2WJRA

Nanc porin structure in rhombohedral crystal form.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
214
structure length
204
Chain Sequence
ALDVRGGYRSGSHAYETRLKVSEGWQNGWWASMESNTWNTINDVQVEVNYAIKLDDQWTVRPGMLTHFSSNGTRYGPYVKLSWDATKDLNFGIRYRYDWKAYRQQDLSGDMSRDNVHRWDGYVTYHINSDFTFAWQTTLYSKQNDYRYANHKKWATENAFVLQYHMTPDITPYIEYDYLDRQGVYNGRDNLSENSYRIGVSFKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nanc Crystal Structure, a Model for Outer Membrane Channels of the Acidic Sugar-Specific Kdgm Porin Family.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords PROBABLE N-ACETYLNEURAMINIC ACID OUTER MEMBRANE CHANNEL PROT
total genus 62
structure length 204
sequence length 214
ec nomenclature
pdb deposition date 2009-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.40 Mainly Beta Beta Barrel Porin monomeric porin ompg 2wjrA00
2F1CX 2JQYA 4PR7A 2WJQA 2IWWA 4FQEA 2WVPA 2IWVA 2WJRA 4CTDA 2X9KA
chains in the Genus database with same CATH superfamily
4G75A 1PRNA 4FSOA 2F1VA 3POUA 5DL8A 4UB6O 5AFUL 3HW9A 3PORA 4RJWA 2IWWA 4JCHA 5AFUK 3HOLA 4RLBA 2MHLA 4D64A 1Q9GA 4PUXA 3AA0B 3DWOX 3NJTA 3PGUA 4N75A 4FZNA 4AKMA 2Y7SA 4AYID 5E79O 1YS5A 3LK2B 3AAEB 4Z3TA 5B66O 1H6S1 1QJ8A 4AZLA 2Y0LA 1GFOA 3BRYA 2MNHA 2K0LA 1ZHTA 2KXPB 3DZMA 5ADXK 2WVPA 3AA7A 2ERVA 4FZLA 3PGRA 4UB8O 5G39A 2LFUA 2X9KA 3PRNA 2X27X 5KAIO 3SYSA 3VY9X 1IZNB 4N74A 2XG6A 1QJ9A 3UPGA 4AKRB 2XE1A 1GFQA 1ORMA 2Y0HA 4RJXA 2R4NA 4C4VA 1HXUA 3LK3B 2R88A 3AA0A 3POQA 4D65A 3HOEA 3JCUO 4C00A 2JQYA 4RL9A 4RLCA 3SYBA 3VE1A 3KVDD 4E1SA 3T20A 2R4LA 1HXTA 5G26A 1MM5A 3DA4A 1BT9A 1GFMA 1OSMA 4FUVA 4PR7A 5DL6A 5IYUA 3WI4A 4FMSA 4K3BA 4LSFA 1P4TA 2IWVA 4O4XA 3AAAA 4F4BA 1MPFA 2LHFA 3BS0A 4XNLA 4C69X 2F1CX 4O3WA 4FESA 3VY8X 5GTIO 4B61A 2WJQA 3PGSA 2XTQA 4FOZA 3EMNX 2R4PA 3PF1A 3DA3A 3O0EA 4FRTA 2YPVA 4O49A 5G3AA 3VE2A 6PRNA 2FGQX 1THQA 3AA1A 2J1NA 2FGRA 4FRXA 3AA7B 1GFNA 2W80C 2M07A 4E1TA 4GCPA 5ADXL 5GV0A 4O3YA 3BRZA 3UAQA 3UU2A 2ZLDA 1OPFA 2R8AA 3SZVA 4FQEA 3JTYA 1S5LO 3SY7A 2QTKA 3VZTX 5PRNA 5EE2A 4KR4A 4AKRA 2J4UP 7PRNA 2R89A 3QRCA 1G90A 4C4VB 