4FRTA

Crystal structure of pseudomonas aeruginosa occk7 (opdd)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
389
structure length
370
Chain Sequence
GKAGLELRNFYFNRDYRQPSQSYSEEWAQGFLLRYESGYTEGLFGLGVDALGLLGVRLDSSPERSYSTSDRRAAHDYSSLGLTAKLRVSHSTLKIGTLMPRLPVVQFNDTRLHPQTFQGGLLEVNEIDGLALQFGQLRQVKQRDSTNAEDLGITRGNKRNVSDRFDFAGGTYRWSERLSSSYHYANLEDFYRQHHLGVQHLLPLADDQSLKSDIRWARSTDEGRVNNRALNALFTYRLGGHAFGLGYQRMSGDSGFAYLAGTDPYLVNFVQIGDFANKDERSWQLRYDYDFAAIGLPGLTFMSRYLRGEHIDLLDGGGRGKEWERDTDIAYLVGPLKNLGIKLRNGTFRSDFGNDIDETRLIVSYALPLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Probable porin
publication title Crystal Structures of OccK Subfamily Proteins
rcsb
source organism Pseudomonas aeruginosa
total genus 85
structure length 370
sequence length 389
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4frtA00
2ZFGA 3O0EA 3SYBA 1HXTA 1GFOA 3A2SX 4FT6A 4LSFA 2PRNA 1PRNA 4D64A 1PHOA 4FRXA 2XG6A 3FYXA 3VY8X 1MPFA 2Y0KA 5DL8A 4KR4A 4D5UA 6PRNA 1GFPA 3K19A 4FSPA 1OPFA 4KR8A 3UPGA 3T20A 3VY9X 3PORA 2QTKA 5DL5A 2ZLDA 3HWBA 3SY7A 5PRNA 4AUIA 1E54A 3POUA 3WI4A 2ODJA 3SY9A 4LSIA 7PRNA 2XE2A 2XE3A 3EMNX 8PRNA 2PORA 2Y2XA 3NSGA 2XE5A 1GFNA 1HXUA 5DL6A 2XE1A 4D65A 4JFBA 2FGRA 2O4VA 1HXXA 4FRTA 3JTYA 4GCSA 1OSMA 1H6S1 3VZUX 1GFQA 4RJXA 3VZTX 3UU2A 4FMSA 1BH3A 3PRNA 4GCPA 2J1NA 4BUMX 3POXA 1BT9A 4FOZA 3T0SA 2J4UP 4LSEA 2Y0LA 1GFMA 2FGQX 4FSOA 3SZVA 3VZWX 2K4TA 5DL7A 2OMFA 4LSHA 3POQA 4C69X 4RJWA 3SYSA 4KRAA 3T24A 5JDPA 5FVNA 2Y0HA 3HW9A 3SZDA 3WI5A 4GCQA
chains in the Genus database with same CATH superfamily
3AA0B 4RLCA 2F1TA 3LK41 2ZFGA 3O0EA 3SYBA 2WVPA 4AYEC 3A0BO 3NJTA 1HXTA 5D5DA 1GFOA 2YNKA 3A2SX 4FT6A 4LSFA 5EE2A 2PRNA 4C4VB 3QRAA 2M06A 1PRNA 3AA7B 4U9CA 3UAQA 4E1TA 5G3AA 3DWOX 4JCHA 3VE1A 3DA3A 2YPVA 2N2MA 2R4NA 1QJ8A 2AXTO 2WJQA 4D64A 2KXPB 4UB8O 1PHOA 4FRXA 1T1LA 2XG6A 5G38A 3FYXA 3PF1A 3VY8X 1MPFA 3AAAA 