4FRTA

Crystal structure of pseudomonas aeruginosa occk7 (opdd)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
389
structure length
370
Chain Sequence
GKAGLELRNFYFNRDYRQPSQSYSEEWAQGFLLRYESGYTEGLFGLGVDALGLLGVRLDSSPERSYSTSDRRAAHDYSSLGLTAKLRVSHSTLKIGTLMPRLPVVQFNDTRLHPQTFQGGLLEVNEIDGLALQFGQLRQVKQRDSTNAEDLGITRGNKRNVSDRFDFAGGTYRWSERLSSSYHYANLEDFYRQHHLGVQHLLPLADDQSLKSDIRWARSTDEGRVNNRALNALFTYRLGGHAFGLGYQRMSGDSGFAYLAGTDPYLVNFVQIGDFANKDERSWQLRYDYDFAAIGLPGLTFMSRYLRGEHIDLLDGGGRGKEWERDTDIAYLVGPLKNLGIKLRNGTFRSDFGNDIDETRLIVSYALPLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of OccK Subfamily Proteins
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
molecule keywords Probable porin
total genus 85
structure length 370
sequence length 389
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4frtA00
4AUIA 3HWBA 4KR8A 4KRAA 3PORA 2OMFA 3WI5A 4FMSA 4FRXA 3UU2A 3POXA 4FT6A 3VZWX 1OPFA 2FGRA 5DL8A 3EMNX 2XE1A 3PRNA 3K19A 3POUA 4D65A 4D5UA 4GCPA 3SZVA 6PRNA 2XE3A 1BT9A 3WI4A 2Y0KA 2ZLDA 2FGQX 2ODJA 1GFQA 4FOZA 5DL5A 4C69X 1H6S1 2Y0HA 4LSIA 1GFOA 4KR4A 3VY9X 4RJWA 1PHOA 4BUMX 4FSPA 1HXUA 2XG6A 2QTKA 3POQA 3O0EA 4RJXA 3SYSA 2PRNA 3T24A 3SY9A 2XE2A 2PORA 3FYXA 4LSEA 2ZFGA 4D64A 2XE5A 1PRNA 5DL7A 4FSOA 3NSGA 1MPFA 8PRNA 3T20A 3A2SX 2Y0LA 2K4TA 1OSMA 3HW9A 2J1NA 3VZUX 3SYBA 3VY8X 5FVNA 5JDPA 2O4VA 4JFBA 2Y2XA 3T0SA 1GFMA 1HXXA 1E54A 7PRNA 1GFNA 2J4UP 5DL6A 4LSHA 4LSFA 3JTYA 3SY7A 4FRTA 1BH3A 5PRNA 1GFPA 4GCSA 3UPGA 3VZTX 1HXTA 4GCQA 3SZDA
chains in the Genus database with same CATH superfamily
5D5DA 5G3AA 4C4VB 2R8AA 4Z3TA 4N74A 3HWBA 4AUIA 1QJ8A 3DA4A 2JMMA 1ZHXA 4FUVA 4KR8A 1ZHZA 3RBHA 2WJRA 2Y7SA 4KRAA 2R4LA 3LK3B 3PORA 5EE2A 4AZLA 2OMFA 3WI5A 4FMSA 4FRXA 4O4XA 5B66O 3A0HO 1MM4A 3UU2A 3POXA 2LHFA 4FT6A 5KAIO 3VZWX 4N59A 2KC0A 4AKRB 4GF4A 4B61A 1OPFA 1YS5A 2FGRA 3PQSA 2XMXA 3EMNX 2IWVA 3JCUO 5DL8A 4AYMC 