4RJWA

Crystal structure of pseudomonas aeruginosa opro
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
426
structure length
426
Chain Sequence
RLQHHHHHHHLEGTVTTDGADIVIKTKGGLEVATTDKEFSFKLGGRLQADYSRFDGFYTKNGNTADAAYFRRAFIELGGTAYKDWKYQINFDLSHNTGSSDNGYFDEASVTYTGFNPVNLKFGRFDPDFGLEKATSSKWVTAPERNAAYELADWINTHQDGMGAQVNSTLADMAYLSAGVSAKDADDSDGDSVKQFNFRGVFAPMHEAGNVLHVGVNYAYRDLDDTAFDSRIRPRLGMRGIATSGGNDAGDNGNRATFGGVSNSPAGSYKDDSVWGLEGAWAMGPFSAQAEYLARKLKADDNAYKDIKAKGYYAQLAYTLTGESRQYKLEGAKFDSVKPENKEIGAWEVFYRYDNIKVEDDNVVADTATREVGDTKAKAHNLGVNWYVNDAVKISAAYVKAKTDKITNNNGDDDGDGFVTRLQYVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Porin O
publication title Structure, Dynamics, and Substrate Specificity of the OprO Porin from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 128
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2014-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07396 Porin_O_P Phosphate-selective porin O and P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4rjwA00
3T20A 3T0SA 3SYSA 3POQA 3VZUX 2FGQX 3PRNA 2FGRA 4FSOA 4KRAA 3NSGA 3K19A 4FMSA 3VZWX 3SY7A 2J1NA 1PHOA 4FT6A 1BT9A 2J4UP 4C69X 3UPGA 2K4TA 3SZDA 4BUMX 4D5UA 1PRNA 3HWBA 4D65A 5FVNA 4FSPA 4GCPA 4GCSA 1OSMA 3POXA 2XE2A 8PRNA 6PRNA 4RJXA 4LSEA 2XG6A 2XE3A 3EMNX 2ODJA 3VY8X 4D64A 4GCQA 3WI4A 4RJWA 1GFNA 1HXXA 3A2SX 5DL7A 3UU2A 5PRNA 2ZFGA 3O0EA 2Y0KA 3T24A 3PORA 1GFQA 3HW9A 3FYXA 1E54A 2ZLDA 2OMFA 4LSIA 4KR4A 4LSHA 2XE1A 4LSFA 4AUIA 2PRNA 2Y2XA 3POUA 3VZTX 4FRXA 2Y0HA 3WI5A 2Y0LA 3SYBA 5DL6A 1GFMA 5JDPA 7PRNA 4JFBA 1MPFA 4FRTA 2QTKA 1HXTA 1GFOA 5DL8A 3SZVA 3SY9A 4KR8A 3VY9X 2O4VA 2PORA 2XE5A 1GFPA 5DL5A 1OPFA 4FOZA 1BH3A 1H6S1 3JTYA 1HXUA
chains in the Genus database with same CATH superfamily