3C5OA 4O3WA 1MM4A 2MHLA 2Y0KA 5DL8A 4AZLA 2XMXA 4FZMA 1ZHTA 4AKRA 1ZHYA 4KR4A 3RBHA 4FESA 2LHFA 5IYUA 2R8AA 4D5UA 6PRNA 4O3ZA 1GFPA 2R4LA 3K19A 4FSPA 1Q9FA 3WU2O 2ERVA 1OPFA 4KR8A 3LK3A 3LK2A 5KAIO 3QRCA 3AA1A 3AAAB 4FZNA 2KC0A 3AA6B 1ZHWA 3T20A 5E79O 3UPGA 2F1CX 4O3YA 1S5LO 3VY9X 4O4XA 2M07A 4CTDA 2X27X 3PORA 4XNLA 4O3XB 4FUVA 2QTKA 5DL5A 3GP6A 1BXWA 1THQA 2ZLDA 4AFKA 3HWBA 3SY7A 4K3BA 4AYID 4B61A 5PRNA 4AUIA 1E54A 3POUA 2R4OA 3WI4A 3G7GA 2ODJA 4N59A 5G26A 3AA1B 3SY9A 2W81C 4LSIA 4UB6O 2R88A 4QQ1A 4Z3TA 7PRNA 2KZ7A 4IL6O 1Q9GA 2XE2A 2XE3A 3EMNX 4GHBA 2PORA 2Y2XA 4K3CA 3AAEA 3NSGA 8PRNA 2XE5A 1GFNA 1HXUA 5DL6A 2XE1A 1ZHZA 4RL9A 3BRZA 4D65A 3KZIO 4N58A 4JFBA 2K0LA 1G90A 5GTIO 2KDYA 5TISO 2JQYA 1IZNA 2FGRA 2IWVA 2O4VA 2Y7SA 4AKMA 1T16A 1HXXA 5H2FO 4FRTA 4AKRB 4AYDC 2KZ7B 3JTYA 4GCSA 1MM5A 1OSMA 1H6S1 1YS5A 3PQUA 3AA0A 3VZUX 3PQSA 1GFQA 4RJXA 3VZTX 3UU2A 4F4BA 4FMSA 1BH3A 3PRNA 2R89A 2J1NA 4GCPA 3V8UA 5AFUK 3LK3B 3LK2B 5ADXK 3DZMA 4BUMX 3POXA 4AYNA 4C4VA 1ZHXA 1IZNB 5GV0A 1BT9A 4FZLA 4FOZA 3T0SA 4G76A 2J4UP 2IWWA 2X9KA 4LSEA 2Y0LA 3PGSA 5G39A 2MNHA 4E1SA 3DA4A 5ADXL 2LFUA 1GFMA 2FGQX 4FSOA 3SZVA 2JMMA 3VZWX 4AYMC 3LK42 5T5FA 2K4TA 3KVDD 2XTQA 4N75A 5KAFO 4GF4A 2R4PA 2W80C 3A0HO 5DL7A 2OMFA 5GTHO 4LSHA 2WJRA 4XNKA 3BS0A 4FQEA 3POQA 2F1VA 4C69X 1ORMA 1QJPA 4RJWA 1QJ9A 3AAEB 3DWNA 1P4TA 4O4UA 2GE4A 3SYSA 4KRAA 4N74A 3AA6A 3HOEA 3HOLA 4PJ0O 4RLBA 3T24A 3VE2A 3PGRA 4G75A 5AFUL 5B5EO 5FVNA 5JDPA 3JCUO 2XTRA 2Y0HA 4O49A 3AA7A 4C00A 2N2LA 3HW9A 3SZDA 5B66O 3BRYA 4PUXA 3PGUA 2KXPA 3WI5A 3TZGA 4GCQA 4PR7A
chains in the Genus database with same CATH topology
