4RLCA

Crystal structure of the n-terminal beta-barrel domain of pseudomonas aeruginosa oprf
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
160
structure length
135
Chain Sequence
b'QGQNSVEIEAFGKRYFADLYGGSIGYFLTDDVELALSYGEYHDVVHGNLTSLDAIYHFGTPGVGLRPYVSAGLAHQNITNINSDSQGRQQMTMANIGAGLKYYFTENFFAKASLDGQYGLEKGEWMAGLGVGFNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane porin F
publication title Small-Molecule Transport by CarO, an Abundant Eight-Stranded beta-Barrel Outer Membrane Protein from Acinetobacter baumannii.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
total genus 36
structure length 135
sequence length 160
ec nomenclature
pdb deposition date 2014-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 4rlcA00
1MM5A 1QJ9A 2ERVA 2F1TA 4RLCA 3C5OA 2GE4A 1QJ8A 3QRAA 2N2MA 3QRCA 1ORMA 1Q9FA 2N2LA 2JMMA 3G7GA 1Q9GA 1G90A 2K0LA 3GP6A 1QJPA 1THQA 1BXWA 2MNHA 2X27X 2M07A 2M06A 2F1VA 4PUXA 1MM4A 1P4TA 2LHFA 2MHLA
chains in the Genus database with same CATH superfamily
4B61A 3VZTX 1GFOA 1GFQA 3O0EA 5G3AA 2QTKA 5G38A 8PRNA 2ZLDA 1QJ8A 4GF4A 3SY9A 2R4NA 5E79O 4LSFA 3POQA 3VY9X 1ORMA 2N2LA 3DA4A 2JMMA 1IZNA 5KAFO 4FRTA 3WU2O 1G90A 4LSHA 4N59A 1IZNB 3SYSA 3PRNA 3BRYA 4D64A 1HXUA 4FESA 2KZ7A 3HW9A 4O4UA 2R8AA 4RL9A 3LK2A 3T20A 3POUA 2W81C 3LK2B 4N58A 4FSOA 4O3XB 4O4XA 4XNLA 1T16A 3PQUA 4AZLA 2PRNA 4KRAA 3LK42 3AA1B 5B5EO 4PUXA 2WJRA 4FZMA 3TZGA 2O4VA 2ZFGA 2IWWA 4O3ZA 2LHFA 1PRNA 4FUVA 1ZHZA 2YNKA 3SY7A 3AAEB 2MHLA 3PORA 4FZNA 4O49A 2XTQA 5GTIO 4N75A 4XNKA 1QJ9A 2ERVA 5GTHO 1BH3A 2WVPA 5T5FA 4GCPA 1ZHXA 2LFUA 2AXTO 3C5OA 4FMSA 4RLCA 1HXTA 2X9KA 1ZHWA 4JFBA 7PRNA 3QRAA 3BS0A 4N74A 4RJWA 2N2MA 3QRCA 2K4TA 1H6S1 4PJ0O 4F4BA 5IYUA 4E1SA 1Q9GA 4AYEC 4FT6A 2R4PA 3JCUO 3GP6A 5G39A 2Y0HA 3T24A 2FGQX 1BXWA 3DWNA 3SZDA 2Y2XA 3LK3A 3NJTA 5G26A 2KZ7B 4G75A 2M06A 4AFKA 4FSPA 3PF1A 5H2FO 4U9CA 4C4VA 3HOLA 4D5UA 1P4TA 3PGSA 3DA3A 4RLBA 5ADXK 3AAAA 3EMNX 5D5DA 6PRNA 1HXXA 4Z3TA 3RBHA 2XE2A 2R4OA 3FYXA 1MPFA 3WI5A 4JCHA 4D65A 4LSIA 