4JFBA

Crystal structure of ompf in c2 with tncs
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Outer membrane protein F
publication title Stubborn contaminants: influence of detergents on the purity of the multidrug ABC transporter BmrA
pubmed doi rcsb
source organism Escherichia coli
total genus 92
structure length 340
sequence length 340
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4jfbA00
2ZFGA 5DL6A 1BH3A 4D65A 4FT6A 4FRXA 1OPFA 4D5UA 1HXXA 1HXTA 3VZWX 1HXUA 3SY7A 4LSIA 5DL7A 5DL8A 4BUMX 3NSGA 3T24A 1BT9A 1PHOA 2XE2A 3SYBA 3SY9A 3WI5A 1E54A 3K19A 4LSHA 1OSMA 3VZUX 1GFPA 6PRNA 2K4TA 5DL5A 3O0EA 5JDPA 3HWBA 3UPGA 5FVNA 4KR8A 3POXA 3SZDA 3JTYA 3FYXA 4GCQA 2XE1A 2J1NA 4RJXA 2PORA 2Y0HA 3PRNA 5PRNA 1H6S1 2ZLDA 2Y0KA 3VY9X 3SZVA 1PRNA 3PORA 1GFNA 2J4UP 3T20A 2Y0LA 4FSOA 3T0SA 4FMSA 4KR4A 1GFMA 2OMFA 3POUA 3POQA 3WI4A 4AUIA 4LSEA 4D64A 4RJWA 4GCPA 2ODJA 2Y2XA 4LSFA 8PRNA 2XG6A 7PRNA 3SYSA 3VY8X 3VZTX 2FGQX 1MPFA 4JFBA 2O4VA 4FOZA 2QTKA 4KRAA 4GCSA 4FSPA 1GFQA 1GFOA 2PRNA 2XE3A 4FRTA 3A2SX 2XE5A 3HW9A 4C69X 3EMNX 3UU2A 2FGRA
chains in the Genus database with same CATH superfamily
5G39A 3QRCA 4F4BA 3LK3B 2ZFGA 1QJPA 4FQEA 5DL6A 1MM5A 4GF4A 1BH3A 1ZHZA 4N58A 4D65A 5GV0A 4FT6A 5ADXL 3QRAA 4FRXA 4AFKA 1OPFA 4O3YA 2N2MA 4D5UA 1HXXA 4C4VA 4RLBA 3A0BO 3LK42 1IZNA 4U9CA 1HXTA 3VZWX 1HXUA 3SY7A 4LSIA 2R4LA 3BRZA 1MM4A 4N75A 5DL7A 4E1SA 2MNHA 4O3WA 5DL8A 2JMMA 4GHBA 4XNKA 5TISO 4BUMX 3G7GA 5D5DA 3BS0A 3NSGA 3T24A 3DWNA 1BT9A 1PHOA 2F1VA 2W81C 2XE2A 3DA3A 3HOEA 3SYBA 1Q9FA 2R88A 3SY9A 1T1LA 1E54A 4O3ZA 3WI5A 3K19A 3AA1A 4C00A 4LSHA 2F1CX 3PGUA 4C4VB 1IZNB 3WU2O 1ORMA 1OSMA 1GFPA 4N59A 3VZUX 4PUXA 3LK41 5GTHO 4IL6O 6PRNA 3KZIO 2K4TA 3V8UA 5DL5A 3TZGA 2R4NA 3O0EA 4AKMA 5JDPA 3HWBA 3NJTA 2KXPA 4FZLA 1S5LO 5KAIO 2Y7SA 2WVPA 2YPVA 3BRYA 5FVNA 4G75A 3AA7A 3UAQA 3T20A 4KR8A 3POXA 1YS5A 4O49A 3SZDA 2XMXA 3FYXA 3JTYA 3AA1B 3PGSA 2AXTO 2GE4A 2R8AA 4GCQA 2N2LA 2XE1A 2J1NA 3AA6A 1THQA 4RL9A 4RJXA 2YNKA 2PORA 2Y0HA 3DWOX 3PRNA 5PRNA 1BXWA 1H6S1 2LHFA 2W80C 2KXPB 2R89A 2ZLDA 4QQ1A 4XNLA 5KAFO 3PQSA 2Y0KA 1G90A 3AA7B 3VY9X 1ZHXA 3SZVA 4Z3TA 4K3CA 2R4OA 1ZHTA 5B5EO 2X9KA 1PRNA 3PORA 4G76A 3AAEA 