3AA0B 4RLCA 2F1TA 3LK41 2ZFGA 3O0EA 3SYBA 4AYEC 1HXTA 5D5DA 1GFOA 2YNKA 3A2SX 4FT6A 4LSFA 5EE2A 2PRNA 4E1TA 3QRAA 2M06A 1PRNA 3AA7B 4U9CA 3UAQA 3VE1A 4JCHA 3DA3A 2YPVA 2N2MA 1QJ8A 4D64A 2KXPB 1PHOA 4FRXA 2XG6A 3FYXA 3VY8X 1MPFA 3AAAA 3C5OA 4O3WA 1MM4A 2MHLA 2Y0KA 5DL8A 4AZLA 2XMXA 4FZMA 1ZHTA 4AKRA 1ZHYA 4KR4A 3RBHA 4FESA 2LHFA 5IYUA 4D5UA 6PRNA 4O3ZA 1GFPA 3K19A 4FSPA 1Q9FA 2ERVA 1OPFA 4KR8A 3LK3A 3LK2A 3QRCA 3AA1A 3AAAB 4FZNA 2KC0A 3AA6B 1ZHWA 3T20A 3UPGA 4O3YA 3VY9X 4O4XA 2M07A 2X27X 3PORA 4XNLA 4O3XB 4FUVA 2QTKA 5DL5A 3GP6A 1BXWA 1THQA 2ZLDA 4AFKA 3HWBA 3SY7A 4AYID 4B61A 5PRNA 4AUIA 1E54A 3POUA 3WI4A 3G7GA 2ODJA 4N59A 5G26A 3AA1B 3SY9A 2W81C 4LSIA 4QQ1A 4Z3TA 7PRNA 2KZ7A 1Q9GA 2XE2A 2XE3A 3EMNX 4GHBA 2PORA 2Y2XA 3VE2A 3AAEA 3NSGA 8PRNA 2XE5A 1GFNA 1HXUA 5DL6A 2XE1A 1ZHZA 4RL9A 4D65A 4N58A 4JFBA 2K0LA 1G90A 2KDYA 1IZNA 2FGRA 2Y7SA 2O4VA 4AKMA 1HXXA 4FRTA 4AKRB 4AYDC 2KZ7B 3JTYA 4GCSA 1MM5A 1OSMA 1H6S1 1YS5A 3PQUA 3AA0A 3VZUX 3PQSA 1GFQA 4RJXA 3VZTX 3UU2A 4F4BA 4FMSA 1BH3A 3PRNA 4GCPA 2J1NA 3V8UA 5AFUK 3LK3B 3LK2B 5ADXK 4BUMX 3POXA 4AYNA 1ZHXA 1IZNB 5GV0A 1BT9A 4FZLA 4FOZA 3T0SA 4G76A 2J4UP 4LSEA 2Y0LA 4E1SA 2MNHA 3DA4A 5ADXL 2LFUA 1GFMA 2FGQX 4FSOA 3SZVA 2JMMA 3VZWX 4AYMC 3LK42 5T5FA 2K4TA 3KVDD 2XTQA 4GF4A 2W80C 5DL7A 2OMFA 4LSHA 4XNKA 3POQA 2F1VA 4C69X 1ORMA 1QJPA 4RJWA 1QJ9A 3AAEB 3SYSA 1P4TA 4O4UA 2GE4A 4KRAA 4RLBA 3AA6A 3HOEA 3HOLA 3T24A 5AFUL 4G75A 5JDPA 5FVNA 2XTRA 2Y0HA 4O49A 3AA7A 2N2LA 3HW9A 3SZDA 4PUXA 2KXPA 3WI5A 3TZGA 4GCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZFG A;  3O0E A;  3SYB A;  1HXT A;  1GFO A;  3A2S X;  4FT6 A;  4LSF A;  2PRN A;  1PRN A;  4D64 A;  1PHO A;  4FRX A;  2XG6 A;  3FYX A;  3VY8 X;  1MPF A;  2Y0K A;  5DL8 A;  4KR4 A;  4D5U A;  6PRN A;  1GFP A;  3K19 A;  4FSP A;  1OPF A;  4KR8 A;  3UPG A;  3T20 A;  3VY9 X;  3POR A;  2QTK A;  5DL5 A;  2ZLD A;  3HWB A;  3SY7 A;  5PRN A;  4AUI A;  1E54 A;  3POU A;  3WI4 A;  2ODJ A;  3SY9 A;  4LSI A;  7PRN A;  2XE2 A;  2XE3 A;  3EMN X;  8PRN A;  2POR A;  2Y2X A;  3NSG A;  2XE5 A;  1GFN A;  1HXU A;  5DL6 A;  2XE1 A;  4D65 A;  4JFB A;  2FGR A;  2O4V A;  1HXX A;  4FRT A;  3JTY A;  