4RJWA

Crystal structure of pseudomonas aeruginosa opro
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
426
structure length
426
Chain Sequence
RLQHHHHHHHLEGTVTTDGADIVIKTKGGLEVATTDKEFSFKLGGRLQADYSRFDGFYTKNGNTADAAYFRRAFIELGGTAYKDWKYQINFDLSHNTGSSDNGYFDEASVTYTGFNPVNLKFGRFDPDFGLEKATSSKWVTAPERNAAYELADWINTHQDGMGAQVNSTLADMAYLSAGVSAKDADDSDGDSVKQFNFRGVFAPMHEAGNVLHVGVNYAYRDLDDTAFDSRIRPRLGMRGIATSGGNDAGDNGNRATFGGVSNSPAGSYKDDSVWGLEGAWAMGPFSAQAEYLARKLKADDNAYKDIKAKGYYAQLAYTLTGESRQYKLEGAKFDSVKPENKEIGAWEVFYRYDNIKVEDDNVVADTATREVGDTKAKAHNLGVNWYVNDAVKISAAYVKAKTDKITNNNGDDDGDGFVTRLQYVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Porin O
publication title Structure, Dynamics, and Substrate Specificity of the OprO Porin from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
total genus 128
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2014-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07396 Porin_O_P Phosphate-selective porin O and P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4rjwA00
1MPFA 4D5UA 4D65A 4FSOA 1HXXA 2O4VA 3FYXA 4FOZA 3SY7A 4GCSA 3HWBA 3UPGA 3POUA 4FMSA 1HXUA 2XE1A 4C69X 3T0SA 1OPFA 5DL7A 4RJXA 2XE2A 1E54A 2Y2XA 4LSFA 2J1NA 3VZTX 2QTKA 4AUIA 2ODJA 1HXTA 3PRNA 2K4TA 3SZVA 3O0EA 5PRNA 4KR8A 1H6S1 2ZLDA 2Y0KA 5DL8A 6PRNA 2ZFGA 3PORA 3T20A 5JDPA 1BT9A 1PRNA 4FRXA 5DL5A 1GFPA 1PHOA 3A2SX 2OMFA 3WI5A 3EMNX 4FT6A 3VZUX 1OSMA 3SYSA 1GFNA 3VY8X 2J4UP 3SY9A 1BH3A 3UU2A 1GFQA 4LSEA 4RJWA 1GFMA 3NSGA 5DL6A 3T24A 4BUMX 2PORA 3JTYA 2FGRA 4GCPA 3VY9X 4JFBA 4KRAA 4KR4A 3HW9A 7PRNA 2XE3A 4LSHA 4FRTA 8PRNA 5FVNA 3SZDA 2XE5A 4LSIA 2XG6A 3SYBA 4FSPA 3VZWX 3WI4A 3K19A 2Y0HA 4GCQA 3POQA 2PRNA 1GFOA 4D64A 3POXA 2FGQX 2Y0LA
chains in the Genus database with same CATH superfamily
