4FRTA

Crystal structure of pseudomonas aeruginosa occk7 (opdd)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
389
structure length
370
Chain Sequence
GKAGLELRNFYFNRDYRQPSQSYSEEWAQGFLLRYESGYTEGLFGLGVDALGLLGVRLDSSPERSYSTSDRRAAHDYSSLGLTAKLRVSHSTLKIGTLMPRLPVVQFNDTRLHPQTFQGGLLEVNEIDGLALQFGQLRQVKQRDSTNAEDLGITRGNKRNVSDRFDFAGGTYRWSERLSSSYHYANLEDFYRQHHLGVQHLLPLADDQSLKSDIRWARSTDEGRVNNRALNALFTYRLGGHAFGLGYQRMSGDSGFAYLAGTDPYLVNFVQIGDFANKDERSWQLRYDYDFAAIGLPGLTFMSRYLRGEHIDLLDGGGRGKEWERDTDIAYLVGPLKNLGIKLRNGTFRSDFGNDIDETRLIVSYALPLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable porin
publication title Crystal Structures of OccK Subfamily Proteins
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
total genus 85
structure length 370
sequence length 389
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4frtA00
2K4TA 1H6S1 3SYBA 2Y0LA 4FMSA 1E54A 3SY9A 7PRNA 3VZTX 2Y2XA 3A2SX 4D5UA 4FSOA 4KR4A 2XE2A 3POQA 4LSHA 4FOZA 3VY8X 1BT9A 3UU2A 2PORA 3VY9X 1HXXA 4FSPA 6PRNA 5JDPA 1OPFA 5PRNA 2XE5A 4D64A 2Y0KA 2ZLDA 3HW9A 4RJWA 3K19A 3JTYA 5DL6A 1OSMA 4RJXA 4FT6A 2PRNA 3POUA 3SZVA 3PRNA 4FRTA 4GCSA 2J4UP 5DL8A 4BUMX 4GCPA 3SYSA 3T20A 3SY7A 1HXTA 1GFMA 1GFPA 2XE3A 3WI4A 2ZFGA 4LSEA 4JFBA 3VZUX 2QTKA 3VZWX 3SZDA 1PHOA 2FGRA 4FRXA 4KR8A 3T0SA 3HWBA 4C69X 1HXUA 1GFQA 3NSGA 3T24A 2OMFA 3EMNX 1GFOA 5DL5A 3PORA 2O4VA 8PRNA 2ODJA 4D65A 4LSIA 2Y0HA 4AUIA 1GFNA 2FGQX 5DL7A 4LSFA 4GCQA 3UPGA 1BH3A 4KRAA 2J1NA 2XG6A 3FYXA 1PRNA 3POXA 2XE1A 3O0EA 5FVNA 1MPFA 3WI5A
chains in the Genus database with same CATH superfamily
2K4TA 3AAEB 1T16A 4AZLA 1H6S1 1QJPA 3SYBA 2IWWA 2JQYA 2KXPA 1E54A 2Y0LA 4FMSA 3SY9A 3DWOX 3UAQA 2AXTO 3VZTX 7PRNA 3BS0A 4O3WA 4E1SA 1ZHZA 5TISO 5D5DA 1P4TA 4C00A 2M07A 4XNLA 2Y2XA 4AYMC 5GTHO 3A2SX 5G39A 3RBHA 4D5UA 4FSOA 3AAEA 5EE2A 4KR4A 2K0LA 3AAAB 5B66O 2XE2A 4B61A 3PQSA 3POQA 4LSHA 3A0BO 2WVPA 4AKMA 