4GCS A;  1OSM A;  1H6S 1;  3VZU X;  1GFQ A;  4RJX A;  3VZT X;  3UU2 A;  4FMS A;  1BH3 A;  3PRN A;  4GCP A;  2J1N A;  4BUM X;  3POX A;  1BT9 A;  4FOZ A;  3T0S A;  2J4U P;  4LSE A;  2Y0L A;  1GFM A;  2FGQ X;  4FSO A;  3SZV A;  3VZW X;  2K4T A;  5DL7 A;  2OMF A;  4LSH A;  3POQ A;  4C69 X;  4RJW A;  3SYS A;  4KRA A;  3T24 A;  5JDP A;  5FVN A;  2Y0H A;  3HW9 A;  3SZD A;  3WI5 A;  4GCQ A; 
#chains in the Genus database with same CATH topology
 3AA0 B;  4RLC A;  2F1T A;  3LK4 1;  2ZFG A;  3O0E A;  3SYB A;  2WVP A;  4AYE C;  3A0B O;  3NJT A;  1HXT A;  5D5D A;  1GFO A;  2YNK A;  3A2S X;  4FT6 A;  4LSF A;  5EE2 A;  2PRN A;  4C4V B;  3QRA A;  2M06 A;  1PRN A;  3AA7 B;  4U9C A;  3UAQ A;  4E1T A;  5G3A A;  3DWO X;  4JCH A;  3VE1 A;  3DA3 A;  2YPV A;  2N2M A;  2R4N A;  1QJ8 A;  2AXT O;  2WJQ A;  4D64 A;  2KXP B;  4UB8 O;  1PHO A;  4FRX A;  1T1L A;  2XG6 A;  5G38 A;  3FYX A;  3PF1 A;  3VY8 X;  1MPF A;  3AAA A;  3C5O A;  4O3W A;  1MM4 A;  2MHL A;  2Y0K A;  5DL8 A;  4AZL A;  2XMX A;  4FZM A;  1ZHT A;  4AKR A;  1ZHY A;  4KR4 A;  3RBH A;  4FES A;  2LHF A;  5IYU A;  2R8A A;  4D5U A;  6PRN A;  4O3Z A;  1GFP A;  2R4L A;  3K19 A;  4FSP A;  1Q9F A;  3WU2 O;  2ERV A;  1OPF A;  4KR8 A;  3LK3 A;  3LK2 A;  5KAI O;  3QRC A;  3AA1 A;  3AAA B;  4FZN A;  2KC0 A;  3AA6 B;  1ZHW A;  3T20 A;  5E79 O;  3UPG A;  2F1C X;  4O3Y A;  1S5L O;  3VY9 X;  4O4X A;  2M07 A;  4CTD A;  2X27 X;  3POR A;  4XNL A;  4O3X B;  4FUV A;  2QTK A;  5DL5 A;  3GP6 A;  1BXW A;  1THQ A;  2ZLD A;  4AFK A;  3HWB A;  3SY7 A;  4K3B A;  4AYI D;  4B61 A;  5PRN A;  4AUI A;  1E54 A;  3POU A;  2R4O A;  3WI4 A;  3G7G A;  2ODJ A;  4N59 A;  5G26 A;  3AA1 B;  3SY9 A;  2W81 C;  4LSI A;  4UB6 O;  2R88 A;  4QQ1 A;  4Z3T A;  7PRN A;  2KZ7 A;  4IL6 O;  1Q9G A;  2XE2 A;  2XE3 A;  3EMN X;  4GHB A;  2POR A;  2Y2X A;  4K3C A;  3AAE A;  3NSG A;  8PRN A;  2XE5 A;  1GFN A;  1HXU A;  