4RLCA

Crystal structure of the n-terminal beta-barrel domain of pseudomonas aeruginosa oprf
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
160
structure length
135
Chain Sequence
QGQNSVEIEAFGKRYFADLYGGSIGYFLTDDVELALSYGEYHDVVHGNLTSLDAIYHFGTPGVGLRPYVSAGLAHQNITNINSDSQGRQQMTMANIGAGLKYYFTENFFAKASLDGQYGLEKGEWMAGLGVGFNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small-Molecule Transport by CarO, an Abundant Eight-Stranded beta-Barrel Outer Membrane Protein from Acinetobacter baumannii.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
molecule keywords Outer membrane porin F
total genus 36
structure length 135
sequence length 160
ec nomenclature
pdb deposition date 2014-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 4rlcA00
2N2MA 1Q9GA 1MM4A 2N2LA 1G90A 2MHLA 2ERVA 1THQA 2MNHA 3QRAA 1ORMA 1QJ9A 3QRCA 2X27X 2F1VA 1Q9FA 1QJPA 2M07A 1P4TA 3GP6A 2F1TA 1MM5A 2GE4A 2JMMA 2K0LA 4RLCA 1BXWA 1QJ8A 2M06A 3G7GA 3C5OA 4PUXA 2LHFA
chains in the Genus database with same CATH superfamily
3PF1A 3POUA 2PORA 2WJRA 3LK41 3DA4A 1S5LO 3VY9X 3WI5A 3EMNX 3AAAA 3BRZA 4E1SA 1T1LA 5T5FA 3TZGA 2N2LA 3DWOX 1GFNA 5H2FO 5ADXL 3RBHA 2ODJA 4GCPA 4KR4A 4AUIA 2R4LA 3KVDD 4LSIA 2WVPA 4AKRB 5AFUK 5DL7A 3A0HO 3AA7B 2X27X 3LK42 4FMSA 2KXPA 1PRNA 1HXUA 2AXTO 2F1VA 3SYBA 1P4TA 3AA1B 3GP6A 2IWWA 4D5UA 2K0LA 5EE2A 3JTYA 4C69X 2QTKA 4K3BA 4AYEC 1MPFA 4GCQA 2XE5A 4AYNA 4B61A 2R88A 4JCHA 4JFBA 4E1TA 4N74A 4O3YA 4AYID 4LSHA 3JCUO 4C4VA 2O4VA 3KZIO 4U9CA 5GTIO 3NJTA 2JQYA 2FGQX 3SZVA 4AKMA 2Y7SA 4FZMA 4KRAA 4XNKA 3VZWX 2J1NA 5DL6A 3POQA 3V8UA 1OSMA 3AA6A 1Q9GA 2WJQA 2KZ7B 2PRNA 4RJXA 2W80C 3PQSA 3NSGA 4N58A 3HOLA 2ZLDA 4FT6A 4FSPA 3AAEA 4FZNA 1ORMA 4AZLA 1QJ9A 3PGSA 4UB6O 4GCSA 3AA0B 3BS0A 5G26A 4O49A 1GFPA 3LK3A 5B5EO 2Y0LA 2F1TA 3UPGA 2GE4A 2W81C 3O0EA 3T0SA 5GV0A 2J4UP 4O3ZA 5DL5A 2XTQA 4BUMX 3HW9A 4O4XA 2X9KA 3HOEA 3LK2B 5IYUA 2R4NA 4D64A 3A2SX 3T20A 3AA7A 5G39A 4Z3TA 1E54A 1ZHYA 4O3WA 5PRNA 1GFQA 3DA3A 1MM4A 5KAFO 1ZHXA 2Y2XA 2YNKA 1G90A 2R89A 1GFOA 