4FRTA

Crystal structure of pseudomonas aeruginosa occk7 (opdd)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
389
structure length
370
Chain Sequence
GKAGLELRNFYFNRDYRQPSQSYSEEWAQGFLLRYESGYTEGLFGLGVDALGLLGVRLDSSPERSYSTSDRRAAHDYSSLGLTAKLRVSHSTLKIGTLMPRLPVVQFNDTRLHPQTFQGGLLEVNEIDGLALQFGQLRQVKQRDSTNAEDLGITRGNKRNVSDRFDFAGGTYRWSERLSSSYHYANLEDFYRQHHLGVQHLLPLADDQSLKSDIRWARSTDEGRVNNRALNALFTYRLGGHAFGLGYQRMSGDSGFAYLAGTDPYLVNFVQIGDFANKDERSWQLRYDYDFAAIGLPGLTFMSRYLRGEHIDLLDGGGRGKEWERDTDIAYLVGPLKNLGIKLRNGTFRSDFGNDIDETRLIVSYALPLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of OccK Subfamily Proteins
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
molecule keywords Probable porin
total genus 85
structure length 370
sequence length 389
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4frtA00
2XE1A 3WI5A 6PRNA 3K19A 1HXUA 4RJXA 5JDPA 4D64A 5DL5A 1GFQA 4GCPA 3VZUX 2Y0HA 4GCSA 4C69X 2XG6A 2K4TA 4KR4A 3T0SA 4FSOA 1HXTA 4LSEA 3SY9A 3POQA 1PRNA 4BUMX 2Y0LA 1OPFA 3EMNX 4FRTA 4GCQA 1GFOA 2XE2A 4FMSA 4KRAA 3PRNA 2FGRA 4FOZA 4JFBA 2XE3A 2PORA 3T24A 4D5UA 1H6S1 4LSIA 1BH3A 2FGQX 1HXXA 4AUIA 4RJWA 1GFMA 5FVNA 3UPGA 1OSMA 2XE5A 3A2SX 2QTKA 1MPFA 3VY8X 4FT6A 1E54A 4FSPA 2Y0KA 3POUA 3WI4A 2O4VA 2PRNA 3SY7A 4LSFA 4FRXA 3SYBA 3FYXA 2ODJA 2OMFA 2J1NA 3PORA 3VY9X 5DL7A 3VZTX 8PRNA 3VZWX 3SYSA 4LSHA 3T20A 3JTYA 3UU2A 1BT9A 3O0EA 5DL6A 4KR8A 3HW9A 3HWBA 2Y2XA 2J4UP 3POXA 1PHOA 3NSGA 5PRNA 3SZVA 7PRNA 1GFPA 5DL8A 3SZDA 4D65A 2ZFGA 2ZLDA 1GFNA
chains in the Genus database with same CATH superfamily
4G76A 1YS5A 2XE1A 5E79O 3WI5A 4Z3TA 2XTQA 4B61A 3AA1B 2W81C 4QQ1A 2X9KA 6PRNA 3K19A 2KZ7B 2ERVA 1HXUA 4FESA 4PR7A 4RJXA 3LK2A 1MM5A 4UB6O 5JDPA 2KXPB 2R89A 4D64A 4CTDA 1THQA 4UB8O 5DL5A 2MHLA 1GFQA 2R4NA 2YPVA 3AAEB 4GCPA 3VZUX 3VE2A 2N2LA 4E1SA 1G90A 3LK3A 2Y0HA 4AYDC 2F1VA 4GCSA 1ZHXA 2X27X 4O4UA 4C69X 1MM4A 3JCUO 