2KDYA 1YS5A 2XE1A 3AA0A 3VE2A 4AYDC 2R89A 4K3CA 4AYMC 5ADXL 4AUIA 3KZIO 2OMFA 2W80C 4C69X 1E54A 4IL6O 1Q9FA 5DL6A 3VZWX 4AYNA 5GV0A 5DL8A 2XMXA 1THQA 3V8UA 3PGRA 2YPVA 1S5LO 3VE1A 4CTDA 3POXA 2M07A 4LSEA 3DWOX 2ODJA 3BRZA 4G76A 4PR7A 4AKRA 4KR4A 2XE3A 3LK3B 4GHBA 4UB6O 4KR8A 3HOEA 1GFPA 3T0SA 3AA6A 5FVNA 2R88A 1MM4A 1PHOA 2R4LA 3HWBA 3K19A 1ZHTA 4AYID 4C4VB 3SZVA 3JTYA 5JDPA 5DL7A 5AFUL 4FOZA 2IWVA 1OSMA 3AAAB 4GCQA 1MM5A 5EE2A 2F1TA 2XG6A 4E1TA 4RJXA 1GFNA 2GE4A 3VZUX 5PRNA 2F1CX 4O3YA 3AA0B 3KVDD 2J1NA 1GFMA 4QQ1A 2PORA 2XTRA 2Y0KA 3G7GA 4FRXA 4BUMX 2K0LA 3WI4A 4C00A 5B66O 1QJPA 3PGUA 4K3BA 2J4UP 2Y0LA 3UU2A 2MNHA 5KAIO 2X27X 4FZLA 2KXPA 2XE5A 1BT9A 1ZHYA 3A0BO 3AA1A 3PQSA 2WJQA 2KXPB 3UPGA 1OPFA 4GCSA 5AFUK 3A2SX 3DZMA 2F1VA 4FQEA 5TISO 3SYBA 3UAQA 3VY8X 4AKMA 4AKRB 1T1LA 3AA7A 3AAEA 2KC0A 3AA6B 2FGRA 2Y7SA 3A0HO 3AA7B 4UB8O 3NSGA 3LK41 5DL5A 2JQYA 4O3WA
chains in the Genus database with same CATH topology
4B61A 3VZTX 1GFOA 1GFQA 3O0EA 2QTKA 8PRNA 2ZLDA 1QJ8A 4GF4A 3SY9A 4LSFA 3POQA 3VY9X 1ORMA 2N2LA 3DA4A 2JMMA 1IZNA 4FRTA 1G90A 4LSHA 4N59A 1IZNB 3SYSA 3PRNA 4D64A 1HXUA 4FESA 2KZ7A 3HW9A 4O4UA 3T20A 4RL9A 3LK2A 3POUA 2W81C 3LK2B 4N58A 4FSOA 4O3XB 4O4XA 4XNLA 4AZLA 3PQUA 2PRNA 4KRAA 3LK42 3AA1B 4PUXA 4FZMA 3TZGA 2O4VA 2ZFGA 4O3ZA 2LHFA 1PRNA 4FUVA 1ZHZA 2YNKA 3SY7A 3AAEB 2MHLA 3PORA 4FZNA 4O49A 2XTQA 4XNKA 1QJ9A 2ERVA 1BH3A 5T5FA 4GCPA 1ZHXA 2LFUA 3C5OA 4FMSA 4RLCA 7PRNA 1HXTA 1ZHWA 4JFBA 3QRAA 4RJWA 2N2MA 3QRCA 2K4TA 1H6S1 4F4BA 5IYUA 4E1SA 1Q9GA 4AYEC 4FT6A 3GP6A 3T24A 2Y0HA 2FGQX 1BXWA 3SZDA 2Y2XA 3LK3A 5G26A 2KZ7B 4G75A 2M06A 4AFKA 4FSPA 4U9CA 3HOLA 4D5UA 1P4TA 3DA3A 4RLBA 5ADXK 3AAAA 3EMNX 5D5DA 6PRNA 1HXXA 4Z3TA 3RBHA 2XE2A 3FYXA 1MPFA 3WI5A 4JCHA 4D65A 4LSIA 2KDYA 1YS5A 2XE1A 3AA0A 3VE2A 4AYDC 4AYMC 5ADXL 4AUIA 2OMFA 2W80C 4C69X 1E54A 1Q9FA 5DL6A 3VZWX 4AYNA 5GV0A 5DL8A 2XMXA 1THQA 3V8UA 2YPVA 3VE1A 3POXA 2M07A 4LSEA 2ODJA 4G76A 4AKRA 4KR4A 2XE3A 3LK3B 4GHBA 3T0SA 4KR8A 3HOEA 1GFPA 3AA6A 5FVNA 1MM4A 1PHOA 4AYID 3HWBA 