3LK2B

Crystal structure of capz bound to the uncapping motif from carmil
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
242
structure length
242
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of a capping protein interaction motif defines a family of actin filament regulators
doi rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
total genus 79
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lk2B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3lk2B02
5AFUK 3AA1B 3AAAB 1IZNB 2KXPB 5AFUL 3LK3B 3AAEB 3AA7B 4AKRB 3LK41 3AA6A 3LK2B 2KZ7B 4AKRA 3AAEA 3LK2A 3LK3A 2KZ7A 3AA7A 3AA0B 3AA6B 5ADXK 3AAAA 3AA1A 1IZNA 3AA0A 5ADXL 2KXPA 3LK42
chains in the Genus database with same CATH superfamily
1MMNA 2YDSA 3A8YC 4CN4A 1W9RA 2FJBA 3PU3A 2DNXA 5JVDE 1D0ZA 3P4PA 4EZ4A 2X9KA 3MJXA 2X9YA 3ZN0B 5L3EB 2PTFA 4AYEC 2AE9A 1XNQT 3AEAA 2IDOB 2KDYA 3CVRA 3VZWX 1MIWA 5IUXA 4AYMC 3SWHA 2WU5A 4KMCA 5FP3A 4DV7T 2A72A 3JC6D 3SY7A 4PR7A 5HEOA 3RKGA 2P9BA 5GONE 1KK7A 3UTKA 4O4LE 2CRBA 4JLEA 2K24A 3PJAA 3FZFB 7PRNA 3Q5DA 5EZYE 1UX5A 4PJ0O 2XHEB 3CKDA 3A0HO 4DR5T 3KVDD 3AE9A 4NUUA 5CB4E 2XTQA 2ODVA 4ILAA 3AVSA 2QRXA 2NW9A 4DV0T 3ZJ2A 4IT4A 2IIUA 4U2ZA 2UXCT 2XQ8A 3FHNA 4GIWA 3TLVA 4GK0E 4AI6A 4N58A 2XQ5A 4F8HA 1GFNA 1IAPA 3GA8A 2IHR1 2PJQA 4DIDB 3PGUA 4UF0A 3ZJ1A 3CIRA 4O2AE 1KFYA 4DR7T 4LFAT 4N75A 1MMGA 1YS5A 3EAMA 3N9NA 2V6YA 2CCQA 3O4XE 2K0LA 3RIUC 4U7IA 1ZHYA 1UURA 5E79O 1YD8G 3ZMZB 3ESLA 5G26A 1FEWA 5FYMA 4DR3T 4O4JE 1YKEB 4FESA 4TN7B 4B3TT 1U5PA 5J0ZA 4ZEYA 2XQ4A 4RJWA 2Q9QB 5JDPA 2E5LT 5LJNA 5HYAA 3AAEA 4QH1A 2BS2A 3T24A 1P4TA 3RRWA 3AEEA 4KX6A 2BDEA 3HW9A 5KAFO 5CFBA 2LSGA 3KV9A 3ZYKA 3BS0A 4GCQA 3IBPA 2OA5A 1QSDA 3ZT7A 3W15B 3G06A 2XSBA 3GN5A 3WAJA 2NOXA 2K4TA 4N59A 2XPKA 3IEEA 1HNZT 1US7B 4D5UA 4LMJA 4OX9T 4H9SE 4PAGA 4QX8B 5FXZA 5L4EA 4OK0A 3AE5A 3RC8A 4P0AA 4JI5T 2UXXB 3SFDA 5LGNB 3QC9A 4O3XB 3C64A 4AKRA 3ZEFB 2IW5B 2XE3A 1IJ6A 4X1KE 3AA7A 1GQEA 4COFA 5LA6E 4TX5A 3PUAA 4DMWA 4AKHA 4AQGA 5KDMC 1N36T 5C8YE 3ANWA 4UELA 2LM9A 4IIJE 5HXRA 5HXSA 1SE7A 4PK5A 2V5DA 5T5FA 4FQEA 3ZT6A 3T0SA 1OEDB 2X51A 2HHHT 5CJ5A 5AQTB 5J2TE 3VU7H 4O2BE 1UCUA 3GP6A 3VKGA 2WDRA 3IHRA 1BXWA 5AFUK 4ZS2A 4H9NC 4QH4A 5L4HA 5B5EO 3PUGA 4QWNB 4B6XA 5DL7A 4X20E 2WVPA 2CM0A 2VKDA 5CA0E 3L39A 4NUVA 5G38A 4NPPA 4H63H 4JI0T 2Y7SA 4G75A 3ZMSB 3NZQA 1Q9GA 5TAOA 3PV0F 2IUBA 3KFWX 1WRDA 5DABA 3IA3A 1IBLT 4FSPA 2QA7A 4DBQA 2XAHB 2VK9A 5F5WA 2Q9QC 3MA9A 2A9UA 5AQUB 3POUA 1BH3A 2Y2XA 3DP7A 5L3DB 5LGUB 5ABGA 2ACXA 2YDRA 2XM1A 1D1CA 3VE2A 5GTIO 2V6YB 4O3YA 3UT5E 2XQAA 2CA5A 5ABFB 2FBWA 2N1GA 5AQQB 3UFEA 1MNEA 4EZHA 4GK5E 5FY0A 4B3RT 3HKBE 5L3CB 1UUSA 5AQRB 4L5GA 3KVAA 1I94T 2V6XA 3E22E 2XM2A 2PBIA 3GN5B 2C5IT 4LF6T 5LOVE 1SHZC 3UAQA 4ZI2C 1WLXA 3CQGB 3P50A 4JI1T 2XY8B 2UXBT 5HCMA 4CN1A 2BKNA 4ZI2D 3LK2A 2XQYA 3U78A 2J47A 3CK6A 3NWIA 4BA9A 3LBXB 1O3XA 3WAKA 3FB2A 3RI5A 4HWCA 2I59A 5FKYA 3PE0A 1M62A 3AB3B 4TNVA 3PF1A 3LK3A 4CXYA 2BBJA 1XDPA 2R4PA 3PUVF 2FJEA 2YU1A 3C98B 3V8UA 2WB5A 2EHOC 4K0UA 2WQYA 4TNWA 3UU5A 3QNUA 3AAEB 4WYVA 4JI2T 3LK41 2ZLYA 1ZKEA 3UU3A 2ODJA 4PUXA 1NAFA 4HE8A 3T1HT 3HOEA 2Y6XA 1D1BA 3CPZA 2KLQA 1E7PA 4AKMA 4K3BA 3AE8A 3AA1B 4IE0A 4MLKA 1QLBA 2K48A 2X9XA 2R4LA 2L9QA 3RGLA 4AQFA 2WBLA 2BG9B 3HL6A 2J4GA 2N2LA 4DUZT 2DL1A 4RLBA 4EV6A 1UK5A 3FXEB 1T16A 2VKJA 2V7MA 5C2TA 3TLUA 4AZLA 2HN2A 4HFVA 3Q5EA 1HNXT 2RA1A 2KWIB 3RKOA 4AKRB 3PURA 4M1PA 2K9AA 4UEMA 3RRCA 5JH7E 3AEFA 2KNDA 5HEUA 5H6RB 4CTDA 4B61A 2V1DB 2KXPA 1OEDC 5AQMB 2RPAA 5JDHA 3AXJA 3PORA 2LHNA 3UULA 3Q2MA 2H7OA 4I50E 4FMSA 4DUYT 3NRXA 4GKKT 2N2MA 3HI2A 3DA4A 2MYSA 4X66T 4A5XA 2QYWA 4U2YA 5ADXL 3BQLA 4KHZF 1BR2A 2CBJA 2H3RA 4TUYE 4L0RA 1T98A 2UXNB 2H88A 2VVSA 3EHZA 2GE4A 2MAWA 2FUPA 3NKZA 3TLWA 3UFGA 2IC6A 2CHNA 4DR6T 5FL1A 2C5KT 2BS4A 3LG7A 3UUNA 1QJ9A 3QRAA 4TWFA 3LDQB 4H63V 5HEGA 1GFQA 1ZHXA 4PJJA 3Q5XA 3NVOA 4O49A 2M06A 2C0SA 3QRCA 2XAFB 3RQUA 3HR0A 1QJPA 3VY9X 3B13A 4BJMA 3K8PC 5AQGB 1J1JA 2J1NA 2LEHA 4RLCA 5LXTE 3SZDA 3J9X1 4MFRA 4ZZBA 2BKPA 5KMGP 3AAAA 1I6ZA 2D5UA 5LBQB 1HNWT 2R88A 4HFEA 4ZOLE 3X1DA 2YINA 2IWVA 2VQET 2X27X 5F3JA 4G76A 3AEBA 2LSKA 2KT9A 5M4YA 2JIWA 3SRZA 5A1LA 1HTJF 4IL9A 1XMOT 4LMKA 2R6GF 3EABA 2R8AA 3J7Yq 3F2EA 5LJMA 3PUQA 3PUSA 1NEKA 1OEDA 3UQ7A 1VCTA 5HXCA 4IL4A 3EI0A 5DJQC 4I55E 3I9WA 4MBQA 5LHIB 2WMOA 4HGAA 4AUIA 3LFMA 1E54A 4UVBB 4LFBT 2JMHA 3BRYA 4U3CA 2KC0A 3LK2B 2NW8A 2XAGB 1H7CA 1OWAA 1BT9A 1Y64B 