1Q9GA 2XE1A 3PRNA 3K19A 2X27X 3LK2B 4CTDA 3POUA 4D65A 3HOEA 1IZNA 4D5UA 4GCPA 3A0BO 5AFUL 3PGUA 3SZVA 3DZMA 6PRNA 5IYUA 2XE3A 1BT9A 3WI4A 3LK42 2IWWA 2Y0KA 2F1CX 2ZLDA 4O3YA 4XNKA 3LK2A 4K3CA 2FGQX 2ODJA 3AAAB 1ZHWA 5E79O 2R89A 1GFQA 2GE4A 3AA7A 4N75A 4E1TA 2XTQA 3AA6B 4FOZA 4AFKA 4D64A 3G7GA 4PUXA 4FESA 4FZNA 5DL5A 4C69X 2WVPA 5AFUK 1H6S1 1P4TA 2Y0HA 1GFOA 4LSIA 5G39A 4KR4A 3VY9X 4RJWA 4RLBA 3DWNA 1PHOA 4RL9A 4BUMX 3V8UA 3AAEB 2F1TA 4FSPA 3AAAA 3VE2A 1QJPA 1HXUA 1QJ9A 1G90A 2M07A 2QTKA 2XG6A 3O0EA 3POQA 4O3WA 2WJQA 2PRNA 4RJXA 2N2MA 3SYSA 3T24A 2KZ7B 4U9CA 3SY9A 2XE2A 1THQA 3AA1A 2PORA 3HOLA 1ZHYA 3NJTA 2KZ7A 5TISO 4FQEA 4AKMA 2MNHA 2KDYA 4JCHA 2ERVA 2KXPB 5ADXK 1Q9FA 2X9KA 3AA7B 3BS0A 3FYXA 4LSEA 5KAFO 4AKRA 4AYID 4E1SA 5B5EO 3BRZA 4XNLA 2KXPA 2ZFGA 2N2LA 4PJ0O 3WU2O 1BXWA 2XE5A 3LK3A 1PRNA 4N58A 4C00A 2R4PA 5H2FO 5DL7A 4G75A 4AYNA 4FSOA 3NSGA 1MPFA 3PGRA 8PRNA 3T20A 5GTIO 3A2SX 2Y0LA 2K4TA 1OSMA 2XTRA 3HW9A 4O4UA 3AA0A 2J1NA 3PGSA 3VZUX 2MHLA 3TZGA 3SYBA 1ZHTA 2W80C 2JQYA 5GTHO 1ORMA 2R88A 3VY8X 2LFUA 3AAEA 4O3ZA 5FVNA 3AA6A 5JDPA 4O3XB 4F4BA 2O4VA 1T16A 1T1LA 4JFBA 2Y2XA 3T0SA 1GFMA 3PQUA 1HXXA 1E54A 4UB8O 7PRNA 1GFNA 5GV0A 2J4UP 2AXTO 2YPVA 3BRYA 5DL6A 2W81C 2YNKA 3C5OA 3PF1A 4LSHA 1MM5A 1S5LO 2M06A 3DA3A 3QRAA 4GHBA 4AYDC 3UPGA 2F1VA 4LSFA 3JTYA 4UB6O 4K3BA 5T5FA 2R4OA 3GP6A 4O49A 4QQ1A 3VE1A 3DWOX 3SY7A 3AA0B 2K0LA 4FRTA 1BH3A 5G38A 4C4VA 4RLCA 5PRNA 1GFPA 4GCSA 4PR7A 5G26A 3UAQA 3AA1B 3VZTX 5ADXL 1HXTA 4IL6O 1IZNB 3KZIO 2R4NA 3QRCA 4FZLA 3KVDD 4G76A 4GCQA 4AYEC 3SZDA 3LK41 4FZMA
chains in the Genus database with same CATH topology