1ORMA 3TZGA 1MPFA 3LK41 3HOLA 4D5UA 3GP6A 4D65A 5ADXL 4K3BA 4FSOA 2XTQA 1P4TA 2KC0A 2MNHA 1HXXA 4C4VB 4IL6O 2O4VA 4F4BA 3FYXA 1Q9GA 4FOZA 3SY7A 4GCSA 4AFKA 5KAFO 2X9KA 4N58A 4Z3TA 2XMXA 1IZNB 3HWBA 3UPGA 3PQUA 5IYUA 5H2FO 1IZNA 3POUA 4FMSA 4UB8O 4O4UA 1HXUA 2XE1A 4C69X 5T5FA 4PR7A 4B61A 3T0SA 1ZHXA 2IWVA 1OPFA 4PUXA 4E1SA 4FZMA 5DL7A 4O3YA 3PGSA 3KZIO 3AA6B 5GTHO 5TISO 1G90A 3AA6A 2ERVA 1ZHTA 4RJXA 3DZMA 3JCUO 4CTDA 2XE2A 1E54A 2Y2XA 2YPVA 3KVDD 4LSFA 4O4XA 1T1LA 4AZLA 4AKMA 5B5EO 2J1NA 1ZHYA 3VZTX 2QTKA 4AUIA 2KXPB 2ODJA 3BRYA 1HXTA 3LK3B 3PRNA 2K4TA 4JCHA 4XNKA 3O0EA 3SZVA 2N2LA 3LK3A 4G76A 2YNKA 4G75A 4C4VA 4N74A 5EE2A 5PRNA 5G26A 3VE2A 5AFUK 4KR8A 2XTRA 4PJ0O 2Y7SA 1H6S1 3BS0A 4FUVA 3DWOX 2ZLDA 4N75A 4E1TA 2Y0KA 5DL8A 5E79O 4AYID 5B66O 1YS5A 2ZFGA 3C5OA 3PORA 4FZNA 6PRNA 1QJ9A 2W81C 2WJQA 3T20A 5JDPA 3QRAA 2R4OA 1BT9A 1PRNA 3PF1A 4FQEA 5AFUL 4FRXA 1THQA 4U9CA 2X27X 5DL5A 1GFPA 1PHOA 3A2SX 2OMFA 5GV0A 4N59A 3AA0B 3WI5A 3EMNX 2LFUA 3NJTA 4FT6A 3AA0A 3VZUX 3AA7B 1QJ8A 4GHBA 2F1TA 2KXPA 3AA1B 3AA7A 1OSMA 3G7GA 4O49A 1GFNA 4K3CA 3SYSA 3AA1A 3VY8X 2J4UP 2R4PA 3AAAB 3SY9A 2N2MA 1T16A 3AAAA 1BH3A 5G39A 2W80C 3LK2B 2F1VA 2F1CX 2JQYA 4FESA 1GFQA 4LSEA 4RJWA 3RBHA 3UU2A 3LK2A 1GFMA 2R89A 2JMMA 3NSGA 1MM5A 4O3ZA 4QQ1A 5GTIO 4AYNA 5DL6A 3T24A 3DA4A 2PORA 5G3AA 2WVPA 4BUMX 4AYEC 1BXWA 3JTYA 2FGRA 1Q9FA 2M07A 2R8AA 4GCPA 3VY9X 4JFBA 4AKRB 5ADXK 3HOEA 4AKRA 1QJPA 4KRAA 4KR4A 2KZ7B 4RL9A 2M06A 3HW9A 4UB6O 4AYMC 7PRNA 2KZ7A 3BRZA 2XE3A 4RLCA 4LSHA 4FRTA 2IWWA 5G38A 2AXTO 4GF4A 8PRNA 5FVNA 1ZHZA 2WJRA 4O3WA 3WU2O 1ZHWA 3LK42 4RLBA 3SZDA 4XNLA 3V8UA 2XE5A 4LSIA 3PGRA 4FZLA 4AYDC 2XG6A 3SYBA 2KDYA 4FSPA 3VZWX 3WI4A 3K19A 2Y0HA 3PGUA 4GCQA 3POQA 3A0BO 4O3XB 2LHFA 2PRNA 3QRCA 4C00A 3DWNA 1GFOA 2GE4A 3A0HO 1S5LO 3DA3A 1MM4A 4D64A 3AAEB 2MHLA 5D5DA 3POXA 5KAIO 2R4NA 2R4LA 2R88A 2FGQX 3AAEA 3UAQA 3VE1A 2K0LA 2Y0LA 3PQSA
chains in the Genus database with same CATH topology