1T16A 2XG6A 4AYNA 2K4TA 4KR4A 4AYMC 4N75A 3T0SA 2LFUA 5G26A 4O3XB 4FSOA 1HXTA 4C00A 1ZHZA 4LSEA 4XNLA 1P4TA 3AAAA 4PUXA 4E1TA 3SY9A 3LK3B 1ZHTA 3BRYA 1PRNA 3POQA 4O3WA 5B5EO 4XNKA 3PGUA 3AAEA 4BUMX 3WU2O 4FZNA 2Y0LA 1OPFA 3EMNX 4FRTA 4GCQA 1GFOA 2XE2A 3NJTA 4C4VA 3C5OA 3DWNA 3GP6A 4FMSA 4KRAA 5G38A 4AFKA 3PRNA 4K3BA 2WJRA 2FGRA 4FOZA 4IL6O 1ZHYA 4U9CA 4O49A 3VE1A 2XMXA 4JFBA 4PJ0O 2XE3A 4FUVA 3AA0A 2KXPA 4AYID 2PORA 2M07A 3PGRA 3T24A 4D5UA 3V8UA 3BRZA 3DA4A 1ORMA 4GHBA 4AKRA 1H6S1 2WJQA 3AA6B 4G75A 1BH3A 3AA1A 4LSIA 2F1CX 2FGQX 5B66O 5GV0A 5T5FA 4O3ZA 5H2FO 2WVPA 1HXXA 1BXWA 2XTRA 5EE2A 5G39A 4AUIA 3LK41 4RJWA 2R8AA 2JMMA 3QRAA 1GFMA 3A0HO 4FZMA 1OSMA 5FVNA 2JQYA 1T1LA 3DZMA 3UPGA 3PQUA 2XE5A 4FQEA 4AKRB 3HOLA 3A2SX 2QTKA 5IYUA 1MPFA 4C4VB 3VY8X 4FT6A 1E54A 3LK42 3KZIO 4FSPA 3UAQA 2Y0KA 1ZHWA 2R88A 4N74A 1IZNB 3POUA 4F4BA 3WI4A 2O4VA 2PRNA 2R4OA 3AAAB 3SY7A 3QRCA 4LSFA 4RLCA 3PF1A 2KC0A 4FRXA 2LHFA 3SYBA 4AYEC 1QJ8A 3FYXA 2ODJA 4RLBA 2W80C 5ADXK 2OMFA 2J1NA 5KAIO 4N58A 3DA3A 3PORA 2YNKA 4O3YA 4JCHA 2MNHA 3VY9X 5DL7A 3VZTX 5TISO 8PRNA 5AFUK 2N2MA 3VZWX 5KAFO 2R4PA 3SYSA 1QJ9A 1QJPA 5AFUL 1Q9FA 4LSHA 3T20A 3JTYA 3UU2A 3PQSA 1BT9A 3LK2B 3O0EA 5DL6A 3HOEA 3HW9A 4KR8A 4AZLA 2GE4A 4N59A 4RL9A 3HWBA 2AXTO 2KZ7A 2IWVA 2KDYA 1IZNA 2M06A 2Y2XA 3DWOX 5GTHO 4O4XA 2J4UP 2R4LA 4K3CA 3G7GA 2F1TA 3PGSA 3POXA 5D5DA 3TZGA 1PHOA 1S5LO 3NSGA 5PRNA 4FZLA 3AA7A 3SZVA 7PRNA 3KVDD 1GFPA 5DL8A 1Q9GA 2K0LA 3AA6A 4GF4A 3RBHA 5ADXL 4AKMA 3A0BO 3BS0A 3SZDA 4D65A 2IWWA 3AA7B 5G3AA 2ZFGA 2ZLDA 3AA0B 5GTIO 2Y7SA 1GFNA
chains in the Genus database with same CATH topology
