4RJWA

Crystal structure of pseudomonas aeruginosa opro
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
426
structure length
426
Chain Sequence
b'RLQHHHHHHHLEGTVTTDGADIVIKTKGGLEVATTDKEFSFKLGGRLQADYSRFDGFYTKNGNTADAAYFRRAFIELGGTAYKDWKYQINFDLSHNTGSSDNGYFDEASVTYTGFNPVNLKFGRFDPDFGLEKATSSKWVTAPERNAAYELADWINTHQDGMGAQVNSTLADMAYLSAGVSAKDADDSDGDSVKQFNFRGVFAPMHEAGNVLHVGVNYAYRDLDDTAFDSRIRPRLGMRGIATSGGNDAGDNGNRATFGGVSNSPAGSYKDDSVWGLEGAWAMGPFSAQAEYLARKLKADDNAYKDIKAKGYYAQLAYTLTGESRQYKLEGAKFDSVKPENKEIGAWEVFYRYDNIKVEDDNVVADTATREVGDTKAKAHNLGVNWYVNDAVKISAAYVKAKTDKITNNNGDDDGDGFVTRLQYVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Porin O
publication title Structure, Dynamics, and Substrate Specificity of the OprO Porin from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
total genus 128
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2014-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07396 Porin_O_P Phosphate-selective porin O and P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4rjwA00
4FSOA 4JFBA 4GCSA 2XE5A 3SYBA 8PRNA 3PORA 4LSHA 2PORA 3PRNA 1GFMA 2K4TA 5FVNA 4RJWA 2ODJA 4FT6A 1OSMA 3VY9X 4KR8A 3SZDA 2XE3A 3WI4A 3VZWX 4GCPA 1BH3A 2Y2XA 4KRAA 2XG6A 1HXXA 1GFOA 1GFPA 4FOZA 2Y0HA 2XE2A 3VZUX 3HWBA 6PRNA 2ZFGA 3UU2A 3A2SX 1MPFA 3POXA 5PRNA 2Y0KA 3O0EA 4RJXA 2PRNA 1GFQA 4LSIA 2QTKA 5DL5A 2FGRA 1GFNA 3SYSA 3VZTX 5DL7A 2J1NA 3VY8X 4FSPA 4KR4A 1PRNA 5DL6A 3SZVA 4GCQA 4FMSA 2FGQX 4LSEA 3SY7A 4D65A 5DL8A 2O4VA 3K19A 4BUMX 2XE1A 7PRNA 3JTYA 1H6S1 4FRXA 1OPFA 3FYXA 2J4UP 1HXTA 2Y0LA 4FRTA 4LSFA 4D5UA 3EMNX 3NSGA 1HXUA 2OMFA 3POQA 3T24A 1PHOA 2ZLDA 1E54A 5JDPA 3UPGA 1BT9A 3SY9A 3POUA 4D64A 3T0SA 4AUIA 3HW9A 3T20A 4C69X 3WI5A
chains in the Genus database with same CATH superfamily