3K19A 1ZHTA 5JDPA 3SZVA 3JTYA 5DL7A 5AFUL 4FOZA 1OSMA 3AAAB 4GCQA 1MM5A 5EE2A 2F1TA 2XG6A 4E1TA 4RJXA 1GFNA 2GE4A 3VZUX 5PRNA 4O3YA 3AA0B 3KVDD 2J1NA 1GFMA 4QQ1A 2PORA 2XTRA 2Y0KA 3G7GA 4FRXA 4BUMX 2K0LA 3WI4A 1QJPA 2J4UP 2Y0LA 3UU2A 2MNHA 2X27X 4FZLA 2KXPA 2XE5A 1BT9A 1ZHYA 3PQSA 3AA1A 2KXPB 3UPGA 1OPFA 4GCSA 5AFUK 3A2SX 2F1VA 3VY8X 3SYBA 3UAQA 4AKMA 4AKRB 3AA7A 3AAEA 2KC0A 3AA6B 2FGRA 2Y7SA 3AA7B 3NSGA 3LK41 5DL5A 4O3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MM5 A;  1QJ9 A;  2ERV A;  2F1T A;  4RLC A;  3C5O A;  2GE4 A;  1QJ8 A;  3QRA A;  2N2M A;  3QRC A;  1ORM A;  1Q9F A;  2N2L A;  2JMM A;  3G7G A;  1Q9G A;  1G90 A;  2K0L A;  3GP6 A;  1QJP A;  1THQ A;  1BXW A;  2MNH A;  2X27 X;  2M07 A;  2M06 A;  2F1V A;  4PUX A;  1MM4 A;  1P4T A;  2LHF A;  2MHL A; 
#chains in the Genus database with same CATH topology
 4B61 A;  3VZT X;  1GFO A;  1GFQ A;  3O0E A;  5G3A A;  2QTK A;  5G38 A;  8PRN A;  2ZLD A;  1QJ8 A;  4GF4 A;  3SY9 A;  2R4N A;  5E79 O;  4LSF A;  3POQ A;  3VY9 X;  1ORM A;  2N2L A;  3DA4 A;  2JMM A;  1IZN A;  5KAF O;  4FRT A;  3WU2 O;  1G90 A;  4LSH A;  4N59 A;  1IZN B;  3SYS A;  3PRN A;  3BRY A;  4D64 A;  1HXU A;  4FES A;  2KZ7 A;  3HW9 A;  4O4U A;  2R8A A;  4RL9 A;  3LK2 A;  3T20 A;  3POU A;  2W81 C;  3LK2 B;  4N58 A;  4FSO A;  4O3X B;  4O4X A;  4XNL A;  1T16 A;  3PQU A;  4AZL A;  2PRN A;  4KRA A;  3LK4 2;  3AA1 B;  5B5E O;  4PUX A;  2WJR A;  4FZM A;  3TZG A;  2O4V A;  2ZFG A;  2IWW A;  4O3Z A;  2LHF A;  1PRN A;  4FUV A;  1ZHZ A;  2YNK A;  3SY7 A;  3AAE B;  2MHL A;  3POR A;  4FZN A;  4O49 A;  2XTQ A;  5GTI O;  4N75 A;  4XNK A;  1QJ9 A;  2ERV A;  5GTH O;  1BH3 A;  2WVP A;  5T5F A;  4GCP A;  1ZHX A;  2LFU A;  2AXT O;  3C5O A;  4FMS A;  4RLC A;  1HXT A;  2X9K A;  1ZHW A;  4JFB A;  7PRN A;  3QRA A;  3BS0 A;  4N74 A;  4RJW A;  2N2M A;  3QRC A;  2K4T A;  1H6S 1;  4PJ0 O;  4F4B A;  5IYU A;  4E1S A;  1Q9G A;  4AYE C;  4FT6 A;  2R4P A;  3JCU O;  3GP6 A;  5G39 A;  2Y0H A;  3T24 A;  2FGQ X;  1BXW A;  3DWN A;  3SZD A;  2Y2X