3PGRA 1GFNA 3LK2A 2J4UP 2M06A 2Y0LA 3AA6B 4RLCA 4AYEC 4AKRA 4FSOA 3T0SA 5AFUK 3KVDD 4FMSA 4KR4A 8PRNA 3HOLA 1GFMA 2R4PA 2MHLA 2OMFA 2KZ7A 2WJRA 2K0LA 2X27X 3A0HO 3POQA 3POUA 3WI4A 5GTIO 5T5FA 4AUIA 4FUVA 4LSEA 2ERVA 4D64A 4AZLA 4RJWA 3C5OA 5E79O 4AYMC 4E1TA 4GCPA 2ODJA 2Y2XA 4JCHA 4N74A 3VE2A 3AAEB 5EE2A 1T16A 3LK2B 4LSFA 2XG6A 3PF1A 5G38A 3RBHA 1Q9GA 4K3BA 7PRNA 2XTRA 4AKRB 3JCUO 3AA0A 2KC0A 4O4XA 4O4UA 4PJ0O 5G26A 3SYSA 3VY8X 3VZTX 4CTDA 1QJ8A 2FGQX 2KZ7B 5H2FO 4FZMA 1MPFA 4JFBA 2IWVA 2O4VA 4FOZA 2QTKA 3DZMA 3VE1A 3AAAA 5AFUL 2IWWA 4KRAA 2M07A 4GCSA 5ADXK 4PR7A 3DA4A 4FSPA 4AYID 2XTQA 2WJQA 3GP6A 4FESA 1GFQA 1GFOA 2PRNA 2XE3A 2JQYA 3LK3A 3AA0B 4O3XB 4B61A 1ZHYA 5IYUA 4FRTA 5B66O 1P4TA 2LFUA 4AYNA 3A2SX 2XE5A 3PQUA 4FZNA 2KDYA 2F1TA 1QJ9A 3HW9A 3AAAB 4UB8O 4AYDC 3UPGA 5G3AA 4C69X 3EMNX 4UB6O 3UU2A 2FGRA 1ZHWA
chains in the Genus database with same CATH topology
3QRCA 4F4BA 3LK3B 2ZFGA 1QJPA 5DL6A 1MM5A 4GF4A 1BH3A 1ZHZA 4N58A 4D65A 5GV0A 4FT6A 5ADXL 3QRAA 4FRXA 4AFKA 1OPFA 4O3YA 2N2MA 4D5UA 1HXXA 4RLBA 3LK42 1IZNA 4U9CA 1HXTA 3VZWX 1HXUA 3SY7A 4LSIA 4E1SA 1MM4A 5DL7A 2MNHA 4O3WA 5DL8A 2JMMA 4GHBA 4XNKA 4BUMX 3G7GA 5D5DA 3NSGA 3T24A 1BT9A 1PHOA 2F1VA 2W81C 2XE2A 3DA3A 3HOEA 3SYBA 1Q9FA 3SY9A 3WI5A 1E54A 4O3ZA 3K19A 3AA1A 4LSHA 1IZNB 1ORMA 1OSMA 1GFPA 4N59A 3VZUX 4PUXA 3LK41 6PRNA 2K4TA 3V8UA 5DL5A 3TZGA 3O0EA 4AKMA 5JDPA 3HWBA 2KXPA 4FZLA 3UPGA 2Y7SA 5FVNA 2YPVA 3UAQA 3T20A 4G75A 3AA7A 4KR8A 3POXA 1YS5A 4O49A 3SZDA 2XMXA 3FYXA 3JTYA 3AA1B 2GE4A 4GCQA 2N2LA 2XE1A 2J1NA 3AA6A 1THQA 4RL9A 4RJXA 2YNKA 2PORA 2Y0HA 3PRNA 5PRNA 1BXWA 1H6S1 2LHFA 2W80C 2KXPB 4XNLA 2ZLDA 4QQ1A 3PQSA 2Y0KA 1G90A 3AA7B 3VY9X 1ZHXA 3SZVA 4Z3TA 1ZHTA 1PRNA 3PORA 4G76A 3AAEA 1GFNA 3LK2A 2J4UP 2M06A 2Y0LA 3AA6B 4RLCA 4AYEC 4AKRA 4FSOA 3T0SA 5AFUK 3KVDD 4FMSA 4KR4A 3HOLA 1GFMA 2MHLA 2OMFA 2KZ7A 2K0LA 2X27X 3POQA 3POUA 3WI4A 5T5FA 4AUIA 4FUVA 4LSEA 2ERVA 4D64A 4AZLA 4RJWA 3C5OA 4AYMC 4E1TA 4GCPA 2ODJA 2Y2XA 4JCHA 3VE2A 3AAEB 5EE2A 3LK2B 4LSFA 2XG6A 3RBHA 8PRNA 5IYUA 1Q9GA 7PRNA 2XTRA 4AKRB 3AA0A 2KC0A 4O4XA 4O4UA 5G26A 3SYSA 3VY8X 3VZTX 1QJ8A 2FGQX 2KZ7B 4FZMA 1MPFA 4JFBA 2O4VA 4FOZA 2QTKA 5AFUL 3VE1A 3AAAA 