1ORMA 3TZGA 1MPFA 3LK41 3HOLA 4D5UA 3GP6A 4D65A 5ADXL 4FSOA 2XTQA 1P4TA 2KC0A 2MNHA 1HXXA 2O4VA 4F4BA 3FYXA 1Q9GA 4FOZA 3SY7A 4GCSA 4AFKA 4N58A 4Z3TA 2XMXA 1IZNB 3HWBA 3UPGA 3PQUA 5IYUA 1IZNA 3POUA 4FMSA 4O4UA 1HXUA 2XE1A 4C69X 5T5FA 4B61A 3T0SA 1ZHXA 1OPFA 4PUXA 4E1SA 4FZMA 5DL7A 4O3YA 3AA6B 1G90A 3AA6A 2ERVA 1ZHTA 4RJXA 2XE2A 1E54A 2Y2XA 2YPVA 3KVDD 4LSFA 4O4XA 4AZLA 4AKMA 2J1NA 1ZHYA 3VZTX 2QTKA 4AUIA 2KXPB 2ODJA 3LK3B 1HXTA 3PRNA 2K4TA 4JCHA 4XNKA 3O0EA 3SZVA 2N2LA 3LK3A 4G76A 2YNKA 4G75A 5EE2A 5PRNA 5G26A 3VE2A 5AFUK 4KR8A 2XTRA 2Y7SA 1H6S1 4FUVA 2ZLDA 4E1TA 2Y0KA 5DL8A 6PRNA 4AYID 1YS5A 2ZFGA 3C5OA 3PORA 4FZNA 3T20A 1QJ9A 2W81C 5JDPA 3QRAA 1BT9A 1PRNA 4FRXA 1THQA 4U9CA 2X27X 5DL5A 1GFPA 1PHOA 3A2SX 2OMFA 5GV0A 4N59A 3AA0B 3WI5A 3EMNX 2LFUA 4FT6A 3AA0A 3VZUX 3AA7B 1QJ8A 4GHBA 2F1TA 2KXPA 3AA1B 3AA7A 1OSMA 3G7GA 4O49A 1GFNA 3SYSA 3VY8X 3AA1A 2J4UP 3AAAB 3SY9A 2N2MA 3AAAA 1BH3A 2W80C 3LK2B 2F1VA 4FESA 5AFUL 3UU2A 1GFQA 4LSEA 4RJWA 3RBHA 3LK2A 1GFMA 2JMMA 3NSGA 1MM5A 4O3ZA 4QQ1A 4AYNA 5DL6A 3T24A 3DA4A 2PORA 4BUMX 4AYEC 1BXWA 3JTYA 2FGRA 1Q9FA 2M07A 4GCPA 3VY9X 4JFBA 4AKRB 5ADXK 3HOEA 4AKRA 1QJPA 4KRAA 4KR4A 2KZ7B 4RL9A 2M06A 3HW9A 4AYMC 7PRNA 2KZ7A 2XE3A 4RLCA 4LSHA 4FRTA 4GF4A 8PRNA 5FVNA 1ZHZA 4O3WA 1ZHWA 3LK42 4RLBA 3SZDA 4XNLA 3V8UA 2XE5A 4LSIA 4AYDC 4FZLA 2XG6A 3SYBA 2KDYA 4FSPA 3VZWX 3WI4A 3K19A 2Y0HA 4GCQA 3POQA 4O3XB 2LHFA 2PRNA 3QRCA 1GFOA 2GE4A 3DA3A 1MM4A 4D64A 3AAEB 2MHLA 5D5DA 3POXA 3UAQA 3AAEA 2FGQX 3VE1A 2K0LA 2Y0LA 3PQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MPF A;  4D5U A;  4D65 A;  4FSO A;  1HXX A;  2O4V A;  3FYX A;  4FOZ A;  3SY7 A;  4GCS A;  3HWB A;  3UPG A;  3POU A;  4FMS A;  1HXU A;  2XE1 A;  4C69 X;  3T0S A;  1OPF A;  5DL7 A;  4RJX A;  2XE2 A;  1E54 A;  2Y2X A;  4LSF A;  2J1N A;  3VZT X;  2QTK A;  4AUI A;  2ODJ A;  1HXT A;  3PRN A;  2K4T A;  3SZV A;  3O0E A;  5PRN A;  4KR8 A;  1H6S 1;  2ZLD A;  2Y0K A;  5DL8 A;  6PRN A;  2ZFG A;  3POR A;  3T20 A;  5JDP A;  1BT9 A;  1PRN A;  4FRX A;  5DL5 A;  1GFP A;  1PHO A;  3A2S X;  