4G76A 1YS5A 2XE1A 4Z3TA 3WI5A 2XTQA 4B61A 3AA1B 2W81C 4QQ1A 6PRNA 3K19A 2KZ7B 2ERVA 1HXUA 4FESA 4RJXA 3LK2A 1MM5A 5JDPA 2KXPB 4D64A 1THQA 5DL5A 2MHLA 1GFQA 2YPVA 3AAEB 4GCPA 1G90A 3VZUX 3VE2A 2N2LA 4E1SA 3LK3A 2Y0HA 4AYDC 2F1VA 4GCSA 1ZHXA 2X27X 4O4UA 4C69X 1MM4A 2XG6A 4AYNA 2K4TA 4KR4A 4AYMC 3T0SA 2LFUA 5G26A 4O3XB 4FSOA 1HXTA 1ZHZA 4LSEA 4XNLA 1P4TA 3AAAA 4PUXA 4E1TA 3SY9A 3LK3B 1ZHTA 3POQA 1PRNA 4O3WA 4XNKA 3AAEA 4BUMX 4FZNA 2Y0LA 1OPFA 3EMNX 4FRTA 4GCQA 1GFOA 2XE2A 3C5OA 3GP6A 4FMSA 4KRAA 4AFKA 3PRNA 2FGRA 4FOZA 1ZHYA 4U9CA 4O49A 3VE1A 2XMXA 4JFBA 2XE3A 4FUVA 3AA0A 2KXPA 4AYID 2PORA 2M07A 3T24A 4D5UA 3V8UA 3DA4A 1ORMA 4GHBA 4AKRA 1H6S1 5GV0A 3AA6B 4G75A 1BH3A 3AA1A 4LSIA 2FGQX 5T5FA 4O3ZA 1HXXA 1BXWA 2XTRA 5EE2A 4AUIA 3LK41 4RJWA 2JMMA 3QRAA 1GFMA 4FZMA 5FVNA 1OSMA 3UPGA 3PQUA 2XE5A 4AKRB 5IYUA 3HOLA 3A2SX 2QTKA 1MPFA 3VY8X 4FT6A 1E54A 3LK42 4FSPA 3UAQA 2Y0KA 1ZHWA 1IZNB 3POUA 4F4BA 3WI4A 2O4VA 2PRNA 3AAAB 3SY7A 3QRCA 4LSFA 4RLCA 2KC0A 4FRXA 2LHFA 3SYBA 4AYEC 1QJ8A 3FYXA 2ODJA 4RLBA 2W80C 5ADXK 2OMFA 2J1NA 4N58A 3DA3A 3PORA 2YNKA 4O3YA 4JCHA 2MNHA 3VY9X 5DL7A 3VZTX 8PRNA 5AFUK 2N2MA 3VZWX 3SYSA 1QJ9A 1QJPA 5AFUL 1Q9FA 4LSHA 3T20A 3JTYA 3UU2A 3PQSA 1BT9A 3LK2B 3O0EA 5DL6A 3HOEA 3HW9A 4KR8A 4AZLA 2GE4A 4N59A 4RL9A 3HWBA 2KZ7A 2KDYA 2M06A 1IZNA 2Y2XA 4O4XA 2J4UP 3G7GA 2F1TA 5D5DA 3POXA 3TZGA 1PHOA 3NSGA 5PRNA 4FZLA 3AA7A 3SZVA 7PRNA 3KVDD 1GFPA 5DL8A 1Q9GA 2K0LA 3AA6A 4GF4A 3RBHA 5ADXL 4AKMA 3SZDA 4D65A 3AA7B 2ZFGA 2ZLDA 3AA0B 2Y7SA 1GFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XE1 A;  3WI5 A;  6PRN A;  3K19 A;  1HXU A;  4RJX A;  5JDP A;  4D64 A;  5DL5 A;  1GFQ A;  4GCP A;  3VZU X;  2Y0H A;  4GCS A;  4C69 X;  2XG6 A;  2K4T A;  4KR4 A;  3T0S A;  4FSO A;  1HXT A;  4LSE A;  3SY9 A;  3POQ A;  1PRN A;  4BUM X;  2Y0L A;  1OPF A;  3EMN X;  4FRT A;  4GCQ A;  1GFO A;  2XE2 A;  4FMS A;  4KRA A;  3PRN A;  2FGR A;  4FOZ A;  4JFB A;  2XE3 A;  2POR A;  3T24 A;  4D5U A;  1H6S 1;  4LSI A;  1BH3 A;  2FGQ X;  1HXX A;  4AUI A;  4RJW A;  1GFM A;  5FVN A;  3UPG A;  1OSM A;  2XE5 A;  3A2S X;  2QTK A;  1MPF A;  3VY8 X;  4FT6 A;  1E54 A;  4FSP A;  2Y0K A;  3POU A;  3WI4 