5DL6 A;  2XE1 A;  1ZHZ A;  4RL9 A;  3BRZ A;  4D65 A;  3KZI O;  4N58 A;  4JFB A;  2K0L A;  1G90 A;  5GTI O;  2KDY A;  5TIS O;  2JQY A;  1IZN A;  2FGR A;  2IWV A;  2O4V A;  2Y7S A;  4AKM A;  1T16 A;  1HXX A;  5H2F O;  4FRT A;  4AKR B;  4AYD C;  2KZ7 B;  3JTY A;  4GCS A;  1MM5 A;  1OSM A;  1H6S 1;  1YS5 A;  3PQU A;  3AA0 A;  3VZU X;  3PQS A;  1GFQ A;  4RJX A;  3VZT X;  3UU2 A;  4F4B A;  4FMS A;  1BH3 A;  3PRN A;  2R89 A;  2J1N A;  4GCP A;  3V8U A;  5AFU K;  3LK3 B;  3LK2 B;  5ADX K;  3DZM A;  4BUM X;  3POX A;  4AYN A;  4C4V A;  1ZHX A;  1IZN B;  5GV0 A;  1BT9 A;  4FZL A;  4FOZ A;  3T0S A;  4G76 A;  2J4U P;  2IWW A;  2X9K A;  4LSE A;  2Y0L A;  3PGS A;  5G39 A;  2MNH A;  4E1S A;  3DA4 A;  5ADX L;  2LFU A;  1GFM A;  2FGQ X;  4FSO A;  3SZV A;  2JMM A;  3VZW X;  4AYM C;  3LK4 2;  5T5F A;  2K4T A;  3KVD D;  2XTQ A;  4N75 A;  5KAF O;  4GF4 A;  2R4P A;  2W80 C;  3A0H O;  5DL7 A;  2OMF A;  5GTH O;  4LSH A;  2WJR A;  4XNK A;  3BS0 A;  4FQE A;  3POQ A;  2F1V A;  4C69 X;  1ORM A;  1QJP A;  4RJW A;  1QJ9 A;  3AAE B;  3DWN A;  1P4T A;  4O4U A;  2GE4 A;  3SYS A;  4KRA A;  4N74 A;  3AA6 A;  3HOE A;  3HOL A;  4PJ0 O;  4RLB A;  3T24 A;  3VE2 A;  3PGR A;  4G75 A;  5AFU L;  5B5E O;  5FVN A;  5JDP A;  3JCU O;  2XTR A;  2Y0H A;  4O49 A;  3AA7 A;  4C00 A;  2N2L A;  3HW9 A;  3SZD A;  5B66 O;  3BRY A;  4PUX A;  3PGU A;  2KXP A;  3WI5 A;  3TZG A;  4GCQ A;  4PR7 A; 
#chains in the Genus database with same CATH homology
 3AA0 B;  4RLC A;  2F1T A;  3LK4 1;  2ZFG A;  3O0E A;  3SYB A;  4AYE C;  1HXT A;  5D5D A;  1GFO A;  2YNK A;  3A2S X;  4FT6 A;  4LSF A;  5EE2 A;  2PRN A;  4E1T A;  3QRA A;  2M06 A;  1PRN A;  3AA7 B;  4U9C A;  3UAQ A;  3VE1 A;  4JCH A;  3DA3 A;  2YPV A;  2N2M A;  1QJ8 A;  4D64 A;  2KXP B;  1PHO A;  4FRX A;  2XG6 A;  3FYX A;  3VY8 X;  1MPF A;  3AAA A;  3C5O A;  4O3W A;  1MM4 A;  2MHL A;  2Y0K A;  5DL8 A;  4AZL A;  