2OMF A;  3WI5 A;  3EMN X;  4FT6 A;  3VZU X;  1OSM A;  3SYS A;  1GFN A;  3VY8 X;  2J4U P;  3SY9 A;  1BH3 A;  3UU2 A;  1GFQ A;  4LSE A;  4RJW A;  1GFM A;  3NSG A;  5DL6 A;  3T24 A;  4BUM X;  2POR A;  3JTY A;  2FGR A;  4GCP A;  3VY9 X;  4JFB A;  4KRA A;  4KR4 A;  3HW9 A;  7PRN A;  2XE3 A;  4LSH A;  4FRT A;  8PRN A;  5FVN A;  3SZD A;  2XE5 A;  4LSI A;  2XG6 A;  3SYB A;  4FSP A;  3VZW X;  3WI4 A;  3K19 A;  2Y0H A;  4GCQ A;  3POQ A;  2PRN A;  1GFO A;  4D64 A;  3POX A;  2FGQ X;  2Y0L A; 
#chains in the Genus database with same CATH topology
 1ORM A;  3TZG A;  1MPF A;  3LK4 1;  3HOL A;  4D5U A;  3GP6 A;  4D65 A;  5ADX L;  4K3B A;  4FSO A;  2XTQ A;  1P4T A;  2KC0 A;  2MNH A;  1HXX A;  4C4V B;  4IL6 O;  2O4V A;  4F4B A;  3FYX A;  1Q9G A;  4FOZ A;  3SY7 A;  4GCS A;  4AFK A;  5KAF O;  2X9K A;  4N58 A;  4Z3T A;  2XMX A;  1IZN B;  3HWB A;  3UPG A;  3PQU A;  5IYU A;  5H2F O;  1IZN A;  3POU A;  4FMS A;  4UB8 O;  4O4U A;  1HXU A;  2XE1 A;  4C69 X;  5T5F A;  4PR7 A;  4B61 A;  3T0S A;  1ZHX A;  2IWV A;  1OPF A;  4PUX A;  4E1S A;  4FZM A;  5DL7 A;  4O3Y A;  3PGS A;  3KZI O;  3AA6 B;  5GTH O;  5TIS O;  1G90 A;  3AA6 A;  2ERV A;  1ZHT A;  4RJX A;  3DZM A;  3JCU O;  4CTD A;  2XE2 A;  1E54 A;  2Y2X A;  2YPV A;  3KVD D;  4LSF A;  4O4X A;  1T1L A;  4AZL A;  4AKM A;  5B5E O;  2J1N A;  1ZHY A;  3VZT X;  2QTK A;  4AUI A;  2KXP B;  2ODJ A;  3BRY A;  1HXT A;  3LK3 B;  3PRN A;  2K4T A;  4JCH A;  4XNK A;  3O0E A;  3SZV A;  2N2L A;  3LK3 A;  4G76 A;  2YNK A;  4G75 A;  4C4V A;  4N74 A;  5EE2 A;  5PRN A;  5G26 A;  3VE2 A;  5AFU K;  4KR8 A;  2XTR A;  4PJ0 O;  2Y7S A;  1H6S 1;  3BS0 A;  4FUV A;  3DWO X;  2ZLD A;  4N75 A;  4E1T A;  2Y0K A;  5DL8 A;  5E79 O;  4AYI D;  5B66 O;  1YS5 A;  2ZFG A;  3C5O A;  3POR A;  4FZN A;  6PRN A;  1QJ9 A;  2W81 C;  2WJQ A;  3T20 A;  5JDP A;  3QRA A;  2R4O A;  1BT9 A;  1PRN A;  3PF1 A;  4FQE A;  5AFU L;  4FRX A;  1THQ A;  4U9C A;  2X27 X;  