A;  3LK3 A;  3NJT A;  5G26 A;  2KZ7 B;  4G75 A;  2M06 A;  4AFK A;  4FSP A;  3PF1 A;  5H2F O;  4U9C A;  4C4V A;  3HOL A;  4D5U A;  1P4T A;  3PGS A;  3DA3 A;  4RLB A;  5ADX K;  3AAA A;  3EMN X;  5D5D A;  6PRN A;  1HXX A;  4Z3T A;  3RBH A;  2XE2 A;  2R4O A;  3FYX A;  1MPF A;  3WI5 A;  4JCH A;  4D65 A;  4LSI A;  2KDY A;  1YS5 A;  2XE1 A;  3AA0 A;  3VE2 A;  4AYD C;  2R89 A;  4K3C A;  4AYM C;  5ADX L;  4AUI A;  3KZI O;  2OMF A;  2W80 C;  4C69 X;  1E54 A;  4IL6 O;  1Q9F A;  5DL6 A;  3VZW X;  4AYN A;  5GV0 A;  5DL8 A;  2XMX A;  1THQ A;  3V8U A;  3PGR A;  2YPV A;  1S5L O;  3VE1 A;  4CTD A;  3POX A;  2M07 A;  4LSE A;  3DWO X;  2ODJ A;  3BRZ A;  4G76 A;  4PR7 A;  4AKR A;  4KR4 A;  2XE3 A;  3LK3 B;  4GHB A;  4UB6 O;  4KR8 A;  3HOE A;  1GFP A;  3T0S A;  3AA6 A;  5FVN A;  2R88 A;  1MM4 A;  1PHO A;  2R4L A;  3HWB A;  3K19 A;  1ZHT A;  4AYI D;  4C4V B;  3SZV A;  3JTY A;  5JDP A;  5DL7 A;  5AFU L;  4FOZ A;  2IWV A;  1OSM A;  3AAA B;  4GCQ A;  1MM5 A;  5EE2 A;  2F1T A;  2XG6 A;  4E1T A;  4RJX A;  1GFN A;  2GE4 A;  3VZU X;  5PRN A;  2F1C X;  4O3Y A;  3AA0 B;  3KVD D;  2J1N A;  1GFM A;  4QQ1 A;  2POR A;  2XTR A;  2Y0K A;  3G7G A;  4FRX A;  4BUM X;  2K0L A;  3WI4 A;  4C00 A;  5B66 O;  1QJP A;  3PGU A;  4K3B A;  2J4U P;  2Y0L A;  3UU2 A;  2MNH A;  5KAI O;  2X27 X;  4FZL A;  2KXP A;  2XE5 A;  1BT9 A;  1ZHY A;  3A0B O;  3AA1 A;  3PQS A;  2WJQ A;  2KXP B;  3UPG A;  1OPF A;  4GCS A;  5AFU K;  3A2S X;  3DZM A;  2F1V A;  4FQE A;  5TIS O;  3SYB A;  3UAQ A;  3VY8 X;  4AKM A;  4AKR B;  1T1L A;  3AA7 A;  3AAE A;  2KC0 A;  3AA6 B;  2FGR A;  2Y7S A;  3A0H O;  3AA7 B;  4UB8 O;  3NSG A;  3LK4 1;  5DL5 A;  2JQY A;  4O3W A; 
#chains in the Genus database with same CATH homology
