2WJRA

Nanc porin structure in rhombohedral crystal form.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
214
structure length
204
Chain Sequence
ALDVRGGYRSGSHAYETRLKVSEGWQNGWWASMESNTWNTINDVQVEVNYAIKLDDQWTVRPGMLTHFSSNGTRYGPYVKLSWDATKDLNFGIRYRYDWKAYRQQDLSGDMSRDNVHRWDGYVTYHINSDFTFAWQTTLYSKQNDYRYANHKKWATENAFVLQYHMTPDITPYIEYDYLDRQGVYNGRDNLSENSYRIGVSFKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords PROBABLE N-ACETYLNEURAMINIC ACID OUTER MEMBRANE CHANNEL PROT
publication title Nanc Crystal Structure, a Model for Outer Membrane Channels of the Acidic Sugar-Specific Kdgm Porin Family.
pubmed doi rcsb
source organism Escherichia coli
total genus 62
structure length 204
sequence length 214
ec nomenclature
pdb deposition date 2009-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.40 Mainly Beta Beta Barrel Porin monomeric porin ompg 2wjrA00
2IWVA 2WJQA 4CTDA 2X9KA 4PR7A 2IWWA 2JQYA 4FQEA 2WVPA 2WJRA 2F1CX
chains in the Genus database with same CATH superfamily
3G7GA 4O4UA 3SYSA 3AAEB 3EMNX 3AA0A 4O3YA 1Q9FA 4FSOA 2FGRA 2QTKA 4C00A 4FZMA 3T20A 3WU2O 4XNLA 5ADXK 1IZNB 2Y7SA 3DA4A 1HXTA 4QQ1A 5JDPA 3AA1B 8PRNA 2KC0A 4FZLA 2R8AA 4KR8A 4D64A 2J1NA 2ZFGA 4O3WA 5H2FO 3AAAB 4GCPA 2KDYA 2WVPA 2N2MA 4AKRB 1MM5A 1BT9A 3LK2A 3HWBA 4G76A 4JCHA 4N74A 3VE2A 4AKMA 2XTRA 5GV0A 5GTHO 3VZUX 1BH3A 4FQEA 4KRAA 4PUXA 1HXUA 2R4PA 7PRNA 1HXXA 2R89A 2X27X 4D65A 2KXPB 3SZVA 3PORA 4AFKA 4UB8O 1ZHZA 2KZ7A 3KVDD 1QJ9A 1E54A 1OSMA 2R4OA 2XE1A 3POQA 4U9CA 5G38A 3AA7B 4FT6A 4G75A 4O3ZA 5KAFO 3V8UA 3WI5A 3BS0A 1QJ8A 3A2SX 4LSHA 4FUVA 2IWVA 1QJPA 3SY9A 2XMXA 3AA1A 2K4TA 2OMFA 2Y0LA 4XNKA 5KAIO 4N59A 3HW9A 4RLBA 5DL5A 1PHOA 2LFUA 3AAAA 4PR7A 2JQYA 4AKRA 3AA6A 4E1SA 3FYXA 3LK3B 1ZHWA 3NJTA 2XE2A 3PGSA 4FSPA 3BRYA 4O4XA 1GFOA 3NSGA 5EE2A 2N2LA 5GTIO 3VE1A 4IL6O 3SY7A 2M06A 1P4TA 3HOEA 4GCSA 5E79O 3QRAA 3VZTX 4FESA 2GE4A 4LSEA 3A0HO 1GFQA 3AA0B 3DZMA 4AYDC 4AYEC 3T0SA 1ZHTA 3AAEA 4N58A 4AYID 5D5DA 3DA3A 4BUMX 1Q9GA 2PORA 3AA7A 6PRNA 4RLCA 3QRCA 4JFBA 1GFMA 1ORMA 4FZNA 4LSIA 1MPFA 1IZNA 1THQA 1PRNA 3VY9X 2YPVA 3VZWX 2M07A 