5DL5 A;  1GFP A;  1PHO A;  3A2S X;  2OMF A;  5GV0 A;  4N59 A;  3AA0 B;  3WI5 A;  3EMN X;  2LFU A;  3NJT A;  4FT6 A;  3AA0 A;  3VZU X;  3AA7 B;  1QJ8 A;  4GHB A;  2F1T A;  2KXP A;  3AA1 B;  3AA7 A;  1OSM A;  3G7G A;  4O49 A;  1GFN A;  4K3C A;  3SYS A;  3AA1 A;  3VY8 X;  2J4U P;  2R4P A;  3AAA B;  3SY9 A;  2N2M A;  1T16 A;  3AAA A;  1BH3 A;  5G39 A;  2W80 C;  3LK2 B;  2F1V A;  2F1C X;  2JQY A;  4FES A;  1GFQ A;  4LSE A;  4RJW A;  3RBH A;  3UU2 A;  3LK2 A;  1GFM A;  2R89 A;  2JMM A;  3NSG A;  1MM5 A;  4O3Z A;  4QQ1 A;  5GTI O;  4AYN A;  5DL6 A;  3T24 A;  3DA4 A;  2POR A;  5G3A A;  2WVP A;  4BUM X;  4AYE C;  1BXW A;  3JTY A;  2FGR A;  1Q9F A;  2M07 A;  2R8A A;  4GCP A;  3VY9 X;  4JFB A;  4AKR B;  5ADX K;  3HOE A;  4AKR A;  1QJP A;  4KRA A;  4KR4 A;  2KZ7 B;  4RL9 A;  2M06 A;  3HW9 A;  4UB6 O;  4AYM C;  7PRN A;  2KZ7 A;  3BRZ A;  2XE3 A;  4RLC A;  4LSH A;  4FRT A;  2IWW A;  5G38 A;  2AXT O;  4GF4 A;  8PRN A;  5FVN A;  1ZHZ A;  2WJR A;  4O3W A;  3WU2 O;  1ZHW A;  3LK4 2;  4RLB A;  3SZD A;  4XNL A;  3V8U A;  2XE5 A;  4LSI A;  3PGR A;  4FZL A;  4AYD C;  2XG6 A;  3SYB A;  2KDY A;  4FSP A;  3VZW X;  3WI4 A;  3K19 A;  2Y0H A;  3PGU A;  4GCQ A;  3POQ A;  3A0B O;  4O3X B;  2LHF A;  2PRN A;  3QRC A;  4C00 A;  3DWN A;  1GFO A;  2GE4 A;  3A0H O;  1S5L O;  3DA3 A;  1MM4 A;  4D64 A;  3AAE B;  2MHL A;  5D5D A;  3POX A;  5KAI O;  2R4N A;  2R4L A;  2R88 A;  2FGQ X;  3AAE A;  3UAQ A;  3VE1 A;  2K0L A;  2Y0L A;  3PQS A; 
#chains in the Genus database with same CATH homology
 1ORM A;  3TZG A;  1MPF A;  3LK4 1;  3HOL A;  4D5U A;  3GP6 A;  4D65 A;  5ADX L;  4FSO A;  2XTQ A;  1P4T A;  2KC0 A;  2MNH A;  1HXX A;  2O4V A;  4F4B A;  3FYX A;  1Q9G A;  4FOZ A;  3SY7 A;  4GCS A;  4AFK A;  4N58 A;  4Z3T A;  2XMX A;  1IZN B;  3HWB A;  3UPG A;  3PQU A;  5IYU A;  1IZN A;  3POU A;  4FMS A;  4O4U A;  1HXU A;  2XE1 A;  4C69 X;  5T5F A;  4B61 A;  3T0S A;  1ZHX A;  1OPF