4FRTA

Crystal structure of pseudomonas aeruginosa occk7 (opdd)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
389
structure length
370
Chain Sequence
b'GKAGLELRNFYFNRDYRQPSQSYSEEWAQGFLLRYESGYTEGLFGLGVDALGLLGVRLDSSPERSYSTSDRRAAHDYSSLGLTAKLRVSHSTLKIGTLMPRLPVVQFNDTRLHPQTFQGGLLEVNEIDGLALQFGQLRQVKQRDSTNAEDLGITRGNKRNVSDRFDFAGGTYRWSERLSSSYHYANLEDFYRQHHLGVQHLLPLADDQSLKSDIRWARSTDEGRVNNRALNALFTYRLGGHAFGLGYQRMSGDSGFAYLAGTDPYLVNFVQIGDFANKDERSWQLRYDYDFAAIGLPGLTFMSRYLRGEHIDLLDGGGRGKEWERDTDIAYLVGPLKNLGIKLRNGTFRSDFGNDIDETRLIVSYALPLW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable porin
publication title Crystal Structures of OccK Subfamily Proteins
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
total genus 85
structure length 370
sequence length 389
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4frtA00
4LSFA 1OSMA 4FOZA 2PRNA 3SYBA 2FGRA 3SYSA 4FSPA 1GFMA 4D64A 3T24A 3PRNA 3HWBA 3FYXA 4D5UA 3SZDA 3NSGA 1HXUA 1BH3A 4KR8A 4RJXA 2Y2XA 4FT6A 2FGQX 3A2SX 3JTYA 4FRTA 2J1NA 5FVNA 3POQA 2O4VA 5DL5A 5JDPA 4GCPA 2ZFGA 5DL8A 2ODJA 4FSOA 3VY8X 5DL6A 4D65A 3PORA 3T0SA 1GFNA 1BT9A 2Y0KA 3VZUX 3POUA 3O0EA 7PRNA 1HXXA 3UU2A 2Y0LA 4LSIA 4RJWA 2QTKA 2XE5A 2XE1A 3SY7A 4KR4A 3VZWX 4GCSA 2PORA 2OMFA 6PRNA 3VZTX 3EMNX 1PHOA 5PRNA 2J4UP 1OPFA 4JFBA 3WI5A 1E54A 4BUMX 4FRXA 2XE3A 5DL7A 4LSEA 4KRAA 1GFOA 3VY9X 3UPGA 3WI4A 4LSHA 1HXTA 4AUIA 2K4TA 1H6S1 1PRNA 4C69X 8PRNA 1MPFA 3SZVA 2ZLDA 1GFPA 3HW9A 3POXA 3K19A 2Y0HA 2XG6A 4GCQA 3SY9A 2XE2A 4FMSA 1GFQA 3T20A
chains in the Genus database with same CATH superfamily
4LSFA 1OSMA 4FOZA 4XNLA 5AFUL 2R4LA 4N58A 2IWVA 5IYUA 3DWNA 4UB8O 2PRNA 3AA0A 5KAIO 4AKMA 1MM4A 4RL9A 3SYBA 2WJRA 4K3BA 3PGRA 2N2LA 4O4UA 4PJ0O 2FGRA 3BRZA 2KZ7B 2R88A 3SYSA 2ERVA 2W81C 3AAAA 4FSPA 2AXTO 1GFMA 4K3CA 3LK2A 4D64A 4RLBA 3T24A 4UB6O 3PRNA 5T5FA 4AYID 3HWBA 4E1SA 3FYXA 4D5UA 3SZDA 3DA4A 2N2MA 