2D9DA 2WJQA 4BJNA 5L3FB 1LVKA 2X9WA 4YTNA 3PTRB 5HXEA 3UPGA 4OFZA 4PJLA 3CX7B 3H37A 3N9MA 5C3JA 4GYSA 5FY1A 3ABVA 5AQKB 4EEBA 3OYXA 2JMKA 2LJLA 4EOZB 3KZIO 2CBIA 4P09A 4ANJA 1HCIA 2AXTO 1MPFA 3QUJA 2N9DA 2CWOA 4U72A 5FXXA 4Z91A 4YY3T 1NENA 2XAJB 4NXMT 2W4XA 3V5SA 2E9XA 2EHOB 3ZMTB 4DV2T 1E2AA 4EIWA 5FVNA 5HCJA 2KINB 4B3MT 4O4XA 3VZUX 3DWOX 4QH5A 1Z0PA 3POQA 3C50A 3SS1A 1J5ET 2V7JA 3PQSA 5IYZE 2YN6A 3U3IA 1E1HB 4C91A 2OV9A 5JRCB 3QOFA 3EDVA 3IF8B 4UIGA 3O1JA 2BG9C 4D65A 2KSRA 2VL8A 4KR8A 4LF4T 4FOZA 4GF4A 4IGUA 3EUHA 3RBHA 2LLYA 2LFUA 4AQYT 5LP6E 5LBMA 4DBRA 2CWYA 1T1LA 3ZC1A 3VRAA 2NW7A 2UU9T 4WBNE 2UUAT 4EYYR 1W0AA 4QXBB 2XTLA 4HEAA 4IDNA 1HFAA 4PK6A 4YXDA 2ODUA 1CHUA 4YSYA 2PORA 2JQQA 2LOPA 4DV4T 1HG2A 4I43B 2J62A 4ILBA 2FGRA 2VKHA 2J4UP 4FI5A 5AQLB 3RYHE 4L9IA 2HPJA 4DMVA 5HWYA 4O3ZA 4KI0F 1QUUA 2D0UA 2LKHA 4AFKA 1HG5A 3AA0A 4YSXA 4GYRA 3R6NA 5G39A 3B57A 3AAAB 3RH3A 2GK9A 4IE7A 3ZYMA 5FL0A 4AYNA 4XNLA 2Q9QA 3MACA 4OYJA 2XASB 5LHHB 2W61A 4IDPA 5E0OA 3RX6A 4GOUA 5DL6A 2A2FX 4JBWF 5DQVA 1MM5A 3KV4A 5L3GB 4UVCB 4AXPA 3FZKB 2EHOA 3K3QC 2VQFT 5JR9B 4LSHA 2XE5A 3RYCE 3SYSA 2ERVA 3ZMVB 4HTEA 3OKQA 2B76A 5FXVA 4JI4T 3JADA 4GKJT 4ISTA 1N33T 3FZLB 3KV6A 5AQVB 2IWWA 5KAIO 4B3ST 3V5UA 2YDQA 5DL5A 2W62A 2WP9A 5J2UE 3UUXB 2DWKA 4CI2B 1VCSA 2I6HA 2WU2A 3R84B 3OVUA 2XQ3A 2F1TA 4CN6A 2RP4A 4UB6O 2JQHA 3EDUA 4NIQA 3N9LA 4FRTA 4KHPT 4K3CA 3SYBA 1GFOA 4XBFB 4X65T 5B66O 2ES0A 5ABFA 2QGSA 3AE3A 1Y01A 2O4VA 1S94A 4EEDA 3VY8X 5AQSB 2JPFA 3HKCE 1HS7A 2YEVC 4JYAT 2HPLA 4AYDC 4X62T 3M3ZB 4GCSA 4TV8E 4DNDA 4BUMX 2UUCT 4ISSA 3K1SA 4WZXA 1U4QA 3JTYA 4BAYB 2W81C 4HFHA 4G2AA 3SZVA 4A98A 1IBKT 2XZEA 1IZNB 3PGSA 3AE2A 5IWAT 3E0ZA 3A0BO 3A2SX 1W09A 1ZEEA 3SFEA 4ILCA 5PRNA 3UU2A 5AQHB 2W67A 3Q5WA 2LKGA 1OSMA 1WYBA 4OYKA 3I9YA 2PG8A 2VURA 3UU8A 3F31A 2FJAA 4PJNA 4HFDA 1N32T 2IMLA 4AISA 1UGOA 5JDFA 4FUVA 4PK4A 4PNIA 3KBUA 4I4TE 3PUYF 4WNKA 3RQWA 1XDOA 4NXNT 4YLHA 2X0HA 2NTXA 4IREA 5JQGE 3N9OA 4QXCB 2Y0HA 3AA7B 2CEAA 3UU6A 3ZLIA 1T7SA 2XE2A 3RLFF 2JQ9A 5EE2A 4PFPA 1VOMA 4LSEA 1Z8UA 4X5TA 1JNZA 2V7LA 5G3AA 4U9CA 2FGQX 3AE1A 1WYCA 5J1GA 4FZLA 1MM4A 4LF7T 4E7ZA 4YHHT 3ZYLA 1D1AA 2JRKA 2R4NA 4CZZB 3LJCA 4QXHB 4ILUA 2X0LB 2CMRA 4DO0A 5H6QB 4JEHB 3NBXX 1UX4A 2MHLA 1OPFA 3BRZA 2KWHA 2CPTA 4FZNA 1YQ3A 1HXUA 4KBMB 5AQIB 4JI8T 4LF9T 4O4UA 3PJAJ 3POXA 6PRNA 3PU8A 4FZMA 2E8IA 2HH7A 1OEDE 2BG9A 2K5BB 5FNVE 2JQYA 2X66A 3NZPA 5JR9A 2VWAA 2WMNA 5ETWA 1T8BA 2MBGA 2XUEA 4FJOA 2WCAA 1ZV4X 4IE5A 3BK9A 4U31A 1DU2A 1YW0A 3MKDA 2LRKA 4F6RC 5AFUL 4QHOA 4AIUA 1FJGT 4CQIA 2NWBA 5DQWA 1WFDA 3O1HA 4V1Av 4YJ2E 4DR2T 2YK0A 2LRLA 4HN9A 5LGTB 3C4ZA 3AA1A 2ACZA 4ZI7E 5DL8A 1LRZA 1ZHCA 1ORMA 3JAFA 3L8RA 3ZPOA 3ZT5A 4UV8B 3VR9A 3N2GE 4E1TA 2PFVA 1PHOA 3FBZA 5JDNA 2W00A 3CWZB 5JR9C 4DVDA 3AECA 5LNKA 2A3DA 3LK42 4IHJE 1KNRA 2WAUA 4U74A 4YSZA 2JQKA 3BQIA 2SPCA 5AQOB 5FVKA 4XNKA 2V7IA 2V5CA 2M07A 2XQ9A 4LMLA 2CXDA 4YHJA 1D0XA 4DR4T 1QJ8A 1WR6A 2LOSA 1IZNA 1YXRA 4HFCA 4EGWA 1X79A 4HWDA 4Z90A 3ZC0A 1W0BA 2ZLDA 3LK3B 3JAEA 5AQJB 2W63A 3TLSA 3O1IA 1SA0E 4FT6A 4UB8O 5FXWA 5KXJA 3DTOA 3HA4A 4LFCT 3NJTA 2F4VT 5HAXA 1ZHTA 4E7SA 3A7MA 4X1YE 1Q9FA 2BBHA 3PDYA 5LB7B 3ANWB 5LYJE 3T1YT 3PUXF 4I0UA 2CXLA 5JRCA 3LSVA 3PUZF 1NWMX 4A97A 2W80C 2DHRA 1LKXA 1S35A 3RPUA 1KNPA 3AA6B 3VKHA 3HKEE 4U7YA 1IJ5A 4CXWA 1M7KA 2V8SV 3DA3A 5IHYA 1BR4A 1THQA 2KZ7B 4G63A 3OPCA 2D0TA 3SOLA 3KBTA 1YQ4A 1ZHWA 2WDVA 2LSJA 4AKGA 3AAIA 2V26A 5JDQA 5GTHO 3N9QA 2FJDA 5HWXA 1IBMT 2F1CX 4TZ4C 2BVLA 2HN1A 5TISO 1YKHB 2YU2A 4IDZA 4DV5T 3ETVA 4WW0A 2AXDS 3A5XA 2KXPB 4F4BA 2XQ6A 2CLYB 2ZM0A 3CQCB 4K0KT 1G8XA 3N2OA 2E5VA 4YTMA 4ZXLA 3L09A 2CHOA 3PQUA 2MNHA 4GCPA 2VASA 3JCFA 3ZMUB 4U33A 2NP9A 1BR0A 4Q25A 2R89A 2Z6EA 2IC9A 4HFBA 4DV3T 2VL0A 3B5MA 1GFMA 1SUMB 1HR0T 3N5LA 2WWVA 1XNRT 3QB5K 3S4UA 3ZSSA 4JV5T 4IL6O 2WZHA 1B7TA 3WI5A 2X67A 4UVAB 3TLTA 3M65A 4AQFC 1KEYA 4AKLA 3KINB 1HX1B 2W66A 3C5OA 5HXHA 2BKOA 5CA1E 2CXFA 5FVLA 4GHBA 2X0YA 4ERRA 2R4OA 4Z8XA 2V7KA 3JC6C 2X68A 3GMIA 3RHWA 3UUBA 2WY2A 3F57A 2W2UA 3WU2O 2WS3A 2L8KA 3TKLB 2OMFA 1AJ3A 4DV1T 4HWIB 3RIFA 4H9PC 2X9HA 1R8IA 5LMUT 4MHCA 4EAHA 2UUBT 4JI3T 4DR1T 2WJRA 2N2NA 4HWHA 4C00A 3OYZA 3LBXA 3E08A 1XZYA 5JTGA 4JCHA 4TWDA 3ETUA 1BR1A 4OHFA 1J5WA 4A56A 3AA0B 2BG9E 3ZSTA 4MALA 4PFOA 2BZBA 4TV9E 4KR4A 3FXDB 2MTQA 4H9QC 3ZCIA 4ZI3C 2BVMA 3HOLA 4FRXA 3KDSE 1JNRA 1S5LO 3OBVE 2UXDT 2KZ7A 1PRNA 4N78D 2MOZA 3WI3A 2ZM6T 3SY9A 2D2SA 3NSGA 4CI3B 