4RLCA

Crystal structure of the n-terminal beta-barrel domain of pseudomonas aeruginosa oprf
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
160
structure length
135
Chain Sequence
QGQNSVEIEAFGKRYFADLYGGSIGYFLTDDVELALSYGEYHDVVHGNLTSLDAIYHFGTPGVGLRPYVSAGLAHQNITNINSDSQGRQQMTMANIGAGLKYYFTENFFAKASLDGQYGLEKGEWMAGLGVGFNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane porin F
publication title Small-Molecule Transport by CarO, an Abundant Eight-Stranded beta-Barrel Outer Membrane Protein from Acinetobacter baumannii.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
total genus 36
structure length 135
sequence length 160
ec nomenclature
pdb deposition date 2014-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 4rlcA00
2MNHA 2MHLA 1MM5A 2K0LA 1QJ8A 1BXWA 3GP6A 1MM4A 2JMMA 1THQA 3G7GA 2ERVA 2X27X 2LHFA 2M07A 2F1VA 4RLCA 1Q9FA 1G90A 1P4TA 1QJPA 1ORMA 4PUXA 2N2MA 2M06A 2GE4A 3QRCA 2F1TA 1Q9GA 1QJ9A 2N2LA 3QRAA 3C5OA
chains in the Genus database with same CATH superfamily
4AYDC 3PGRA 3LK42 3LK3A 1MM5A 2K0LA 2Y0LA 4D5UA 3AAAB 4O3WA 3GP6A 2R89A 4FESA 2JMMA 4K3CA 4U9CA 3LK41 3PQSA 2KDYA 2PORA 3PF1A 3SY9A 3PGSA 2M07A 2F1VA 3LK2A 3K19A 4JCHA 1ZHZA 3T20A 1Q9FA 1G90A 1QJPA 3AAEB 4CTDA 2OMFA 4GHBA 2XG6A 2WVPA 3KZIO 2N2MA 4GCQA 2WJRA 3KVDD 4QQ1A 3AA7B 4AUIA 4O3YA 6PRNA 4C4VA 3DZMA 2O4VA 2F1CX 5AFUK 3VY8X 1MPFA 4LSFA 1OPFA 3A0HO 3VZUX 2KZ7A 2XMXA 5JDPA 2KXPA 2XE2A 4N58A 5DL8A 4FRXA 2R4OA 3AA6A 3V8UA 4FSOA 4O4XA 1GFQA 5KAFO 4FT6A 2PRNA 4O3ZA 2MHLA 2W80C 4B61A 5ADXL 3UPGA 2Y7SA 5DL6A 2XTRA 3VZTX 5GTHO 3AA1A 1GFMA 2ZLDA 4BUMX 4KR8A 3HW9A 5GTIO 1GFOA 1THQA 3JCUO 4GF4A 3JTYA 4AKMA 2ERVA 5D5DA 3VE1A 4FQEA 4AYEC 1BT9A 3PQUA 2KZ7B 4PJ0O 4AYID 4RLCA 1IZNB 2X9KA 4KR4A 4O4UA 4D65A 5GV0A 4F4BA 4PUXA 3RBHA 5E79O 2GE4A 2K4TA 3T0SA 2LFUA 3HOLA 3QRCA 4E1SA 3SY7A 1Q9GA 5G39A 3LK3B 3VE2A 1E54A 1PRNA 2QTKA 3UU2A 1QJ9A 3WI4A 1PHOA 2R4PA 2WJQA 3POXA 3UAQA 3QRAA 5KAIO 4LSEA 2IWVA 4FUVA 5FVNA 3POQA 3BRZA 4RL9A 4AKRA 3HWBA 1ZHXA 1QJ8A 3EMNX 2J1NA 