1HXUA 1BH3A 3NSGA 4KR8A 4RJXA 3LK3A 3VE1A 2Y2XA 4FT6A 3A0BO 1T16A 1THQA 2FGQX 3A2SX 1ZHXA 3BS0A 2LHFA 3GP6A 3JTYA 4O3ZA 2W80C 4B61A 4AYMC 1IZNB 1ORMA 3HOLA 5KAFO 4FRTA 3TZGA 3AA6A 2F1VA 4AFKA 2J1NA 5FVNA 3POQA 2O4VA 3G7GA 5ADXK 2K0LA 3AA7A 2IWWA 5DL5A 4E1TA 1QJ9A 5JDPA 2KC0A 3QRAA 4U9CA 1QJ8A 1ZHWA 3RBHA 4GCPA 1MM5A 3VE2A 4FZLA 4GHBA 2ZFGA 4O3WA 5D5DA 5DL8A 1Q9FA 3DWOX 3PGUA 1ZHYA 1P4TA 2ODJA 4FZMA 4FSOA 5B66O 4O3XB 4IL6O 4G76A 4RLCA 5DL6A 3VY8X 4D65A 4O3YA 4N75A 4GF4A 4AYDC 3AAEB 3PORA 4Z3TA 4AKRB 3BRYA 4JCHA 3T0SA 2R4NA 4FZNA 1GFNA 1Q9GA 1BT9A 2Y0KA 4AYNA 4N74A 2R89A 4FESA 3UAQA 3DA3A 4PUXA 1G90A 3PF1A 4C4VB 3VZUX 1IZNA 3POUA 2YNKA 4AYEC 3PQSA 5H2FO 3O0EA 5G38A 7PRNA 2JQYA 1HXXA 2XTRA 3UU2A 3KZIO 5B5EO 2R8AA 2KXPB 5GV0A 5ADXL 2Y0LA 4LSIA 2XTQA 2R4PA 4RJWA 2QTKA 2XE5A 1YS5A 2M07A 2WJQA 4O4XA 2XE1A 5G3AA 3SY7A 4FUVA 4KR4A 3LK42 3VZWX 1T1LA 2YPVA 3AAAB 4GCSA 2KZ7A 2PORA 2OMFA 4FMSA 6PRNA 3VZTX 3EMNX 3DZMA 1PHOA 2X9KA 5PRNA 1ZHTA 3AAEA 2WVPA 4G75A 2J4UP 4AKRA 5E79O 1OPFA 3AA1B 4JFBA 4FQEA 3C5OA 2XMXA 3WI5A 1E54A 4BUMX 4FRXA 4F4BA 2XE3A 1QJPA 3NJTA 4LSEA 5DL7A 4KRAA 5TISO 2JMMA 1GFOA 4O49A 4C4VA 2MNHA 5GTHO 2KDYA 4XNKA 3AA6B 4PR7A 3VY9X 3V8UA 5AFUK 3UPGA 3WI4A 4AZLA 4LSHA 2F1TA 1ZHZA 2KXPA 3AA7B 3KVDD 3QRCA 3AA0B 1HXTA 4QQ1A 3A0HO 4AUIA 1BXWA 2F1CX 2K4TA 5EE2A 4C00A 1H6S1 1PRNA 4C69X 8PRNA 1MPFA 2M06A 3SZVA 2ZLDA 5G39A 1GFPA 3LK2B 3PGSA 2MHLA 2LFUA 2Y7SA 3HW9A 3AA1A 2X27X 4CTDA 3POXA 5G26A 2GE4A 2R4OA 3PQUA 5GTIO 3WU2O 3K19A 2Y0HA 2XG6A 4GCQA 4N59A 3LK3B 3SY9A 3LK41 1S5LO 2XE2A 3HOEA 3JCUO 1GFQA 3T20A
chains in the Genus database with same CATH topology