1Q9FA 3QRAA 1S5LO 3G7GA 4FOZA 3VY8X 1BT9A 5G26A 3UU2A 2KDYA 1Q9GA 3PGRA 4Z3TA 2PORA 1QJ8A 1ZHXA 1HXXA 3VY9X 4FSPA 6PRNA 4UB8O 4AYEC 3DZMA 2F1TA 5JDPA 3AAAA 2KZ7B 4GHBA 1OPFA 4PR7A 5PRNA 2XE5A 4N74A 3KVDD 2XTRA 2W80C 4AFKA 4D64A 4G76A 2Y0KA 2ZLDA 4PUXA 2MNHA 2X9KA 3HW9A 3K19A 4RJWA 1ZHTA 4FUVA 3VE2A 4O3ZA 4E1TA 5H2FO 4N58A 2LHFA 4XNKA 3JTYA 5DL6A 5G3AA 3DA4A 2R4LA 1MM5A 1OSMA 2KZ7A 4RJXA 2GE4A 5B5EO 1THQA 1QJ9A 4FT6A 4O4XA 2R4OA 3AA7B 2PRNA 2R89A 3WU2O 1BXWA 4K3BA 3POUA 3SZVA 2YPVA 3BRYA 2XTQA 3PRNA 4FRTA 4GCSA 4C4VB 4IL6O 1IZNB 1G90A 2J4UP 3A0HO 4RLBA 4GF4A 5KAIO 4O3XB 5DL8A 2F1VA 4BUMX 4GCPA 3LK3B 3SYSA 3AA7A 3V8UA 4AKRB 3T20A 2R4NA 4RL9A 3SY7A 1HXTA 4O49A 1GFMA 3DA3A 5KAFO 4AYID 3TZGA 2R88A 1GFPA 3PGUA 4F4BA 2XE3A 4PJ0O 3WI4A 2Y7SA 2ZFGA 4LSEA 4JFBA 3VZUX 2YNKA 2QTKA 2N2LA 3VZWX 1T1LA 3PQUA 4FESA 5AFUK 4G75A 2IWVA 2F1CX 3C5OA 3SZDA 4AKRA 3LK2B 2KXPB 1PHOA 3NJTA 2FGRA 2ERVA 4CTDA 2LFUA 4FRXA 4KR8A 3LK41 3T0SA 2W81C 2WJQA 2WJRA 5E79O 4O4UA 3HWBA 2X27X 3LK42 3PGSA 4C69X 1HXUA 3AA0B 1GFQA 3HOEA 3NSGA 3DWNA 3T24A 2OMFA 3BRZA 3EMNX 3AA1B 1GFOA 2O4VA 3GP6A 3PORA 2R4PA 3LK2A 4N75A 4FZMA 2JMMA 2N2MA 2ODJA 4U9CA 4LSIA 4D65A 8PRNA 5ADXL 2Y0HA 3HOLA 5AFUL 4FZNA 4JCHA 4QQ1A 4UB6O 4AUIA 5IYUA 4C4VA 1ZHWA 1GFNA 2FGQX 3AA0A 1IZNA 3KZIO 4LSFA 5DL7A 4N59A 3AA1A 4K3CA 3AA6B 4GCQA 5T5FA 3UPGA 4O3YA 5DL5A 5ADXK 1YS5A 1BH3A 3LK3A 1MM4A 2J1NA 2XG6A 4KRAA 3FYXA 1PRNA 5G38A 4AYDC 4FQEA 2M06A 3QRCA 4AYNA 1ORMA 2R8AA 4RLCA 1ZHYA 3VE1A 2MHLA 3JCUO 3PF1A 3AA6A 3POXA 4FZLA 5GTIO 2XE1A 2KC0A 3O0EA 5FVNA 2XMXA 1MPFA 5GV0A 3WI5A
chains in the Genus database with same CATH topology