3T20A 2WJQA 5B66O 2KXPB 2R4LA 5E79O 2KXPA 1T1LA 3SYSA 3T0SA 2KDYA 3AA0B 3POQA 5G39A 2FGQX 2GE4A 3LK2A 3VZUX 3PRNA 3PGRA 2R4NA 4AYNA 5KAFO 1YS5A 2FGRA 2XTQA 4FSOA 4KRAA 3DWNA 4N59A 2K0LA 4O4XA 3NSGA 3AA7B 3K19A 3DA4A 4FMSA 3PF1A 3SY7A 2N2MA 3VZWX 1P4TA 1IZNA 1ZHYA 3PQSA 4G76A 1QJ9A 2J1NA 4CTDA 1PHOA 2Y7SA 3WU2O 4FT6A 4AFKA 1BT9A 4FQEA 2J4UP 4C69X 3AAEB 8PRNA 3UPGA 4AKRB 2ERVA 1T16A 2R88A 1Q9GA 2K4TA 3SZDA 3RBHA 4BUMX 4D5UA 1PRNA 2X9KA 2XMXA 1QJPA 3HWBA 3QRCA 4D65A 5FVNA 2F1TA 3QRAA 4FSPA 3TZGA 4GCPA 1S5LO 4GCSA 4UB6O 1OSMA 3AA0A 1ZHTA 2XE2A 3PGUA 3POXA 4AYID 4QQ1A 4C4VB 4O3XB 2R89A 4RJXA 4RLBA 4XNKA 4LSEA 3KVDD 4E1SA 2XG6A 3G7GA 2XE3A 2JMMA 3DA3A 3EMNX 2ODJA 2R4OA 2W81C 3A0BO 4C00A 4B61A 3VY8X 4D64A 4GCQA 3AA1B 3WI4A 4RJWA 1GFNA 3AA7A 4GHBA 1HXXA 5TISO 3A2SX 5DL7A 3KZIO 1ORMA 5G26A 3UU2A 5AFUL 4PR7A 2ZFGA 3O0EA 3HOLA 2Y0KA 5PRNA 4FUVA 2R4PA 3A0HO 4IL6O 3DZMA 3T24A 4O49A 3PORA 4UB8O 1GFQA 3AAEA 3FYXA 3HW9A 5T5FA 4AKRA 5G3AA 3DWOX 5KAIO 1QJ8A 3C5OA 3VE2A 1E54A 5H2FO 1MM4A 2ZLDA 4PUXA 4FZNA 2OMFA 4FESA 3GP6A 4LSIA 4KR4A 3AA6B 3BRYA 4LSHA 2XE1A 4F4BA 2W80C 4C4VA 2MNHA 4LSFA 5ADXL 4AUIA 2M06A 2KZ7B 2KC0A 5GV0A 2PRNA 4FZLA 2Y2XA 3AAAB 3POUA 1Q9FA 3BRZA 2IWWA 3VZTX 3PGSA 3AA1A 4FRXA 3V8UA 2Y0HA 3VE1A 3UAQA 2WJRA 2Y0LA 3SYBA 3WI5A 5AFUK 4N75A 5DL6A 4JCHA 5IYUA 3LK41 3BS0A 1GFMA 4FZMA 2LHFA 4K3BA 6PRNA 5JDPA 2IWVA 7PRNA 4Z3TA 1G90A 4G75A 2R8AA 4GF4A 1MPFA 4JFBA 4U9CA 4AYDC 2LFUA 2N2LA 4FRTA 1BXWA 1THQA 3LK2B 2WVPA 5G38A 2XTRA 1ZHWA 2QTKA 3HOEA 2AXTO 1HXTA 2F1VA 3LK42 4RL9A 3AA6A 5ADXK 1GFOA 5DL8A 3LK3B 3SZVA 3LK3A 5D5DA 4N74A 3SY9A 4AYEC 4AZLA 4KR8A 5GTIO 4O3WA 1IZNB 2KZ7A 4XNLA 2M07A 2JQYA 2MHLA 4O3ZA 2O4VA 5EE2A 3VY9X 3AAAA 3PQUA 2PORA 2X27X 4PJ0O 4AKMA 4O3YA 2XE5A 1GFPA 4K3CA 1OPFA 3JCUO 4N58A 4RLCA 3NJTA 5DL5A 4FOZA 1BH3A 1H6S1 3JTYA 4O4UA 4E1TA 1HXUA 1MM5A 1ZHZA 1ZHXA 5GTHO 2YPVA 5B5EO 4AYMC 2YNKA 2F1CX
chains in the Genus database with same CATH topology