4KRAA 2M07A 4GCSA 5ADXK 3DA4A 4FSPA 4AYID 2XTQA 3GP6A 4FESA 1GFQA 1GFOA 2PRNA 2XE3A 3LK3A 3AA0B 4O3XB 4B61A 1ZHYA 4FRTA 1P4TA 2LFUA 4AYNA 3A2SX 2XE5A 3PQUA 4FZNA 2KDYA 2F1TA 1QJ9A 3HW9A 3AAAB 4AYDC 4C69X 3EMNX 3UU2A 2FGRA 1ZHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZFG A;  5DL6 A;  1BH3 A;  4D65 A;  4FT6 A;  4FRX A;  1OPF A;  4D5U A;  1HXX A;  1HXT A;  3VZW X;  1HXU A;  3SY7 A;  4LSI A;  5DL7 A;  5DL8 A;  4BUM X;  3NSG A;  3T24 A;  1BT9 A;  1PHO A;  2XE2 A;  3SYB A;  3SY9 A;  3WI5 A;  1E54 A;  3K19 A;  4LSH A;  1OSM A;  3VZU X;  1GFP A;  6PRN A;  2K4T A;  5DL5 A;  3O0E A;  5JDP A;  3HWB A;  3UPG A;  5FVN A;  4KR8 A;  3POX A;  3SZD A;  3JTY A;  3FYX A;  4GCQ A;  2XE1 A;  2J1N A;  4RJX A;  2POR A;  2Y0H A;  3PRN A;  5PRN A;  1H6S 1;  2ZLD A;  2Y0K A;  3VY9 X;  3SZV A;  1PRN A;  3POR A;  1GFN A;  2J4U P;  3T20 A;  2Y0L A;  4FSO A;  3T0S A;  4FMS A;  4KR4 A;  1GFM A;  2OMF A;  3POU A;  3POQ A;  3WI4 A;  4AUI A;  4LSE A;  4D64 A;  4RJW A;  4GCP A;  2ODJ A;  2Y2X A;  4LSF A;  8PRN A;  2XG6 A;  7PRN A;  3SYS A;  3VY8 X;  3VZT X;  2FGQ X;  1MPF A;  4JFB A;  2O4V A;  4FOZ A;  2QTK A;  4KRA A;  4GCS A;  4FSP A;  1GFQ A;  1GFO A;  2PRN A;  2XE3 A;  4FRT A;  3A2S X;  2XE5 A;  3HW9 A;  4C69 X;  3EMN X;  3UU2 A;  2FGR A; 
#chains in the Genus database with same CATH topology
 5G39 A;  3QRC A;  4F4B A;  3LK3 B;  2ZFG A;  1QJP A;  4FQE A;  5DL6 A;  1MM5 A;  4GF4 A;  1BH3 A;  1ZHZ A;  4N58 A;  4D65 A;  5GV0 A;  4FT6 A;  5ADX L;  3QRA A;  4FRX A;  4AFK A;  1OPF A;  4O3Y A;  2N2M A;  4D5U A;  1HXX A;  4C4V A;  4RLB A;  3A0B O;  3LK4 2;  1IZN A;  4U9C A;  1HXT A;  3VZW X;  1HXU A;  3SY7 A;  4LSI A;  2R4L A;  3BRZ A;  1MM4 A;  4N75 A;  5DL7 A;  4E1S A;  2MNH A;  4O3W A;  5DL8 A;  2JMM A;  4GHB A;  4XNK A;  5TIS O;  4BUM X;  3G7G A;  5D5D A;  3BS0 A;  3NSG A;  3T24 A;  3DWN A;  1BT9 A;  1PHO A;  2F1V A;  2W81 C;  2XE2 A;  3DA3 A;  3HOE A;  3SYB A;  1Q9F A;  2R88 A;  3SY9 A;  1T1L A;  1E54 A;  4O3Z A;  3WI5 A;  3K19 A;  3AA1 A;  4C00 A;  4LSH A;  2F1C X;  3PGU A;  4C4V B;  1IZN B;  3WU2 O;  1ORM A;  1OSM A;  1GFP A;  4N59 A;  3VZU X;  4PUX A;  3LK4 1;  5GTH O;  4IL6 O;  6PRN A;  3KZI O;  