4RLCA

Crystal structure of the n-terminal beta-barrel domain of pseudomonas aeruginosa oprf
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
160
structure length
135
Chain Sequence
QGQNSVEIEAFGKRYFADLYGGSIGYFLTDDVELALSYGEYHDVVHGNLTSLDAIYHFGTPGVGLRPYVSAGLAHQNITNINSDSQGRQQMTMANIGAGLKYYFTENFFAKASLDGQYGLEKGEWMAGLGVGFNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Outer membrane porin F
publication title Small-Molecule Transport by CarO, an Abundant Eight-Stranded beta-Barrel Outer Membrane Protein from Acinetobacter baumannii.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 36
structure length 135
sequence length 160
ec nomenclature
pdb deposition date 2014-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 4rlcA00
2JMMA 2F1VA 2ERVA 1QJPA 2M06A 1BXWA 1Q9GA 2N2LA 3GP6A 1G90A 4RLCA 4PUXA 1QJ8A 2N2MA 2MHLA 2LHFA 1ORMA 2M07A 2F1TA 1MM5A 3G7GA 1QJ9A 1MM4A 2X27X 1P4TA 3QRCA 2K0LA 1Q9FA 2GE4A 3C5OA 1THQA 2MNHA 3QRAA
chains in the Genus database with same CATH superfamily
1IZNB 1YS5A 2K4TA 3TZGA 4AYID 2ZLDA 3SZDA 4FSPA 1QJPA 3T24A 4FZLA 2KDYA 3HW9A 1S5LO 4G76A 2N2LA 5GV0A 5PRNA 2KZ7A 4RLCA 2OMFA 4FZNA 4PUXA 4O3WA 4RJXA 4XNKA 4AKMA 2WVPA 1T1LA 2R4PA 7PRNA 3WI5A 4GCQA 5H2FO 4U9CA 2XMXA 2YNKA 4D5UA 2M07A 1MM5A 3AA6A 3G7GA 1QJ9A 3LK3B 3POUA 3SYSA 1ZHXA 4E1TA 2AXTO 5T5FA 4C00A 2PORA 4UB8O 5G39A 1ZHTA 3K19A 2K0LA 5GTIO 3VE2A 3POXA 2W80C 4CTDA 3C5OA 3V8UA 1OSMA 1THQA 3AA1A 2FGRA 3VY9X 3VE1A 4AKRB 3VZWX 4FSOA 2Y0KA 4FESA 4JCHA 1ZHZA 3PGUA 1H6S1 5G26A 1PHOA 2F1VA 2ERVA 3UAQA 2XG6A 2M06A 4C4VA 3AAAA 3AAEB 3UPGA 3DA3A 4BUMX 2R89A 2R8AA 1ZHWA 4O3ZA 4E1SA 3LK2A 4RLBA 4AYNA 1PRNA 3VZUX 4GHBA 1GFMA 2MHLA 2LHFA 5ADXL 4O49A 2R4NA 4GF4A 5AFUL 3PGSA 4LSIA 5DL8A 2QTKA 3AA0A 2JQYA 3PORA 3NJTA 2KXPA 3O0EA 3QRCA 3T0SA 2GE4A 2LFUA 2PRNA 1IZNA 2FGQX 3AA7B 4FMSA 3BRYA 4B61A 5JDPA 4O3YA 4FOZA 3VY8X 3WI4A 8PRNA 3HOLA 2XE2A 2XTRA 5G38A 2R88A 3SY9A 1HXTA 4N59A 1ZHYA 3DA4A 3SZVA 3UU2A 6PRNA 2R4LA 4LSFA 1MPFA 2XE3A 3HOEA 1GFNA 1BT9A 1Q9GA 2ZFGA 