2K4TA 3AAEB 4AZLA 1H6S1 1QJPA 3SYBA 2KXPA 2Y0LA 1E54A 4FMSA 3SY9A 3UAQA 7PRNA 3VZTX 4O3WA 4E1SA 1ZHZA 5D5DA 1P4TA 2M07A 4XNLA 2Y2XA 4AYMC 3A2SX 3RBHA 4D5UA 4FSOA 3AAEA 5EE2A 4KR4A 2K0LA 3AAAB 2XE2A 4B61A 3PQSA 3POQA 4LSHA 4AKMA 1Q9FA 3QRAA 3G7GA 4FOZA 3VY8X 1BT9A 5G26A 3UU2A 2KDYA 1Q9GA 4Z3TA 2PORA 1QJ8A 1ZHXA 1HXXA 3VY9X 4FSPA 6PRNA 4AYEC 2F1TA 5JDPA 3AAAA 2KZ7B 4GHBA 1OPFA 5PRNA 2XE5A 4D64A 3KVDD 2XTRA 2W80C 4AFKA 4G76A 2Y0KA 2ZLDA 4PUXA 2MNHA 3HW9A 4RJWA 3K19A 4E1TA 1ZHTA 4FUVA 3VE2A 4O3ZA 4N58A 2LHFA 4XNKA 3JTYA 5DL6A 3DA4A 1MM5A 1OSMA 2KZ7A 4RJXA 2GE4A 1THQA 1QJ9A 4FT6A 4O4XA 3AA7B 2PRNA 1BXWA 3POUA 3SZVA 2YPVA 2XTQA 3PRNA 4FRTA 4GCSA 1G90A 1IZNB 2J4UP 4RLBA 4GF4A 4O3XB 5DL8A 2F1VA 4BUMX 4GCPA 3LK3B 3SYSA 3AA7A 3V8UA 4AKRB 3T20A 4RL9A 3SY7A 1HXTA 4O49A 1GFMA 3DA3A 4AYID 3TZGA 4F4BA 1GFPA 2XE3A 3WI4A 2Y7SA 2ZFGA 4LSEA 4JFBA 3VZUX 2YNKA 2QTKA 2N2LA 3VZWX 3PQUA 4FESA 5AFUK 4G75A 3C5OA 3SZDA 4AKRA 3LK2B 2KXPB 1PHOA 2FGRA 2ERVA 2LFUA 4FRXA 4KR8A 3LK41 3T0SA 2W81C 4O4UA 3HWBA 2X27X 3LK42 4C69X 1HXUA 3AA0B 1GFQA 3HOEA 3NSGA 3T24A 2OMFA 3EMNX 3AA1B 1GFOA 2O4VA 3GP6A 3PORA 3LK2A 5DL5A 4FZMA 2JMMA 2N2MA 2ODJA 4U9CA 4LSIA 4D65A 8PRNA 5ADXL 2Y0HA 3HOLA 5AFUL 4FZNA 4JCHA 4QQ1A 4AUIA 5IYUA 1ZHWA 1GFNA 2FGQX 3AA0A 1IZNA 4LSFA 5DL7A 4N59A 3AA1A 5T5FA 3AA6B 4GCQA 3UPGA 4O3YA 5ADXK 1YS5A 1BH3A 3LK3A 1MM4A 2J1NA 2XG6A 4KRAA 3FYXA 1PRNA 4AYDC 2M06A 3QRCA 4AYNA 1ORMA 4RLCA 1ZHYA 3VE1A 2MHLA 3AA6A 3POXA 4FZLA 2XE1A 2KC0A 3O0EA 5FVNA 2XMXA 1MPFA 5GV0A 3WI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K4T A;  1H6S 1;  3SYB A;  2Y0L A;  4FMS A;  1E54 A;  3SY9 A;  7PRN A;  3VZT X;  2Y2X A;  3A2S X;  4D5U A;  4FSO A;  4KR4 A;  2XE2 A;  3POQ A;  4LSH A;  4FOZ A;  3VY8 X;  1BT9 A;  3UU2 A;  2POR A;  3VY9 X;  1HXX A;  4FSP A;  6PRN A;  5JDP A;  1OPF A;  5PRN A;  2XE5 A;  4D64 A;  2Y0K A;  2ZLD A;  3HW9 A;  4RJW A;  3K19 A;  3JTY A;  5DL6 A;  1OSM A;  4RJX A;  4FT6 A;  2PRN A;  3POU A;  3SZV A;  3PRN A;  4FRT A;  4GCS A;  2J4U P;  5DL8 A;  4BUM X;  4GCP A;  3SYS A;  3T20 A;  3SY7 A;  1HXT A;  1GFM A;  1GFP A;  2XE3 A;  3WI4 A;  2ZFG A;  4LSE A;  4JFB A;  3VZU X;  2QTK