2K4T A;  3V8U A;  5DL5 A;  3TZG A;  2R4N A;  3O0E A;  4AKM A;  5JDP A;  3HWB A;  3NJT A;  2KXP A;  4FZL A;  1S5L O;  5KAI O;  2Y7S A;  2WVP A;  2YPV A;  3BRY A;  5FVN A;  4G75 A;  3AA7 A;  3UAQ A;  3T20 A;  4KR8 A;  3POX A;  1YS5 A;  4O49 A;  3SZD A;  2XMX A;  3FYX A;  3JTY A;  3AA1 B;  3PGS A;  2AXT O;  2GE4 A;  2R8A A;  4GCQ A;  2N2L A;  2XE1 A;  2J1N A;  3AA6 A;  1THQ A;  4RL9 A;  4RJX A;  2YNK A;  2POR A;  2Y0H A;  3DWO X;  3PRN A;  5PRN A;  1BXW A;  1H6S 1;  2LHF A;  2W80 C;  2KXP B;  2R89 A;  2ZLD A;  4QQ1 A;  4XNL A;  5KAF O;  3PQS A;  2Y0K A;  1G90 A;  3AA7 B;  3VY9 X;  1ZHX A;  3SZV A;  4Z3T A;  4K3C A;  2R4O A;  1ZHT A;  5B5E O;  2X9K A;  1PRN A;  3POR A;  4G76 A;  3AAE A;  3PGR A;  1GFN A;  3LK2 A;  2J4U P;  2M06 A;  2Y0L A;  3AA6 B;  4RLC A;  4AYE C;  4AKR A;  4FSO A;  3T0S A;  5AFU K;  3KVD D;  4FMS A;  4KR4 A;  8PRN A;  3HOL A;  1GFM A;  2R4P A;  2MHL A;  2OMF A;  2KZ7 A;  2WJR A;  2K0L A;  2X27 X;  3A0H O;  3POQ A;  3POU A;  3WI4 A;  5GTI O;  5T5F A;  4AUI A;  4FUV A;  4LSE A;  2ERV A;  4D64 A;  4AZL A;  4RJW A;  3C5O A;  5E79 O;  4AYM C;  4E1T A;  4GCP A;  2ODJ A;  2Y2X A;  4JCH A;  4N74 A;  3VE2 A;  3AAE B;  5EE2 A;  1T16 A;  3LK2 B;  4LSF A;  2XG6 A;  3PF1 A;  5G38 A;  3RBH A;  1Q9G A;  4K3B A;  7PRN A;  2XTR A;  4AKR B;  3JCU O;  3AA0 A;  2KC0 A;  4O4X A;  4O4U A;  4PJ0 O;  5G26 A;  3SYS A;  3VY8 X;  3VZT X;  4CTD A;  1QJ8 A;  2FGQ X;  2KZ7 B;  5H2F O;  4FZM A;  1MPF A;  4JFB A;  2IWV A;  2O4V A;  4FOZ A;  2QTK A;  3DZM A;  3VE1 A;  3AAA A;  5AFU L;  2IWW A;  4KRA A;  2M07 A;  4GCS A;  5ADX K;  4PR7 A;  3DA4 A;  4FSP A;  4AYI D;  2XTQ A;  2WJQ A;  3GP6 A;  4FES A;  1GFQ A;  1GFO A;  2PRN A;  2XE3 A;  2JQY A;  3LK3 A;  3AA0 B;  4O3X B;  4B61 A;  1ZHY A;  5IYU A;  4FRT A;  5B66 O;  1P4T A;  2LFU A;  4AYN A;  3A2S X;  2XE5 A;  3PQU A;  4FZN A;  2KDY A;  2F1T A;  1QJ9 A;  3HW9 A;  3AAA B;  4UB8 O;  4AYD C;  3UPG A;  5G3A A;  4C69 X;  3EMN X;  4UB6 O;  3UU2 A;  2FGR A;  1ZHW A; 
#chains in the Genus database with same CATH homology