2YPVA 2R8AA 3LK2B 4FZMA 4LSHA 4LSIA 1MM4A 4RJWA 3VY9X 3AA0A 5ADXK 4JFBA 4FOZA 4FZLA 3SYBA 3A2SX 2X27X 5DL5A 4AFKA 4RJXA 1T1LA 3BRYA 2FGRA 1H6S1 3AAAA 2Y0KA 2W81C 1GFPA 1P4TA 3DWOX 1ORMA 2KXPB 5G3AA 1HXXA 4RLBA 2KC0A 3SZDA 4C00A 3O0EA 2XE5A 3AA6B 4G76A 3POUA 4KRAA 2Y0HA 5G38A 1GFNA 1ZHWA 2F1TA 2XE1A 2R4LA 4PR7A 5TISO 4UB6O 3SZVA 8PRNA 4O3XB 5G26A 4AZLA 2XTQA 3AAEA 4UB8O 3AA1B 3C5OA 4O49A 4FSPA 4D64A 3AA7A 3PORA 3DWNA 4N75A 4FZNA 2MNHA 3NJTA 3VZWX 5IYUA 4C69X 3DA4A 5PRNA 3T24A 4AYMC 1BXWA 5B5EO 2ODJA 2YNKA 5DL7A 1ZHYA 4FRTA 3TZGA 5T5FA 3G7GA 4K3BA 5H2FO 3HOEA 4E1TA 2LHFA 1HXTA 2JQYA 4N74A 4GCSA 3FYXA 2XE3A 2R88A 4GCPA 2AXTO 5EE2A 5AFUL 1BH3A 1S5LO 4XNKA 4N59A 1HXUA 4XNLA 3DA3A 1OSMA 5B66O 3PGUA 1YS5A 2M06A 2FGQX 2R4NA 3WU2O 4AKRB 2J4UP 4IL6O 1T16A 3PRNA 3SYSA 2IWWA 4FMSA 2N2LA 1IZNA 2Y2XA 1ZHTA 4C4VB 3BS0A 3WI5A 4Z3TA 3A0BO 7PRNA 3NSGA 4AYNA 3AA0B 4G75A 2ZFGA
chains in the Genus database with same CATH topology
4AYDC 3LK42 3LK3A 1MM5A 2K0LA 2Y0LA 4D5UA 3AAAB 4O3WA 3GP6A 4FESA 2JMMA 4U9CA 3LK41 3PQSA 2KDYA 2PORA 3SY9A 2M07A 2F1VA 3LK2A 3K19A 4JCHA 1ZHZA 3T20A 1Q9FA 1G90A 1QJPA 3AAEB 2OMFA 4GHBA 2XG6A 4GCQA 4AUIA 2N2MA 4QQ1A 3KVDD 3AA7B 4O3YA 6PRNA 2O4VA 5AFUK 3VY8X 1MPFA 3VZUX 1OPFA 5JDPA 2KZ7A 2XMXA 2KXPA 2XE2A 4N58A 5DL8A 4FRXA 3AA6A 3V8UA 4FSOA 4O4XA 1GFQA 4FT6A 2PRNA 4O3ZA 2MHLA 2W80C 4B61A 5ADXL 3UPGA 2Y7SA 5DL6A 2XTRA 3VZTX 3AA1A 1GFMA 2ZLDA 4BUMX 4KR8A 3HW9A 1GFOA 1THQA 4GF4A 3JTYA 4AKMA 2ERVA 5D5DA 3VE1A 4AYEC 1BT9A 3PQUA 2KZ7B 5GV0A 4AYID 4RLCA 1IZNB 4KR4A 4O4UA 4D65A 4F4BA 4PUXA 3RBHA 2GE4A 2K4TA 3T0SA 2LFUA 3HOLA 3QRCA 4E1SA 3SY7A 1Q9GA 3LK3B 3VE2A 1E54A 1PRNA 2QTKA 3UU2A 1QJ9A 3WI4A 1PHOA 3POXA 3UAQA 3QRAA 4LSEA 4FUVA 4AKRA 5FVNA 3POQA 4RL9A 3HWBA 1ZHXA 1QJ8A 3EMNX 2J1NA 2YPVA 3LK2B 4FZMA 4LSHA 4LSFA 4LSIA 1MM4A 4RJWA 3VY9X 3AA0A 5ADXK 4JFBA 4FOZA 4FZLA 3SYBA 3A2SX 2X27X 5DL5A 4AFKA 4RJXA 2FGRA 1H6S1 3AAAA 2Y0KA 2W81C 1GFPA 1P4TA 1ORMA 2KXPB 3SZDA 1HXXA 4RLBA 2KC0A 3O0EA 2XE5A 3AA6B 4G76A 3POUA 4KRAA 2Y0HA 1GFNA 1ZHWA 