4JI6T 2LSYA 3ZKRA 3AA6A 5JREA 2CE7A 5L47A 2VKOA 5AQPB 2LT3A 4YJ3E 4C4VA 5L2LA 4PJMA 3H3MA 4Z3TA 2H7VC 3EMNX 2MPKA 3N2KE 2E9XB 1WR0A 1GFPA 1OXZA 3AEGA 4CI1B 4J2CA 1HXTA 4ASKA 1HF8A 4JI7T 2VVNA 4CXXA 1X9BA 4QKNA 1LVFA 3O9XA 2CLYC 4EXTA 4O4IE 2E9XC 5IYUA 4JUYA 4HKAA 3P4RA 1G90A 3GWHA 4ZZCA 2L3LA 2XSAA 3CX6B 8PRNA 1CUNA 5ABEA 4P0BA 3P8CD 3CMLA 5AQFB 1KF6A 1ZP0A 1T72A 2J1DG 5ABHA 3L3PA 3QB5A 5JDMA 3VHLA 3FZMB 1MIYA 3MK7C 3C4XA 4RL9A 3WI4A 3AVRA 3HWBA 4XAXB 5L3BB 2XTRA 5JDLA 1FIOA 3FZHB 2XAQB 2M6BA 1G73A 3RC3A 2VB6A 1H6S1 5LMNT 2LE8A 4H9OC 4C69X 4ADZA 1V9DA 5LG3A 2ZMAA 2WM9A 2XMXA 2Y0LA 3TZGA 5BMVE 4IDQA 3PGRA 4YTPA 1MMAA 4LF8T 4O3WA 3KVBA 2IAKA 3CQXC 3PRNA 4EB6E 3FBLA 2W0GA 3VRBA 3ONJA 4KUMB 4HWFA 5EK3A 4H9RC 5JDGA 3VZTX 2YOEA 3DJBA 2E2AA 2LM2A 2JJ9A 5LG4A 3CX8B 1MNDA 3MXZA 4UXNB 4X1IE 3K3NA 3EVYA 1D0YA 4TWHA 4RJXA 4C90A 2YPVA 3AE4A 3AXJB 5ADXK 4IE4A 3KV5A 2BS3A 3P4QA 2C5JA 2ZFGA 5BR8T 5AQNB 4KRAA 4JFBA 3RF1A 1WCRA 3AE7A 2QVAA 4LSIA 1XMQT 2DLRA 2KMFA 2I0MA 2WZIA 3RIAA 5EK4A 2XQ7A 1ZHZA 2B1EA 2WDQA 4IDOA 5D5DA 2M67A 3N9PA 2DI4A 3I0QA 4HFIA 1HX8A 5KX5E 3D0TA 4UF0B 3ZCJA 2WSSV 2QTKA 4AKIA 1L0VA 2LHFA 2DCFA 3RYIE 4WBOA 4FSOA 5F8PA 3I0OA 4PW8A 3DZMA 3K19A 2E9XD 1FMWA 3ONLC 3BQKA 1N34T 3VR8A 5CGMA 2LHRA 2Y8DA 2EHOD 3Q9DA 4YT0A 4IE6A 1FMVA 3AE6A 2LSIA 3UQ4A 2YNKA 1ZOYA 2F1VA 2XG6A 2YKSA 3QK6A 3HKDE 1MMDA 3K3OA 3T20A 3FYXA 3P4WA 4KP3C 3RIUA 3O0EA 4O8SA 3MZKB 5GV0A 4N74A 2NR4A 2XJ7A 4LF5T 2WWUA 3JCUO 4AYID 3RYFE 2NTYA 4EYUA 4O4HE 4DV6T 2Y48B 3NRYA 2H89A 2K3WA 5H2FO 4D64A 2G0UA 4LSFA 4ZHQE 1MIVA 2M6IA 3H3AA 3P7IA 4C4VB 3C4WA 3T8OA 3OTOT 4E1SA 2ZM8A 3AEDA 3ZN1B 3P4SA 5LCYA 1EZ3A 2DWGA 1VRBA 3C51A 4JEUB 2JMMA 3UUMA 2Y0KA 5HEJA 3OJAA 2OLTA 1HXXA 4QX7B 1KNZA 5HEHA 4UV9B 5FY7A 3DWNA 3ONXA 4P1NA 4X64T 3G7GA 4ZI3D 3PUWF 1XWMA 5LHGB 5FMNA 4ZS3A 2PRNA 3I1AA 2XE1A 2ZM2A 4UR9A 2Q9QD 3VE1A 3UU4A 5EK2A 4QQ1A 4YFSA 4XZCA
chains in the Genus database with same CATH topology
1MMNA 3AA1B 2QGSA 4IE0A 2O4VA 4MLKA 3PU3A 1B7TA 2DNXA 5JVDE 1D0ZA 1S94A 2X67A 3WI5A 3VY8X 2K48A 4EZ4A 2X9XA 3MJXA 2L9QA 2JPFA 2X9YA 3ZN0B 4AQFA 5L3EB 4UVAB 2WBLA 3HKCE 1HS7A 3HL6A 4AYEC 3M65A 2N2LA 4AQFC 4RLBA 2YEVC 3KINB 4AKLA 3FXEB 2HPLA 4AYDC 2VKJA 2V7MA 4GCSA 4TV8E 4DNDA 4BUMX 2KDYA 3CVRA 4ISSA 5HXHA 3C5OA 3VZWX 3JTYA 1U4QA 1MIWA 4BAYB 3SWHA 5CA1E 4AYMC 4KMCA 2CXFA 2W81C 4AZLA 5FP3A 4G2AA 4GHBA 4HFVA 3SZVA 2A72A 4ERRA 1IZNB 4Z8XA 2V7KA 3JC6D 3JC6C 3SY7A 2X68A 3GMIA 2RA1A 2KWIB 3RKOA 4AKRB 3PURA 3E0ZA 4M1PA 2K9AA 2P9BA 3F57A 4UEMA 3RRCA 5GONE 3A2SX 1KK7A 2L8KA 3TKLB 1ZEEA 3UTKA 5JH7E 2OMFA 2KNDA 1AJ3A 4O4LE 5H6RB 4H9PC 5PRNA 3UU2A 4B61A 2X9HA 3Q5WA 4JLEA 2K24A 2V1DB 2KXPA 4MHCA 4EAHA 5JDHA 1OSMA 7PRNA 3PORA 1WYBA 4OYKA 2LHNA 2N2NA 5EZYE 3UULA 1UX5A 2H7OA 3I9YA 2PG8A 2XHEB 3Q2MA 4I50E 4FMSA 3OYZA 3LBXA 3E08A 3CKDA 3NRXA 3F31A 4JCHA 3KVDD 3ETUA 4PJNA 3HI2A 2N2MA 3DA4A 1BR1A 2MYSA 4NUUA 5CB4E 4OHFA 2XTQA 4A56A 5JDFA 3AA0B 4FUVA 4PK4A 2ODVA 4PNIA 3KBUA 4MALA 3AVSA 4PFOA 2NW9A 4I4TE 5ADXL 2BZBA 3BQLA 3ZJ2A 1BR2A 2H3RA 4TV9E 4WNKA 4KR4A 4TUYE 4L0RA 3FXDB 1T98A 2UXNB 2MTQA 4YLHA 4H9QC 2GE4A 2NTXA 5JQGE 2IC6A 3N9OA 4QXCB 3ZCIA 3FHNA 4GIWA 2Y0HA 4ZI3C 2BVMA 4GK0E 3AA7B 2CEAA 4AI6A 3HOLA 4FRXA 4N58A 2C5KT 1GFNA 1IAPA 3GA8A 3KDSE 2PJQA 3ZLIA 3LG7A 2XE2A 3OBVE 5EE2A 4UF0A 3UUNA 3ZJ1A 4PFPA 1VOMA 2KZ7A 4LSEA 3O0EA 1QJ9A 4O2AE 3QRAA 1PRNA 4N78D 2MOZA 4H63V 2V7LA 1MMGA 1YS5A 3N9NA 3WI3A 1GFQA 1ZHXA 4PJJA 3Q5XA 4U9CA 4O49A 2CCQA 2M06A 2C0SA 3O4XE 2K0LA 3QRCA 3SY9A 2XAFB 2FGQX 2D2SA 3NSGA 1ZHYA 1WYCA 4CI3B 3HR0A 5J1GA 1QJPA 2LSYA 3VY9X 1YD8G 3B13A 4BJMA 3ZMZB 3AA6A 3ESLA 5JREA 2CE7A 1MM4A 3K8PC 4FZLA 5G26A 2J1NA 2VKOA 4E7ZA 2LEHA 4RLCA 5LXTE 3SZDA 3J9X1 1FEWA 4MFRA 5FYMA 4O4JE 1YKEB 3ZYLA 1D1AA 5KMGP 2JRKA 3AAAA 2LT3A 2D5UA 4CZZB 5LBQB 4YJ3E 5L2LA 4FESA 4TN7B 4PJMA 1U5PA 3LJCA 4QXHB 4ZOLE 4ILUA 4Z3TA 2H7VC 2X0LB 2YINA 4RJWA 2CMRA 4DO0A 3EMNX 2Q9QB 5H6QB 2X27X 3N2KE 2E9XB 1GFPA 5F3JA 4G76A 4JEHB 1OXZA 3NBXX 4CI1B 5JDPA 4J2CA 1HXTA 4ASKA 1HF8A 5LJNA 5HYAA 1UX4A 2MHLA 3AAEA 3T24A 2LSKA 2KT9A 1P4TA 1OPFA 4CXXA 3RRWA 5M4YA 3SRZA 4QKNA 1LVFA 2KWHA 3O9XA 4FZNA 5A1LA 2CLYC 2BDEA 4EXTA 4KBMB 1HTJF 1HXUA 4O4IE 3HW9A 2LSGA 3KV9A 2E9XC 3ZYKA 5IYUA 4JUYA 4GCQA 3J7Yq 3IBPA 4HKAA 4O4UA 3GWHA 1G90A 3F2EA 2L3LA 3POXA 6PRNA 3PU8A 4FZMA 2E8IA 2HH7A 2OA5A 3PUQA 1QSDA 5LJMA 3PUSA 3W15B 3GN5A 5HXCA 3WAJA 2K5BB 2NOXA 3CX6B 5FNVE 8PRNA 1CUNA 2K4TA 4N59A 4P0BA 