2XMX A;  4FZM A;  1ZHT A;  4AKR A;  1ZHY A;  4KR4 A;  3RBH A;  4FES A;  2LHF A;  5IYU A;  4D5U A;  6PRN A;  4O3Z A;  1GFP A;  3K19 A;  4FSP A;  1Q9F A;  2ERV A;  1OPF A;  4KR8 A;  3LK3 A;  3LK2 A;  3QRC A;  3AA1 A;  3AAA B;  4FZN A;  2KC0 A;  3AA6 B;  1ZHW A;  3T20 A;  3UPG A;  4O3Y A;  3VY9 X;  4O4X A;  2M07 A;  2X27 X;  3POR A;  4XNL A;  4O3X B;  4FUV A;  2QTK A;  5DL5 A;  3GP6 A;  1BXW A;  1THQ A;  2ZLD A;  4AFK A;  3HWB A;  3SY7 A;  4AYI D;  4B61 A;  5PRN A;  4AUI A;  1E54 A;  3POU A;  3WI4 A;  3G7G A;  2ODJ A;  4N59 A;  5G26 A;  3AA1 B;  3SY9 A;  2W81 C;  4LSI A;  4QQ1 A;  4Z3T A;  7PRN A;  2KZ7 A;  1Q9G A;  2XE2 A;  2XE3 A;  3EMN X;  4GHB A;  2POR A;  2Y2X A;  3VE2 A;  3AAE A;  3NSG A;  8PRN A;  2XE5 A;  1GFN A;  1HXU A;  5DL6 A;  2XE1 A;  1ZHZ A;  4RL9 A;  4D65 A;  4N58 A;  4JFB A;  2K0L A;  1G90 A;  2KDY A;  1IZN A;  2FGR A;  2Y7S A;  2O4V A;  4AKM A;  1HXX A;  4FRT A;  4AKR B;  4AYD C;  2KZ7 B;  3JTY A;  4GCS A;  1MM5 A;  1OSM A;  1H6S 1;  1YS5 A;  3PQU A;  3AA0 A;  3VZU X;  3PQS A;  1GFQ A;  4RJX A;  3VZT X;  3UU2 A;  4F4B A;  4FMS A;  1BH3 A;  3PRN A;  4GCP A;  2J1N A;  3V8U A;  5AFU K;  3LK3 B;  3LK2 B;  5ADX K;  4BUM X;  3POX A;  4AYN A;  1ZHX A;  1IZN B;  5GV0 A;  1BT9 A;  4FZL A;  4FOZ A;  3T0S A;  4G76 A;  2J4U P;  4LSE A;  2Y0L A;  4E1S A;  2MNH A;  3DA4 A;  5ADX L;  2LFU A;  1GFM A;  2FGQ X;  4FSO A;  3SZV A;  2JMM A;  3VZW X;  4AYM C;  3LK4 2;  5T5F A;  2K4T A;  3KVD D;  2XTQ A;  4GF4 A;  2W80 C;  5DL7 A;  2OMF A;  4LSH A;  4XNK A;  3POQ A;  2F1V A;  4C69 X;  1ORM A;  1QJP A;  4RJW A;  1QJ9 A;  3AAE B;  3SYS A;  1P4T A;  4O4U A;  2GE4 A;  4KRA A;  4RLB A;  3AA6 A;  3HOE A;  3HOL A;  3T24 A;  5AFU L;  4G75 A;  5JDP A;  5FVN A;  2XTR A;  2Y0H A;  4O49 A;  3AA7 A;  2N2L A;  3HW9 A;  3SZD A;  4PUX A;  2KXP A;  3WI5 A;  3TZG A;  4GCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...