2WJRA

Nanc porin structure in rhombohedral crystal form.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
214
structure length
204
Chain Sequence
ALDVRGGYRSGSHAYETRLKVSEGWQNGWWASMESNTWNTINDVQVEVNYAIKLDDQWTVRPGMLTHFSSNGTRYGPYVKLSWDATKDLNFGIRYRYDWKAYRQQDLSGDMSRDNVHRWDGYVTYHINSDFTFAWQTTLYSKQNDYRYANHKKWATENAFVLQYHMTPDITPYIEYDYLDRQGVYNGRDNLSENSYRIGVSFKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE N-ACETYLNEURAMINIC ACID OUTER MEMBRANE CHANNEL PROT
publication title Nanc Crystal Structure, a Model for Outer Membrane Channels of the Acidic Sugar-Specific Kdgm Porin Family.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 62
structure length 204
sequence length 214
ec nomenclature
pdb deposition date 2009-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.40 Mainly Beta Beta Barrel Porin monomeric porin ompg 2wjrA00
4CTDA 2X9KA 4FQEA 2JQYA 2WJRA 2IWWA 2WVPA 4PR7A 2IWVA 2F1CX 2WJQA
chains in the Genus database with same CATH superfamily
4CTDA 3A0BO 2WJRA 2XMXA 3BS0A 4GCQA 3HWBA 3C5OA 4LSEA 1ZHZA 4Z3TA 1G90A 1S5LO 2PRNA 3V8UA 3AAAA 2M07A 1ORMA 2MHLA 4UB8O 3VE1A 3POXA 4AKRA 3SY7A 1BT9A 1THQA 3PORA 4O3YA 4C69X 3LK42 1Q9FA 3VY8X 2X27X 4E1SA 1ZHWA 1GFMA 3BRYA 4D65A 4RL9A 2LFUA 2F1VA 1QJ8A 2FGQX 3AA7A 3WI5A 1OSMA 3T24A 2KXPA 4AKMA 5B66O 1GFPA 2N2MA 1E54A 3AA6A 3VZWX 2Y0LA 5D5DA 1MM5A 3KZIO 8PRNA 3POUA 4O3ZA 3K19A 3AAAB 3SZDA 2F1TA 4AKRB 2JQYA 1HXTA 4O3XB 2Y7SA 2XTRA 3NJTA 3NSGA 3POQA 5H2FO 4U9CA 1MM4A 1ZHYA 3G7GA 4AUIA 4FT6A 4FZLA 4GHBA 3LK2A 3KVDD 3AA7B 4FRXA 3VZTX 5G3AA 3TZGA 4FESA 2KXPB 1IZNA 1MPFA 3AA6B 2KZ7A 3DWOX 3PGUA 3AA0A 3PGSA 3GP6A 4O3WA 7PRNA 4FMSA 3DA3A 3PRNA 3DWNA 5T5FA 5AFUK 5ADXK 2KC0A 3HW9A 5G26A 4F4BA 3VY9X 5JDPA 4O4UA 2LHFA 3JCUO 4UB6O 3A2SX 2K4TA 4B61A 3HOLA 3QRCA 2OMFA 3LK3A 4FSOA 4RJXA 4AYDC 3LK2B 2WVPA 1GFQA 2XE1A 4N58A 5GTHO 2WJQA 1IZNB 4FZNA 2JMMA 4O4XA 3SZVA 2KZ7B 4FZMA 1ZHXA 2XE3A 1Q9GA 4PR7A 2IWVA 2QTKA 4KRAA 4FSPA 2XE2A 2YPVA 3VZUX 1HXUA 2W80C 2GE4A 4BUMX 4C4VA 4XNKA 5FVNA 3DA4A 2ZFGA 2IWWA 5KAIO 3LK3B 4FUVA 4KR4A 4FRTA 1PRNA 2R4NA 4N74A 4JCHA 4D64A 