4LSFA 1GFPA 3DWNA 4KR4A 2XTQA 5G39A 4GCQA 2R4NA 2JMMA 2J4UP 5G3AA 4C4VB 3GP6A 3HOLA 4K3BA 3UPGA 2XE5A 2XG6A 2ODJA 3TZGA 4FOZA 3POXA 5DL6A 4UB6O 5DL7A 1H6S1 2F1CX 2FGQX 3LK2B 2W80C 5AFUL 2R4LA 2W81C 2Y2XA 3LK41 3UAQA 2AXTO 5B5EO 3PRNA 4GF4A 5DL8A 2R88A 4FRXA 1T16A 2Y0HA 3PGRA 4N75A 3UU2A 4AZLA 1OPFA 1BXWA 3PQUA 3SYBA 2KXPA 3A0BO 3DWOX 3WI4A 2KZ7B 3VY8X 4FMSA 3RBHA 2YNKA 4RJWA 1S5LO 4AYMC 4GHBA 4D5UA 5ADXL 2IWWA 3JTYA 4C69X 1G90A 5PRNA 4AUIA 2F1TA 3PF1A 4O49A 1ZHYA 2MNHA 5TISO 3T24A 2F1VA 3BRZA 2PRNA 4RL9A 2LHFA 3LK42 2ZLDA 2MHLA 5FVNA 2ERVA 3SZDA 1T1LA 2WJQA 5T5FA 4AYNA 4CTDA 2X9KA 2XE3A 3AA6B 4PJ0O 1ZHXA 3POUA 4F4BA 5B66O 5IYUA 3PQSA 5G26A 3JCUO 3LK3A 1MM4A 4C4VA 2K0LA 4FRTA 3PGUA 1YS5A 3O0EA 5AFUK 3K19A 3C5OA 3KZIO 4K3CA 4RJXA 4Z3TA 1GFNA 2WJRA 2O4VA 4O3XB 2Y0KA 4B61A 4E1TA
chains in the Genus database with same CATH topology
2IWVA 2WJQA 4CTDA 2X9KA 4PR7A 2IWWA 2JQYA 4FQEA 2WVPA 2WJRA 2F1CX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IWV A;  2WJQ A;  4CTD A;  2X9K A;  4PR7 A;  2IWW A;  2JQY A;  4FQE A;  2WVP A;  2WJR A;  2F1C X; 
#chains in the Genus database with same CATH topology
 3G7G A;  4O4U A;  3SYS A;  3AAE B;  3EMN X;  3AA0 A;  4O3Y A;  1Q9F A;  4FSO A;  2FGR A;  2QTK A;  4C00 A;  4FZM A;  3T20 A;  3WU2 O;  4XNL A;  5ADX K;  1IZN B;  2Y7S A;  3DA4 A;  1HXT A;  4QQ1 A;  5JDP A;  3AA1 B;  8PRN A;  2KC0 A;  4FZL A;  2R8A A;  4KR8 A;  4D64 A;  2J1N A;  2ZFG A;  4O3W A;  5H2F O;  3AAA B;  4GCP A;  2KDY A;  2WVP A;  2N2M A;  4AKR B;  1MM5 A;  1BT9 A;  3LK2 A;  3HWB A;  4G76 A;  4JCH A;  4N74 A;  3VE2 A;  4AKM A;  2XTR A;  5GV0 A;  5GTH O;  3VZU X;  1BH3 A;  4FQE A;  4KRA A;  4PUX A;  1HXU A;  2R4P A;  7PRN A;  1HXX A;  2R89 A;  2X27 X;  4D65 A;  2KXP B;  3SZV A;  3POR A;  4AFK A;  4UB8 O;  1ZHZ A;  2KZ7 A;  3KVD D;  1QJ9 A;  1E54 A;  1OSM A;  2R4O A;  2XE1 A;  3POQ A;  4U9C A;  5G38 A;  3AA7 B;  4FT6 A;  4G75 A;  4O3Z A;  5KAF O;  3V8U A;  3WI5 A;  3BS0 A;  1QJ8 A;  3A2S X;  4LSH A;  4FUV A;  2IWV A;  1QJP A;  3SY9 A;  2XMX A;  3AA1 A;  2K4T A;  2OMF A;  2Y0L A;  4XNK A;  5KAI O;  4N59 