4FSOA 4JFBA 4GCSA 3WU2O 3PGSA 4RLBA 3DWOX 2XE5A 1QJPA 5G38A 2KC0A 3SYBA 5ADXL 8PRNA 2XTRA 3TZGA 4AFKA 3PORA 4LSHA 2PORA 3PRNA 4XNKA 1GFMA 2K4TA 5FVNA 5G3AA 4AKRA 2M07A 2KZ7A 4IL6O 4RJWA 2R88A 4B61A 2WVPA 4FZNA 1P4TA 2ODJA 2WJRA 4E1SA 4FT6A 4JCHA 4PR7A 5GTHO 5G39A 4C4VA 1OSMA 3VY9X 4F4BA 2KDYA 1YS5A 4AYID 4KR8A 5B5EO 1Q9FA 5D5DA 4AYEC 5ADXK 3SZDA 2XE3A 5AFUL 1ZHYA 1MM5A 4GCPA 3VZWX 3WI4A 1BH3A 2Y2XA 3PGUA 2WJQA 3KZIO 4KRAA 4AYMC 5GV0A 4AZLA 2XG6A 1HXXA 1GFOA 2Y7SA 1GFPA 4CTDA 1IZNA 3AA0A 3DZMA 1QJ8A 4FOZA 2R89A 2XE2A 2Y0HA 3VZUX 4AKRB 2IWWA 2KZ7B 3HWBA 2MHLA 2R8AA 4UB6O 2LFUA 3UAQA 2ZFGA 1BXWA 2X9KA 3NJTA 3A2SX 2R4PA 1MPFA 4N58A 5TISO 3UU2A 5AFUK 3POXA 5H2FO 2JQYA 5PRNA 5IYUA 3LK2B 5G26A 2Y0KA 1S5LO 3O0EA 4FUVA 4RJXA 4UB8O 4G75A 1G90A 2PRNA 3C5OA 4C00A 1GFQA 4LSIA 3VE1A 2QTKA 3AAAA 5DL5A 5KAIO 2ERVA 3AA7A 2FGRA 1GFNA 3A0HO 3AAEB 3BRYA 3QRCA 4G76A 4N75A 2KXPA 4O3WA 3SYSA 3VZTX 2LHFA 5DL7A 2YPVA 1IZNB 4FZLA 2J1NA 2XMXA 1THQA 5T5FA 4RLCA 3VY8X 4FSPA 4O4XA 4KR4A 3V8UA 2N2LA 1PRNA 4E1TA 5EE2A 5DL6A 1ZHZA 3HOEA 4AKMA 3SZVA 1ORMA 4GCQA 1T1LA 3PQSA 2FGQX 4FMSA 4O3YA 2R4OA 2J4UP 2K0LA 2R4LA 1ZHTA 4LSEA 4AYDC 1ZHXA 4RL9A 2GE4A 4C4VB 3LK42 3SY7A 3VE2A 2JMMA 4D65A 5DL8A 2F1VA 6PRNA 2XTQA 2O4VA 3AA6A 3AA7B 4N59A 5E79O 3K19A 5KAFO 4BUMX 2W81C 2W80C 3A0BO 3KVDD 4GF4A 4U9CA 2XE1A 3HOLA 3PF1A 4FESA 4GHBA 4O4UA 1T16A 3LK3A 7PRNA 4K3BA 2AXTO 3JTYA 1H6S1 1ZHWA 3QRAA 3DA3A 1OPFA 4FRXA 3FYXA 3AA0B 4FZMA 1HXTA 2Y0LA 4FRTA 4LSFA 4N74A 3AA1A 4QQ1A 3EMNX 3PQUA 3JCUO 4D5UA 3RBHA 3NSGA 4Z3TA 4O3ZA 1HXUA 2OMFA 3PGRA 4XNLA 2YNKA 3GP6A 4O3XB 3POQA 3T24A 2M06A 1PHOA 2N2MA 3DWNA 3AA6B 2ZLDA 1E54A 3LK41 4K3CA 5JDPA 4PJ0O 3LK2A 1QJ9A 4AYNA 3UPGA 1MM4A 1BT9A 2MNHA 2X27X 3AAAB 3G7GA 5GTIO 3SY9A 5B66O 3POUA 2R4NA 3T0SA 4AUIA 2KXPB 3LK3B 1Q9GA 3HW9A 4D64A 3BS0A 3T20A 4O49A 4C69X 3BRZA 4PUXA 3WI5A 3DA4A 2IWVA 3AAEA 4FQEA 2F1CX 2F1TA 3AA1B
chains in the Genus database with same CATH topology