2F1TA 2XE1A 3SZVA 8PRNA 4O3XB 5G26A 4AZLA 2XTQA 3AAEA 3AA1B 3C5OA 4O49A 4FSPA 4D64A 3AA7A 3PORA 4FZNA 2MNHA 5IYUA 3VZWX 4C69X 3DA4A 5PRNA 3T24A 4AYMC 1BXWA 2ODJA 2YNKA 5DL7A 1ZHYA 4FRTA 3TZGA 5T5FA 3G7GA 3HOEA 4E1TA 2LHFA 1HXTA 4GCSA 3FYXA 2XE3A 4GCPA 5EE2A 5AFUL 1BH3A 4XNKA 4N59A 1HXUA 4XNLA 3DA3A 1OSMA 1YS5A 2M06A 2FGQX 2J4UP 4AKRB 3PRNA 3SYSA 4FMSA 2N2LA 1IZNA 2Y2XA 1ZHTA 3WI5A 4Z3TA 7PRNA 3NSGA 4AYNA 3AA0B 4G75A 2ZFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MNH A;  2MHL A;  1MM5 A;  2K0L A;  1QJ8 A;  1BXW A;  3GP6 A;  1MM4 A;  2JMM A;  1THQ A;  3G7G A;  2ERV A;  2X27 X;  2LHF A;  2M07 A;  2F1V A;  4RLC A;  1Q9F A;  1G90 A;  1P4T A;  1QJP A;  1ORM A;  4PUX A;  2N2M A;  2M06 A;  2GE4 A;  3QRC A;  2F1T A;  1Q9G A;  1QJ9 A;  2N2L A;  3QRA A;  3C5O A; 
#chains in the Genus database with same CATH topology
 4AYD C;  3PGR A;  3LK4 2;  3LK3 A;  1MM5 A;  2K0L A;  2Y0L A;  4D5U A;  3AAA B;  4O3W A;  3GP6 A;  2R89 A;  4FES A;  2JMM A;  4K3C A;  4U9C A;  3LK4 1;  3PQS A;  2KDY A;  2POR A;  3PF1 A;  3SY9 A;  3PGS A;  2M07 A;  2F1V A;  3LK2 A;  3K19 A;  4JCH A;  1ZHZ A;  3T20 A;  1Q9F A;  1G90 A;  1QJP A;  3AAE B;  4CTD A;  2OMF A;  4GHB A;  2XG6 A;  2WVP A;  3KZI O;  2N2M A;  4GCQ A;  2WJR A;  3KVD D;  4QQ1 A;  3AA7 B;  4AUI A;  4O3Y A;  6PRN A;  4C4V A;  3DZM A;  2O4V A;  2F1C X;  5AFU K;  3VY8 X;  1MPF A;  4LSF A;  1OPF A;  3A0H O;  3VZU X;  2KZ7 A;  2XMX A;  5JDP A;  2KXP A;  2XE2 A;  4N58 A;  5DL8 A;  4FRX A;  2R4O A;  3AA6 A;  3V8U A;  4FSO A;  4O4X A;  1GFQ A;  5KAF O;  4FT6 A;  2PRN A;  4O3Z A;  2MHL A;  2W80 C;  4B61 A;  5ADX L;  3UPG A;  2Y7S A;  5DL6 A;  2XTR A;  3VZT X;  5GTH O;  3AA1 A;  1GFM A;  2ZLD A;  4BUM X;  4KR8 A;  3HW9 A;  5GTI O;  1GFO A;  1THQ A;  3JCU O;  4GF4 A;  3JTY A;  4AKM A;  2ERV A;  5D5D A;  3VE1 A;  4FQE A;  4AYE C;  1BT9 A;  3PQU A;  2KZ7 B;  4PJ0 O;  4AYI D;  4RLC A;  1IZN B;  2X9K A;  4KR4 A;  4O4U A;  4D65 A;  5GV0 A;  4F4B A;  4PUX A;  3RBH A;  5E79 O;  2GE4 A;  2K4T A;  3T0S A;  2LFU