A;  3HW9 A;  4RLB A;  5DL5 A;  1PHO A;  2LFU A;  3AAA A;  4PR7 A;  2JQY A;  4AKR A;  3AA6 A;  4E1S A;  3FYX A;  3LK3 B;  1ZHW A;  3NJT A;  2XE2 A;  3PGS A;  4FSP A;  3BRY A;  4O4X A;  1GFO A;  3NSG A;  5EE2 A;  2N2L A;  5GTI O;  3VE1 A;  4IL6 O;  3SY7 A;  2M06 A;  1P4T A;  3HOE A;  4GCS A;  5E79 O;  3QRA A;  3VZT X;  4FES A;  2GE4 A;  4LSE A;  3A0H O;  1GFQ A;  3AA0 B;  3DZM A;  4AYD C;  4AYE C;  3T0S A;  1ZHT A;  3AAE A;  4N58 A;  4AYI D;  5D5D A;  3DA3 A;  4BUM X;  1Q9G A;  2POR A;  3AA7 A;  6PRN A;  4RLC A;  3QRC A;  4JFB A;  1GFM A;  1ORM A;  4FZN A;  4LSI A;  1MPF A;  1IZN A;  1THQ A;  1PRN A;  3VY9 X;  2YPV A;  3VZW X;  2M07 A;  4LSF A;  1GFP A;  3DWN A;  4KR4 A;  2XTQ A;  5G39 A;  4GCQ A;  2R4N A;  2JMM A;  2J4U P;  5G3A A;  4C4V B;  3GP6 A;  3HOL A;  4K3B A;  3UPG A;  2XE5 A;  2XG6 A;  2ODJ A;  3TZG A;  4FOZ A;  3POX A;  5DL6 A;  4UB6 O;  5DL7 A;  1H6S 1;  2F1C X;  2FGQ X;  3LK2 B;  2W80 C;  5AFU L;  2R4L A;  2W81 C;  2Y2X A;  3LK4 1;  3UAQ A;  2AXT O;  5B5E O;  3PRN A;  4GF4 A;  5DL8 A;  2R88 A;  4FRX A;  1T16 A;  2Y0H A;  3PGR A;  4N75 A;  3UU2 A;  4AZL A;  1OPF A;  1BXW A;  3PQU A;  3SYB A;  2KXP A;  3A0B O;  3DWO X;  3WI4 A;  2KZ7 B;  3VY8 X;  4FMS A;  3RBH A;  2YNK A;  4RJW A;  1S5L O;  4AYM C;  4GHB A;  4D5U A;  5ADX L;  2IWW A;  3JTY A;  4C69 X;  1G90 A;  5PRN A;  4AUI A;  2F1T A;  3PF1 A;  4O49 A;  1ZHY A;  2MNH A;  5TIS O;  3T24 A;  2F1V A;  3BRZ A;  2PRN A;  4RL9 A;  2LHF A;  3LK4 2;  2ZLD A;  2MHL A;  5FVN A;  2ERV A;  3SZD A;  1T1L A;  2WJQ A;  5T5F A;  4AYN A;  4CTD A;  2X9K A;  2XE3 A;  3AA6 B;  4PJ0 O;  1ZHX A;  3POU A;  4F4B A;  5B66 O;  5IYU A;  3PQS A;  5G26 A;  3JCU O;  3LK3 A;  1MM4 A;  4C4V A;  2K0L A;  4FRT A;  3PGU A;  1YS5 A;  3O0E A;  5AFU K;  3K19 A;  3C5O A;  3KZI O;  4K3C A;  4RJX A;  4Z3T A;  1GFN A;  2WJR A;  2O4V A;  4O3X B;  2Y0K A;  4B61 A;  4E1T A; 
#chains in the Genus database with same CATH homology
 2IWV A;  2WJQ A;  4CTD A;  2X9K A;  4PR7 A;  2IWW A;  2JQY A;  4FQE A;  2WVP A;  2WJR A;  2F1C X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...