4AFKA 4D65A 1T16A 4FZLA 2XMXA 3QRAA 1GFMA 4O4UA 4GHBA 3SY9A 5JDPA 1IZNA 4QQ1A 3UU2A 4FESA 2LFUA 4FUVA 3HWBA 3AAAB 2XE1A 1Q9FA 2KC0A 4PJ0O 3VY8X 3VZUX 4XNLA 5FVNA 3SY7A 8PRNA 2JMMA 1HXXA 4G75A 3K19A 4KR8A 4LSFA 2Y0KA 1ZHWA 2F1CX 5D5DA 2K4TA 2XTRA 2R4OA 2KZ7A 1QJ8A 2XE3A 3PRNA 4GF4A 3G7GA 4IL6O 4LSEA 1ZHTA 3WU2O 5G3AA 4PUXA 3SZDA 2LHFA 3UAQA 3VE1A 4FOZA 5E79O 3AA0A 2KXPB 2KDYA 3PGRA 2Y0HA 1PHOA 3PORA 7PRNA 5ADXK 3WI4A 1HXTA 1BH3A 1H6S1 2FGRA 2N2MA 4RJWA 4G76A 3T24A 4N59A 4RLBA 5AFUL 2IWVA 3PGUA 3FYXA 2MHLA 2ERVA 4C4VB 5G38A 1THQA 3VE2A 4PR7A 2MNHA 3A0BO 1ZHZA 4FQEA 6PRNA 4O3XB 4UB8O 3QRCA 3AA6B 2XG6A 3VZTX 1YS5A 1QJPA 2M07A 3DWNA 3LK2A 4CTDA 2XE2A 1MM5A 4K3CA 4RLCA 5B66O 2ZFGA 3AAEB 4F4BA 3POXA 4AKRA 1BXWA 4FRTA 1BT9A 2M06A 4N75A 3DZMA 5DL8A 5GTHO 3C5OA 4FSOA 4FRXA 1OPFA 5KAIO 1IZNB 2OMFA 4RL9A 3LK3B 3SYSA 4AYMC 3AA1A 2R4PA 3BRYA 5TISO 4C00A 2R8AA 4AYDC 2YPVA 3PQUA
chains in the Genus database with same CATH topology
3POUA 2PORA 3LK41 3DA4A 3VY9X 3WI5A 3EMNX 3AAAA 4E1SA 5T5FA 3TZGA 2N2LA 1GFNA 5ADXL 3RBHA 2ODJA 4GCPA 4KR4A 3KVDD 4LSIA 4AKRB 5AFUK 5DL7A 3AA7B 2X27X 3LK42 4FMSA 1PRNA 2F1VA 1HXUA 2KXPA 3SYBA 1P4TA 3AA1B 3GP6A 4D5UA 2K0LA 5EE2A 3JTYA 4C69X 2QTKA 4AYEC 1MPFA 4GCQA 2XE5A 4AYNA 4B61A 4JCHA 4E1TA 4JFBA 4O3YA 4AYID 4LSHA 2O4VA 4U9CA 2FGQX 3SZVA 4AKMA 2Y7SA 4FZMA 4KRAA 4XNKA 3VZWX 2J1NA 5DL6A 3POQA 3V8UA 1OSMA 3AA6A 1Q9GA 2KZ7B 2PRNA 4RJXA 2W80C 3PQSA 3NSGA 4N58A 3HOLA 2ZLDA 4FT6A 4FSPA 3AAEA 4FZNA 1ORMA 4AZLA 1QJ9A 4GCSA 3AA0B 5G26A 4O49A 1GFPA 3LK3A 2Y0LA 2F1TA 3UPGA 2GE4A 2W81C 3O0EA 3T0SA 2J4UP 4O3ZA 5DL5A 2XTQA 4BUMX 3HW9A 4O4XA 3HOEA 3LK2B 5IYUA 4D64A 3A2SX 3T20A 3AA7A 4Z3TA 1E54A 1ZHYA 4O3WA 5PRNA 1GFQA 3DA3A 1MM4A 1ZHXA 2Y2XA 2YNKA 1G90A 1GFOA 4AFKA 4D65A 4FZLA 2XMXA 3QRAA 1GFMA 4O4UA 4GHBA 3SY9A 5JDPA 1IZNA 4QQ1A 3UU2A 4FESA 2LFUA 4FUVA 3HWBA 3AAAB 2XE1A 1Q9FA 2KC0A 3VY8X 3VZUX 4XNLA 5FVNA 3SY7A 8PRNA 2JMMA 1HXXA 4G75A 3K19A 4KR8A 4LSFA 2Y0KA 1ZHWA 5D5DA 2K4TA 2XTRA 2KZ7A 1QJ8A 2XE3A 3PRNA 4GF4A 3G7GA 4LSEA 4AUIA 