4LSFA 1OSMA 4FOZA 5AFUL 4N58A 5IYUA 2PRNA 3AA0A 4AKMA 1MM4A 4RL9A 3SYBA 2N2LA 4O4UA 2FGRA 2KZ7B 3SYSA 2ERVA 2W81C 3AAAA 4FSPA 1GFMA 3LK2A 4D64A 4RLBA 3T24A 3PRNA 5T5FA 4AYID 3HWBA 4E1SA 3FYXA 4D5UA 3SZDA 3DA4A 2N2MA 1HXUA 1BH3A 3NSGA 4KR8A 4RJXA 3LK3A 3VE1A 2Y2XA 4FT6A 1THQA 2FGQX 3A2SX 1ZHXA 3JTYA 2LHFA 3GP6A 4O3ZA 2W80C 4B61A 4AYMC 1IZNB 1ORMA 3HOLA 4FRTA 3TZGA 3AA6A 2F1VA 4AFKA 2J1NA 5FVNA 3POQA 2O4VA 3G7GA 5ADXK 2K0LA 3AA7A 5DL5A 4E1TA 1QJ9A 5JDPA 2KC0A 3QRAA 4U9CA 1QJ8A 1ZHWA 3RBHA 4GCPA 1MM5A 3VE2A 4FZLA 4GHBA 2ZFGA 4O3WA 5D5DA 5DL8A 1Q9FA 1ZHYA 1P4TA 2ODJA 4FZMA 4FSOA 4O3XB 5DL6A 4G76A 4RLCA 3VY8X 4D65A 4O3YA 4GF4A 4AYDC 3AAEB 3PORA 4Z3TA 4AKRB 4JCHA 3T0SA 4FZNA 1GFNA 1Q9GA 1BT9A 2Y0KA 4AYNA 4FESA 3UAQA 3DA3A 4PUXA 1G90A 3VZUX 1IZNA 3POUA 2YNKA 4AYEC 3PQSA 3O0EA 7PRNA 1HXXA 2XTRA 3UU2A 2KXPB 5GV0A 5ADXL 2Y0LA 4LSIA 2XTQA 4RJWA 2QTKA 2XE5A 1YS5A 2M07A 4O4XA 2XE1A 3SY7A 4FUVA 4KR4A 3LK42 3VZWX 2YPVA 3AAAB 4GCSA 2KZ7A 2PORA 2OMFA 4FMSA 6PRNA 3VZTX 3EMNX 1PHOA 5PRNA 1ZHTA 3AAEA 4G75A 2J4UP 4AKRA 1OPFA 3AA1B 4JFBA 4F4BA 3C5OA 2XMXA 3WI5A 1E54A 4BUMX 4FRXA 2XE3A 1QJPA 4LSEA 5DL7A 4KRAA 2JMMA 1GFOA 4O49A 2MNHA 2KDYA 4XNKA 3AA6B 5AFUK 3VY9X 3V8UA 3UPGA 3WI4A 4AZLA 4LSHA 2F1TA 1ZHZA 2KXPA 3AA7B 3KVDD 3QRCA 3AA0B 1HXTA 4QQ1A 4AUIA 1BXWA 2K4TA 5EE2A 1H6S1 1PRNA 4C69X 8PRNA 1MPFA 2M06A 3SZVA 2ZLDA 1GFPA 3LK2B 2MHLA 2LFUA 2Y7SA 3HW9A 3AA1A 2X27X 3POXA 5G26A 2GE4A 3PQUA 3K19A 2Y0HA 2XG6A 4GCQA 4N59A 3LK3B 3SY9A 3LK41 2XE2A 3HOEA 4XNLA 1GFQA 3T20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LSF A;  1OSM A;  4FOZ A;  2PRN A;  3SYB A;  2FGR A;  3SYS A;  4FSP A;  1GFM A;  4D64 A;  3T24 A;  3PRN A;  3HWB A;  3FYX A;  4D5U A;  3SZD A;  3NSG A;  1HXU A;  1BH3 A;  4KR8 A;  4RJX A;  2Y2X A;  4FT6 A;  2FGQ X;  3A2S X;  3JTY A;  4FRT A;  2J1N A;  5FVN A;  3POQ A;  2O4V A;  5DL5 A;  5JDP A;  4GCP A;  2ZFG A;  5DL8 A;  2ODJ A;  4FSO A;  3VY8 X;  5DL6 A;  4D65 A;  3POR A;  3T0S A;  1GFN A;  1BT9 A;  2Y0K A;  3VZU X;  3POU A;  3O0E A;  7PRN A;  1HXX A;  3UU2 A;  2Y0L A;  4LSI A;  4RJW A;  2QTK A;  2XE5 A;  2XE1 A;  3SY7 A;  4KR4 A;  3VZW X;  4GCS A;  2POR A;  2OMF