3LK41 4AYNA 2J1NA 1PHOA 4E1TA 3WU2O 4RLBA 3HOEA 1GFOA 2XG6A 3VE2A 1GFNA 3PGRA 2FGRA 4QQ1A 3FYXA 2R8AA 2M06A 1ZHTA 2K0LA 1QJPA 5DL5A 2PORA 4C00A 2KDYA 3PF1A 4O49A 1P4TA 5G38A 1BH3A 5DL6A 5PRNA 1T1LA 4N59A 4RLCA 4AYEC 4C4VB 6PRNA 3AAEA 2W81C 2R88A 4AYID 5DL7A 2YNKA 2Y0HA 2XE5A 4XNLA 1H6S1 2J4UP 3UAQA 4G75A 3SYSA 5AFUL 5ADXL 3AA0B 2ODJA 2ERVA 3AA1A 3O0EA 2Y0KA 4AZLA 1YS5A 4GF4A 2R4OA 4GCSA 4N75A 1HXXA 4LSFA 3A0HO 3EMNX 3PQUA 4JFBA 5DL8A 3SY9A 3PQSA 2R4LA 3JTYA 3DZMA 2R89A 4LSHA 3BRZA 4GCPA 4KR8A 2MNHA 2R4PA 4FOZA 5GTIO 4IL6O 2Y2XA 4LSIA 3AAEB 3T0SA 2ZLDA 4FQEA 4RJWA 4K3BA 5E79O 4K3CA 5KAFO 2O4VA 1T16A 2F1CX 3AA1B 4G76A 3RBHA 3SYBA 3WI4A 5EE2A 2XTQA 5TISO 4PUXA 2N2LA 3UPGA 5B5EO 2X9KA 5G39A 1OPFA 5IYUA 3QRAA 4PJ0O 4D5UA 2AXTO 3UU2A 4AFKA 1QJ9A 4AYMC 1BXWA 3T20A 5GV0A
chains in the Genus database with same CATH topology
4CTDA 2X9KA 4FQEA 2JQYA 2WJRA 2IWWA 2WVPA 4PR7A 2IWVA 2F1CX 2WJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CTD A;  2X9K A;  4FQE A;  2JQY A;  2WJR A;  2IWW A;  2WVP A;  4PR7 A;  2IWV A;  2F1C X;  2WJQ A; 
#chains in the Genus database with same CATH topology
 4CTD A;  3A0B O;  2WJR A;  2XMX A;  3BS0 A;  4GCQ A;  3HWB A;  3C5O A;  4LSE A;  1ZHZ A;  4Z3T A;  1G90 A;  1S5L O;  2PRN A;  3V8U A;  3AAA A;  2M07 A;  1ORM A;  2MHL A;  4UB8 O;  3VE1 A;  3POX A;  4AKR A;  3SY7 A;  1BT9 A;  1THQ A;  3POR A;  4O3Y A;  4C69 X;  3LK4 2;  1Q9F A;  3VY8 X;  2X27 X;  4E1S A;  1ZHW A;  1GFM A;  3BRY A;  4D65 A;  4RL9 A;  2LFU A;  2F1V A;  1QJ8 A;  2FGQ X;  3AA7 A;  3WI5 A;  1OSM A;  3T24 A;  2KXP A;  4AKM A;  5B66 O;  1GFP A;  2N2M A;  1E54 A;  3AA6 A;  3VZW X;  2Y0L A;  5D5D A;  1MM5 A;  3KZI O;  8PRN A;  3POU A;  4O3Z A;  3K19 A;  3AAA B;  3SZD A;  2F1T A;  4AKR B;  2JQY A;  1HXT A;  4O3X B;  2Y7S A;  2XTR A;  3NJT A;  3NSG A;  3POQ A;  5H2F O;  4U9C A;  1MM4 A;  1ZHY A;  3G7G A;  4AUI A;  4FT6 A;  4FZL A;  4GHB A;  3LK2 A;  3KVD D;  3AA7 B;  4FRX A;  3VZT X;  5G3A A;  3TZG A;  4FES A;  2KXP B;  1IZN A;  1MPF A;  3AA6 B;  2KZ7 A;  3DWO X;  3PGU A;  3AA0 A;  3PGS A;  3GP6 A;  4O3W A;  