4FSOA 4JFBA 4GCSA 4RLBA 2XE5A 1QJPA 3SYBA 2KC0A 5ADXL 8PRNA 3TZGA 4AFKA 3PORA 4LSHA 2PORA 3PRNA 4XNKA 1GFMA 2K4TA 5FVNA 4AKRA 2M07A 2KZ7A 4RJWA 4B61A 4FZNA 1P4TA 2ODJA 4E1SA 4FT6A 4JCHA 1OSMA 3VY9X 4F4BA 2KDYA 1YS5A 4AYID 4KR8A 1Q9FA 5D5DA 4AYEC 5ADXK 3SZDA 2XE3A 5AFUL 1ZHYA 1MM5A 4GCPA 3VZWX 3WI4A 1BH3A 2Y2XA 4KRAA 4AYMC 5GV0A 4AZLA 2XG6A 1HXXA 1GFOA 2Y7SA 1GFPA 1IZNA 3AA0A 1QJ8A 4FOZA 2Y0HA 2XE2A 3VZUX 4AKRB 2KZ7B 3HWBA 2MHLA 3UAQA 2LFUA 6PRNA 2ZFGA 1BXWA 3UU2A 3A2SX 5AFUK 1MPFA 4N58A 3POXA 5PRNA 5IYUA 3LK2B 5G26A 2Y0KA 3O0EA 4FUVA 4RJXA 4G75A 1G90A 2PRNA 3C5OA 1GFQA 4LSIA 3VE1A 2QTKA 3AAAA 5DL5A 2ERVA 3AA7A 2FGRA 1GFNA 3AAEB 3QRCA 4G76A 4O3WA 2KXPA 3SYSA 3VZTX 2LHFA 5DL7A 2YPVA 1IZNB 4FZLA 2J1NA 2XMXA 1THQA 5T5FA 4RLCA 3VY8X 4FSPA 4O4XA 4KR4A 3V8UA 2N2LA 1PRNA 4E1TA 5EE2A 5DL6A 1ZHZA 3HOEA 4AKMA 3SZVA 1ORMA 4GCQA 3PQSA 4FMSA 2FGQX 4O3YA 2J4UP 2K0LA 1ZHTA 4LSEA 4AYDC 1ZHXA 4RL9A 2GE4A 3LK42 3SY7A 3VE2A 2JMMA 4D65A 5DL8A 2F1VA 2XTQA 2O4VA 3AA6A 3AA7B 4N59A 3K19A 4BUMX 2W81C 2W80C 3KVDD 4GF4A 4U9CA 2XE1A 3HOLA 4FESA 4GHBA 4O4UA 3LK3A 7PRNA 3JTYA 1H6S1 1ZHWA 3QRAA 3DA3A 1OPFA 4FRXA 3FYXA 3AA0B 4FZMA 1HXTA 2Y0LA 4FRTA 4LSFA 4QQ1A 3AA1A 4D5UA 3EMNX 3PQUA 3RBHA 3NSGA 4Z3TA 4O3ZA 1HXUA 2OMFA 4XNLA 2YNKA 3GP6A 4O3XB 3POQA 3T24A 2M06A 1PHOA 2N2MA 3LK41 3AA6B 2ZLDA 1E54A 5JDPA 3LK2A 1QJ9A 4AYNA 3UPGA 1MM4A 1BT9A 2MNHA 2X27X 3AAAB 3G7GA 3SY9A 3POUA 4D64A 3T0SA 4AUIA 2KXPB 3LK3B 1Q9GA 3HW9A 3T20A 4O49A 4C69X 4PUXA 3WI5A 3DA4A 3AAEA 2XTRA 2F1TA 3AA1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FSO A;  4JFB A;  4GCS A;  2XE5 A;  3SYB A;  8PRN A;  3POR A;  4LSH A;  2POR A;  3PRN A;  1GFM A;  2K4T A;  5FVN A;  4RJW A;  2ODJ A;  4FT6 A;  1OSM A;  3VY9 X;  4KR8 A;  3SZD A;  2XE3 A;  3WI4 A;  3VZW X;  4GCP A;  1BH3 A;  2Y2X A;  4KRA A;  2XG6 A;  1HXX A;  1GFO A;  1GFP A;  4FOZ A;  2Y0H A;  2XE2 A;  3VZU X;  3HWB A;  6PRN A;  2ZFG A;  3UU2 A;  3A2S X;  1MPF A;  3POX A;  5PRN A;  2Y0K A;  3O0E A;  4RJX A;  2PRN A;  1GFQ A;  4LSI A;  2QTK A;  5DL5 A;  2FGR A;  1GFN A;  