A;  6PRN A;  3VZT X;  3EMN X;  1PHO A;  5PRN A;  2J4U P;  1OPF A;  4JFB A;  3WI5 A;  1E54 A;  4BUM X;  4FRX A;  2XE3 A;  5DL7 A;  4LSE A;  4KRA A;  1GFO A;  3VY9 X;  3UPG A;  3WI4 A;  4LSH A;  1HXT A;  4AUI A;  2K4T A;  1H6S 1;  1PRN A;  4C69 X;  8PRN A;  1MPF A;  3SZV A;  2ZLD A;  1GFP A;  3HW9 A;  3POX A;  3K19 A;  2Y0H A;  2XG6 A;  4GCQ A;  3SY9 A;  2XE2 A;  4FMS A;  1GFQ A;  3T20 A; 
#chains in the Genus database with same CATH topology
 4LSF A;  1OSM A;  4FOZ A;  4XNL A;  5AFU L;  2R4L A;  4N58 A;  2IWV A;  5IYU A;  3DWN A;  4UB8 O;  2PRN A;  3AA0 A;  5KAI O;  4AKM A;  1MM4 A;  4RL9 A;  3SYB A;  2WJR A;  4K3B A;  3PGR A;  2N2L A;  4O4U A;  4PJ0 O;  2FGR A;  3BRZ A;  2KZ7 B;  2R88 A;  3SYS A;  2ERV A;  2W81 C;  3AAA A;  4FSP A;  2AXT O;  1GFM A;  4K3C A;  3LK2 A;  4D64 A;  4RLB A;  3T24 A;  4UB6 O;  3PRN A;  5T5F A;  4AYI D;  3HWB A;  4E1S A;  3FYX A;  4D5U A;  3SZD A;  3DA4 A;  2N2M A;  1HXU A;  1BH3 A;  3NSG A;  4KR8 A;  4RJX A;  3LK3 A;  3VE1 A;  2Y2X A;  4FT6 A;  3A0B O;  1T16 A;  1THQ A;  2FGQ X;  3A2S X;  1ZHX A;  3BS0 A;  2LHF A;  3GP6 A;  3JTY A;  4O3Z A;  2W80 C;  4B61 A;  4AYM C;  1IZN B;  1ORM A;  3HOL A;  5KAF O;  4FRT A;  3TZG A;  3AA6 A;  2F1V A;  4AFK A;  2J1N A;  5FVN A;  3POQ A;  2O4V A;  3G7G A;  5ADX K;  2K0L A;  3AA7 A;  2IWW A;  5DL5 A;  4E1T A;  1QJ9 A;  5JDP A;  2KC0 A;  3QRA A;  4U9C A;  1QJ8 A;  1ZHW A;  3RBH A;  4GCP A;  1MM5 A;  3VE2 A;  4FZL A;  4GHB A;  2ZFG A;  4O3W A;  5D5D A;  5DL8 A;  1Q9F A;  3DWO X;  3PGU A;  1ZHY A;  1P4T A;  2ODJ A;  4FZM A;  4FSO A;  5B66 O;  4O3X B;  4IL6 O;  4G76 A;  4RLC A;  5DL6 A;  3VY8 X;  4D65 A;  4O3Y A;  4N75 A;  4GF4 A;  4AYD C;  3AAE B;  3POR A;  4Z3T A;  4AKR B;  3BRY A;  4JCH A;  3T0S A;  2R4N A;  4FZN A;  1GFN A;  1Q9G A;  1BT9 A;  2Y0K A;  4AYN A;  4N74 A;  2R89 A;  4FES A;  3UAQ A;  3DA3 A;  4PUX A;  1G90 A;  3PF1 A;  4C4V B;  