1ZHTA 4PUXA 3SZDA 2LHFA 3UAQA 3VE1A 4FOZA 3AA0A 2KXPB 2KDYA 2Y0HA 1PHOA 3PORA 7PRNA 5ADXK 3WI4A 1HXTA 1BH3A 1H6S1 2FGRA 2N2MA 4RJWA 4G76A 3T24A 4N59A 4RLBA 5AFUL 3FYXA 2MHLA 2ERVA 1THQA 3VE2A 2MNHA 1ZHZA 6PRNA 4O3XB 3QRCA 3AA6B 2XG6A 3VZTX 1YS5A 1QJPA 2M07A 3LK2A 2XE2A 1MM5A 4RLCA 2ZFGA 3AAEB 4F4BA 3POXA 4AKRA 1BXWA 4FRTA 1BT9A 2M06A 5DL8A 3C5OA 4FSOA 4FRXA 1OPFA 5GV0A 1IZNB 2OMFA 4RL9A 3LK3B 3SYSA 4AYMC 3AA1A 4AYDC 2YPVA 3PQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N2M A;  1Q9G A;  1MM4 A;  2N2L A;  1G90 A;  2MHL A;  2ERV A;  1THQ A;  2MNH A;  3QRA A;  1ORM A;  1QJ9 A;  3QRC A;  2X27 X;  2F1V A;  1Q9F A;  1QJP A;  2M07 A;  1P4T A;  3GP6 A;  2F1T A;  1MM5 A;  2GE4 A;  2JMM A;  2K0L A;  4RLC A;  1BXW A;  1QJ8 A;  2M06 A;  3G7G A;  3C5O A;  4PUX A;  2LHF A; 
#chains in the Genus database with same CATH topology
 3PF1 A;  3POU A;  2POR A;  2WJR A;  3LK4 1;  3DA4 A;  1S5L O;  3VY9 X;  3WI5 A;  3EMN X;  3AAA A;  3BRZ A;  4E1S A;  1T1L A;  5T5F A;  3TZG A;  2N2L A;  3DWO X;  1GFN A;  5H2F O;  5ADX L;  3RBH A;  2ODJ A;  4GCP A;  4KR4 A;  4AUI A;  2R4L A;  3KVD D;  4LSI A;  2WVP A;  4AKR B;  5AFU K;  5DL7 A;  3A0H O;  3AA7 B;  2X27 X;  3LK4 2;  4FMS A;  2KXP A;  1PRN A;  1HXU A;  2AXT O;  2F1V A;  3SYB A;  1P4T A;  3AA1 B;  3GP6 A;  2IWW A;  4D5U A;  2K0L A;  5EE2 A;  3JTY A;  4C69 X;  2QTK A;  4K3B A;  4AYE C;  1MPF A;  4GCQ A;  2XE5 A;  4AYN A;  4B61 A;  2R88 A;  4JCH A;  4JFB A;  4E1T A;  4N74 A;  4O3Y A;  4AYI D;  4LSH A;  3JCU O;  4C4V A;  2O4V A;  3KZI O;  4U9C A;  5GTI O;  3NJT A;  2JQY A;  2FGQ X;  3SZV A;  4AKM A;  2Y7S A;  4FZM A;  4KRA A;  4XNK A;  3VZW X;  2J1N A;  5DL6 A;  3POQ A;  3V8U A;  1OSM A;  3AA6 A;  1Q9G A;  2WJQ A;  2KZ7 B;  2PRN A;  4RJX A;  2W80 C;  3PQS A;  3NSG A;  4N58 A;  3HOL A;  2ZLD A;  4FT6 A;  4FSP A;  3AAE A;  4FZN A;  1ORM A;  4AZL A;  1QJ9 A;  3PGS A;  4UB6 O;  4GCS A;  3AA0 B;  3BS0 A;  5G26 A;  4O49 A;  1GFP A;  3LK3 A;  5B5E O;  2Y0L A;  2F1T A;  3UPG A;  2GE4 A;  2W81 C;  3O0E A;  