3T20A 2KXPB 3T0SA 2KXPA 3SYSA 2KDYA 3AA0B 3POQA 3VZUX 2FGQX 2GE4A 3LK2A 3PRNA 4AYNA 1YS5A 2FGRA 2XTQA 4FSOA 4KRAA 4N59A 4O4XA 2K0LA 3NSGA 3AA7B 3K19A 3DA4A 4FMSA 3VZWX 3SY7A 2N2MA 1P4TA 1IZNA 1ZHYA 3PQSA 4G76A 1QJ9A 2J1NA 1PHOA 2Y7SA 4FT6A 4AFKA 1BT9A 2J4UP 4C69X 3AAEB 3UPGA 4AKRB 2ERVA 1Q9GA 2K4TA 3SZDA 3RBHA 4BUMX 4D5UA 1PRNA 2XMXA 3QRCA 1QJPA 3HWBA 4D65A 5FVNA 2F1TA 3QRAA 4FSPA 3TZGA 4GCPA 4GCSA 1OSMA 3AA0A 1ZHTA 2XE2A 3POXA 8PRNA 4AYID 4QQ1A 6PRNA 4O3XB 4RLBA 4RJXA 4XNKA 4LSEA 3KVDD 4E1SA 2XG6A 3G7GA 2XE3A 2JMMA 3DA3A 3EMNX 2ODJA 2W81C 4B61A 3VY8X 4D64A 4GCQA 3AA1B 3WI4A 4RJWA 1GFNA 3AA7A 4GHBA 1HXXA 3A2SX 5DL7A 1ORMA 5G26A 3UU2A 5AFUL 5PRNA 2ZFGA 3O0EA 3HOLA 2Y0KA 4FUVA 3T24A 4O49A 3PORA 1GFQA 3AAEA 3FYXA 3HW9A 5T5FA 4AKRA 3VE2A 1QJ8A 3C5OA 1E54A 1MM4A 2ZLDA 4PUXA 4FZNA 2OMFA 4FESA 3GP6A 4LSIA 4KR4A 3AA6B 4F4BA 4LSHA 2XE1A 2W80C 2MNHA 4LSFA 5ADXL 4AUIA 2M06A 2KZ7B 2KC0A 2PRNA 4FZLA 2Y2XA 3AAAB 3POUA 1Q9FA 3VZTX 3AA1A 4FRXA 3V8UA 2Y0HA 3VE1A 3UAQA 2Y0LA 3SYBA 3WI5A 5AFUK 5IYUA 5DL6A 4JCHA 3LK41 1GFMA 4FZMA 2LHFA 5JDPA 7PRNA 4Z3TA 1G90A 4G75A 4GF4A 4JFBA 1MPFA 4U9CA 4AYDC 2LFUA 2N2LA 4FRTA 1BXWA 1THQA 3LK2B 2XTRA 1ZHWA 2QTKA 3HOEA 1HXTA 2F1VA 3LK42 4RL9A 3AA6A 5ADXK 1GFOA 5DL8A 3LK3B 3SZVA 3LK3A 5D5DA 3SY9A 4AYEC 4AZLA 4KR8A 4O3WA 1IZNB 2KZ7A 4XNLA 2M07A 2MHLA 5EE2A 4O3ZA 2O4VA 3VY9X 5GV0A 3AAAA 3PQUA 2PORA 2X27X 4AKMA 4O3YA 2XE5A 1GFPA 4N58A 1OPFA 5DL5A 4RLCA 4FOZA 1BH3A 1H6S1 3JTYA 4O4UA 4E1TA 1HXUA 1MM5A 1ZHZA 1ZHXA 2YPVA 4AYMC 2YNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T20 A;  3T0S A;  3SYS A;  3POQ A;  3VZU X;  2FGQ X;  3PRN A;  2FGR A;  4FSO A;  4KRA A;  3NSG A;  3K19 A;  4FMS A;  3VZW X;  3SY7 A;  2J1N A;  1PHO A;  4FT6 A;  1BT9 A;  2J4U P;  4C69 X;  3UPG A;  2K4T A;  3SZD A;  4BUM X;  4D5U A;  1PRN A;  3HWB A;  4D65 A;  5FVN A;  4FSP A;  4GCP A;  4GCS A;  1OSM A;  3POX A;  2XE2 A;  8PRN A;  6PRN A;  4RJX A;  4LSE A;  2XG6 A;  2XE3 A;  3EMN X;  2ODJ A;  3VY8 X;  4D64 A;  4GCQ A;  3WI4 A;  4RJW A;  1GFN A;  1HXX A;  3A2S X;  5DL7 A;  3UU2 