5D5DA 4Z3TA 4AUIA 3HWBA 1QJ8A 3DA4A 2JMMA 1ZHXA 4FUVA 4KR8A 1ZHZA 3RBHA 2Y7SA 4KRAA 3LK3B 3PORA 5EE2A 4AZLA 2OMFA 3WI5A 4FMSA 4FRXA 4O4XA 1MM4A 3UU2A 3POXA 2LHFA 4FT6A 3VZWX 4N59A 2KC0A 4AKRB 4GF4A 4B61A 1OPFA 1YS5A 2FGRA 3PQSA 2XMXA 3EMNX 5DL8A 4AYMC 1Q9GA 2XE1A 3PRNA 3K19A 2X27X 3LK2B 3POUA 4D65A 3HOEA 1IZNA 4D5UA 4GCPA 5AFUL 3SZVA 6PRNA 5IYUA 2XE3A 1BT9A 3WI4A 3LK42 2Y0KA 2ZLDA 4O3YA 4XNKA 3LK2A 2FGQX 2ODJA 3AAAB 1ZHWA 3AA7A 1GFQA 2GE4A 4E1TA 2XTQA 3AA6B 4FOZA 4AFKA 3G7GA 4PUXA 4FESA 4FZNA 5DL5A 4C69X 5AFUK 1H6S1 1P4TA 2Y0HA 1GFOA 4LSIA 4KR4A 3VY9X 4RJWA 4RLBA 1PHOA 4RL9A 4BUMX 3V8UA 3AAEB 2F1TA 4FSPA 3AAAA 3VE2A 1QJPA 1HXUA 1QJ9A 1G90A 2M07A 2QTKA 2XG6A 3O0EA 3POQA 4O3WA 4RJXA 2PRNA 3SYSA 2N2MA 3T24A 2KZ7B 4U9CA 3SY9A 2XE2A 1THQA 3AA1A 2PORA 3HOLA 1ZHYA 2KZ7A 4AKMA 2MNHA 2KDYA 4JCHA 2ERVA 2KXPB 5ADXK 1Q9FA 4AKRA 3AA7B 4AYID 3FYXA 4LSEA 4E1SA 4XNLA 2KXPA 2ZFGA 2N2LA 4D64A 1BXWA 2XE5A 3LK3A 1PRNA 4N58A 5DL7A 4G75A 4AYNA 4FSOA 3NSGA 1MPFA 8PRNA 3T20A 3A2SX 2Y0LA 2K4TA 1OSMA 2XTRA 3HW9A 4O4UA 3AA0A 2J1NA 3VZUX 2MHLA 3TZGA 3SYBA 1ZHTA 2W80C 1ORMA 3VY8X 2LFUA 3AAEA 4O3ZA 5FVNA 3AA6A 5JDPA 4O3XB 4F4BA 2O4VA 4JFBA 2Y2XA 3T0SA 1GFMA 3PQUA 1HXXA 1E54A 7PRNA 1GFNA 2J4UP 2YPVA 5DL6A 2W81C 2YNKA 3C5OA 4LSHA 4AYDC 1MM5A 2M06A 3DA3A 3QRAA 4GHBA 2F1VA 4LSFA 3JTYA 5T5FA 3GP6A 4O49A 4QQ1A 3VE1A 3SY7A 3AA0B 2K0LA 4FRTA 1BH3A 4RLCA 5PRNA 1GFPA 4GCSA 5G26A 3UAQA 3VZTX 3AA1B 5GV0A 5ADXL 1HXTA 3UPGA 1IZNB 4G76A 3QRCA 4FZLA 4GCQA 3KVDD 4AYEC 3SZDA 3LK41 4FZMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AUI A;  3HWB A;  4KR8 A;  4KRA A;  3POR A;  2OMF A;  3WI5 A;  4FMS A;  4FRX A;  3UU2 A;  3POX A;  4FT6 A;  3VZW X;  1OPF A;  2FGR A;  5DL8 A;  3EMN X;  2XE1 A;  3PRN A;  3K19 A;  3POU A;  4D65 A;  4D5U A;  4GCP A;  3SZV A;  6PRN A;  2XE3 A;  1BT9 A;  3WI4 A;  2Y0K A;  2ZLD A;  2FGQ X;  2ODJ A;  1GFQ A;  4FOZ A;  5DL5 A;  4C69 X;  1H6S 1;  2Y0H A;  4LSI A;  1GFO A;  4KR4 A;  3VY9 X;  4RJW A;  1PHO A;  4BUM X;  4FSP A;  1HXU A;  2XG6 A;  2QTK A;  3POQ A;  3O0E A;  4RJX A;  3SYS A;  2PRN A;  3T24 A;  3SY9 A;  2XE2 A;  2POR A;  3FYX A;  4LSE A;  2ZFG A;  4D64 A;  2XE5 A;  1PRN