2WJRA

Nanc porin structure in rhombohedral crystal form.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
214
structure length
204
Chain Sequence
b'ALDVRGGYRSGSHAYETRLKVSEGWQNGWWASMESNTWNTINDVQVEVNYAIKLDDQWTVRPGMLTHFSSNGTRYGPYVKLSWDATKDLNFGIRYRYDWKAYRQQDLSGDMSRDNVHRWDGYVTYHINSDFTFAWQTTLYSKQNDYRYANHKKWATENAFVLQYHMTPDITPYIEYDYLDRQGVYNGRDNLSENSYRIGVSFKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE N-ACETYLNEURAMINIC ACID OUTER MEMBRANE CHANNEL PROT
molecule tags Transport protein
source organism Escherichia coli
publication title Nanc Crystal Structure, a Model for Outer Membrane Channels of the Acidic Sugar-Specific Kdgm Porin Family.
pubmed doi rcsb
total genus 62
structure length 204
sequence length 214
ec nomenclature
pdb deposition date 2009-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.40 Mainly Beta Beta Barrel Porin monomeric porin ompg 2wjrA00
2IWVA 2WJQA 2F1CX 4FQEA 2JQYA 4CTDA 2X9KA 4PR7A 2IWWA 2WJRA 2WVPA
chains in the Genus database with same CATH superfamily
2F1CX 2O4VA 2KXPA 2N2LA 7PRNA 1BXWA 5KAFO 5AFUK 3EMNX 4F4BA 2KZ7B 1GFQA 4C4VA 1P4TA 1MPFA 2ZFGA 3A2SX 3AA0B 3KZIO 3V8UA 4C69X 2FGRA 1GFMA 2F1VA 4Z3TA 2M07A 4AUIA 3UU2A 3KVDD 2X27X 2R4LA 3DZMA 2XTQA 3HWBA 2W80C 4G75A 5PRNA 4PJ0O 3VE1A 5B5EO 1HXTA 1ZHXA 2IWVA 2M06A 2WJQA 3QRCA 4LSFA 4O4UA 3UAQA 2Y7SA 3POQA 4FUVA 4LSEA 4O3XB 3VZTX 4B61A 4AKRB 4GCQA 3PGRA 3PQUA 3QRAA 3AAAB 4D65A 5JDPA 4U9CA 4QQ1A 4RJXA 4FSPA 4N75A 4O3ZA 4FZNA 2R4PA 1QJ9A 2JQYA 2YNKA 4AYEC 5DL6A 4XNKA 2X9KA 2Y2XA 3O0EA 4O3YA 4PR7A 1T16A 4UB6O 1PRNA 5DL7A 3AA6B 5G38A 3RBHA 6PRNA 3VZUX 4AZLA 1OPFA 3PQSA 2AXTO 4FESA 4RLBA 1YS5A 2OMFA 2XE3A 2KXPB 3FYXA 3K19A 4PUXA 4K3BA 5ADXK 3LK3A 2QTKA 5GV0A 5EE2A 2GE4A 3A0BO 1ZHWA 3SYSA 3DWNA 4CTDA 4RJWA 1BH3A 4E1TA 4AYDC 4AYID 2XE5A 3AAAA 3C5OA 3VE2A 1QJPA 4KRAA 4FSOA 2K0LA 3DWOX 3WI4A 1IZNA 4C00A 2LFUA 3BRYA 3DA4A 4KR8A 2LHFA 3UPGA 4GF4A 3VY9X 2KDYA 3WI5A 5GTHO 3LK2B 2WJRA 3AAEA 1E54A 3NJTA 2R8AA 3NSGA 2XE2A 3LK3B 4GHBA 3TZGA 2XG6A 5FVNA 2PORA 4K3CA 3LK42 5GTIO 3HOLA 2N2MA 4FZLA 4LSHA 4AYNA 1MM4A 2FGQX 2PRNA 3AAEB 2YPVA 