3IEEA 2X66A 3P8CD 1US7B 3NZPA 3CMLA 4I55E 3I9WA 5DJQC 5JR9A 4D5UA 4H9SE 2VWAA 4MBQA 5LHIB 2WMNA 2J1DG 4PAGA 4QX8B 5ETWA 5FXZA 2MBGA 2XUEA 3L3PA 4FJOA 4OK0A 5JDMA 3VHLA 1MIYA 3MK7C 1ZV4X 2WMOA 4IE5A 3BK9A 3C4XA 4HGAA 4P0AA 3RC8A 4RL9A 3WI4A 2UXXB 1YW0A 3AVRA 3MKDA 4AUIA 3HWBA 4F6RC 3LFMA 1E54A 5LGNB 5AFUL 4QHOA 4XAXB 5L3BB 4CQIA 4UVBB 2NWBA 3QC9A 2XTRA 5DQWA 2JMHA 5JDLA 2KC0A 4O3XB 3LK2B 1FIOA 3C64A 2NW8A 2XAGB 2XAQB 1H7CA 1OWAA 3O1HA 4AKRA 1G73A 4V1Av 3RC3A 3ZEFB 4YJ2E 1BT9A 2VB6A 2IW5B 1H6S1 1Y64B 2YK0A 2LE8A 2XE3A 1IJ6A 4X1KE 3AA7A 4BJNA 4H9OC 1LVKA 4HN9A 5LA6E 5L3FB 2X9WA 1V9DA 4ADZA 5LGTB 4TX5A 4C69X 3C4ZA 3PUAA 4DMWA 2ZMAA 3AA1A 4AKHA 4AQGA 5KDMC 2WM9A 4ZI7E 5C8YE 5DL8A 1LRZA 1ZHCA 3ANWA 4UELA 1ORMA 2LM9A 3PTRB 5BMVE 2XMXA 2Y0LA 3TZGA 4IIJE 5HXRA 5HXSA 5HXEA 3UPGA 4OFZA 4PJLA 1MMAA 3CX7B 3H37A 3N9MA 4O3WA 3ZPOA 4PK5A 3KVBA 5T5FA 4GYSA 4UV8B 3N2GE 2IAKA 2LFUA 3CQXC 5FY1A 3PRNA 4EB6E 3FBLA 4E1TA 3T0SA 2W0GA 4KUMB 2PFVA 5EK3A 4H9RC 1PHOA 5JDGA 2X51A 3FBZA 3VZTX 3OYXA 2JMKA 3DJBA 5JDNA 2LJLA 2W00A 5J2TE 3VU7H 2JJ9A 4O2BE 4EOZB 3CWZB 5LG4A 1UCUA 3CX8B 5JR9C 4P09A 4DVDA 4ANJA 3GP6A 1HCIA 3VKGA 5LNKA 2A3DA 1MNDA 3MXZA 3LK42 3QUJA 1MPFA 4IHJE 2N9DA 3IHRA 2CWOA 2WAUA 4U72A 4UXNB 4X1IE 4ZS2A 4U74A 5FXXA 1BXWA 4H9NC 5AFUK 3K3NA 3EVYA 3BQIA 2SPCA 1D0YA 2XAJB 4XNKA 3PUGA 4RJXA 2V7IA 4QWNB 4B6XA 4C90A 2M07A 2YPVA 3V5SA 2E9XA 2CXDA 4YHJA 2EHOB 5DL7A 1D0XA 3ZMTB 4X20E 4EIWA 1WR6A 1QJ8A 5ADXK 4IE4A 5FVNA 3KV5A 2LOSA 2KINB 2CM0A 1IZNA 2VKDA 4O4XA 2C5JA 5CA0E 3VZUX 4NUVA 2ZFGA 1X79A 4H63H 1Z0PA 2Y7SA 3POQA 4G75A 3ZMSB 3NZQA 4JFBA 4KRAA 1Q9GA 3ZC0A 3C50A 5TAOA 2ZLDA 3KFWX 3LK3B 1WRDA 5DABA 3SS1A 2V7JA 3PQSA 5IYZE 4FSPA 2W63A 3U3IA 3O1IA 1E1HB 4LSIA 4C91A 2QA7A 1SA0E 4FT6A 5JRCB 5FXWA 3EDVA 3IF8B 4UIGA 2DLRA 3DTOA 3HA4A 3O1JA 4DBQA 2KMFA 2XAHB 4AFKA 4D65A 2VK9A 2Q9QC 5EK4A 5HAXA 2VL8A 3MA9A 1ZHTA 4KR8A 4E7SA 1ZHZA 4X1YE 4FOZA 1Q9FA 2B1EA 4GF4A 4IGUA 3POUA 1BH3A 3PDYA 3EUHA 2Y2XA 5D5DA 3RBHA 3ANWB 5LYJE 2M67A 3DP7A 5L3DB 3N9PA 5LGUB 5LP6E 2DI4A 3I0QA 5LBMA 2CWYA 4DBRA 2CXLA 3ZC1A 1HX8A 5JRCA 5KX5E 3D0TA 4UF0B 2ACXA 3ZCJA 2NW7A 1D1CA 1NWMX 3VE2A 2WSSV 2QTKA 4AKIA 4WBNE 2W80C 2LHFA 4O3YA 2DHRA 3UT5E 4EYYR 1LKXA 2DCFA 4QXBB 2XTLA 4WBOA 3RYIE 4HEAA 4FSOA 1HFAA 1S35A 3RPUA 5F8PA 3I0OA 2CA5A 4PW8A 3K19A 3AA6B 3VKHA 2E9XD 1FMWA 2N1GA 3HKEE 3BQKA 4PK6A 3UFEA 2ODUA 1MNEA 2PORA 4EZHA 4GK5E 2JQQA 2LHRA 2LOPA 1IJ5A 5FY0A 3HKBE 4CXWA 5L3CB 1HG2A 4I43B 2Y8DA 2EHOD 3DA3A 3Q9DA 4IE6A 5IHYA 4L5GA 1BR4A 2VKHA 2FGRA 3KVAA 1THQA 1FMVA 2J4UP 4FI5A 2LSIA 2YNKA 2F1VA 3RYHE 2XG6A 4L9IA 2KZ7B 3QK6A 3E22E 4G63A 2PBIA 3GN5B 3HKDE 2HPJA 4DMVA 1MMDA 5HWYA 4O3ZA 2C5IT 3K3OA 3T20A 2D0TA 5LOVE 1QUUA 1SHZC 2D0UA 4KP3C 3FYXA 1HG5A 3SOLA 4O8SA 3KBTA 3MZKB 1ZHWA 3AA0A 3UAQA 5GV0A 2LSJA 4GYRA 4ZI2C 4AKGA 3AAIA 2V26A 1WLXA 3R6NA 3B57A 3AAAB 5JDQA 3CQGB 2WWUA 3RH3A 2GK9A 3N9QA 4IE7A 4AYID 5HWXA 3ZYMA 3RYFE 2NTYA 4EYUA 4AYNA 4O4HE 2Y48B 4TZ4C 4XNLA 3NRYA 2Q9QA 4ZI2D 3LK2A 2BVLA 2XQYA 3MACA 3U78A 1YKHB 2YU2A 4IDZA 2XASB 4OYJA 5LHHB 4D64A 2G0UA 2W61A 3ETVA 4WW0A 4BA9A 5E0OA 3RX6A 3LBXB 1O3XA 4GOUA 3WAKA 2A2FX 4LSFA 5DL6A 4ZHQE 1MIVA 5DQVA 1MM5A 3FB2A 3H3AA 3KV4A 3P7IA 5L3GB 4UVCB 4AXPA 3A5XA 3C4WA 3T8OA 2KXPB 2I59A 4E1SA 2ZM8A 3ZN1B 2EHOA 3K3QC 5LCYA 4F4BA 5JR9B 4LSHA 1EZ3A 2DWGA 2XE5A 1VRBA 2CLYB 3C51A 3RYCE 3PE0A 4JEUB 3SYSA 2ZM0A 2ERVA 3ZMVB 3AB3B 2JMMA 4HTEA 3CQCB 3UUMA 2Y0KA 3LK3A 3OKQA 3OJAA 1G8XA 3N2OA 1HXXA 5FXVA 4QX7B 4CXYA 4ISTA 3L09A 1KNZA 4UV9B 5FY7A 3ONXA 3PQUA 2YU1A 3C98B 3KV6A 3V8UA 2MNHA 3V5UA 4GCPA 2EHOC 2VASA 3G7GA 5DL5A 4K0UA 2W62A 4ZI3D 5J2UE 5FMNA 2DWKA 3UUXB 5LHGB 3ZMUB 3AAEB 4CI2B 2NP9A 4ZS3A 2PRNA 3LK41 2ZLYA 3I1AA 1ZKEA 1BR0A 2ODJA 4PUXA 2Z6EA 1NAFA 2XE1A 2IC9A 2ZM2A 4HE8A 3R84B 3HOEA 2F1TA 2RP4A 2Q9QD 1GFMA 3VE1A 2Y6XA 3EDUA 3N5LA 1D1BA 3CPZA 2KLQA 3N9LA 4FRTA 5EK2A 3S4UA 3SYBA 1GFOA 4XBFB 4QQ1A 4AKMA 2ES0A 4YFSA 4XZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFU K;  3AA1 B;  3AAA B;  1IZN B;  2KXP B;  5AFU L;  3LK3 B;  3AAE B;  3AA7 B;  4AKR B;  3LK4 1;  3AA6 A;  3LK2 B;  2KZ7 B;  4AKR A;  3AAE A;  3LK2 A;  3LK3 A;  2KZ7 A;  3AA7 A;  3AA0 B;  3AA6 B;  5ADX K;  3AAA A;  3AA1 A;  1IZN A;  3AA0 A;  5ADX L;  2KXP A;  3LK4 2; 
#chains in the Genus database with same CATH topology