4AYEC 2KC0A 4O4UA 4RJWA 5GTHO 4LSEA 2Y0LA 3BS0A 3DWNA 1GFQA 3DZMA 4C69X 4GCPA 4LSHA 3LK3A 4FRXA 1QJ8A 3NSGA 5B66O 4IL6O 4UB6O 3KZIO 2IWWA 2N2MA 2KZ7B 4N74A 5D5DA 5DL6A 2F1TA 4FT6A 5FVNA 3PF1A 1T16A 5G3AA 1GFPA 4O3XB 2WJQA 4XNLA 1MM4A 4AKRA 2X9KA 3AA6B 2X27X 2XE1A 1P4TA 3JCUO 4KRAA 4N58A 4FQEA 3A0HO 3BRZA 4FUVA 4PR7A 3WU2O 4O4XA 1GFOA 4QQ1A 2MNHA 1BH3A 3A2SX 4G75A 3QRAA 2IWVA 4N75A 4RL9A 4AYMC 5KAFO 4Z3TA 2JMMA 3AAEA 3AA1B 3FYXA 3LK42 3PRNA 3RBHA 2XE5A 2R4OA 1E54A 1BXWA 4K3BA 2O4VA 3KVDD 2Y2XA 3GP6A 3PGRA 4AFKA 1G90A 4AYDC 3DWOX 2W81C 4JFBA 2J4UP 3JTYA 3A0BO 3PQUA 4GCSA 4C4VB 2J1NA 4F4BA 5IYUA 5E79O 3AAAB 4KR8A 5KAIO 1ORMA 3EMNX 3PQSA 3POQA 2XTQA 1OPFA 2YPVA 3HWBA 4D65A 3LK2B 1HXUA 5DL5A 5EE2A 5B5EO 3LK41 4PJ0O 1HXXA 3AA7A 4FZMA 5DL7A 3SYBA 3VZTX 5ADXK 4FRTA 2Y7SA 2WJRA 4D64A 3T20A 1Q9FA 4AUIA 4AZLA 2ODJA 5AFUK 3AA0B 4KR4A 2Y0HA 2F1CX 5TISO 2KXPB 4K3CA 3SY7A
chains in the Genus database with same CATH topology
1IZNB 1YS5A 2K4TA 3TZGA 4AYID 2ZLDA 3SZDA 4FSPA 1QJPA 3T24A 4FZLA 2KDYA 3HW9A 4G76A 2N2LA 5GV0A 5PRNA 2KZ7A 4RLCA 2OMFA 4FZNA 4PUXA 4O3WA 4RJXA 4XNKA 4AKMA 7PRNA 3WI5A 4GCQA 4U9CA 2XMXA 2YNKA 4D5UA 2M07A 1MM5A 3AA6A 3G7GA 1QJ9A 3LK3B 3POUA 3SYSA 1ZHXA 4E1TA 5T5FA 2PORA 1ZHTA 3K19A 2K0LA 3VE2A 3POXA 2W80C 3C5OA 3V8UA 1OSMA 1THQA 3AA1A 2FGRA 3VY9X 3VE1A 4AKRB 3VZWX 4FSOA 2Y0KA 4FESA 4JCHA 1ZHZA 1H6S1 5G26A 1PHOA 2F1VA 2ERVA 3UAQA 2XG6A 2M06A 3AAAA 3AAEB 3UPGA 3DA3A 4BUMX 1ZHWA 4O3ZA 4E1SA 3LK2A 4RLBA 4AYNA 1PRNA 3VZUX 4GHBA 1GFMA 2MHLA 2LHFA 5ADXL 4O49A 4GF4A 5AFUL 4LSIA 5DL8A 2QTKA 3AA0A 3PORA 3QRCA 3T0SA 2KXPA 3O0EA 2GE4A 2LFUA 2PRNA 1IZNA 2FGQX 3AA7B 4FMSA 4B61A 5JDPA 4O3YA 4FOZA 3VY8X 3WI4A 8PRNA 3HOLA 2XTRA 2XE2A 3SY9A 1HXTA 4N59A 1ZHYA 3DA4A 3SZVA 3UU2A 6PRNA 4LSFA 1MPFA 2XE3A 3HOEA 1GFNA 1BT9A 1Q9GA 2ZFGA 4AYEC 2KC0A 4O4UA 4RJWA 4LSEA 2Y0LA 4C69X 1GFQA 4GCPA 4LSHA 3LK3A 4FRXA 1QJ8A 3NSGA 2N2MA 2KZ7B 5FVNA 5D5DA 5DL6A 2F1TA 4FT6A 1GFPA 4O3XB 4XNLA 1MM4A 4AKRA 3AA6B 2X27X 2XE1A 1P4TA 4KRAA 4N58A 4FUVA 4O4XA 1GFOA 4QQ1A 