3SYS A;  3VZT X;  5DL7 A;  2J1N A;  3VY8 X;  4FSP A;  4KR4 A;  1PRN A;  5DL6 A;  3SZV A;  4GCQ A;  4FMS A;  2FGQ X;  4LSE A;  3SY7 A;  4D65 A;  5DL8 A;  2O4V A;  3K19 A;  4BUM X;  2XE1 A;  7PRN A;  3JTY A;  1H6S 1;  4FRX A;  1OPF A;  3FYX A;  2J4U P;  1HXT A;  2Y0L A;  4FRT A;  4LSF A;  4D5U A;  3EMN X;  3NSG A;  1HXU A;  2OMF A;  3POQ A;  3T24 A;  1PHO A;  2ZLD A;  1E54 A;  5JDP A;  3UPG A;  1BT9 A;  3SY9 A;  3POU A;  4D64 A;  3T0S A;  4AUI A;  3HW9 A;  3T20 A;  4C69 X;  3WI5 A; 
#chains in the Genus database with same CATH topology
 4FSO A;  4JFB A;  4GCS A;  3WU2 O;  3PGS A;  4RLB A;  3DWO X;  2XE5 A;  1QJP A;  5G38 A;  2KC0 A;  3SYB A;  5ADX L;  8PRN A;  2XTR A;  3TZG A;  4AFK A;  3POR A;  4LSH A;  2POR A;  3PRN A;  4XNK A;  1GFM A;  2K4T A;  5FVN A;  5G3A A;  4AKR A;  2M07 A;  2KZ7 A;  4IL6 O;  4RJW A;  2R88 A;  4B61 A;  2WVP A;  4FZN A;  1P4T A;  2ODJ A;  2WJR A;  4E1S A;  4FT6 A;  4JCH A;  4PR7 A;  5GTH O;  5G39 A;  4C4V A;  1OSM A;  3VY9 X;  4F4B A;  2KDY A;  1YS5 A;  4AYI D;  4KR8 A;  5B5E O;  1Q9F A;  5D5D A;  4AYE C;  5ADX K;  3SZD A;  2XE3 A;  5AFU L;  1ZHY A;  1MM5 A;  4GCP A;  3VZW X;  3WI4 A;  1BH3 A;  2Y2X A;  3PGU A;  2WJQ A;  3KZI O;  4KRA A;  4AYM C;  5GV0 A;  4AZL A;  2XG6 A;  1HXX A;  1GFO A;  2Y7S A;  1GFP A;  4CTD A;  1IZN A;  3AA0 A;  3DZM A;  1QJ8 A;  4FOZ A;  2R89 A;  2XE2 A;  2Y0H A;  3VZU X;  4AKR B;  2IWW A;  2KZ7 B;  3HWB A;  2MHL A;  2R8A A;  4UB6 O;  2LFU A;  3UAQ A;  2ZFG A;  1BXW A;  2X9K A;  3NJT A;  3A2S X;  2R4P A;  1MPF A;  4N58 A;  5TIS O;  3UU2 A;  5AFU K;  3POX A;  5H2F O;  2JQY A;  5PRN A;  5IYU A;  3LK2 B;  5G26 A;  2Y0K A;  1S5L O;  3O0E A;  4FUV A;  4RJX A;  4UB8 O;  4G75 A;  1G90 A;  2PRN A;  3C5O A;  4C00 A;  1GFQ A;  4LSI A;  3VE1 A;  2QTK A;  3AAA A;  5DL5 A;  5KAI O;  2ERV A;  3AA7 A;  2FGR A;  1GFN A;  3A0H O;  3AAE B;  3BRY A;  3QRC A;  4G76 A;  4N75 A;  2KXP A;  4O3W A;  3SYS A;  