 1MMN A;  2YDS A;  3A8Y C;  4CN4 A;  1W9R A;  2FJB A;  3PU3 A;  2DNX A;  5JVD E;  1D0Z A;  3P4P A;  4EZ4 A;  2X9K A;  3MJX A;  2X9Y A;  3ZN0 B;  5L3E B;  2PTF A;  4AYE C;  2AE9 A;  1XNQ T;  3AEA A;  2IDO B;  2KDY A;  3CVR A;  3VZW X;  1MIW A;  5IUX A;  4AYM C;  3SWH A;  2WU5 A;  4KMC A;  5FP3 A;  4DV7 T;  2A72 A;  3JC6 D;  3SY7 A;  4PR7 A;  5HEO A;  3RKG A;  2P9B A;  5GON E;  1KK7 A;  3UTK A;  4O4L E;  2CRB A;  4JLE A;  2K24 A;  3PJA A;  3FZF B;  7PRN A;  3Q5D A;  5EZY E;  1UX5 A;  4PJ0 O;  2XHE B;  3CKD A;  3A0H O;  4DR5 T;  3KVD D;  3AE9 A;  4NUU A;  5CB4 E;  2XTQ A;  2ODV A;  4ILA A;  3AVS A;  2QRX A;  2NW9 A;  4DV0 T;  3ZJ2 A;  4IT4 A;  2IIU A;  4U2Z A;  2UXC T;  2XQ8 A;  3FHN A;  4GIW A;  3TLV A;  4GK0 E;  4AI6 A;  4N58 A;  2XQ5 A;  4F8H A;  1GFN A;  1IAP A;  3GA8 A;  2IHR 1;  2PJQ A;  4DID B;  3PGU A;  4UF0 A;  3ZJ1 A;  3CIR A;  4O2A E;  1KFY A;  4DR7 T;  4LFA T;  4N75 A;  1MMG A;  1YS5 A;  3EAM A;  3N9N A;  2V6Y A;  2CCQ A;  3O4X E;  2K0L A;  3RIU C;  4U7I A;  1ZHY A;  1UUR A;  5E79 O;  1YD8 G;  3ZMZ B;  3ESL A;  5G26 A;  1FEW A;  5FYM A;  4DR3 T;  4O4J E;  1YKE B;  4FES A;  4TN7 B;  4B3T T;  1U5P A;  5J0Z A;  4ZEY A;  2XQ4 A;  4RJW A;  2Q9Q B;  5JDP A;  2E5L T;  5LJN A;  5HYA A;  3AAE A;  4QH1 A;  2BS2 A;  3T24 A;  1P4T A;  3RRW A;  3AEE A;  4KX6 A;  2BDE A;  3HW9 A;  5KAF O;  5CFB A;  2LSG A;  3KV9 A;  3ZYK A;  3BS0 A;  4GCQ A;  3IBP A;  2OA5 A;  1QSD A;  3ZT7 A;  3W15 B;  3G06 A;  2XSB A;  3GN5 A;  3WAJ A;  2NOX A;  2K4T A;  4N59 A;  2XPK A;  3IEE A;  1HNZ T;  1US7 B;  4D5U A;  4LMJ A;  4OX9 T;  4H9S E;  4PAG A;  4QX8 B;  5FXZ A;  5L4E A;  4OK0 A;  3AE5 A;  3RC8 A;  4P0A A;  4JI5 T;  2UXX B;  3SFD A;  5LGN B;  3QC9 A;  4O3X B;  3C64 A;  4AKR A;  3ZEF B;  2IW5 B;  2XE3 A;  1IJ6 A;  4X1K E;  3AA7 A;  1GQE A;  4COF A;  5LA6 E;  4TX5 A;  3PUA A;  4DMW A;  4AKH A;  4AQG A;  5KDM C;  1N36 T;  5C8Y E;  3ANW A;  4UEL A;  2LM9 A;  4IIJ E;  5HXR A;  5HXS A;  1SE7 A;  4PK5 A;  2V5D A;  5T5F A;  4FQE A;  3ZT6 A;  3T0S A;  1OED B;  2X51 A;  2HHH T;  5CJ5 A;  5AQT B;  5J2T E;  3VU7 H;  4O2B E;  1UCU A;  3GP6 A;  3VKG A;  2WDR A;  3IHR A;  1BXW A;  5AFU K;  4ZS2 A;  4H9N C;  4QH4 A;  5L4H A;  5B5E O;  3PUG A;  4QWN B;  4B6X A;  5DL7 A;  4X20 E;  2WVP A;  2CM0 A;  2VKD A;  5CA0 E;  3L39 A;  4NUV A;  5G38 A;  4NPP A;  4H63 H;  4JI0 T;  2Y7S A;  4G75 A;  3ZMS B;  3NZQ A;  1Q9G A;  5TAO A;  3PV0 F;  2IUB A;  3KFW X;  1WRD A;  5DAB A;  3IA3 A;  1IBL T;  4FSP A;  2QA7 A;  4DBQ A;  2XAH B;  2VK9 A;  5F5W A;  2Q9Q C;  3MA9 A;  2A9U A;  5AQU B;  3POU A;  1BH3 A;  2Y2X A;  3DP7 A;  5L3D B;  5LGU B;  5ABG A;  2ACX A;  2YDR A;  2XM1 A;  1D1C A;  3VE2 A;  5GTI O;  2V6Y B;  4O3Y A;  3UT5 E;  2XQA A;  2CA5 A;  5ABF B;  2FBW A;  2N1G A;  5AQQ B;  3UFE A;  1MNE A;  4EZH A;  4GK5 E;  5FY0 A;  4B3R T;  3HKB E;  5L3C B;  1UUS A;  5AQR B;  4L5G A;  3KVA A;  1I94 T;  2V6X A;  3E22 E;  2XM2 A;  2PBI A;  3GN5 B;  2C5I T;  4LF6 T;  5LOV E;  1SHZ C;  3UAQ A;  4ZI2 C;  1WLX A;  3CQG B;  3P50 A;  4JI1 T;  2XY8 B;  2UXB T;  5HCM A;  4CN1 A;  2BKN A;  4ZI2 D;  3LK2 A;  2XQY A;  3U78 A;  2J47 A;  3CK6 A;  3NWI A;  4BA9 A;  3LBX B;  1O3X A;  3WAK A;  3FB2 A;  3RI5 A;  4HWC A;  2I59 A;  5FKY A;  3PE0 A;  1M62 A;  3AB3 B;  4TNV A;  3PF1 A;  3LK3 A;  4CXY A;  2BBJ A;  1XDP A;  2R4P A;  3PUV F;  2FJE A;  2YU1 A;  3C98 B;  3V8U A;  2WB5 A;  2EHO C;  4K0U A;  2WQY A;  4TNW A;  3UU5 A;  3QNU A;  3AAE B;  4WYV A;  4JI2 T;  3LK4 1;  2ZLY A;  1ZKE A;  3UU3 A;  2ODJ A;  4PUX A;  1NAF A;  4HE8 A;  3T1H T;  3HOE A;  2Y6X A;  1D1B A;  3CPZ A;  2KLQ A;  1E7P A;  4AKM A;  4K3B A;  3AE8 A;  3AA1 B;  4IE0 A;  4MLK A;  1QLB A;  2K48 A;  2X9X A;  2R4L A;  2L9Q A;  3RGL A;  4AQF A;  2WBL A;  2BG9 B;  3HL6 A;  2J4G A;  2N2L A;  4DUZ T;  2DL1 A;  4RLB A;  4EV6 A;  1UK5 A;  3FXE B;  1T16 A;  2VKJ A;  2V7M A;  5C2T A;  3TLU A;  4AZL A;  2HN2 A;  4HFV A;  3Q5E A;  1HNX T;  2RA1 A;  2KWI B;  3RKO A;  4AKR B;  3PUR A;  4M1P A;  2K9A A;  4UEM A;  3RRC A;  5JH7 E;  3AEF A;  2KND A;  5HEU A;  5H6R B;  4CTD A;  4B61 A;  2V1D B;  2KXP A;  1OED C;  5AQM B;  2RPA A;  5JDH A;  3AXJ A;  3POR A;  2LHN A;  3UUL A;  3Q2M A;  2H7O A;  4I50 E;  4FMS A;  4DUY T;  3NRX A;  4GKK T;  2N2M A;  3HI2 A;  3DA4 A;  2MYS A;  4X66 T;  4A5X A;  2QYW A;  4U2Y A;  5ADX L;  3BQL A;  4KHZ F;  1BR2 A;  2CBJ A;  2H3R A;  4TUY E;  4L0R A;  1T98 A;  2UXN B;  2H88 A;  2VVS A;  3EHZ A;  2GE4 A;  2MAW A;  2FUP A;  3NKZ A;  3TLW A;  3UFG A;  2IC6 A;  2CHN A;  4DR6 T;  5FL1 