A;  2O4V A;  2PRN A;  3SY7 A;  4LSF A;  4FRX A;  3SYB A;  3FYX A;  2ODJ A;  2OMF A;  2J1N A;  3POR A;  3VY9 X;  5DL7 A;  3VZT X;  8PRN A;  3VZW X;  3SYS A;  4LSH A;  3T20 A;  3JTY A;  3UU2 A;  1BT9 A;  3O0E A;  5DL6 A;  4KR8 A;  3HW9 A;  3HWB A;  2Y2X A;  2J4U P;  3POX A;  1PHO A;  3NSG A;  5PRN A;  3SZV A;  7PRN A;  1GFP A;  5DL8 A;  3SZD A;  4D65 A;  2ZFG A;  2ZLD A;  1GFN A; 
#chains in the Genus database with same CATH topology
 4G76 A;  1YS5 A;  2XE1 A;  5E79 O;  3WI5 A;  4Z3T A;  2XTQ A;  4B61 A;  3AA1 B;  2W81 C;  4QQ1 A;  2X9K A;  6PRN A;  3K19 A;  2KZ7 B;  2ERV A;  1HXU A;  4FES A;  4PR7 A;  4RJX A;  3LK2 A;  1MM5 A;  4UB6 O;  5JDP A;  2KXP B;  2R89 A;  4D64 A;  4CTD A;  1THQ A;  4UB8 O;  5DL5 A;  2MHL A;  1GFQ A;  2R4N A;  2YPV A;  3AAE B;  4GCP A;  3VZU X;  3VE2 A;  2N2L A;  4E1S A;  1G90 A;  3LK3 A;  2Y0H A;  4AYD C;  2F1V A;  4GCS A;  1ZHX A;  2X27 X;  4O4U A;  4C69 X;  1MM4 A;  3JCU O;  1T16 A;  2XG6 A;  4AYN A;  2K4T A;  4KR4 A;  4AYM C;  4N75 A;  3T0S A;  2LFU A;  5G26 A;  4O3X B;  4FSO A;  1HXT A;  4C00 A;  1ZHZ A;  4LSE A;  4XNL A;  1P4T A;  3AAA A;  4PUX A;  4E1T A;  3SY9 A;  3LK3 B;  1ZHT A;  3BRY A;  1PRN A;  3POQ A;  4O3W A;  5B5E O;  4XNK A;  3PGU A;  3AAE A;  4BUM X;  3WU2 O;  4FZN A;  2Y0L A;  1OPF A;  3EMN X;  4FRT A;  4GCQ A;  1GFO A;  2XE2 A;  3NJT A;  4C4V A;  3C5O A;  3DWN A;  3GP6 A;  4FMS A;  4KRA A;  5G38 A;  4AFK A;  3PRN A;  4K3B A;  2WJR A;  2FGR A;  4FOZ A;  4IL6 O;  1ZHY A;  4U9C A;  4O49 A;  3VE1 A;  2XMX A;  4JFB A;  4PJ0 O;  2XE3 A;  4FUV A;  3AA0 A;  2KXP A;  4AYI D;  2POR A;  2M07 A;  3PGR A;  3T24 A;  4D5U A;  3V8U A;  3BRZ A;  3DA4 A;  1ORM A;  4GHB A;  4AKR A;  1H6S 1;  2WJQ A;  3AA6 B;  4G75 A;  1BH3 A;  3AA1 A;  4LSI A;  2F1C X;  2FGQ X;  5B66 O;  5GV0 A;  5T5F A;  4O3Z A;  5H2F O;  2WVP A;  1HXX A;  1BXW A;  2XTR A;  5EE2 A;  5G39 A;  4AUI A;  3LK4 