 4B61 A;  3VZT X;  1GFO A;  1GFQ A;  3O0E A;  2QTK A;  8PRN A;  2ZLD A;  1QJ8 A;  4GF4 A;  3SY9 A;  4LSF A;  3POQ A;  3VY9 X;  1ORM A;  2N2L A;  3DA4 A;  2JMM A;  1IZN A;  4FRT A;  1G90 A;  4LSH A;  4N59 A;  1IZN B;  3SYS A;  3PRN A;  4D64 A;  1HXU A;  4FES A;  2KZ7 A;  3HW9 A;  4O4U A;  3T20 A;  4RL9 A;  3LK2 A;  3POU A;  2W81 C;  3LK2 B;  4N58 A;  4FSO A;  4O3X B;  4O4X A;  4XNL A;  4AZL A;  3PQU A;  2PRN A;  4KRA A;  3LK4 2;  3AA1 B;  4PUX A;  4FZM A;  3TZG A;  2O4V A;  2ZFG A;  4O3Z A;  2LHF A;  1PRN A;  4FUV A;  1ZHZ A;  2YNK A;  3SY7 A;  3AAE B;  2MHL A;  3POR A;  4FZN A;  4O49 A;  2XTQ A;  4XNK A;  1QJ9 A;  2ERV A;  1BH3 A;  5T5F A;  4GCP A;  1ZHX A;  2LFU A;  3C5O A;  4FMS A;  4RLC A;  7PRN A;  1HXT A;  1ZHW A;  4JFB A;  3QRA A;  4RJW A;  2N2M A;  3QRC A;  2K4T A;  1H6S 1;  4F4B A;  5IYU A;  4E1S A;  1Q9G A;  4AYE C;  4FT6 A;  3GP6 A;  3T24 A;  2Y0H A;  2FGQ X;  1BXW A;  3SZD A;  2Y2X A;  3LK3 A;  5G26 A;  2KZ7 B;  4G75 A;  2M06 A;  4AFK A;  4FSP A;  4U9C A;  3HOL A;  4D5U A;  1P4T A;  3DA3 A;  4RLB A;  5ADX K;  3AAA A;  3EMN X;  5D5D A;  6PRN A;  1HXX A;  4Z3T A;  3RBH A;  2XE2 A;  3FYX A;  1MPF A;  3WI5 A;  4JCH A;  4D65 A;  4LSI A;  2KDY A;  1YS5 A;  2XE1 A;  3AA0 A;  3VE2 A;  4AYD C;  4AYM C;  5ADX L;  4AUI A;  2OMF A;  2W80 C;  4C69 X;  1E54 A;  1Q9F A;  5DL6 A;  3VZW X;  4AYN A;  5GV0 A;  5DL8 A;  2XMX A;  1THQ A;  3V8U A;  2YPV A;  3VE1 A;  3POX A;  2M07 A;  4LSE A;  2ODJ A;  4G76 A;  4AKR A;  4KR4 A;  2XE3 A;  3LK3 B;  4GHB A;  3T0S A;  4KR8 A;  3HOE A;  1GFP A;  3AA6 A;  5FVN A;  1MM4 A;  1PHO A;  4AYI D;  3HWB A;  3K19 A;  1ZHT A;  5JDP A;  3SZV A;  3JTY A;  5DL7 A;  5AFU L;  4FOZ A;  1OSM A;  3AAA B;  4GCQ A;  1MM5 A;  5EE2 A;  2F1T A;  2XG6 A;  4E1T A;  4RJX A;  1GFN A;  2GE4 A;  3VZU X;  5PRN A;  4O3Y A;  3AA0 B;  3KVD D;  2J1N A;  1GFM A;  4QQ1 A;  2POR A;  2XTR A;  2Y0K A;  3G7G A;  4FRX A;  4BUM X;  2K0L A;  3WI4 A;  1QJP A;  2J4U P;  2Y0L A;  3UU2 A;  2MNH A;  2X27 X;  4FZL A;  2KXP A;  2XE5 A;  1BT9 A;  1ZHY A;  3PQS A;  3AA1 A;  2KXP B;  3UPG A;  1OPF A;  4GCS A;  5AFU K;  3A2S X;  2F1V A;  3VY8 X;  3SYB A;  3UAQ A;  4AKM A;  4AKR B;  3AA7 A;  3AAE A;  2KC0 A;  3AA6 B;  2FGR A;  2Y7S A;  3AA7 B;  3NSG A;  3LK4 1;  5DL5 A;  4O3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...