3VZT X;  2LHF A;  5DL7 A;  2YPV A;  1IZN B;  4FZL A;  2J1N A;  2XMX A;  1THQ A;  5T5F A;  4RLC A;  3VY8 X;  4FSP A;  4O4X A;  4KR4 A;  3V8U A;  2N2L A;  1PRN A;  4E1T A;  5EE2 A;  5DL6 A;  1ZHZ A;  3HOE A;  4AKM A;  3SZV A;  1ORM A;  4GCQ A;  1T1L A;  3PQS A;  2FGQ X;  4FMS A;  4O3Y A;  2R4O A;  2J4U P;  2K0L A;  2R4L A;  1ZHT A;  4LSE A;  4AYD C;  1ZHX A;  4RL9 A;  2GE4 A;  4C4V B;  3LK4 2;  3SY7 A;  3VE2 A;  2JMM A;  4D65 A;  5DL8 A;  2F1V A;  6PRN A;  2XTQ A;  2O4V A;  3AA6 A;  3AA7 B;  4N59 A;  5E79 O;  3K19 A;  5KAF O;  4BUM X;  2W81 C;  2W80 C;  3A0B O;  3KVD D;  4GF4 A;  4U9C A;  2XE1 A;  3HOL A;  3PF1 A;  4FES A;  4GHB A;  4O4U A;  1T16 A;  3LK3 A;  7PRN A;  4K3B A;  2AXT O;  3JTY A;  1H6S 1;  1ZHW A;  3QRA A;  3DA3 A;  1OPF A;  4FRX A;  3FYX A;  3AA0 B;  4FZM A;  1HXT A;  2Y0L A;  4FRT A;  4LSF A;  4N74 A;  3AA1 A;  4QQ1 A;  3EMN X;  3PQU A;  3JCU O;  4D5U A;  3RBH A;  3NSG A;  4Z3T A;  4O3Z A;  1HXU A;  2OMF A;  3PGR A;  4XNL A;  2YNK A;  3GP6 A;  4O3X B;  3POQ A;  3T24 A;  2M06 A;  1PHO A;  2N2M A;  3DWN A;  3AA6 B;  2ZLD A;  1E54 A;  3LK4 1;  4K3C A;  5JDP A;  4PJ0 O;  3LK2 A;  1QJ9 A;  4AYN A;  3UPG A;  1MM4 A;  1BT9 A;  2MNH A;  2X27 X;  3AAA B;  3G7G A;  5GTI O;  3SY9 A;  5B66 O;  3POU A;  2R4N A;  3T0S A;  4AUI A;  2KXP B;  3LK3 B;  1Q9G A;  3HW9 A;  4D64 A;  3BS0 A;  3T20 A;  4O49 A;  4C69 X;  3BRZ A;  4PUX A;  3WI5 A;  3DA4 A;  2IWV A;  3AAE A;  4FQE A;  2F1C X;  2F1T A;  3AA1 B; 
#chains in the Genus database with same CATH homology
 4FSO A;  4JFB A;  4GCS A;  4RLB A;  2XE5 A;  1QJP A;  3SYB A;  2KC0 A;  5ADX L;  8PRN A;  3TZG A;  4AFK A;  3POR A;  4LSH A;  2POR A;  3PRN A;  4XNK A;  1GFM A;  2K4T A;  5FVN A;  4AKR A;  2M07 A;  2KZ7 A;  4RJW A;  4B61 A;  4FZN A;  1P4T A;  2ODJ A;  4E1S A;  4FT6 A;  4JCH A;  1OSM A;  3VY9 X;  4F4B A;  2KDY A;  1YS5 A;  4AYI D;  4KR8 A;  1Q9F A;  5D5D A;  4AYE C;  5ADX K;  3SZD