A;  3VZW X;  3SZD A;  1PHO A;  2FGR A;  4FRX A;  4KR8 A;  3T0S A;  3HWB A;  4C69 X;  1HXU A;  1GFQ A;  3NSG A;  3T24 A;  2OMF A;  3EMN X;  1GFO A;  5DL5 A;  3POR A;  2O4V A;  8PRN A;  2ODJ A;  4D65 A;  4LSI A;  2Y0H A;  4AUI A;  1GFN A;  2FGQ X;  5DL7 A;  4LSF A;  4GCQ A;  3UPG A;  1BH3 A;  4KRA A;  2J1N A;  2XG6 A;  3FYX A;  1PRN A;  3POX A;  2XE1 A;  3O0E A;  5FVN A;  1MPF A;  3WI5 A; 
#chains in the Genus database with same CATH topology
 2K4T A;  3AAE B;  1T16 A;  4AZL A;  1H6S 1;  1QJP A;  3SYB A;  2IWW A;  2JQY A;  2KXP A;  1E54 A;  2Y0L A;  4FMS A;  3SY9 A;  3DWO X;  3UAQ A;  2AXT O;  3VZT X;  7PRN A;  3BS0 A;  4O3W A;  4E1S A;  1ZHZ A;  5TIS O;  5D5D A;  1P4T A;  4C00 A;  2M07 A;  4XNL A;  2Y2X A;  4AYM C;  5GTH O;  3A2S X;  5G39 A;  3RBH A;  4D5U A;  4FSO A;  3AAE A;  5EE2 A;  4KR4 A;  2K0L A;  3AAA B;  5B66 O;  2XE2 A;  4B61 A;  3PQS A;  3POQ A;  4LSH A;  3A0B O;  2WVP A;  4AKM A;  1Q9F A;  3QRA A;  1S5L O;  3G7G A;  4FOZ A;  3VY8 X;  1BT9 A;  5G26 A;  3UU2 A;  2KDY A;  1Q9G A;  3PGR A;  4Z3T A;  2POR A;  1QJ8 A;  1ZHX A;  1HXX A;  3VY9 X;  4FSP A;  6PRN A;  4UB8 O;  4AYE C;  3DZM A;  2F1T A;  5JDP A;  3AAA A;  2KZ7 B;  4GHB A;  1OPF A;  4PR7 A;  5PRN A;  2XE5 A;  4N74 A;  3KVD D;  2XTR A;  2W80 C;  4AFK A;  4D64 A;  4G76 A;  2Y0K A;  2ZLD A;  4PUX A;  2MNH A;  2X9K A;  3HW9 A;  3K19 A;  4RJW A;  1ZHT A;  4FUV A;  3VE2 A;  4O3Z A;  4E1T A;  5H2F O;  4N58 A;  2LHF A;  4XNK A;  3JTY A;  5DL6 A;  5G3A A;  3DA4 A;  2R4L A;  1MM5 A;  1OSM A;  2KZ7 A;  4RJX A;  2GE4 A;  5B5E O;  1THQ A;  1QJ9 A;  4FT6 A;  4O4X A;  2R4O A;  3AA7 B;  2PRN A;  2R89 A;  3WU2 O;  1BXW A;  4K3B A;  3POU A;  3SZV A;  2YPV A;  3BRY A;  2XTQ A;  3PRN A;  4FRT A;  4GCS A;  4C4V B;  4IL6 O;  1IZN B;  1G90 A;  2J4U P;  3A0H O;  4RLB A;  4GF4 A;  5KAI O;  4O3X B;  5DL8 A;  2F1V A;  4BUM X;  4GCP A;  3LK3 B;  3SYS A;  3AA7 A;  