2MNHA 1BH3A 3A2SX 4G75A 3QRAA 4RL9A 4AYMC 4Z3TA 2JMMA 3AAEA 3AA1B 3FYXA 3LK42 3PRNA 3RBHA 2XE5A 1E54A 1BXWA 2O4VA 3KVDD 2Y2XA 3GP6A 4AFKA 1G90A 4AYDC 4JFBA 2W81C 2J4UP 3JTYA 4GCSA 3PQUA 4F4BA 2J1NA 5IYUA 3AAAB 4KR8A 1ORMA 3EMNX 3PQSA 3POQA 2XTQA 1OPFA 2YPVA 3HWBA 4D65A 3LK2B 1HXUA 5DL5A 5EE2A 3LK41 1HXXA 3AA7A 4FZMA 5DL7A 3SYBA 3VZTX 5ADXK 4FRTA 2Y7SA 4D64A 3T20A 1Q9FA 4AUIA 4AZLA 2ODJA 5AFUK 3AA0B 4KR4A 2Y0HA 2KXPB 3SY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMM A;  2F1V A;  2ERV A;  1QJP A;  2M06 A;  1BXW A;  1Q9G A;  2N2L A;  3GP6 A;  1G90 A;  4RLC A;  4PUX A;  1QJ8 A;  2N2M A;  2MHL A;  2LHF A;  1ORM A;  2M07 A;  2F1T A;  1MM5 A;  3G7G A;  1QJ9 A;  1MM4 A;  2X27 X;  1P4T A;  3QRC A;  2K0L A;  1Q9F A;  2GE4 A;  3C5O A;  1THQ A;  2MNH A;  3QRA A; 
#chains in the Genus database with same CATH topology
 1IZN B;  1YS5 A;  2K4T A;  3TZG A;  4AYI D;  2ZLD A;  3SZD A;  4FSP A;  1QJP A;  3T24 A;  4FZL A;  2KDY A;  3HW9 A;  1S5L O;  4G76 A;  2N2L A;  5GV0 A;  5PRN A;  2KZ7 A;  4RLC A;  2OMF A;  4FZN A;  4PUX A;  4O3W A;  4RJX A;  4XNK A;  4AKM A;  2WVP A;  1T1L A;  2R4P A;  7PRN A;  3WI5 A;  4GCQ A;  5H2F O;  4U9C A;  2XMX A;  2YNK A;  4D5U A;  2M07 A;  1MM5 A;  3AA6 A;  3G7G A;  1QJ9 A;  3LK3 B;  3POU A;  3SYS A;  1ZHX A;  4E1T A;  2AXT O;  5T5F A;  4C00 A;  2POR A;  4UB8 O;  5G39 A;  1ZHT A;  3K19 A;  2K0L A;  5GTI O;  3VE2 A;  3POX A;  2W80 C;  4CTD A;  3C5O A;  3V8U A;  1OSM A;  1THQ A;  3AA1 A;  2FGR A;  3VY9 X;  3VE1 A;  4AKR B;  3VZW X;  4FSO A;  2Y0K A;  4FES A;  4JCH A;  1ZHZ A;  3PGU A;  1H6S 1;  5G26 A;  1PHO A;  2F1V A;  2ERV A;  3UAQ A;  2XG6 A;  2M06 A;  4C4V A;  3AAA A;  3AAE B;  3UPG A;  3DA3 A;  4BUM X;  2R89 A;  2R8A A;  1ZHW A;  4O3Z A;  4E1S A;  3LK2 A;  4RLB A;  4AYN A;  1PRN A;  3VZU X;  4GHB A;  1GFM A;  2MHL A;  2LHF A;  5ADX L;  4O49 A;  2R4N A;  4GF4 A;  5AFU L;  3PGS A;  4LSI A;  5DL8 A;  2QTK A;  3AA0 A;  2JQY A;  3POR A;  3NJT A;  2KXP A;  3O0E A;  3QRC A;  3T0S A;  2GE4 A;  2LFU A;  2PRN