A;  2C5K T;  2BS4 A;  3LG7 A;  3UUN A;  1QJ9 A;  3QRA A;  4TWF A;  3LDQ B;  4H63 V;  5HEG A;  1GFQ A;  1ZHX A;  4PJJ A;  3Q5X A;  3NVO A;  4O49 A;  2M06 A;  2C0S A;  3QRC A;  2XAF B;  3RQU A;  3HR0 A;  1QJP A;  3VY9 X;  3B13 A;  4BJM A;  3K8P C;  5AQG B;  1J1J A;  2J1N A;  2LEH A;  4RLC A;  5LXT E;  3SZD A;  3J9X 1;  4MFR A;  4ZZB A;  2BKP A;  5KMG P;  3AAA A;  1I6Z A;  2D5U A;  5LBQ B;  1HNW T;  2R88 A;  4HFE A;  4ZOL E;  3X1D A;  2YIN A;  2IWV A;  2VQE T;  2X27 X;  5F3J A;  4G76 A;  3AEB A;  2LSK A;  2KT9 A;  5M4Y A;  2JIW A;  3SRZ A;  5A1L A;  1HTJ F;  4IL9 A;  1XMO T;  4LMK A;  2R6G F;  3EAB A;  2R8A A;  3J7Y q;  3F2E A;  5LJM A;  3PUQ A;  3PUS A;  1NEK A;  1OED A;  3UQ7 A;  1VCT A;  5HXC A;  4IL4 A;  3EI0 A;  5DJQ C;  4I55 E;  3I9W A;  4MBQ A;  5LHI B;  2WMO A;  4HGA A;  4AUI A;  3LFM A;  1E54 A;  4UVB B;  4LFB T;  2JMH A;  3BRY A;  4U3C A;  2KC0 A;  3LK2 B;  2NW8 A;  2XAG B;  1H7C A;  1OWA A;  1BT9 A;  1Y64 B;  2D9D A;  2WJQ A;  4BJN A;  5L3F B;  1LVK A;  2X9W A;  4YTN A;  3PTR B;  5HXE A;  3UPG A;  4OFZ A;  4PJL A;  3CX7 B;  3H37 A;  3N9M A;  5C3J A;  4GYS A;  5FY1 A;  3ABV A;  5AQK B;  4EEB A;  3OYX A;  2JMK A;  2LJL A;  4EOZ B;  3KZI O;  2CBI A;  4P09 A;  4ANJ A;  1HCI A;  2AXT O;  1MPF A;  3QUJ A;  2N9D A;  2CWO A;  4U72 A;  5FXX A;  4Z91 A;  4YY3 T;  1NEN A;  2XAJ B;  4NXM T;  2W4X A;  3V5S A;  2E9X A;  2EHO B;  3ZMT B;  4DV2 T;  1E2A A;  4EIW A;  5FVN A;  5HCJ A;  2KIN B;  4B3M T;  4O4X A;  3VZU X;  3DWO X;  4QH5 A;  1Z0P A;  3POQ A;  3C50 A;  3SS1 A;  1J5E T;  2V7J A;  3PQS A;  5IYZ E;  2YN6 A;  3U3I A;  1E1H B;  4C91 A;  2OV9 A;  5JRC B;  3QOF A;  3EDV A;  3IF8 B;  4UIG A;  3O1J A;  2BG9 C;  4D65 A;  2KSR A;  2VL8 A;  4KR8 A;  4LF4 T;  4FOZ A;  4GF4 A;  4IGU A;  3EUH A;  3RBH A;  2LLY A;  2LFU A;  4AQY T;  5LP6 E;  5LBM A;  4DBR A;  2CWY A;  1T1L A;  3ZC1 A;  3VRA A;  2NW7 A;  2UU9 T;  4WBN E;  2UUA T;  4EYY R;  1W0A A;  4QXB B;  2XTL A;  4HEA A;  4IDN A;  1HFA A;  4PK6 A;  4YXD A;  2ODU A;  1CHU A;  4YSY A;  2POR A;  2JQQ A;  2LOP A;  4DV4 T;  1HG2 A;  4I43 B;  2J62 A;  4ILB A;  2FGR A;  2VKH A;  2J4U P;  4FI5 A;  5AQL B;  3RYH E;  4L9I A;  2HPJ A;  4DMV A;  5HWY A;  4O3Z A;  4KI0 F;  1QUU A;  2D0U A;  2LKH A;  4AFK A;  1HG5 A;  3AA0 A;  4YSX A;  4GYR A;  3R6N A;  5G39 A;  3B57 A;  3AAA B;  3RH3 A;  2GK9 A;  4IE7 A;  3ZYM A;  5FL0 A;  4AYN A;  4XNL A;  2Q9Q A;  3MAC A;  4OYJ A;  2XAS B;  5LHH B;  2W61 A;  4IDP A;  5E0O A;  3RX6 A;  4GOU A;  5DL6 A;  2A2F X;  4JBW F;  5DQV A;  1MM5 A;  3KV4 A;  5L3G B;  4UVC B;  4AXP A;  3FZK B;  2EHO A;  3K3Q C;  2VQF T;  5JR9 B;  4LSH A;  2XE5 A;  3RYC E;  3SYS A;  2ERV A;  3ZMV B;  4HTE A;  3OKQ A;  2B76 A;  5FXV A;  4JI4 T;  3JAD A;  4GKJ T;  4IST A;  1N33 T;  3FZL B;  3KV6 A;  5AQV B;  2IWW A;  5KAI O;  4B3S T;  3V5U A;  2YDQ A;  5DL5 A;  2W62 A;  2WP9 A;  5J2U E;  3UUX B;  2DWK A;  4CI2 B;  1VCS A;  2I6H A;  2WU2 A;  3R84 B;  3OVU A;  2XQ3 A;  2F1T A;  4CN6 A;  2RP4 A;  4UB6 O;  2JQH A;  3EDU A;  4NIQ A;  3N9L A;  4FRT A;  4KHP T;  4K3C A;  3SYB A;  1GFO A;  4XBF B;  4X65 T;  5B66 O;  2ES0 A;  5ABF A;  2QGS A;  3AE3 A;  1Y01 A;  2O4V A;  1S94 A;  4EED A;  3VY8 X;  5AQS B;  2JPF A;  3HKC E;  1HS7 A;  2YEV C;  4JYA T;  2HPL A;  4AYD C;  4X62 T;  3M3Z B;  4GCS A;  4TV8 E;  4DND A;  4BUM X;  2UUC T;  4ISS A;  3K1S A;  4WZX A;  1U4Q A;  3JTY A;  4BAY B;  2W81 C;  4HFH A;  4G2A A;  3SZV A;  4A98 A;  1IBK T;  2XZE A;  1IZN B;  3PGS A;  3AE2 A;  5IWA T;  3E0Z A;  3A0B O;  3A2S X;  1W09 A;  1ZEE A;  3SFE A;  4ILC A;  5PRN A;  3UU2 A;  5AQH B;  2W67 A;  3Q5W A;  2LKG A;  1OSM A;  1WYB A;  4OYK A;  3I9Y A;  2PG8 A;  2VUR A;  3UU8 A;  3F31 A;  2FJA A;  4PJN A;  4HFD A;  1N32 T;  2IML A;  4AIS A;  1UGO A;  5JDF A;  4FUV A;  4PK4 A;  4PNI A;  3KBU A;  4I4T E;  3PUY F;  4WNK A;  3RQW A;  1XDO A;  4NXN T;  4YLH A;  2X0H A;  2NTX A;  4IRE A;  5JQG E;  3N9O A;  4QXC B;  2Y0H A;  3AA7 B;  2CEA A;  3UU6 A;  3ZLI A;  1T7S A;  2XE2 A;  3RLF F;  2JQ9 A;  5EE2 A;  4PFP A;  1VOM A;  4LSE A;  1Z8U A;  4X5T A;  1JNZ A;  2V7L A;  5G3A A;  4U9C A;  2FGQ X;  3AE1 A;  1WYC A;  5J1G A;  4FZL A;  1MM4 A;  4LF7 T;  4E7Z A;  4YHH T;  3ZYL A;  1D1A A;  2JRK A;  2R4N A;  4CZZ B;  3LJC A;  4QXH B;  4ILU A;  2X0L B;  2CMR A;  4DO0 A;  5H6Q B;  4JEH B;  3NBX X;  1UX4 A;  2MHL A;  1OPF A;  3BRZ A;  2KWH A;  2CPT A;  4FZN A;  1YQ3 A;  1HXU A;  4KBM