7PRN A;  4FMS A;  3DA3 A;  3PRN A;  3DWN A;  5T5F A;  5AFU K;  5ADX K;  2KC0 A;  3HW9 A;  5G26 A;  4F4B A;  3VY9 X;  5JDP A;  4O4U A;  2LHF A;  3JCU O;  4UB6 O;  3A2S X;  2K4T A;  4B61 A;  3HOL A;  3QRC A;  2OMF A;  3LK3 A;  4FSO A;  4RJX A;  4AYD C;  3LK2 B;  2WVP A;  1GFQ A;  2XE1 A;  4N58 A;  5GTH O;  2WJQ A;  1IZN B;  4FZN A;  2JMM A;  4O4X A;  3SZV A;  2KZ7 B;  4FZM A;  1ZHX A;  2XE3 A;  1Q9G A;  4PR7 A;  2IWV A;  2QTK A;  4KRA A;  4FSP A;  2XE2 A;  2YPV A;  3VZU X;  1HXU A;  2W80 C;  2GE4 A;  4BUM X;  4C4V A;  4XNK A;  5FVN A;  3DA4 A;  2ZFG A;  2IWW A;  5KAI O;  3LK3 B;  4FUV A;  4KR4 A;  4FRT A;  1PRN A;  2R4N A;  4N74 A;  4JCH A;  4D64 A;  3LK4 1;  4AYN A;  2J1N A;  1PHO A;  4E1T A;  3WU2 O;  4RLB A;  3HOE A;  1GFO A;  2XG6 A;  3VE2 A;  1GFN A;  3PGR A;  2FGR A;  4QQ1 A;  3FYX A;  2R8A A;  2M06 A;  1ZHT A;  2K0L A;  1QJP A;  5DL5 A;  2POR A;  4C00 A;  2KDY A;  3PF1 A;  4O49 A;  1P4T A;  5G38 A;  1BH3 A;  5DL6 A;  5PRN A;  1T1L A;  4N59 A;  4RLC A;  4AYE C;  4C4V B;  6PRN A;  3AAE A;  2W81 C;  2R88 A;  4AYI D;  5DL7 A;  2YNK A;  2Y0H A;  2XE5 A;  4XNL A;  1H6S 1;  2J4U P;  3UAQ A;  4G75 A;  3SYS A;  5AFU L;  5ADX L;  3AA0 B;  2ODJ A;  2ERV A;  3AA1 A;  3O0E A;  2Y0K A;  4AZL A;  1YS5 A;  4GF4 A;  2R4O A;  4GCS A;  4N75 A;  1HXX A;  4LSF A;  3A0H O;  3EMN X;  3PQU A;  4JFB A;  5DL8 A;  3SY9 A;  3PQS A;  2R4L A;  3JTY A;  3DZM A;  2R89 A;  4LSH A;  3BRZ A;  4GCP A;  4KR8 A;  2MNH A;  2R4P A;  4FOZ A;  5GTI O;  4IL6 O;  2Y2X A;  4LSI A;  3AAE B;  3T0S A;  2ZLD A;  4FQE A;  4RJW A;  4K3B A;  5E79 O;  4K3C A;  5KAF O;  2O4V A;  1T16 A;  2F1C X;  3AA1 B;  4G76 A;  3RBH A;  3SYB A;  3WI4 A;  5EE2 A;  2XTQ A;  5TIS O;  4PUX A;  2N2L A;  3UPG A;  5B5E O;  2X9K A;  5G39 A;  1OPF A;  5IYU A;  3QRA A;  4PJ0 O;  4D5U A;  2AXT O;  3UU2 A;  4AFK A;  1QJ9 A;  4AYM C;  1BXW A;  3T20 A;  5GV0 A; 
#chains in the Genus database with same CATH homology
 4CTD A;  2X9K A;  4FQE A;  2JQY A;  2WJR A;  2IWW A;  2WVP A;  4PR7 A;  2IWV A;  2F1C X;  2WJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...