3VZU X;  1IZN A;  3POU A;  2YNK A;  4AYE C;  3PQS A;  5H2F O;  3O0E A;  5G38 A;  7PRN A;  2JQY A;  1HXX A;  2XTR A;  3UU2 A;  3KZI O;  5B5E O;  2R8A A;  2KXP B;  5GV0 A;  5ADX L;  2Y0L A;  4LSI A;  2XTQ A;  2R4P A;  4RJW A;  2QTK A;  2XE5 A;  1YS5 A;  2M07 A;  2WJQ A;  4O4X A;  2XE1 A;  5G3A A;  3SY7 A;  4FUV A;  4KR4 A;  3LK4 2;  3VZW X;  1T1L A;  2YPV A;  3AAA B;  4GCS A;  2KZ7 A;  2POR A;  2OMF A;  4FMS A;  6PRN A;  3VZT X;  3EMN X;  3DZM A;  1PHO A;  2X9K A;  5PRN A;  1ZHT A;  3AAE A;  2WVP A;  4G75 A;  2J4U P;  4AKR A;  5E79 O;  1OPF A;  3AA1 B;  4JFB A;  4FQE A;  3C5O A;  2XMX A;  3WI5 A;  1E54 A;  4BUM X;  4FRX A;  4F4B A;  2XE3 A;  1QJP A;  3NJT A;  4LSE A;  5DL7 A;  4KRA A;  5TIS O;  2JMM A;  1GFO A;  4O49 A;  4C4V A;  2MNH A;  5GTH O;  2KDY A;  4XNK A;  3AA6 B;  4PR7 A;  3VY9 X;  3V8U A;  5AFU K;  3UPG A;  3WI4 A;  4AZL A;  4LSH A;  2F1T A;  1ZHZ A;  2KXP A;  3AA7 B;  3KVD D;  3QRC A;  3AA0 B;  1HXT A;  4QQ1 A;  3A0H O;  4AUI A;  1BXW A;  2F1C X;  2K4T A;  5EE2 A;  4C00 A;  1H6S 1;  1PRN A;  4C69 X;  8PRN A;  1MPF A;  2M06 A;  3SZV A;  2ZLD A;  5G39 A;  1GFP A;  3LK2 B;  3PGS A;  2MHL A;  2LFU A;  2Y7S A;  3HW9 A;  3AA1 A;  2X27 X;  4CTD A;  3POX A;  5G26 A;  2GE4 A;  2R4O A;  3PQU A;  5GTI O;  3WU2 O;  3K19 A;  2Y0H A;  2XG6 A;  4GCQ A;  4N59 A;  3LK3 B;  3SY9 A;  3LK4 1;  1S5L O;  2XE2 A;  3HOE A;  3JCU O;  1GFQ A;  3T20 A; 
#chains in the Genus database with same CATH homology
 4LSF A;  1OSM A;  4FOZ A;  5AFU L;  4N58 A;  5IYU A;  2PRN A;  3AA0 A;  4AKM A;  1MM4 A;  4RL9 A;  3SYB A;  2N2L A;  4O4U A;  2FGR A;  2KZ7 B;  3SYS A;  2ERV A;  2W81 C;  3AAA A;  4FSP A;  1GFM A;  3LK2 A;  4D64 A;  4RLB A;  3T24 A;  3PRN A;  5T5F A;  4AYI D;  3HWB A;  4E1S A;  3FYX A;  4D5U A;  3SZD A;  3DA4 A;  2N2M A;  1HXU A;  1BH3 A;  3NSG A;  4KR8 A;  4RJX A;  3LK3 A;  3VE1 A;  2Y2X A;  4FT6 A;  1THQ A;  