B;  5AQI B;  4JI8 T;  4LF9 T;  4O4U A;  3PJA J;  3POX A;  6PRN A;  3PU8 A;  4FZM A;  2E8I A;  2HH7 A;  1OED E;  2BG9 A;  2K5B B;  5FNV E;  2JQY A;  2X66 A;  3NZP A;  5JR9 A;  2VWA A;  2WMN A;  5ETW A;  1T8B A;  2MBG A;  2XUE A;  4FJO A;  2WCA A;  1ZV4 X;  4IE5 A;  3BK9 A;  4U31 A;  1DU2 A;  1YW0 A;  3MKD A;  2LRK A;  4F6R C;  5AFU L;  4QHO A;  4AIU A;  1FJG T;  4CQI A;  2NWB A;  5DQW A;  1WFD A;  3O1H A;  4V1A v;  4YJ2 E;  4DR2 T;  2YK0 A;  2LRL A;  4HN9 A;  5LGT B;  3C4Z A;  3AA1 A;  2ACZ A;  4ZI7 E;  5DL8 A;  1LRZ A;  1ZHC A;  1ORM A;  3JAF A;  3L8R A;  3ZPO A;  3ZT5 A;  4UV8 B;  3VR9 A;  3N2G E;  4E1T A;  2PFV A;  1PHO A;  3FBZ A;  5JDN A;  2W00 A;  3CWZ B;  5JR9 C;  4DVD A;  3AEC A;  5LNK A;  2A3D A;  3LK4 2;  4IHJ E;  1KNR A;  2WAU A;  4U74 A;  4YSZ A;  2JQK A;  3BQI A;  2SPC A;  5AQO B;  5FVK A;  4XNK A;  2V7I A;  2V5C A;  2M07 A;  2XQ9 A;  4LML A;  2CXD A;  4YHJ A;  1D0X A;  4DR4 T;  1QJ8 A;  1WR6 A;  2LOS A;  1IZN A;  1YXR A;  4HFC A;  4EGW A;  1X79 A;  4HWD A;  4Z90 A;  3ZC0 A;  1W0B A;  2ZLD A;  3LK3 B;  3JAE A;  5AQJ B;  2W63 A;  3TLS A;  3O1I A;  1SA0 E;  4FT6 A;  4UB8 O;  5FXW A;  5KXJ A;  3DTO A;  3HA4 A;  4LFC T;  3NJT A;  2F4V T;  5HAX A;  1ZHT A;  4E7S A;  3A7M A;  4X1Y E;  1Q9F A;  2BBH A;  3PDY A;  5LB7 B;  3ANW B;  5LYJ E;  3T1Y T;  3PUX F;  4I0U A;  2CXL A;  5JRC A;  3LSV A;  3PUZ F;  1NWM X;  4A97 A;  2W80 C;  2DHR A;  1LKX A;  1S35 A;  3RPU A;  1KNP A;  3AA6 B;  3VKH A;  3HKE E;  4U7Y A;  1IJ5 A;  4CXW A;  1M7K A;  2V8S V;  3DA3 A;  5IHY A;  1BR4 A;  1THQ A;  2KZ7 B;  4G63 A;  3OPC A;  2D0T A;  3SOL A;  3KBT A;  1YQ4 A;  1ZHW A;  2WDV A;  2LSJ A;  4AKG A;  3AAI A;  2V26 A;  5JDQ A;  5GTH O;  3N9Q A;  2FJD A;  5HWX A;  1IBM T;  2F1C X;  4TZ4 C;  2BVL A;  2HN1 A;  5TIS O;  1YKH B;  2YU2 A;  4IDZ A;  4DV5 T;  3ETV A;  4WW0 A;  2AXD S;  3A5X A;  2KXP B;  4F4B A;  2XQ6 A;  2CLY B;  2ZM0 A;  3CQC B;  4K0K T;  1G8X A;  3N2O A;  2E5V A;  4YTM A;  4ZXL A;  3L09 A;  2CHO A;  3PQU A;  2MNH A;  4GCP A;  2VAS A;  3JCF A;  3ZMU B;  4U33 A;  2NP9 A;  1BR0 A;  4Q25 A;  2R89 A;  2Z6E A;  2IC9 A;  4HFB A;  4DV3 T;  2VL0 A;  3B5M A;  1GFM A;  1SUM B;  1HR0 T;  3N5L A;  2WWV A;  1XNR T;  3QB5 K;  3S4U A;  3ZSS A;  4JV5 T;  4IL6 O;  2WZH A;  1B7T A;  3WI5 A;  2X67 A;  4UVA B;  3TLT A;  3M65 A;  4AQF C;  1KEY A;  4AKL A;  3KIN B;  1HX1 B;  2W66 A;  3C5O A;  5HXH A;  2BKO A;  5CA1 E;  2CXF A;  5FVL A;  4GHB A;  2X0Y A;  4ERR A;  2R4O A;  4Z8X A;  2V7K A;  3JC6 C;  2X68 A;  3GMI A;  3RHW A;  3UUB A;  2WY2 A;  3F57 A;  2W2U A;  3WU2 O;  2WS3 A;  2L8K A;  3TKL B;  2OMF A;  1AJ3 A;  4DV1 T;  4HWI B;  3RIF A;  4H9P C;  2X9H A;  1R8I A;  5LMU T;  4MHC A;  4EAH A;  2UUB T;  4JI3 T;  4DR1 T;  2WJR A;  2N2N A;  4HWH A;  4C00 A;  3OYZ A;  3LBX A;  3E08 A;  1XZY A;  5JTG A;  4JCH A;  4TWD A;  3ETU A;  1BR1 A;  4OHF A;  1J5W A;  4A56 A;  3AA0 B;  2BG9 E;  3ZST A;  4MAL A;  4PFO A;  2BZB A;  4TV9 E;  4KR4 A;  3FXD B;  2MTQ A;  4H9Q C;  3ZCI A;  4ZI3 C;  2BVM A;  3HOL A;  4FRX A;  3KDS E;  1JNR A;  1S5L O;  3OBV E;  2UXD T;  2KZ7 A;  1PRN A;  4N78 D;  2MOZ A;  3WI3 A;  2ZM6 T;  3SY9 A;  2D2S A;  3NSG A;  4CI3 B;  4JI6 T;  2LSY A;  3ZKR A;  3AA6 A;  5JRE A;  2CE7 A;  5L47 A;  2VKO A;  5AQP B;  2LT3 A;  4YJ3 E;  4C4V A;  5L2L A;  4PJM A;  3H3M A;  4Z3T A;  2H7V C;  3EMN X;  2MPK A;  3N2K E;  2E9X B;  1WR0 A;  1GFP A;  1OXZ A;  3AEG A;  4CI1 B;  4J2C A;  1HXT A;  4ASK A;  1HF8 A;  4JI7 T;  2VVN A;  4CXX A;  1X9B A;  4QKN A;  1LVF A;  3O9X A;  2CLY C;  4EXT A;  4O4I E;  2E9X C;  5IYU A;  4JUY A;  4HKA A;  3P4R A;  1G90 A;  3GWH A;  4ZZC A;  2L3L A;  2XSA A;  3CX6 B;  8PRN A;  1CUN A;  5ABE A;  4P0B A;  3P8C D;  3CML A;  5AQF B;  1KF6 A;  1ZP0 A;  1T72 A;  2J1D G;  5ABH A;  3L3P A;  3QB5 A;  5JDM A;  3VHL A;  3FZM B;  1MIY A;  3MK7 C;  3C4X A;  4RL9 A;  3WI4 A;  3AVR A;  3HWB A;  4XAX B;  5L3B B;  2XTR A;  5JDL A;  1FIO A;  3FZH B;  2XAQ B;  2M6B A;  1G73 A;  3RC3 A;  2VB6 A;  1H6S 1;  5LMN T;  2LE8 A;  4H9O C;  4C69 X;  4ADZ A;  1V9D A;  5LG3 A;  2ZMA A;  2WM9 A;  2XMX A;  2Y0L A;  3TZG A;  5BMV E;  4IDQ A;  3PGR A;  4YTP A;  1MMA A;  4LF8 T;  4O3W A;  3KVB A;  2IAK A;  3CQX C;  3PRN A;  4EB6 E;  3FBL A;  2W0G A;  3VRB A;  3ONJ A;  4KUM B;  4HWF A;  5EK3 A;  4H9R C;  5JDG A;  3VZT X;  2YOE A;  3DJB A;  2E2A A;  2LM2 A;  2JJ9 A;  5LG4 A;  3CX8 B;  1MND A;  3MXZ A;  4UXN B;  4X1I E;  