1;  4RJW A;  2R8A A;  2JMM A;  3QRA A;  1GFM A;  3A0H O;  4FZM A;  1OSM A;  5FVN A;  2JQY A;  1T1L A;  3DZM A;  3UPG A;  3PQU A;  2XE5 A;  4FQE A;  4AKR B;  3HOL A;  3A2S X;  2QTK A;  5IYU A;  1MPF A;  4C4V B;  3VY8 X;  4FT6 A;  1E54 A;  3LK4 2;  3KZI O;  4FSP A;  3UAQ A;  2Y0K A;  1ZHW A;  2R88 A;  4N74 A;  1IZN B;  3POU A;  4F4B A;  3WI4 A;  2O4V A;  2PRN A;  2R4O A;  3AAA B;  3SY7 A;  3QRC A;  4LSF A;  4RLC A;  3PF1 A;  2KC0 A;  4FRX A;  2LHF A;  3SYB A;  4AYE C;  1QJ8 A;  3FYX A;  2ODJ A;  4RLB A;  2W80 C;  5ADX K;  2OMF A;  2J1N A;  5KAI O;  4N58 A;  3DA3 A;  3POR A;  2YNK A;  4O3Y A;  4JCH A;  2MNH A;  3VY9 X;  5DL7 A;  3VZT X;  5TIS O;  8PRN A;  5AFU K;  2N2M A;  3VZW X;  5KAF O;  2R4P A;  3SYS A;  1QJ9 A;  1QJP A;  5AFU L;  1Q9F A;  4LSH A;  3T20 A;  3JTY A;  3UU2 A;  3PQS A;  1BT9 A;  3LK2 B;  3O0E A;  5DL6 A;  3HOE A;  3HW9 A;  4KR8 A;  4AZL A;  2GE4 A;  4N59 A;  4RL9 A;  3HWB A;  2AXT O;  2KZ7 A;  2IWV A;  2KDY A;  1IZN A;  2M06 A;  2Y2X A;  3DWO X;  5GTH O;  4O4X A;  2J4U P;  2R4L A;  4K3C A;  3G7G A;  2F1T A;  3PGS A;  3POX A;  5D5D A;  3TZG A;  1PHO A;  1S5L O;  3NSG A;  5PRN A;  4FZL A;  3AA7 A;  3SZV A;  7PRN A;  3KVD D;  1GFP A;  5DL8 A;  1Q9G A;  2K0L A;  3AA6 A;  4GF4 A;  3RBH A;  5ADX L;  4AKM A;  3A0B O;  3BS0 A;  3SZD A;  4D65 A;  2IWW A;  3AA7 B;  5G3A A;  2ZFG A;  2ZLD A;  3AA0 B;  5GTI O;  2Y7S A;  1GFN A; 
#chains in the Genus database with same CATH homology
 4G76 A;  1YS5 A;  2XE1 A;  4Z3T A;  3WI5 A;  2XTQ A;  4B61 A;  3AA1 B;  2W81 C;  4QQ1 A;  6PRN A;  3K19 A;  2KZ7 B;  2ERV A;  1HXU A;  4FES A;  4RJX A;  3LK2 A;  1MM5 A;  5JDP A;  2KXP B;  4D64 A;  1THQ A;  5DL5 A;  2MHL A;  1GFQ A;  2YPV A;  3AAE B;  4GCP A;  1G90 A;  3VZU X;  3VE2 A;  2N2L A;  4E1S A;  3LK3 A;  2Y0H A;  4AYD C;  2F1V A;  4GCS A;  1ZHX A;  2X27 X;  4O4U A;  4C69 X;  1MM4 A;  2XG6 A;  4AYN A;  2K4T