A;  3HOL A;  3QRC A;  4E1S A;  3SY7 A;  1Q9G A;  5G39 A;  3LK3 B;  3VE2 A;  1E54 A;  1PRN A;  2QTK A;  3UU2 A;  1QJ9 A;  3WI4 A;  1PHO A;  2R4P A;  2WJQ A;  3POX A;  3UAQ A;  3QRA A;  5KAI O;  4LSE A;  2IWV A;  4FUV A;  5FVN A;  3POQ A;  3BRZ A;  4RL9 A;  4AKR A;  3HWB A;  1ZHX A;  1QJ8 A;  3EMN X;  2J1N A;  2YPV A;  2R8A A;  3LK2 B;  4FZM A;  4LSH A;  4LSI A;  1MM4 A;  4RJW A;  3VY9 X;  3AA0 A;  5ADX K;  4JFB A;  4FOZ A;  4FZL A;  3SYB A;  3A2S X;  2X27 X;  5DL5 A;  4AFK A;  4RJX A;  1T1L A;  3BRY A;  2FGR A;  1H6S 1;  3AAA A;  2Y0K A;  2W81 C;  1GFP A;  1P4T A;  3DWO X;  1ORM A;  2KXP B;  5G3A A;  1HXX A;  4RLB A;  2KC0 A;  3SZD A;  4C00 A;  3O0E A;  2XE5 A;  3AA6 B;  4G76 A;  3POU A;  4KRA A;  2Y0H A;  5G38 A;  1GFN A;  1ZHW A;  2F1T A;  2XE1 A;  2R4L A;  4PR7 A;  5TIS O;  4UB6 O;  3SZV A;  8PRN A;  4O3X B;  5G26 A;  4AZL A;  2XTQ A;  3AAE A;  4UB8 O;  3AA1 B;  3C5O A;  4O49 A;  4FSP A;  4D64 A;  3AA7 A;  3POR A;  3DWN A;  4N75 A;  4FZN A;  2MNH A;  3NJT A;  3VZW X;  5IYU A;  4C69 X;  3DA4 A;  5PRN A;  3T24 A;  4AYM C;  1BXW A;  5B5E O;  2ODJ A;  2YNK A;  5DL7 A;  1ZHY A;  4FRT A;  3TZG A;  5T5F A;  3G7G A;  4K3B A;  5H2F O;  3HOE A;  4E1T A;  2LHF A;  1HXT A;  2JQY A;  4N74 A;  4GCS A;  3FYX A;  2XE3 A;  2R88 A;  4GCP A;  2AXT O;  5EE2 A;  5AFU L;  1BH3 A;  1S5L O;  4XNK A;  4N59 A;  1HXU A;  4XNL A;  3DA3 A;  1OSM A;  5B66 O;  3PGU A;  1YS5 A;  2M06 A;  2FGQ X;  2R4N A;  3WU2 O;  4AKR B;  2J4U P;  4IL6 O;  1T16 A;  3PRN A;  3SYS A;  2IWW A;  4FMS A;  2N2L A;  1IZN A;  2Y2X A;  1ZHT A;  4C4V B;  3BS0 A;  3WI5 A;  4Z3T A;  3A0B O;  7PRN A;  3NSG A;  4AYN A;  3AA0 B;  4G75 A;  2ZFG A; 
#chains in the Genus database with same CATH homology