A;  1IZN A;  2FGQ X;  3AA7 B;  4FMS A;  3BRY A;  4B61 A;  5JDP A;  4O3Y A;  4FOZ A;  3VY8 X;  3WI4 A;  8PRN A;  3HOL A;  2XE2 A;  2XTR A;  5G38 A;  2R88 A;  3SY9 A;  1HXT A;  4N59 A;  1ZHY A;  3DA4 A;  3SZV A;  3UU2 A;  6PRN A;  2R4L A;  4LSF A;  1MPF A;  2XE3 A;  3HOE A;  1GFN A;  1BT9 A;  1Q9G A;  2ZFG A;  4AYE C;  2KC0 A;  4O4U A;  4RJW A;  5GTH O;  4LSE A;  2Y0L A;  3BS0 A;  3DWN A;  1GFQ A;  3DZM A;  4C69 X;  4GCP A;  4LSH A;  3LK3 A;  4FRX A;  1QJ8 A;  3NSG A;  5B66 O;  4IL6 O;  4UB6 O;  3KZI O;  2IWW A;  2N2M A;  2KZ7 B;  4N74 A;  5D5D A;  5DL6 A;  2F1T A;  4FT6 A;  5FVN A;  3PF1 A;  1T16 A;  5G3A A;  1GFP A;  4O3X B;  2WJQ A;  4XNL A;  1MM4 A;  4AKR A;  2X9K A;  3AA6 B;  2X27 X;  2XE1 A;  1P4T A;  3JCU O;  4KRA A;  4N58 A;  4FQE A;  3A0H O;  3BRZ A;  4FUV A;  4PR7 A;  3WU2 O;  4O4X A;  1GFO A;  4QQ1 A;  2MNH A;  1BH3 A;  3A2S X;  4G75 A;  3QRA A;  2IWV A;  4N75 A;  4RL9 A;  4AYM C;  5KAF O;  4Z3T A;  2JMM A;  3AAE A;  3AA1 B;  3FYX A;  3LK4 2;  3PRN A;  3RBH A;  2XE5 A;  2R4O A;  1E54 A;  1BXW A;  4K3B A;  2O4V A;  3KVD D;  2Y2X A;  3GP6 A;  3PGR A;  4AFK A;  1G90 A;  4AYD C;  3DWO X;  2W81 C;  4JFB A;  2J4U P;  3JTY A;  3A0B O;  3PQU A;  4GCS A;  4C4V B;  2J1N A;  4F4B A;  5IYU A;  5E79 O;  3AAA B;  4KR8 A;  5KAI O;  1ORM A;  3EMN X;  3PQS A;  3POQ A;  2XTQ A;  1OPF A;  2YPV A;  3HWB A;  4D65 A;  3LK2 B;  1HXU A;  5DL5 A;  5EE2 A;  5B5E O;  3LK4 1;  4PJ0 O;  1HXX A;  3AA7 A;  4FZM A;  5DL7 A;  3SYB A;  3VZT X;  5ADX K;  4FRT A;  2Y7S A;  2WJR A;  4D64 A;  3T20 A;  1Q9F A;  4AUI A;  4AZL A;  2ODJ A;  5AFU K;  3AA0 B;  4KR4 A;  2Y0H A;  2F1C X;  5TIS O;  2KXP B;  4K3C A;  3SY7 A; 
#chains in the Genus database with same CATH homology