A;  4KR4 A;  4AYM C;  3T0S A;  2LFU A;  5G26 A;  4O3X B;  4FSO A;  1HXT A;  1ZHZ A;  4LSE A;  4XNL A;  1P4T A;  3AAA A;  4PUX A;  4E1T A;  3SY9 A;  3LK3 B;  1ZHT A;  3POQ A;  1PRN A;  4O3W A;  4XNK A;  3AAE A;  4BUM X;  4FZN A;  2Y0L A;  1OPF A;  3EMN X;  4FRT A;  4GCQ A;  1GFO A;  2XE2 A;  3C5O A;  3GP6 A;  4FMS A;  4KRA A;  4AFK A;  3PRN A;  2FGR A;  4FOZ A;  1ZHY A;  4U9C A;  4O49 A;  3VE1 A;  2XMX A;  4JFB A;  2XE3 A;  4FUV A;  3AA0 A;  2KXP A;  4AYI D;  2POR A;  2M07 A;  3T24 A;  4D5U A;  3V8U A;  3DA4 A;  1ORM A;  4GHB A;  4AKR A;  1H6S 1;  5GV0 A;  3AA6 B;  4G75 A;  1BH3 A;  3AA1 A;  4LSI A;  2FGQ X;  5T5F A;  4O3Z A;  1HXX A;  1BXW A;  2XTR A;  5EE2 A;  4AUI A;  3LK4 1;  4RJW A;  2JMM A;  3QRA A;  1GFM A;  4FZM A;  5FVN A;  1OSM A;  3UPG A;  3PQU A;  2XE5 A;  4AKR B;  5IYU A;  3HOL A;  3A2S X;  2QTK A;  1MPF A;  3VY8 X;  4FT6 A;  1E54 A;  3LK4 2;  4FSP A;  3UAQ A;  2Y0K A;  1ZHW A;  1IZN B;  3POU A;  4F4B A;  3WI4 A;  2O4V A;  2PRN A;  3AAA B;  3SY7 A;  3QRC A;  4LSF A;  4RLC A;  2KC0 A;  4FRX A;  2LHF A;  3SYB A;  4AYE C;  1QJ8 A;  3FYX A;  2ODJ A;  4RLB A;  2W80 C;  5ADX K;  2OMF A;  2J1N A;  4N58 A;  3DA3 A;  3POR A;  2YNK A;  4O3Y A;  4JCH A;  2MNH A;  3VY9 X;  5DL7 A;  3VZT X;  8PRN A;  5AFU K;  2N2M A;  3VZW X;  3SYS A;  1QJ9 A;  1QJP A;  5AFU L;  1Q9F A;  4LSH A;  3T20 A;  3JTY A;  3UU2 A;  3PQS A;  1BT9 A;  3LK2 B;  3O0E A;  5DL6 A;  3HOE A;  3HW9 A;  4KR8 A;  4AZL A;  2GE4 A;  4N59 A;  4RL9 A;  3HWB A;  2KZ7 A;  2KDY A;  2M06 A;  1IZN A;  2Y2X A;  4O4X A;  2J4U P;  3G7G A;  2F1T A;  5D5D A;  3POX A;  3TZG A;  1PHO A;  3NSG A;  5PRN A;  4FZL A;  3AA7 A;  3SZV A;  7PRN A;  3KVD D;  1GFP A;  5DL8 A;  1Q9G A;  2K0L A;  3AA6 A;  4GF4 A;  3RBH A;  5ADX L;  4AKM A;  3SZD A;  4D65 A;  3AA7 B;  2ZFG A;  2ZLD A;  3AA0 B;  2Y7S A;  1GFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...