A;  4PUX A;  4E1S A;  4FZM A;  5DL7 A;  4O3Y A;  3AA6 B;  1G90 A;  3AA6 A;  2ERV A;  1ZHT A;  4RJX A;  2XE2 A;  1E54 A;  2Y2X A;  2YPV A;  3KVD D;  4LSF A;  4O4X A;  4AZL A;  4AKM A;  2J1N A;  1ZHY A;  3VZT X;  2QTK A;  4AUI A;  2KXP B;  2ODJ A;  3LK3 B;  1HXT A;  3PRN A;  2K4T A;  4JCH A;  4XNK A;  3O0E A;  3SZV A;  2N2L A;  3LK3 A;  4G76 A;  2YNK A;  4G75 A;  5EE2 A;  5PRN A;  5G26 A;  3VE2 A;  5AFU K;  4KR8 A;  2XTR A;  2Y7S A;  1H6S 1;  4FUV A;  2ZLD A;  4E1T A;  2Y0K A;  5DL8 A;  6PRN A;  4AYI D;  1YS5 A;  2ZFG A;  3C5O A;  3POR A;  4FZN A;  3T20 A;  1QJ9 A;  2W81 C;  5JDP A;  3QRA A;  1BT9 A;  1PRN A;  4FRX A;  1THQ A;  4U9C A;  2X27 X;  5DL5 A;  1GFP A;  1PHO A;  3A2S X;  2OMF A;  5GV0 A;  4N59 A;  3AA0 B;  3WI5 A;  3EMN X;  2LFU A;  4FT6 A;  3AA0 A;  3VZU X;  3AA7 B;  1QJ8 A;  4GHB A;  2F1T A;  2KXP A;  3AA1 B;  3AA7 A;  1OSM A;  3G7G A;  4O49 A;  1GFN A;  3SYS A;  3VY8 X;  3AA1 A;  2J4U P;  3AAA B;  3SY9 A;  2N2M A;  3AAA A;  1BH3 A;  2W80 C;  3LK2 B;  2F1V A;  4FES A;  5AFU L;  3UU2 A;  1GFQ A;  4LSE A;  4RJW A;  3RBH A;  3LK2 A;  1GFM A;  2JMM A;  3NSG A;  1MM5 A;  4O3Z A;  4QQ1 A;  4AYN A;  5DL6 A;  3T24 A;  3DA4 A;  2POR A;  4BUM X;  4AYE C;  1BXW A;  3JTY A;  2FGR A;  1Q9F A;  2M07 A;  4GCP A;  3VY9 X;  4JFB A;  4AKR B;  5ADX K;  3HOE A;  4AKR A;  1QJP A;  4KRA A;  4KR4 A;  2KZ7 B;  4RL9 A;  2M06 A;  3HW9 A;  4AYM C;  7PRN A;  2KZ7 A;  2XE3 A;  4RLC A;  4LSH A;  4FRT A;  4GF4 A;  8PRN A;  5FVN A;  1ZHZ A;  4O3W A;  1ZHW A;  3LK4 2;  4RLB A;  3SZD A;  4XNL A;  3V8U A;  2XE5 A;  4LSI A;  4AYD C;  4FZL A;  2XG6 A;  3SYB A;  2KDY A;  4FSP A;  3VZW X;  3WI4 A;  3K19 A;  2Y0H A;  4GCQ A;  3POQ A;  4O3X B;  2LHF A;  2PRN A;  3QRC A;  1GFO A;  2GE4 A;  3DA3 A;  1MM4 A;  4D64 A;  3AAE B;  2MHL A;  5D5D A;  3POX A;  3UAQ A;  3AAE A;  2FGQ X;  3VE1 A;  2K0L A;  2Y0L A;  3PQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...