  4AYE C;  3PRN A;  4AYM C;  2XTQ A;  1GFQ A;  1GFM A;  1THQ A;  5DL8 A;  2K4T A;  3DA3 A;  3HW9 A;  3K19 A;  1H6S 1;  2K0L A;  4GCS A;  4D65 A;  2F1V A;  4RLC A;  1YS5 A;  2Y7S A;  2W80 C;  4RJW A;  3VY8 X;  3AA0 A;  3WI4 A;  2Y0K A;  1PHO A;  1BH3 A;  2XMX A;  3AA6 B;  4AYI D;  3VZW X;  4D5U A;  2PRN A;  3LK4 2;  4Z3T A;  4LSH A;  2O4V A;  1ZHX A;  4FMS A;  2KDY A;  5AFU K;  1HXU A;  2XE3 A;  2YPV A;  3C5O A;  4FZN A;  3LK4 1;  4D64 A;  3T24 A;  4O3Y A;  3A2S X;  2POR A;  4JCH A;  3AA7 B;  4O49 A;  4KRA A;  4AKR A;  3AA0 B;  3FYX A;  5T5F A;  4U9C A;  3WI5 A;  4AKM A;  1OSM A;  3HOE A;  1P4T A;  3QRC A;  3SY9 A;  4E1T A;  4AYD C;  1E54 A;  1MM4 A;  4E1S A;  2ZFG A;  3UU2 A;  2KZ7 A;  3AAA B;  5ADX K;  1GFO A;  5JDP A;  4FZM A;  3G7G A;  1GFN A;  5FVN A;  3T0S A;  3NSG A;  3EMN X;  1QJ9 A;  4JFB A;  5EE2 A;  3SYB A;  1G90 A;  2XE5 A;  3UPG A;  3RBH A;  1ZHT A;  3TZG A;  2XTR A;  4XNL A;  2LFU A;  2ZLD A;  4AYN A;  2N2L A;  3AA1 A;  3LK3 A;  4FUV A;  3POU A;  3VE1 A;  5D5D A;  1IZN A;  1BT9 A;  4G75 A;  3PQU A;  1Q9F A;  5GV0 A;  2M07 A;  2MNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...