3T0S A;  5GV0 A;  2J4U P;  4O3Z A;  5DL5 A;  2XTQ A;  4BUM X;  3HW9 A;  4O4X A;  2X9K A;  3HOE A;  3LK2 B;  5IYU A;  2R4N A;  4D64 A;  3A2S X;  3T20 A;  3AA7 A;  5G39 A;  4Z3T A;  1E54 A;  1ZHY A;  4O3W A;  5PRN A;  1GFQ A;  3DA3 A;  1MM4 A;  5KAF O;  1ZHX A;  2Y2X A;  2YNK A;  1G90 A;  2R89 A;  1GFO A;  4AFK A;  4D65 A;  1T16 A;  4FZL A;  2XMX A;  3QRA A;  1GFM A;  4O4U A;  4GHB A;  3SY9 A;  5JDP A;  1IZN A;  4QQ1 A;  3UU2 A;  4FES A;  2LFU A;  4FUV A;  3HWB A;  3AAA B;  2XE1 A;  1Q9F A;  2KC0 A;  4PJ0 O;  3VY8 X;  3VZU X;  4XNL A;  5FVN A;  3SY7 A;  8PRN A;  2JMM A;  1HXX A;  4G75 A;  3K19 A;  4KR8 A;  4LSF A;  2Y0K A;  1ZHW A;  2F1C X;  5D5D A;  2K4T A;  2XTR A;  2R4O A;  2KZ7 A;  1QJ8 A;  2XE3 A;  3PRN A;  4GF4 A;  3G7G A;  4IL6 O;  4LSE A;  1ZHT A;  3WU2 O;  5G3A A;  4PUX A;  3SZD A;  2LHF A;  3UAQ A;  3VE1 A;  4FOZ A;  5E79 O;  3AA0 A;  2KXP B;  2KDY A;  3PGR A;  2Y0H A;  1PHO A;  3POR A;  7PRN A;  5ADX K;  3WI4 A;  1HXT A;  1BH3 A;  1H6S 1;  2FGR A;  2N2M A;  4RJW A;  4G76 A;  3T24 A;  4N59 A;  4RLB A;  5AFU L;  2IWV A;  3PGU A;  3FYX A;  2MHL A;  2ERV A;  4C4V B;  5G38 A;  1THQ A;  3VE2 A;  4PR7 A;  2MNH A;  3A0B O;  1ZHZ A;  4FQE A;  6PRN A;  4O3X B;  4UB8 O;  3QRC A;  3AA6 B;  2XG6 A;  3VZT X;  1YS5 A;  1QJP A;  2M07 A;  3DWN A;  3LK2 A;  4CTD A;  2XE2 A;  1MM5 A;  4K3C A;  4RLC A;  5B66 O;  2ZFG A;  3AAE B;  4F4B A;  3POX A;  4AKR A;  1BXW A;  4FRT A;  1BT9 A;  2M06 A;  4N75 A;  3DZM A;  5DL8 A;  5GTH O;  3C5O A;  4FSO A;  4FRX A;  1OPF A;  5KAI O;  1IZN B;  2OMF A;  4RL9 A;  3LK3 B;  3SYS A;  4AYM C;  3AA1 A;  2R4P A;  3BRY A;  5TIS O;  4C00 A;  2R8A A;  4AYD C;  2YPV A;  3PQU A; 
#chains in the Genus database with same CATH homology