A;  2XE3 A;  5AFU L;  1ZHY A;  1MM5 A;  4GCP A;  3VZW X;  3WI4 A;  1BH3 A;  2Y2X A;  4KRA A;  4AYM C;  5GV0 A;  4AZL A;  2XG6 A;  1HXX A;  1GFO A;  2Y7S A;  1GFP A;  1IZN A;  3AA0 A;  1QJ8 A;  4FOZ A;  2Y0H A;  2XE2 A;  3VZU X;  4AKR B;  2KZ7 B;  3HWB A;  2MHL A;  3UAQ A;  2LFU A;  6PRN A;  2ZFG A;  1BXW A;  3UU2 A;  3A2S X;  5AFU K;  1MPF A;  4N58 A;  3POX A;  5PRN A;  5IYU A;  3LK2 B;  5G26 A;  2Y0K A;  3O0E A;  4FUV A;  4RJX A;  4G75 A;  1G90 A;  2PRN A;  3C5O A;  1GFQ A;  4LSI A;  3VE1 A;  2QTK A;  3AAA A;  5DL5 A;  2ERV A;  3AA7 A;  2FGR A;  1GFN A;  3AAE B;  3QRC A;  4G76 A;  4O3W A;  2KXP A;  3SYS A;  3VZT X;  2LHF A;  5DL7 A;  2YPV A;  1IZN B;  4FZL A;  2J1N A;  2XMX A;  1THQ A;  5T5F A;  4RLC A;  3VY8 X;  4FSP A;  4O4X A;  4KR4 A;  3V8U A;  2N2L A;  1PRN A;  4E1T A;  5EE2 A;  5DL6 A;  1ZHZ A;  3HOE A;  4AKM A;  3SZV A;  1ORM A;  4GCQ A;  3PQS A;  4FMS A;  2FGQ X;  4O3Y A;  2J4U P;  2K0L A;  1ZHT A;  4LSE A;  4AYD C;  1ZHX A;  4RL9 A;  2GE4 A;  3LK4 2;  3SY7 A;  3VE2 A;  2JMM A;  4D65 A;  5DL8 A;  2F1V A;  2XTQ A;  2O4V A;  3AA6 A;  3AA7 B;  4N59 A;  3K19 A;  4BUM X;  2W81 C;  2W80 C;  3KVD D;  4GF4 A;  4U9C A;  2XE1 A;  3HOL A;  4FES A;  4GHB A;  4O4U A;  3LK3 A;  7PRN A;  3JTY A;  1H6S 1;  1ZHW A;  3QRA A;  3DA3 A;  1OPF A;  4FRX A;  3FYX A;  3AA0 B;  4FZM A;  1HXT A;  2Y0L A;  4FRT A;  4LSF A;  4QQ1 A;  3AA1 A;  4D5U A;  3EMN X;  3PQU A;  3RBH A;  3NSG A;  4Z3T A;  4O3Z A;  1HXU A;  2OMF A;  4XNL A;  2YNK A;  3GP6 A;  4O3X B;  3POQ A;  3T24 A;  2M06 A;  1PHO A;  2N2M A;  3LK4 1;  3AA6 B;  2ZLD A;  1E54 A;  5JDP A;  3LK2 A;  1QJ9 A;  4AYN A;  3UPG A;  1MM4 A;  1BT9 A;  2MNH A;  2X27 X;  3AAA B;  3G7G A;  3SY9 A;  3POU A;  4D64 A;  3T0S A;  4AUI A;  2KXP B;  3LK3 B;  1Q9G A;  3HW9 A;  3T20 A;  4O49 A;  4C69 X;  4PUX A;  3WI5 A;  3DA4 A;  3AAE A;  2XTR A;  2F1T A;  3AA1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...