 3QRC A;  4F4B A;  3LK3 B;  2ZFG A;  1QJP A;  5DL6 A;  1MM5 A;  4GF4 A;  1BH3 A;  1ZHZ A;  4N58 A;  4D65 A;  5GV0 A;  4FT6 A;  5ADX L;  3QRA A;  4FRX A;  4AFK A;  1OPF A;  4O3Y A;  2N2M A;  4D5U A;  1HXX A;  4RLB A;  3LK4 2;  1IZN A;  4U9C A;  1HXT A;  3VZW X;  1HXU A;  3SY7 A;  4LSI A;  4E1S A;  1MM4 A;  5DL7 A;  2MNH A;  4O3W A;  5DL8 A;  2JMM A;  4GHB A;  4XNK A;  4BUM X;  3G7G A;  5D5D A;  3NSG A;  3T24 A;  1BT9 A;  1PHO A;  2F1V A;  2W81 C;  2XE2 A;  3DA3 A;  3HOE A;  3SYB A;  1Q9F A;  3SY9 A;  3WI5 A;  1E54 A;  4O3Z A;  3K19 A;  3AA1 A;  4LSH A;  1IZN B;  1ORM A;  1OSM A;  1GFP A;  4N59 A;  3VZU X;  4PUX A;  3LK4 1;  6PRN A;  2K4T A;  3V8U A;  5DL5 A;  3TZG A;  3O0E A;  4AKM A;  5JDP A;  3HWB A;  2KXP A;  4FZL A;  3UPG A;  2Y7S A;  5FVN A;  2YPV A;  3UAQ A;  3T20 A;  4G75 A;  3AA7 A;  4KR8 A;  3POX A;  1YS5 A;  4O49 A;  3SZD A;  2XMX A;  3FYX A;  3JTY A;  3AA1 B;  2GE4 A;  4GCQ A;  2N2L A;  2XE1 A;  2J1N A;  3AA6 A;  1THQ A;  4RL9 A;  4RJX A;  2YNK A;  2POR A;  2Y0H A;  3PRN A;  5PRN A;  1BXW A;  1H6S 1;  2LHF A;  2W80 C;  2KXP B;  4XNL A;  2ZLD A;  4QQ1 A;  3PQS A;  2Y0K A;  1G90 A;  3AA7 B;  3VY9 X;  1ZHX A;  3SZV A;  4Z3T A;  1ZHT A;  1PRN A;  3POR A;  4G76 A;  3AAE A;  1GFN A;  3LK2 A;  2J4U P;  2M06 A;  2Y0L A;  3AA6 B;  4RLC A;  4AYE C;  4AKR A;  4FSO A;  3T0S A;  5AFU K;  3KVD D;  4FMS A;  4KR4 A;  3HOL A;  1GFM A;  2MHL A;  2OMF A;  2KZ7 A;  2K0L A;  2X27 X;  3POQ A;  3POU A;  3WI4 A;  5T5F A;  4AUI A;  4FUV A;  4LSE A;  2ERV A;  4D64 A;  4AZL A;  4RJW A;  3C5O A;  4AYM C;  4E1T A;  4GCP A;  2ODJ A;  2Y2X A;  4JCH A;  3VE2 A;  3AAE B;  5EE2 A;  3LK2 B;  4LSF A;  2XG6 A;  3RBH A;  8PRN A;  5IYU A;  1Q9G A;  7PRN A;  2XTR A;  4AKR B;  3AA0 A;  2KC0 A;  4O4X A;  4O4U A;  5G26 A;  3SYS A;  3VY8 X;  3VZT X;  1QJ8 A;  2FGQ X;  2KZ7 B;  4FZM A;  1MPF A;  4JFB A;  2O4V A;  4FOZ A;  2QTK A;  5AFU L;  3VE1 A;  3AAA A;  4KRA A;  2M07 A;  4GCS A;  5ADX K;  3DA4 A;  4FSP A;  4AYI D;  2XTQ A;  3GP6 A;  4FES A;  1GFQ A;  1GFO A;  2PRN A;  2XE3 A;  3LK3 A;  3AA0 B;  4O3X B;  4B61 A;  1ZHY A;  4FRT A;  1P4T A;  2LFU A;  4AYN A;  3A2S X;  2XE5 A;  3PQU A;  4FZN A;  2KDY A;  2F1T A;  1QJ9 A;  3HW9 A;  3AAA B;  4AYD C;  4C69 X;  3EMN X;  3UU2 A;  2FGR A;  1ZHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...