 4AYD C;  3LK4 2;  3LK3 A;  1MM5 A;  2K0L A;  2Y0L A;  4D5U A;  3AAA B;  4O3W A;  3GP6 A;  4FES A;  2JMM A;  4U9C A;  3LK4 1;  3PQS A;  2KDY A;  2POR A;  3SY9 A;  2M07 A;  2F1V A;  3LK2 A;  3K19 A;  4JCH A;  1ZHZ A;  3T20 A;  1Q9F A;  1G90 A;  1QJP A;  3AAE B;  2OMF A;  4GHB A;  2XG6 A;  4GCQ A;  4AUI A;  2N2M A;  4QQ1 A;  3KVD D;  3AA7 B;  4O3Y A;  6PRN A;  2O4V A;  5AFU K;  3VY8 X;  1MPF A;  3VZU X;  1OPF A;  5JDP A;  2KZ7 A;  2XMX A;  2KXP A;  2XE2 A;  4N58 A;  5DL8 A;  4FRX A;  3AA6 A;  3V8U A;  4FSO A;  4O4X A;  1GFQ A;  4FT6 A;  2PRN A;  4O3Z A;  2MHL A;  2W80 C;  4B61 A;  5ADX L;  3UPG A;  2Y7S A;  5DL6 A;  2XTR A;  3VZT X;  3AA1 A;  1GFM A;  2ZLD A;  4BUM X;  4KR8 A;  3HW9 A;  1GFO A;  1THQ A;  4GF4 A;  3JTY A;  4AKM A;  2ERV A;  5D5D A;  3VE1 A;  4AYE C;  1BT9 A;  3PQU A;  2KZ7 B;  5GV0 A;  4AYI D;  4RLC A;  1IZN B;  4KR4 A;  4O4U A;  4D65 A;  4F4B A;  4PUX A;  3RBH A;  2GE4 A;  2K4T A;  3T0S A;  2LFU A;  3HOL A;  3QRC A;  4E1S A;  3SY7 A;  1Q9G A;  3LK3 B;  3VE2 A;  1E54 A;  1PRN A;  2QTK A;  3UU2 A;  1QJ9 A;  3WI4 A;  1PHO A;  3POX A;  3UAQ A;  3QRA A;  4LSE A;  4FUV A;  4AKR A;  5FVN A;  3POQ A;  4RL9 A;  3HWB A;  1ZHX A;  1QJ8 A;  3EMN X;  2J1N A;  2YPV A;  3LK2 B;  4FZM A;  4LSH A;  4LSF A;  4LSI A;  1MM4 A;  4RJW A;  3VY9 X;  3AA0 A;  5ADX K;  4JFB A;  4FOZ A;  4FZL A;  3SYB A;  3A2S X;  2X27 X;  5DL5 A;  4AFK A;  4RJX A;  2FGR A;  1H6S 1;  3AAA A;  2Y0K A;  2W81 C;  1GFP A;  1P4T A;  1ORM A;  2KXP B;  3SZD A;  1HXX A;  4RLB A;  2KC0 A;  3O0E A;  2XE5 A;  3AA6 B;  4G76 A;  3POU A;  4KRA A;  2Y0H A;  1GFN A;  1ZHW A;  2F1T A;  2XE1 A;  3SZV A;  8PRN A;  4O3X B;  5G26 A;  4AZL A;  2XTQ A;  3AAE A;  3AA1 B;  3C5O A;  4O49 A;  4FSP A;  4D64 A;  3AA7 A;  3POR A;  4FZN A;  2MNH A;  5IYU A;  3VZW X;  4C69 X;  3DA4 A;  5PRN A;  3T24 A;  4AYM C;  1BXW A;  2ODJ A;  2YNK A;  5DL7 A;  1ZHY A;  4FRT A;  3TZG A;  5T5F A;  3G7G A;  3HOE A;  4E1T A;  2LHF A;  1HXT A;  4GCS A;  3FYX A;  2XE3 A;  4GCP A;  5EE2 A;  5AFU L;  1BH3 A;  4XNK A;  4N59 A;  1HXU A;  4XNL A;  3DA3 A;  1OSM A;  1YS5 A;  2M06 A;  2FGQ X;  2J4U P;  4AKR B;  3PRN A;  3SYS A;  4FMS A;  2N2L A;  1IZN A;  2Y2X A;  1ZHT A;  3WI5 A;  4Z3T A;  7PRN A;  3NSG A;  4AYN A;  3AA0 B;  4G75 A;  2ZFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...