5AFUL 3HOEA 1S5LO 3SY9A 3AA6A 3JCUO 3SYBA 4RLCA 4UB8O 5G26A 1BT9A 3T0SA 5B66O 2IWWA 1HXXA 1IZNB 2R89A 4XNLA 2WVPA 4LSIA 2ZLDA 4FRTA 2ERVA 3LK41 3HW9A 5IYUA 3AA7B 1HXUA 1PHOA 3GP6A 4G76A 3VY8X 3PORA 4FOZA 4E1SA 2MNHA 4O49A 4FRXA 1MM5A 2K4TA 3AA7A 3PGSA 2XMXA 3BS0A 4N58A 3A0HO 4O4XA 5DL5A 3AA1B 5DL8A 2Y0LA 2F1TA 5D5DA 1Q9FA 4FMSA 5ADXL 3POXA 2ODJA 4AYMC 1OSMA 2Y0KA 3POUA 5TISO 1G90A 3JTYA 5G3AA 3T24A 1T1LA 4FZMA 1ZHZA 1ORMA 3AA0A 1THQA 4FQEA 4GCSA 4C4VB 2KZ7A 2R88A 4D5UA 3SY7A 4GCPA 3VZWX 2W81C 2XTRA 5G39A 2R4NA 1H6S1 4N74A 3LK2A 4D64A 2R4OA 3PRNA 8PRNA 5E79O 3T20A 1GFPA 3AA1A 2J1NA 5KAIO 1GFOA 3BRZA 1Q9GA 1QJ8A 1ZHTA 4AKRA 5H2FO 4RL9A 2MHLA 2KC0A 1ZHYA 3SZDA 1GFNA 4KR4A 4AKMA 3G7GA 3PGUA 2J4UP 2JMMA 4O3WA 3DA3A 4AFKA 4JFBA 4N59A 3SZVA 4BUMX 2XE1A 3WU2O 3PF1A 5T5FA 4FT6A 4IL6O 4JCHA 2Y0HA
chains in the Genus database with same CATH topology
2IWVA 2WJQA 2F1CX 4FQEA 2JQYA 4CTDA 2X9KA 4PR7A 2IWWA 2WJRA 2WVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IWV A;  2WJQ A;  2F1C X;  4FQE A;  2JQY A;  4CTD A;  2X9K A;  4PR7 A;  2IWW A;  2WJR A;  2WVP A; 
#chains in the Genus database with same CATH topology
 2F1C X;  2O4V A;  2KXP A;  2N2L A;  7PRN A;  1BXW A;  5KAF O;  5AFU K;  3EMN X;  4F4B A;  2KZ7 B;  1GFQ A;  4C4V A;  1P4T A;  1MPF A;  2ZFG A;  3A2S X;  3AA0 B;  3KZI O;  3V8U A;  4C69 X;  2FGR A;  1GFM A;  2F1V A;  4Z3T A;  2M07 A;  4AUI A;  3UU2 A;  3KVD D;  2X27 X;  2R4L A;  3DZM A;  2XTQ A;  3HWB A;  2W80 C;  4G75 A;  5PRN A;  4PJ0 O;  3VE1 A;  5B5E O;  1HXT A;  1ZHX A;  2IWV A;  2M06 A;  2WJQ A;  3QRC A;  4LSF A;  4O4U A;  3UAQ A;  2Y7S A;  3POQ A;  4FUV A;  4LSE A;  4O3X B;  3VZT X;  4B61 A;  4AKR B;  4GCQ A;  3PGR A;  3PQU A;  3QRA A;  3AAA B;  4D65 A;  5JDP A;  4U9C A;  4QQ1 A;  4RJX A;  4FSP A;  4N75 A;  4O3Z A;  4FZN A;  2R4P A;  1QJ9 A;  2JQY A;  2YNK A;  4AYE C;  5DL6 A;  4XNK A;  2X9K A;  2Y2X A;  3O0E A;  4O3Y A;  4PR7 A;  1T16 A;  4UB6 O;  1PRN A;  5DL7 A;  3AA6 B;  5G38 A;  3RBH A;  6PRN A;  3VZU X;  4AZL A;  1OPF A;  3PQS A;  2AXT O;  4FES A;  4RLB A;  1YS5 A;  2OMF A;  2XE3 A;  2KXP