 1IZN B;  1YS5 A;  2K4T A;  3TZG A;  4AYI D;  2ZLD A;  3SZD A;  4FSP A;  1QJP A;  3T24 A;  4FZL A;  2KDY A;  3HW9 A;  4G76 A;  2N2L A;  5GV0 A;  5PRN A;  2KZ7 A;  4RLC A;  2OMF A;  4FZN A;  4PUX A;  4O3W A;  4RJX A;  4XNK A;  4AKM A;  7PRN A;  3WI5 A;  4GCQ A;  4U9C A;  2XMX A;  2YNK A;  4D5U A;  2M07 A;  1MM5 A;  3AA6 A;  3G7G A;  1QJ9 A;  3LK3 B;  3POU A;  3SYS A;  1ZHX A;  4E1T A;  5T5F A;  2POR A;  1ZHT A;  3K19 A;  2K0L A;  3VE2 A;  3POX A;  2W80 C;  3C5O A;  3V8U A;  1OSM A;  1THQ A;  3AA1 A;  2FGR A;  3VY9 X;  3VE1 A;  4AKR B;  3VZW X;  4FSO A;  2Y0K A;  4FES A;  4JCH A;  1ZHZ A;  1H6S 1;  5G26 A;  1PHO A;  2F1V A;  2ERV A;  3UAQ A;  2XG6 A;  2M06 A;  3AAA A;  3AAE B;  3UPG A;  3DA3 A;  4BUM X;  1ZHW A;  4O3Z A;  4E1S A;  3LK2 A;  4RLB A;  4AYN A;  1PRN A;  3VZU X;  4GHB A;  1GFM A;  2MHL A;  2LHF A;  5ADX L;  4O49 A;  4GF4 A;  5AFU L;  4LSI A;  5DL8 A;  2QTK A;  3AA0 A;  3POR A;  3QRC A;  3T0S A;  2KXP A;  3O0E A;  2GE4 A;  2LFU A;  2PRN A;  1IZN A;  2FGQ X;  3AA7 B;  4FMS A;  4B61 A;  5JDP A;  4O3Y A;  4FOZ A;  3VY8 X;  3WI4 A;  8PRN A;  3HOL A;  2XTR A;  2XE2 A;  3SY9 A;  1HXT A;  4N59 A;  1ZHY A;  3DA4 A;  3SZV A;  3UU2 A;  6PRN A;  4LSF A;  1MPF A;  2XE3 A;  3HOE A;  1GFN A;  1BT9 A;  1Q9G A;  2ZFG A;  4AYE C;  2KC0 A;  4O4U A;  4RJW A;  4LSE A;  2Y0L A;  4C69 X;  1GFQ A;  4GCP A;  4LSH A;  3LK3 A;  4FRX A;  1QJ8 A;  3NSG A;  2N2M A;  2KZ7 B;  5FVN A;  5D5D A;  5DL6 A;  2F1T A;  4FT6 A;  1GFP A;  4O3X B;  4XNL A;  1MM4 A;  4AKR A;  3AA6 B;  2X27 X;  2XE1 A;  1P4T A;  4KRA A;  4N58 A;  4FUV A;  4O4X A;  1GFO A;  4QQ1 A;  2MNH A;  1BH3 A;  3A2S X;  4G75 A;  3QRA A;  4RL9 A;  4AYM C;  4Z3T A;  2JMM A;  3AAE A;  3AA1 B;  3FYX A;  3LK4 2;  3PRN A;  3RBH A;  2XE5 A;  1E54 A;  1BXW A;  2O4V A;  3KVD D;  2Y2X A;  3GP6 A;  4AFK A;  1G90 A;  4AYD C;  4JFB A;  2W81 C;  2J4U P;  3JTY A;  4GCS A;  3PQU A;  4F4B A;  2J1N A;  5IYU A;  3AAA B;  4KR8 A;  1ORM A;  3EMN X;  3PQS A;  3POQ A;  2XTQ A;  1OPF A;  2YPV A;  3HWB A;  4D65 A;  3LK2 B;  1HXU A;  5DL5 A;  5EE2 A;  3LK4 1;  1HXX A;  3AA7 A;  4FZM A;  5DL7 A;  3SYB A;  3VZT X;  5ADX K;  4FRT A;  2Y7S A;  4D64 A;  3T20 A;  1Q9F A;  4AUI A;  4AZL A;  2ODJ A;  5AFU K;  3AA0 B;  4KR4 A;  2Y0H A;  2KXP B;  3SY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...