 3POU A;  2POR A;  3LK4 1;  3DA4 A;  3VY9 X;  3WI5 A;  3EMN X;  3AAA A;  4E1S A;  5T5F A;  3TZG A;  2N2L A;  1GFN A;  5ADX L;  3RBH A;  2ODJ A;  4GCP A;  4KR4 A;  3KVD D;  4LSI A;  4AKR B;  5AFU K;  5DL7 A;  3AA7 B;  2X27 X;  3LK4 2;  4FMS A;  1PRN A;  2F1V A;  1HXU A;  2KXP A;  3SYB A;  1P4T A;  3AA1 B;  3GP6 A;  4D5U A;  2K0L A;  5EE2 A;  3JTY A;  4C69 X;  2QTK A;  4AYE C;  1MPF A;  4GCQ A;  2XE5 A;  4AYN A;  4B61 A;  4JCH A;  4E1T A;  4JFB A;  4O3Y A;  4AYI D;  4LSH A;  2O4V A;  4U9C A;  2FGQ X;  3SZV A;  4AKM A;  2Y7S A;  4FZM A;  4KRA A;  4XNK A;  3VZW X;  2J1N A;  5DL6 A;  3POQ A;  3V8U A;  1OSM A;  3AA6 A;  1Q9G A;  2KZ7 B;  2PRN A;  4RJX A;  2W80 C;  3PQS A;  3NSG A;  4N58 A;  3HOL A;  2ZLD A;  4FT6 A;  4FSP A;  3AAE A;  4FZN A;  1ORM A;  4AZL A;  1QJ9 A;  4GCS A;  3AA0 B;  5G26 A;  4O49 A;  1GFP A;  3LK3 A;  2Y0L A;  2F1T A;  3UPG A;  2GE4 A;  2W81 C;  3O0E A;  3T0S A;  2J4U P;  4O3Z A;  5DL5 A;  2XTQ A;  4BUM X;  3HW9 A;  4O4X A;  3HOE A;  3LK2 B;  5IYU A;  4D64 A;  3A2S X;  3T20 A;  3AA7 A;  4Z3T A;  1E54 A;  1ZHY A;  4O3W A;  5PRN A;  1GFQ A;  3DA3 A;  1MM4 A;  1ZHX A;  2Y2X A;  2YNK A;  1G90 A;  1GFO A;  4AFK A;  4D65 A;  4FZL A;  2XMX A;  3QRA A;  1GFM A;  4O4U A;  4GHB A;  3SY9 A;  5JDP A;  1IZN A;  4QQ1 A;  3UU2 A;  4FES A;  2LFU A;  4FUV A;  3HWB A;  3AAA B;  2XE1 A;  1Q9F A;  2KC0 A;  3VY8 X;  3VZU X;  4XNL A;  5FVN A;  3SY7 A;  8PRN A;  2JMM A;  1HXX A;  4G75 A;  3K19 A;  4KR8 A;  4LSF A;  2Y0K A;  1ZHW A;  5D5D A;  2K4T A;  2XTR A;  2KZ7 A;  1QJ8 A;  2XE3 A;  3PRN A;  4GF4 A;  3G7G A;  4LSE A;  4AUI A;  1ZHT A;  4PUX A;  3SZD A;  2LHF A;  3UAQ A;  3VE1 A;  4FOZ A;  3AA0 A;  2KXP B;  2KDY A;  2Y0H A;  1PHO A;  3POR A;  7PRN A;  5ADX K;  3WI4 A;  1HXT A;  1BH3 A;  1H6S 1;  2FGR A;  2N2M A;  4RJW A;  4G76 A;  3T24 A;  4N59 A;  4RLB A;  5AFU L;  3FYX A;  2MHL A;  2ERV A;  1THQ A;  3VE2 A;  2MNH A;  1ZHZ A;  6PRN A;  4O3X B;  3QRC A;  3AA6 B;  2XG6 A;  3VZT X;  1YS5 A;  1QJP A;  2M07 A;  3LK2 A;  2XE2 A;  1MM5 A;  4RLC A;  2ZFG A;  3AAE B;  4F4B A;  3POX A;  4AKR A;  1BXW A;  4FRT A;  1BT9 A;  2M06 A;  5DL8 A;  3C5O A;  4FSO A;  4FRX A;  1OPF A;  5GV0 A;  1IZN B;  2OMF A;  4RL9 A;  3LK3 B;  3SYS A;  4AYM C;  3AA1 A;  4AYD C;  2YPV A;  3PQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...