B;  3FYX A;  3K19 A;  4PUX A;  4K3B A;  5ADX K;  3LK3 A;  2QTK A;  5GV0 A;  5EE2 A;  2GE4 A;  3A0B O;  1ZHW A;  3SYS A;  3DWN A;  4CTD A;  4RJW A;  1BH3 A;  4E1T A;  4AYD C;  4AYI D;  2XE5 A;  3AAA A;  3C5O A;  3VE2 A;  1QJP A;  4KRA A;  4FSO A;  2K0L A;  3DWO X;  3WI4 A;  1IZN A;  4C00 A;  2LFU A;  3BRY A;  3DA4 A;  4KR8 A;  2LHF A;  3UPG A;  4GF4 A;  3VY9 X;  2KDY A;  3WI5 A;  5GTH O;  3LK2 B;  2WJR A;  3AAE A;  1E54 A;  3NJT A;  2R8A A;  3NSG A;  2XE2 A;  3LK3 B;  4GHB A;  3TZG A;  2XG6 A;  5FVN A;  2POR A;  4K3C A;  3LK4 2;  5GTI O;  3HOL A;  2N2M A;  4FZL A;  4LSH A;  4AYN A;  1MM4 A;  2FGQ X;  2PRN A;  3AAE B;  2YPV A;  5AFU L;  3HOE A;  1S5L O;  3SY9 A;  3AA6 A;  3JCU O;  3SYB A;  4RLC A;  4UB8 O;  5G26 A;  1BT9 A;  3T0S A;  5B66 O;  2IWW A;  1HXX A;  1IZN B;  2R89 A;  4XNL A;  2WVP A;  4LSI A;  2ZLD A;  4FRT A;  2ERV A;  3LK4 1;  3HW9 A;  5IYU A;  3AA7 B;  1HXU A;  1PHO A;  3GP6 A;  4G76 A;  3VY8 X;  3POR A;  4FOZ A;  4E1S A;  2MNH A;  4O49 A;  4FRX A;  1MM5 A;  2K4T A;  3AA7 A;  3PGS A;  2XMX A;  3BS0 A;  4N58 A;  3A0H O;  4O4X A;  5DL5 A;  3AA1 B;  5DL8 A;  2Y0L A;  2F1T A;  5D5D A;  1Q9F A;  4FMS A;  5ADX L;  3POX A;  2ODJ A;  4AYM C;  1OSM A;  2Y0K A;  3POU A;  5TIS O;  1G90 A;  3JTY A;  5G3A A;  3T24 A;  1T1L A;  4FZM A;  1ZHZ A;  1ORM A;  3AA0 A;  1THQ A;  4FQE A;  4GCS A;  4C4V B;  2KZ7 A;  2R88 A;  4D5U A;  3SY7 A;  4GCP A;  3VZW X;  2W81 C;  2XTR A;  5G39 A;  2R4N A;  1H6S 1;  4N74 A;  3LK2 A;  4D64 A;  2R4O A;  3PRN A;  8PRN A;  5E79 O;  3T20 A;  1GFP A;  3AA1 A;  2J1N A;  5KAI O;  1GFO A;  3BRZ A;  1Q9G A;  1QJ8 A;  1ZHT A;  4AKR A;  5H2F O;  4RL9 A;  2MHL A;  2KC0 A;  1ZHY A;  3SZD A;  1GFN A;  4KR4 A;  4AKM A;  3G7G A;  3PGU A;  2J4U P;  2JMM A;  4O3W A;  3DA3 A;  4AFK A;  4JFB A;  4N59 A;  3SZV A;  4BUM X;  2XE1 A;  3WU2 O;  3PF1 A;  5T5F A;  4FT6 A;  4IL6 O;  4JCH A;  2Y0H A; 
#chains in the Genus database with same CATH homology
 2IWV A;  2WJQ A;  2F1C X;  4FQE A;  2JQY A;  4CTD A;  2X9K A;  4PR7 A;  2IWW A;  2WJR A;  2WVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...