A;  5PRN A;  2ZFG A;  3O0E A;  2Y0K A;  3T24 A;  3POR A;  1GFQ A;  3HW9 A;  3FYX A;  1E54 A;  2ZLD A;  2OMF A;  4LSI A;  4KR4 A;  4LSH A;  2XE1 A;  4LSF A;  4AUI A;  2PRN A;  2Y2X A;  3POU A;  3VZT X;  4FRX A;  2Y0H A;  3WI5 A;  2Y0L A;  3SYB A;  5DL6 A;  1GFM A;  5JDP A;  7PRN A;  4JFB A;  1MPF A;  4FRT A;  2QTK A;  1HXT A;  1GFO A;  5DL8 A;  3SZV A;  3SY9 A;  4KR8 A;  3VY9 X;  2O4V A;  2POR A;  2XE5 A;  1GFP A;  5DL5 A;  1OPF A;  4FOZ A;  1BH3 A;  1H6S 1;  3JTY A;  1HXU A; 
#chains in the Genus database with same CATH topology
 3T20 A;  2WJQ A;  5B66 O;  2KXP B;  2R4L A;  5E79 O;  2KXP A;  1T1L A;  3SYS A;  3T0S A;  2KDY A;  3AA0 B;  3POQ A;  5G39 A;  2FGQ X;  2GE4 A;  3LK2 A;  3VZU X;  3PRN A;  3PGR A;  2R4N A;  4AYN A;  5KAF O;  1YS5 A;  2FGR A;  2XTQ A;  4FSO A;  4KRA A;  3DWN A;  4N59 A;  2K0L A;  4O4X A;  3NSG A;  3AA7 B;  3K19 A;  3DA4 A;  4FMS A;  3PF1 A;  3SY7 A;  2N2M A;  3VZW X;  1P4T A;  1IZN A;  1ZHY A;  3PQS A;  4G76 A;  1QJ9 A;  2J1N A;  4CTD A;  1PHO A;  2Y7S A;  3WU2 O;  4FT6 A;  4AFK A;  1BT9 A;  4FQE A;  2J4U P;  4C69 X;  3AAE B;  8PRN A;  3UPG A;  4AKR B;  2ERV A;  1T16 A;  2R88 A;  1Q9G A;  2K4T A;  3SZD A;  3RBH A;  4BUM X;  4D5U A;  1PRN A;  2X9K A;  2XMX A;  1QJP A;  3HWB A;  3QRC A;  4D65 A;  5FVN A;  2F1T A;  3QRA A;  4FSP A;  3TZG A;  4GCP A;  1S5L O;  4GCS A;  4UB6 O;  1OSM A;  3AA0 A;  1ZHT A;  2XE2 A;  3PGU A;  3POX A;  4AYI D;  4QQ1 A;  4C4V B;  4O3X B;  2R89 A;  4RJX A;  4RLB A;  4XNK A;  4LSE A;  3KVD D;  4E1S A;  2XG6 A;  3G7G A;  2XE3 A;  2JMM A;  3DA3 A;  3EMN X;  2ODJ A;  2R4O A;  2W81 C;  3A0B O;  4C00 A;  4B61 A;  3VY8 X;  4D64 A;  4GCQ A;  3AA1 B;  3WI4 A;  4RJW A;  1GFN A;  3AA7 A;  4GHB A;  1HXX A;  5TIS O;  3A2S X;  5DL7 A;  3KZI O;  1ORM A;  5G26 A;  3UU2 A;  5AFU L;  4PR7 A;  2ZFG A;  3O0E A;  3HOL A;  2Y0K A;  5PRN A;  4FUV A;  2R4P A;  3A0H O;  4IL6 O;  3DZM A;  3T24 A;  4O49 A;  3POR