A;  5DL7 A;  4FSO A;  3NSG A;  1MPF A;  8PRN A;  3T20 A;  3A2S X;  2Y0L A;  2K4T A;  1OSM A;  3HW9 A;  2J1N A;  3VZU X;  3SYB A;  3VY8 X;  5FVN A;  5JDP A;  2O4V A;  4JFB A;  2Y2X A;  3T0S A;  1GFM A;  1HXX A;  1E54 A;  7PRN A;  1GFN A;  2J4U P;  5DL6 A;  4LSH A;  4LSF A;  3JTY A;  3SY7 A;  4FRT A;  1BH3 A;  5PRN A;  1GFP A;  4GCS A;  3UPG A;  3VZT X;  1HXT A;  4GCQ A;  3SZD A; 
#chains in the Genus database with same CATH topology
 5D5D A;  5G3A A;  4C4V B;  2R8A A;  4Z3T A;  4N74 A;  3HWB A;  4AUI A;  1QJ8 A;  3DA4 A;  2JMM A;  1ZHX A;  4FUV A;  4KR8 A;  1ZHZ A;  3RBH A;  2WJR A;  2Y7S A;  4KRA A;  2R4L A;  3LK3 B;  3POR A;  5EE2 A;  4AZL A;  2OMF A;  3WI5 A;  4FMS A;  4FRX A;  4O4X A;  5B66 O;  3A0H O;  1MM4 A;  3UU2 A;  3POX A;  2LHF A;  4FT6 A;  5KAI O;  3VZW X;  4N59 A;  2KC0 A;  4AKR B;  4GF4 A;  4B61 A;  1OPF A;  1YS5 A;  2FGR A;  3PQS A;  2XMX A;  3EMN X;  2IWV A;  3JCU O;  5DL8 A;  4AYM C;  1Q9G A;  2XE1 A;  3PRN A;  3K19 A;  2X27 X;  3LK2 B;  4CTD A;  3POU A;  4D65 A;  3HOE A;  1IZN A;  4D5U A;  4GCP A;  3A0B O;  5AFU L;  3PGU A;  3SZV A;  3DZM A;  6PRN A;  5IYU A;  2XE3 A;  1BT9 A;  3WI4 A;  3LK4 2;  2IWW A;  2Y0K A;  2F1C X;  2ZLD A;  4O3Y A;  4XNK A;  3LK2 A;  4K3C A;  2FGQ X;  2ODJ A;  3AAA B;  1ZHW A;  5E79 O;  2R89 A;  1GFQ A;  2GE4 A;  3AA7 A;  4N75 A;  4E1T A;  2XTQ A;  3AA6 B;  4FOZ A;  4AFK A;  4D64 A;  3G7G A;  4PUX A;  4FES A;  4FZN A;  5DL5 A;  4C69 X;  2WVP A;  5AFU K;  1H6S 1;  1P4T A;  2Y0H A;  1GFO A;  4LSI A;  5G39 A;  4KR4 A;  3VY9 X;  4RJW A;  4RLB A;  3DWN A;  1PHO A;  4RL9 A;  4BUM X;  3V8U A;  3AAE B;  2F1T A;  4FSP A;  3AAA A;  3VE2 A;  1QJP A;  1HXU A;  1QJ9 A;  1G90 A;  2M07 A;  2QTK A;  2XG6 A;  3O0E A;  3POQ A;  4O3W A;  2WJQ A;  2PRN A;  4RJX A;  2N2M A;  3SYS A;  3T24 A;  2KZ7 B;  4U9C A;  3SY9 A;  2XE2 A;  1THQ A;  3AA1 A;  2POR A;  3HOL A;  1ZHY A;  3NJT