2FGQ X;  3A2S X;  1ZHX A;  3JTY A;  2LHF A;  3GP6 A;  4O3Z A;  2W80 C;  4B61 A;  4AYM C;  1IZN B;  1ORM A;  3HOL A;  4FRT A;  3TZG A;  3AA6 A;  2F1V A;  4AFK A;  2J1N A;  5FVN A;  3POQ A;  2O4V A;  3G7G A;  5ADX K;  2K0L A;  3AA7 A;  5DL5 A;  4E1T A;  1QJ9 A;  5JDP A;  2KC0 A;  3QRA A;  4U9C A;  1QJ8 A;  1ZHW A;  3RBH A;  4GCP A;  1MM5 A;  3VE2 A;  4FZL A;  4GHB A;  2ZFG A;  4O3W A;  5D5D A;  5DL8 A;  1Q9F A;  1ZHY A;  1P4T A;  2ODJ A;  4FZM A;  4FSO A;  4O3X B;  5DL6 A;  4G76 A;  4RLC A;  3VY8 X;  4D65 A;  4O3Y A;  4GF4 A;  4AYD C;  3AAE B;  3POR A;  4Z3T A;  4AKR B;  4JCH A;  3T0S A;  4FZN A;  1GFN A;  1Q9G A;  1BT9 A;  2Y0K A;  4AYN A;  4FES A;  3UAQ A;  3DA3 A;  4PUX A;  1G90 A;  3VZU X;  1IZN A;  3POU A;  2YNK A;  4AYE C;  3PQS A;  3O0E A;  7PRN A;  1HXX A;  2XTR A;  3UU2 A;  2KXP B;  5GV0 A;  5ADX L;  2Y0L A;  4LSI A;  2XTQ A;  4RJW A;  2QTK A;  2XE5 A;  1YS5 A;  2M07 A;  4O4X A;  2XE1 A;  3SY7 A;  4FUV A;  4KR4 A;  3LK4 2;  3VZW X;  2YPV A;  3AAA B;  4GCS A;  2KZ7 A;  2POR A;  2OMF A;  4FMS A;  6PRN A;  3VZT X;  3EMN X;  1PHO A;  5PRN A;  1ZHT A;  3AAE A;  4G75 A;  2J4U P;  4AKR A;  1OPF A;  3AA1 B;  4JFB A;  4F4B A;  3C5O A;  2XMX A;  3WI5 A;  1E54 A;  4BUM X;  4FRX A;  2XE3 A;  1QJP A;  4LSE A;  5DL7 A;  4KRA A;  2JMM A;  1GFO A;  4O49 A;  2MNH A;  2KDY A;  4XNK A;  3AA6 B;  5AFU K;  3VY9 X;  3V8U A;  3UPG A;  3WI4 A;  4AZL A;  4LSH A;  2F1T A;  1ZHZ A;  2KXP A;  3AA7 B;  3KVD D;  3QRC A;  3AA0 B;  1HXT A;  4QQ1 A;  4AUI A;  1BXW A;  2K4T A;  5EE2 A;  1H6S 1;  1PRN A;  4C69 X;  8PRN A;  1MPF A;  2M06 A;  3SZV A;  2ZLD A;  1GFP A;  3LK2 B;  2MHL A;  2LFU A;  2Y7S A;  3HW9 A;  3AA1 A;  2X27 X;  3POX A;  5G26 A;  2GE4 A;  3PQU A;  3K19 A;  2Y0H A;  2XG6 A;  4GCQ A;  4N59 A;  3LK3 B;  3SY9 A;  3LK4 1;  2XE2 A;  3HOE A;  4XNL A;  1GFQ A;  3T20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...