A;  4UB8 O;  1GFQ A;  3AAE A;  3FYX A;  3HW9 A;  5T5F A;  4AKR A;  5G3A A;  3DWO X;  5KAI O;  1QJ8 A;  3C5O A;  3VE2 A;  1E54 A;  5H2F O;  1MM4 A;  2ZLD A;  4PUX A;  4FZN A;  2OMF A;  4FES A;  3GP6 A;  4LSI A;  4KR4 A;  3AA6 B;  3BRY A;  4LSH A;  2XE1 A;  4F4B A;  2W80 C;  4C4V A;  2MNH A;  4LSF A;  5ADX L;  4AUI A;  2M06 A;  2KZ7 B;  2KC0 A;  5GV0 A;  2PRN A;  4FZL A;  2Y2X A;  3AAA B;  3POU A;  1Q9F A;  3BRZ A;  2IWW A;  3VZT X;  3PGS A;  3AA1 A;  4FRX A;  3V8U A;  2Y0H A;  3VE1 A;  3UAQ A;  2WJR A;  2Y0L A;  3SYB A;  3WI5 A;  5AFU K;  4N75 A;  5DL6 A;  4JCH A;  5IYU A;  3LK4 1;  3BS0 A;  1GFM A;  4FZM A;  2LHF A;  4K3B A;  6PRN A;  5JDP A;  2IWV A;  7PRN A;  4Z3T A;  1G90 A;  4G75 A;  2R8A A;  4GF4 A;  1MPF A;  4JFB A;  4U9C A;  4AYD C;  2LFU A;  2N2L A;  4FRT A;  1BXW A;  1THQ A;  3LK2 B;  2WVP A;  5G38 A;  2XTR A;  1ZHW A;  2QTK A;  3HOE A;  2AXT O;  1HXT A;  2F1V A;  3LK4 2;  4RL9 A;  3AA6 A;  5ADX K;  1GFO A;  5DL8 A;  3LK3 B;  3SZV A;  3LK3 A;  5D5D A;  4N74 A;  3SY9 A;  4AYE C;  4AZL A;  4KR8 A;  5GTI O;  4O3W A;  1IZN B;  2KZ7 A;  4XNL A;  2M07 A;  2JQY A;  2MHL A;  4O3Z A;  2O4V A;  5EE2 A;  3VY9 X;  3AAA A;  3PQU A;  2POR A;  2X27 X;  4PJ0 O;  4AKM A;  4O3Y A;  2XE5 A;  1GFP A;  4K3C A;  1OPF A;  3JCU O;  4N58 A;  4RLC A;  3NJT A;  5DL5 A;  4FOZ A;  1BH3 A;  1H6S 1;  3JTY A;  4O4U A;  4E1T A;  1HXU A;  1MM5 A;  1ZHZ A;  1ZHX A;  5GTH O;  2YPV A;  5B5E O;  4AYM C;  2YNK A;  2F1C X; 
#chains in the Genus database with same CATH homology
 3T20 A;  2KXP B;  3T0S A;  2KXP A;  3SYS A;  2KDY A;  3AA0 B;  3POQ A;  3VZU X;  2FGQ X;  2GE4 A;  3LK2 A;  3PRN A;  4AYN A;  1YS5 A;  2FGR A;  2XTQ A;  4FSO A;  4KRA A;  4N59 A;  4O4X A;  2K0L A;  3NSG A;  3AA7 B;  3K19 A;  3DA4 A;  4FMS A;  3VZW X;  3SY7 A;  2N2M A;  1P4T A;  1IZN A;  1ZHY A;  3PQS A;  4G76 A;  1QJ9 A;  2J1N A;  1PHO A;  2Y7S A;  4FT6 A;  4AFK A;  1BT9 A;  2J4U P;  