3V8U A;  4AKR B;  3T20 A;  2R4N A;  4RL9 A;  3SY7 A;  1HXT A;  4O49 A;  1GFM A;  3DA3 A;  5KAF O;  4AYI D;  3TZG A;  2R88 A;  1GFP A;  3PGU A;  4F4B A;  2XE3 A;  4PJ0 O;  3WI4 A;  2Y7S A;  2ZFG A;  4LSE A;  4JFB A;  3VZU X;  2YNK A;  2QTK A;  2N2L A;  3VZW X;  1T1L A;  3PQU A;  4FES A;  5AFU K;  4G75 A;  2IWV A;  2F1C X;  3C5O A;  3SZD A;  4AKR A;  3LK2 B;  2KXP B;  1PHO A;  3NJT A;  2FGR A;  2ERV A;  4CTD A;  2LFU A;  4FRX A;  4KR8 A;  3LK4 1;  3T0S A;  2W81 C;  2WJQ A;  2WJR A;  5E79 O;  4O4U A;  3HWB A;  2X27 X;  3LK4 2;  3PGS A;  4C69 X;  1HXU A;  3AA0 B;  1GFQ A;  3HOE A;  3NSG A;  3DWN A;  3T24 A;  2OMF A;  3BRZ A;  3EMN X;  3AA1 B;  1GFO A;  2O4V A;  3GP6 A;  3POR A;  2R4P A;  3LK2 A;  4N75 A;  4FZM A;  2JMM A;  2N2M A;  2ODJ A;  4U9C A;  4LSI A;  4D65 A;  8PRN A;  5ADX L;  2Y0H A;  3HOL A;  5AFU L;  4FZN A;  4JCH A;  4QQ1 A;  4UB6 O;  4AUI A;  5IYU A;  4C4V A;  1ZHW A;  1GFN A;  2FGQ X;  3AA0 A;  1IZN A;  3KZI O;  4LSF A;  5DL7 A;  4N59 A;  3AA1 A;  4K3C A;  3AA6 B;  4GCQ A;  5T5F A;  3UPG A;  4O3Y A;  5DL5 A;  5ADX K;  1YS5 A;  1BH3 A;  3LK3 A;  1MM4 A;  2J1N A;  2XG6 A;  4KRA A;  3FYX A;  1PRN A;  5G38 A;  4AYD C;  4FQE A;  2M06 A;  3QRC A;  4AYN A;  1ORM A;  2R8A A;  4RLC A;  1ZHY A;  3VE1 A;  2MHL A;  3JCU O;  3PF1 A;  3AA6 A;  3POX A;  4FZL A;  5GTI O;  2XE1 A;  2KC0 A;  3O0E A;  5FVN A;  2XMX A;  1MPF A;  5GV0 A;  3WI5 A; 
#chains in the Genus database with same CATH homology
 2K4T A;  3AAE B;  4AZL A;  1H6S 1;  1QJP A;  3SYB A;  2KXP A;  2Y0L A;  1E54 A;  4FMS A;  3SY9 A;  3UAQ A;  7PRN A;  3VZT X;  4O3W A;  4E1S A;  1ZHZ A;  5D5D A;  1P4T A;  2M07 A;  4XNL A;  2Y2X A;  4AYM C;  3A2S X;  3RBH A;  4D5U A;  4FSO A;  3AAE A;  5EE2 A;  4KR4 A;  2K0L A;  3AAA B;  2XE2 A;  4B61 A;  3PQS A;  3POQ A;  4LSH A;  4AKM A;  1Q9F A;  3QRA A;  3G7G A;  4FOZ A;  3VY8 X;  1BT9 A;  5G26 A;  3UU2 A;  