A;  2KZ7 A;  5TIS O;  4FQE A;  4AKM A;  2MNH A;  2KDY A;  4JCH A;  2ERV A;  2KXP B;  5ADX K;  1Q9F A;  2X9K A;  3AA7 B;  3BS0 A;  3FYX A;  4LSE A;  5KAF O;  4AKR A;  4AYI D;  4E1S A;  5B5E O;  3BRZ A;  4XNL A;  2KXP A;  2ZFG A;  2N2L A;  4PJ0 O;  3WU2 O;  1BXW A;  2XE5 A;  3LK3 A;  1PRN A;  4N58 A;  4C00 A;  2R4P A;  5H2F O;  5DL7 A;  4G75 A;  4AYN A;  4FSO A;  3NSG A;  1MPF A;  3PGR A;  8PRN A;  3T20 A;  5GTI O;  3A2S X;  2Y0L A;  2K4T A;  1OSM A;  2XTR A;  3HW9 A;  4O4U A;  3AA0 A;  2J1N A;  3PGS A;  3VZU X;  2MHL A;  3TZG A;  3SYB A;  1ZHT A;  2W80 C;  2JQY A;  5GTH O;  1ORM A;  2R88 A;  3VY8 X;  2LFU A;  3AAE A;  4O3Z A;  5FVN A;  3AA6 A;  5JDP A;  4O3X B;  4F4B A;  2O4V A;  1T16 A;  1T1L A;  4JFB A;  2Y2X A;  3T0S A;  1GFM A;  3PQU A;  1HXX A;  1E54 A;  4UB8 O;  7PRN A;  1GFN A;  5GV0 A;  2J4U P;  2AXT O;  2YPV A;  3BRY A;  5DL6 A;  2W81 C;  2YNK A;  3C5O A;  3PF1 A;  4LSH A;  1MM5 A;  1S5L O;  2M06 A;  3DA3 A;  3QRA A;  4GHB A;  4AYD C;  3UPG A;  2F1V A;  4LSF A;  3JTY A;  4UB6 O;  4K3B A;  5T5F A;  2R4O A;  3GP6 A;  4O49 A;  4QQ1 A;  3VE1 A;  3DWO X;  3SY7 A;  3AA0 B;  2K0L A;  4FRT A;  1BH3 A;  5G38 A;  4C4V A;  4RLC A;  5PRN A;  1GFP A;  4GCS A;  4PR7 A;  5G26 A;  3UAQ A;  3AA1 B;  3VZT X;  5ADX L;  1HXT A;  4IL6 O;  1IZN B;  3KZI O;  2R4N A;  3QRC A;  4FZL A;  3KVD D;  4G76 A;  4GCQ A;  4AYE C;  3SZD A;  3LK4 1;  4FZM A; 
#chains in the Genus database with same CATH homology
 5D5D A;  4Z3T A;  4AUI A;  3HWB A;  1QJ8 A;  3DA4 A;  2JMM A;  1ZHX A;  4FUV A;  4KR8 A;  1ZHZ A;  3RBH A;  2Y7S A;  4KRA A;  3LK3 B;  3POR A;  5EE2 A;  4AZL A;  2OMF A;  3WI5 A;  4FMS A;  4FRX A;  4O4X A;  1MM4 A;  3UU2 A;  3POX A;  2LHF A;  4FT6 A;  3VZW X;  4N59 A;  2KC0 A;  4AKR B;  4GF4 A;  4B61 A;  1OPF A;  1YS5 A;  2FGR A;  3PQS A;  2XMX A;  3EMN X;  5DL8 A;  4AYM C;  1Q9G A;  2XE1 A;  3PRN A;  3K19 A;  2X27 