4C69 X;  3AAE B;  3UPG A;  4AKR B;  2ERV A;  1Q9G A;  2K4T A;  3SZD A;  3RBH A;  4BUM X;  4D5U A;  1PRN A;  2XMX A;  3QRC A;  1QJP A;  3HWB A;  4D65 A;  5FVN A;  2F1T A;  3QRA A;  4FSP A;  3TZG A;  4GCP A;  4GCS A;  1OSM A;  3AA0 A;  1ZHT A;  2XE2 A;  3POX A;  8PRN A;  4AYI D;  4QQ1 A;  6PRN A;  4O3X B;  4RLB A;  4RJX A;  4XNK A;  4LSE A;  3KVD D;  4E1S A;  2XG6 A;  3G7G A;  2XE3 A;  2JMM A;  3DA3 A;  3EMN X;  2ODJ A;  2W81 C;  4B61 A;  3VY8 X;  4D64 A;  4GCQ A;  3AA1 B;  3WI4 A;  4RJW A;  1GFN A;  3AA7 A;  4GHB A;  1HXX A;  3A2S X;  5DL7 A;  1ORM A;  5G26 A;  3UU2 A;  5AFU L;  5PRN A;  2ZFG A;  3O0E A;  3HOL A;  2Y0K A;  4FUV A;  3T24 A;  4O49 A;  3POR A;  1GFQ A;  3AAE A;  3FYX A;  3HW9 A;  5T5F A;  4AKR A;  3VE2 A;  1QJ8 A;  3C5O A;  1E54 A;  1MM4 A;  2ZLD A;  4PUX A;  4FZN A;  2OMF A;  4FES A;  3GP6 A;  4LSI A;  4KR4 A;  3AA6 B;  4F4B A;  4LSH A;  2XE1 A;  2W80 C;  2MNH A;  4LSF A;  5ADX L;  4AUI A;  2M06 A;  2KZ7 B;  2KC0 A;  2PRN A;  4FZL A;  2Y2X A;  3AAA B;  3POU A;  1Q9F A;  3VZT X;  3AA1 A;  4FRX A;  3V8U A;  2Y0H A;  3VE1 A;  3UAQ A;  2Y0L A;  3SYB A;  3WI5 A;  5AFU K;  5IYU A;  5DL6 A;  4JCH A;  3LK4 1;  1GFM A;  4FZM A;  2LHF A;  5JDP A;  7PRN A;  4Z3T A;  1G90 A;  4G75 A;  4GF4 A;  4JFB A;  1MPF A;  4U9C A;  4AYD C;  2LFU A;  2N2L A;  4FRT A;  1BXW A;  1THQ A;  3LK2 B;  2XTR A;  1ZHW A;  2QTK A;  3HOE A;  1HXT A;  2F1V A;  3LK4 2;  4RL9 A;  3AA6 A;  5ADX K;  1GFO A;  5DL8 A;  3LK3 B;  3SZV A;  3LK3 A;  5D5D A;  3SY9 A;  4AYE C;  4AZL A;  4KR8 A;  4O3W A;  1IZN B;  2KZ7 A;  4XNL A;  2M07 A;  2MHL A;  5EE2 A;  4O3Z A;  2O4V A;  3VY9 X;  5GV0 A;  3AAA A;  3PQU A;  2POR A;  2X27 X;  4AKM A;  4O3Y A;  2XE5 A;  1GFP A;  4N58 A;  1OPF A;  5DL5 A;  4RLC A;  4FOZ A;  1BH3 A;  1H6S 1;  3JTY A;  4O4U A;  4E1T A;  1HXU A;  1MM5 A;  1ZHZ A;  1ZHX A;  2YPV A;  4AYM C;  2YNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...