4GCSA 4AYEC 3AA6B 2XE3A 1T16A 4FZMA 4IL6O 4BUMX 2KXPA 4PJ0O 1E54A 4N58A 4N59A 4LSIA 5KAFO 1Q9FA 3POXA 4FT6A 1IZNA 3AA6A 4KRAA 2PRNA 5DL5A 1ZHZA 3AA1B 5FVNA 2XE2A 3AAEA 5B5EO 1ZHYA 3RBHA 2KDYA 2W81C 2ZFGA 3LK3A 1GFPA 3HWBA 4XNKA 3T24A 1T1LA 4O3ZA 2F1TA 3WU2O 1HXXA 2R4OA 3NSGA 4QQ1A 4K3CA 2YNKA 4AUIA 3PQUA 2GE4A 1ZHXA 2WJRA 4CTDA 5TISO 2JMMA 2M06A 4KR8A 3LK42 3SZDA 4AYMC 3VZUX 4O4UA 3A2SX 3G7GA 2AXTO 2KZ7A 2N2MA 3SY9A 4AYNA 3PQSA 1QJPA 1BXWA 4LSEA 4U9CA 4AFKA 2XE5A 3VZWX 2Y2XA 4FSPA 8PRNA 3C5OA 2KC0A 2PORA 3QRAA 1ZHWA 2XMXA 3A0HO 3GP6A 4G76A 3WI5A 4AYDC 1MM4A 5GTHO 5T5FA 2Y0KA 5JDPA 3DWNA 3TZGA 3LK41 5DL7A 3T0SA 3AAAB 4GF4A 4GCQA 3V8UA 3KZIO 3A0BO 3LK2A 5D5DA 2OMFA 5G38A 4GHBA 1BH3A 2O4VA 2N2LA 4D5UA 2KZ7B 4JFBA 2K4TA 3K19A 4LSHA 2ODJA 3FYXA 4O3XB 5H2FO 1PHOA 2XTRA
chains in the Genus database with same CATH topology
2F1CX 2JQYA 4PR7A 2WJQA 2IWWA 4FQEA 2WVPA 2IWVA 2WJRA 4CTDA 2X9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F1C X;  2JQY A;  4PR7 A;  2WJQ A;  2IWW A;  4FQE A;  2WVP A;  2IWV A;  2WJR A;  4CTD A;  2X9K A; 
#chains in the Genus database with same CATH topology
 4G75 A;  1PRN A;  4FSO A;  2F1V A;  3POU A;  5DL8 A;  4UB6 O;  5AFU L;  3HW9 A;  3POR A;  4RJW A;  2IWW A;  4JCH A;  5AFU K;  3HOL A;  4RLB A;  2MHL A;  4D64 A;  1Q9G A;  4PUX A;  3AA0 B;  3DWO X;  3NJT A;  3PGU A;  4N75 A;  4FZN A;  4AKM A;  2Y7S A;  4AYI D;  5E79 O;  1YS5 A;  3LK2 B;  3AAE B;  4Z3T A;  5B66 O;  1H6S 1;  1QJ8 A;  4AZL A;  2Y0L A;  1GFO A;  3BRY A;  2MNH A;  2K0L A;  1ZHT A;  2KXP B;  3DZM A;  5ADX K;  2WVP A;  3AA7 A;  2ERV A;  4FZL A;  3PGR A;  4UB8 O;  5G39 A;  2LFU A;  2X9K A;  3PRN A;  2X27 X;  5KAI O;  3SYS A;  3VY9 X;  1IZN B;  4N74 A;  2XG6 A;  1QJ9 A;  3UPG A;  4AKR B;  2XE1 A;  1GFQ A;  1ORM A;  2Y0H A;  4RJX A;  2R4N A;  4C4V A;  1HXU A;  3LK3 B;  2R88 A;  3AA0 A;  3POQ A;  4D65 A;  3HOE A;  3JCU O;  4C00 A;  2JQY A;  4RL9 A;  4RLC A;  3SYB A;  3VE1 A;  3KVD D;  4E1S A;  3T20 A;  2R4L A;  1HXT A;  5G26 A;  1MM5 A;  3DA4 A;  1BT9 A;  1GFM A;  1OSM A;  4FUV A;  4PR7 A;  5DL6 A;  5IYU A;  