X;  3LK2 B;  3POU A;  4D65 A;  3HOE A;  1IZN A;  4D5U A;  4GCP A;  5AFU L;  3SZV A;  6PRN A;  5IYU A;  2XE3 A;  1BT9 A;  3WI4 A;  3LK4 2;  2Y0K A;  2ZLD A;  4O3Y A;  4XNK A;  3LK2 A;  2FGQ X;  2ODJ A;  3AAA B;  1ZHW A;  3AA7 A;  1GFQ A;  2GE4 A;  4E1T A;  2XTQ A;  3AA6 B;  4FOZ A;  4AFK A;  3G7G A;  4PUX A;  4FES A;  4FZN A;  5DL5 A;  4C69 X;  5AFU K;  1H6S 1;  1P4T A;  2Y0H A;  1GFO A;  4LSI A;  4KR4 A;  3VY9 X;  4RJW A;  4RLB A;  1PHO A;  4RL9 A;  4BUM X;  3V8U A;  3AAE B;  2F1T A;  4FSP A;  3AAA A;  3VE2 A;  1QJP A;  1HXU A;  1QJ9 A;  1G90 A;  2M07 A;  2QTK A;  2XG6 A;  3O0E A;  3POQ A;  4O3W A;  4RJX A;  2PRN A;  3SYS A;  2N2M A;  3T24 A;  2KZ7 B;  4U9C A;  3SY9 A;  2XE2 A;  1THQ A;  3AA1 A;  2POR A;  3HOL A;  1ZHY A;  2KZ7 A;  4AKM A;  2MNH A;  2KDY A;  4JCH A;  2ERV A;  2KXP B;  5ADX K;  1Q9F A;  4AKR A;  3AA7 B;  4AYI D;  3FYX A;  4LSE A;  4E1S A;  4XNL A;  2KXP A;  2ZFG A;  2N2L A;  4D64 A;  1BXW A;  2XE5 A;  3LK3 A;  1PRN A;  4N58 A;  5DL7 A;  4G75 A;  4AYN A;  4FSO A;  3NSG A;  1MPF A;  8PRN A;  3T20 A;  3A2S X;  2Y0L A;  2K4T A;  1OSM A;  2XTR A;  3HW9 A;  4O4U A;  3AA0 A;  2J1N A;  3VZU X;  2MHL A;  3TZG A;  3SYB A;  1ZHT A;  2W80 C;  1ORM A;  3VY8 X;  2LFU A;  3AAE A;  4O3Z A;  5FVN A;  3AA6 A;  5JDP A;  4O3X B;  4F4B A;  2O4V A;  4JFB A;  2Y2X A;  3T0S A;  1GFM A;  3PQU A;  1HXX A;  1E54 A;  7PRN A;  1GFN A;  2J4U P;  2YPV A;  5DL6 A;  2W81 C;  2YNK A;  3C5O A;  4LSH A;  4AYD C;  1MM5 A;  2M06 A;  3DA3 A;  3QRA A;  4GHB A;  2F1V A;  4LSF A;  3JTY A;  5T5F A;  3GP6 A;  4O49 A;  4QQ1 A;  3VE1 A;  3SY7 A;  3AA0 B;  2K0L A;  4FRT A;  1BH3 A;  4RLC A;  5PRN A;  1GFP A;  4GCS A;  5G26 A;  3UAQ A;  3VZT X;  3AA1 B;  5GV0 A;  5ADX L;  1HXT A;  3UPG A;  1IZN B;  4G76 A;  3QRC A;  4FZL A;  4GCQ A;  3KVD D;  4AYE C;  3SZD A;  3LK4 1;  4FZM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...