2KDY A;  1Q9G A;  4Z3T A;  2POR A;  1QJ8 A;  1ZHX A;  1HXX A;  3VY9 X;  4FSP A;  6PRN A;  4AYE C;  2F1T A;  5JDP A;  3AAA A;  2KZ7 B;  4GHB A;  1OPF A;  5PRN A;  2XE5 A;  4D64 A;  3KVD D;  2XTR A;  2W80 C;  4AFK A;  4G76 A;  2Y0K A;  2ZLD A;  4PUX A;  2MNH A;  3HW9 A;  4RJW A;  3K19 A;  4E1T A;  1ZHT A;  4FUV A;  3VE2 A;  4O3Z A;  4N58 A;  2LHF A;  4XNK A;  3JTY A;  5DL6 A;  3DA4 A;  1MM5 A;  1OSM A;  2KZ7 A;  4RJX A;  2GE4 A;  1THQ A;  1QJ9 A;  4FT6 A;  4O4X A;  3AA7 B;  2PRN A;  1BXW A;  3POU A;  3SZV A;  2YPV A;  2XTQ A;  3PRN A;  4FRT A;  4GCS A;  1G90 A;  1IZN B;  2J4U P;  4RLB A;  4GF4 A;  4O3X B;  5DL8 A;  2F1V A;  4BUM X;  4GCP A;  3LK3 B;  3SYS A;  3AA7 A;  3V8U A;  4AKR B;  3T20 A;  4RL9 A;  3SY7 A;  1HXT A;  4O49 A;  1GFM A;  3DA3 A;  4AYI D;  3TZG A;  4F4B A;  1GFP A;  2XE3 A;  3WI4 A;  2Y7S A;  2ZFG A;  4LSE A;  4JFB A;  3VZU X;  2YNK A;  2QTK A;  2N2L A;  3VZW X;  3PQU A;  4FES A;  5AFU K;  4G75 A;  3C5O A;  3SZD A;  4AKR A;  3LK2 B;  2KXP B;  1PHO A;  2FGR A;  2ERV A;  2LFU A;  4FRX A;  4KR8 A;  3LK4 1;  3T0S A;  2W81 C;  4O4U A;  3HWB A;  2X27 X;  3LK4 2;  4C69 X;  1HXU A;  3AA0 B;  1GFQ A;  3HOE A;  3NSG A;  3T24 A;  2OMF A;  3EMN X;  3AA1 B;  1GFO A;  2O4V A;  3GP6 A;  3POR A;  3LK2 A;  5DL5 A;  4FZM A;  2JMM A;  2N2M A;  2ODJ A;  4U9C A;  4LSI A;  4D65 A;  8PRN A;  5ADX L;  2Y0H A;  3HOL A;  5AFU L;  4FZN A;  4JCH A;  4QQ1 A;  4AUI A;  5IYU A;  1ZHW A;  1GFN A;  2FGQ X;  3AA0 A;  1IZN A;  4LSF A;  5DL7 A;  4N59 A;  3AA1 A;  5T5F A;  3AA6 B;  4GCQ A;  3UPG A;  4O3Y A;  5ADX K;  1YS5 A;  1BH3 A;  3LK3 A;  1MM4 A;  2J1N A;  2XG6 A;  4KRA A;  3FYX A;  1PRN A;  4AYD C;  2M06 A;  3QRC A;  4AYN A;  1ORM A;  4RLC A;  1ZHY A;  3VE1 A;  2MHL A;  3AA6 A;  3POX A;  4FZL A;  2XE1 A;  2KC0 A;  3O0E A;  5FVN A;  2XMX A;  1MPF A;  5GV0 A;  3WI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...