3WI4 A;  4FMS A;  4K3B A;  4LSF A;  1P4T A;  2IWV A;  4O4X A;  3AAA A;  4F4B A;  1MPF A;  2LHF A;  3BS0 A;  4XNL A;  4C69 X;  2F1C X;  4O3W A;  4FES A;  3VY8 X;  5GTI O;  4B61 A;  2WJQ A;  3PGS A;  2XTQ A;  4FOZ A;  3EMN X;  2R4P A;  3PF1 A;  3DA3 A;  3O0E A;  4FRT A;  2YPV A;  4O49 A;  5G3A A;  3VE2 A;  6PRN A;  2FGQ X;  1THQ A;  3AA1 A;  2J1N A;  2FGR A;  4FRX A;  3AA7 B;  1GFN A;  2W80 C;  2M07 A;  4E1T A;  4GCP A;  5ADX L;  5GV0 A;  4O3Y A;  3BRZ A;  3UAQ A;  3UU2 A;  2ZLD A;  1OPF A;  2R8A A;  3SZV A;  4FQE A;  3JTY A;  1S5L O;  3SY7 A;  2QTK A;  3VZT X;  5PRN A;  5EE2 A;  4KR4 A;  4AKR A;  2J4U P;  7PRN A;  2R89 A;  3QRC A;  1G90 A;  4C4V B;  4GCS A;  4AYE C;  3AA6 B;  2XE3 A;  1T16 A;  4FZM A;  4IL6 O;  4BUM X;  2KXP A;  4PJ0 O;  1E54 A;  4N58 A;  4N59 A;  4LSI A;  5KAF O;  1Q9F A;  3POX A;  4FT6 A;  1IZN A;  3AA6 A;  4KRA A;  2PRN A;  5DL5 A;  1ZHZ A;  3AA1 B;  5FVN A;  2XE2 A;  3AAE A;  5B5E O;  1ZHY A;  3RBH A;  2KDY A;  2W81 C;  2ZFG A;  3LK3 A;  1GFP A;  3HWB A;  4XNK A;  3T24 A;  1T1L A;  4O3Z A;  2F1T A;  3WU2 O;  1HXX A;  2R4O A;  3NSG A;  4QQ1 A;  4K3C A;  2YNK A;  4AUI A;  3PQU A;  2GE4 A;  1ZHX A;  2WJR A;  4CTD A;  5TIS O;  2JMM A;  2M06 A;  4KR8 A;  3LK4 2;  3SZD A;  4AYM C;  3VZU X;  4O4U A;  3A2S X;  3G7G A;  2AXT O;  2KZ7 A;  2N2M A;  3SY9 A;  4AYN A;  3PQS A;  1QJP A;  1BXW A;  4LSE A;  4U9C A;  4AFK A;  2XE5 A;  3VZW X;  2Y2X A;  4FSP A;  8PRN A;  3C5O A;  2KC0 A;  2POR A;  3QRA A;  1ZHW A;  2XMX A;  3A0H O;  3GP6 A;  4G76 A;  3WI5 A;  4AYD C;  1MM4 A;  5GTH O;  5T5F A;  2Y0K A;  5JDP A;  3DWN A;  3TZG A;  3LK4 1;  5DL7 A;  3T0S A;  3AAA B;  4GF4 A;  4GCQ A;  3V8U A;  3KZI O;  3A0B O;  3LK2 A;  5D5D A;  2OMF A;  5G38 A;  4GHB A;  1BH3 A;  2O4V A;  2N2L A;  4D5U A;  2KZ7 B;  4JFB A;  2K4T A;  3K19 A;  4LSH A;  2ODJ A;  3FYX A;  4O3X B;  5H2F O;  1PHO A;  2XTR A; 
#chains in the Genus database with same CATH homology
 2F1C X;  2JQY A;  4PR7 A;  2WJQ A;  2IWW A;  4FQE A;  2WVP A;  2IWV A;  2WJR A;  4CTD A;  2X9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...