3K3N A;  3EVY A;  1D0Y A;  4TWH A;  4RJX A;  4C90 A;  2YPV A;  3AE4 A;  3AXJ B;  5ADX K;  4IE4 A;  3KV5 A;  2BS3 A;  3P4Q A;  2C5J A;  2ZFG A;  5BR8 T;  5AQN B;  4KRA A;  4JFB A;  3RF1 A;  1WCR A;  3AE7 A;  2QVA A;  4LSI A;  1XMQ T;  2DLR A;  2KMF A;  2I0M A;  2WZI A;  3RIA A;  5EK4 A;  2XQ7 A;  1ZHZ A;  2B1E A;  2WDQ A;  4IDO A;  5D5D A;  2M67 A;  3N9P A;  2DI4 A;  3I0Q A;  4HFI A;  1HX8 A;  5KX5 E;  3D0T A;  4UF0 B;  3ZCJ A;  2WSS V;  2QTK A;  4AKI A;  1L0V A;  2LHF A;  2DCF A;  3RYI E;  4WBO A;  4FSO A;  5F8P A;  3I0O A;  4PW8 A;  3DZM A;  3K19 A;  2E9X D;  1FMW A;  3ONL C;  3BQK A;  1N34 T;  3VR8 A;  5CGM A;  2LHR A;  2Y8D A;  2EHO D;  3Q9D A;  4YT0 A;  4IE6 A;  1FMV A;  3AE6 A;  2LSI A;  3UQ4 A;  2YNK A;  1ZOY A;  2F1V A;  2XG6 A;  2YKS A;  3QK6 A;  3HKD E;  1MMD A;  3K3O A;  3T20 A;  3FYX A;  3P4W A;  4KP3 C;  3RIU A;  3O0E A;  4O8S A;  3MZK B;  5GV0 A;  4N74 A;  2NR4 A;  2XJ7 A;  4LF5 T;  2WWU A;  3JCU O;  4AYI D;  3RYF E;  2NTY A;  4EYU A;  4O4H E;  4DV6 T;  2Y48 B;  3NRY A;  2H89 A;  2K3W A;  5H2F O;  4D64 A;  2G0U A;  4LSF A;  4ZHQ E;  1MIV A;  2M6I A;  3H3A A;  3P7I A;  4C4V B;  3C4W A;  3T8O A;  3OTO T;  4E1S A;  2ZM8 A;  3AED A;  3ZN1 B;  3P4S A;  5LCY A;  1EZ3 A;  2DWG A;  1VRB A;  3C51 A;  4JEU B;  2JMM A;  3UUM A;  2Y0K A;  5HEJ A;  3OJA A;  2OLT A;  1HXX A;  4QX7 B;  1KNZ A;  5HEH A;  4UV9 B;  5FY7 A;  3DWN A;  3ONX A;  4P1N A;  4X64 T;  3G7G A;  4ZI3 D;  3PUW F;  1XWM A;  5LHG B;  5FMN A;  4ZS3 A;  2PRN A;  3I1A A;  2XE1 A;  2ZM2 A;  4UR9 A;  2Q9Q D;  3VE1 A;  3UU4 A;  5EK2 A;  4QQ1 A;  4YFS A;  4XZC A; 
#chains in the Genus database with same CATH homology
 1MMN A;  3AA1 B;  2QGS A;  4IE0 A;  2O4V A;  4MLK A;  3PU3 A;  1B7T A;  2DNX A;  5JVD E;  1D0Z A;  1S94 A;  2X67 A;  3WI5 A;  3VY8 X;  2K48 A;  4EZ4 A;  2X9X A;  3MJX A;  2L9Q A;  2JPF A;  2X9Y A;  3ZN0 B;  4AQF A;  5L3E B;  4UVA B;  2WBL A;  3HKC E;  1HS7 A;  3HL6 A;  4AYE C;  3M65 A;  2N2L A;  4AQF C;  4RLB A;  2YEV C;  3KIN B;  4AKL A;  3FXE B;  2HPL A;  4AYD C;  2VKJ A;  2V7M A;  4GCS A;  4TV8 E;  4DND A;  4BUM X;  2KDY A;  3CVR A;  4ISS A;  5HXH A;  3C5O A;  3VZW X;  3JTY A;  1U4Q A;  1MIW A;  4BAY B;  3SWH A;  5CA1 E;  4AYM C;  4KMC A;  2CXF A;  2W81 C;  4AZL A;  5FP3 A;  4G2A A;  4GHB A;  4HFV A;  3SZV A;  2A72 A;  4ERR A;  1IZN B;  4Z8X A;  2V7K A;  3JC6 D;  3JC6 C;  3SY7 A;  2X68 A;  3GMI A;  2RA1 A;  2KWI B;  3RKO A;  4AKR B;  3PUR A;  3E0Z A;  4M1P A;  2K9A A;  2P9B A;  3F57 A;  4UEM A;  3RRC A;  5GON E;  3A2S X;  1KK7 A;  2L8K A;  3TKL B;  1ZEE A;  3UTK A;  5JH7 E;  2OMF A;  2KND A;  1AJ3 A;  4O4L E;  5H6R B;  4H9P C;  5PRN A;  3UU2 A;  4B61 A;  2X9H A;  3Q5W A;  4JLE A;  2K24 A;  2V1D B;  2KXP A;  4MHC A;  4EAH A;  5JDH A;  1OSM A;  7PRN A;  3POR A;  1WYB A;  4OYK A;  2LHN A;  2N2N A;  5EZY E;  3UUL A;  1UX5 A;  2H7O A;  3I9Y A;  2PG8 A;  2XHE B;  3Q2M A;  4I50 E;  4FMS A;  3OYZ A;  3LBX A;  3E08 A;  3CKD A;  3NRX A;  3F31 A;  4JCH A;  3KVD D;  3ETU A;  4PJN A;  3HI2 A;  2N2M A;  3DA4 A;  1BR1 A;  2MYS A;  4NUU A;  5CB4 E;  4OHF A;  2XTQ A;  4A56 A;  5JDF A;  3AA0 B;  4FUV A;  4PK4 A;  2ODV A;  4PNI A;  3KBU A;  4MAL A;  3AVS A;  4PFO A;  2NW9 A;  4I4T E;  5ADX L;  2BZB A;  3BQL A;  3ZJ2 A;  1BR2 A;  2H3R A;  4TV9 E;  4WNK A;  4KR4 A;  4TUY E;  4L0R A;  3FXD B;  1T98 A;  2UXN B;  2MTQ A;  4YLH A;  4H9Q C;  2GE4 A;  2NTX A;  5JQG E;  2IC6 A;  3N9O A;  4QXC B;  3ZCI A;  3FHN A;  4GIW A;  2Y0H A;  4ZI3 C;  2BVM A;  4GK0 E;  3AA7 B;  2CEA A;  4AI6 A;  3HOL A;  4FRX A;  4N58 A;  2C5K T;  1GFN A;  1IAP A;  3GA8 A;  3KDS E;  2PJQ A;  3ZLI A;  3LG7 A;  2XE2 A;  3OBV E;  5EE2 A;  4UF0 A;  3UUN A;  3ZJ1 A;  4PFP A;  1VOM A;  2KZ7 A;  4LSE A;  3O0E A;  1QJ9 A;  4O2A E;  3QRA A;  1PRN A;  4N78 D;  2MOZ A;  4H63 V;  2V7L A;  1MMG A;  1YS5 A;  3N9N A;  3WI3 A;  1GFQ A;  1ZHX A;  4PJJ A;  3Q5X A;  4U9C A;  4O49 A;  2CCQ A;  2M06 A;  2C0S A;  3O4X E;  2K0L A;  3QRC A;  3SY9 A;  2XAF B;  2FGQ X;  2D2S A;  3NSG A;  1ZHY A;  1WYC A;  4CI3 B;  3HR0 A;  5J1G A;  1QJP A;  2LSY A;  3VY9 X;  1YD8 G;  3B13 A;  4BJM A;  3ZMZ B;  3AA6 A;  3ESL A;  5JRE A;  2CE7 A;  1MM4 A;  3K8P C;  4FZL A;  5G26 A;  2J1N A;  2VKO A;  4E7Z A;  2LEH A;  4RLC A;  5LXT E;  3SZD A;  3J9X 1;  1FEW A;  4MFR A;  5FYM A;  4O4J E;  1YKE B;  3ZYL A;  1D1A A;  5KMG P;  2JRK A;  3AAA A;  2LT3 A;  2D5U A;  4CZZ B;  5LBQ B;  4YJ3 E;  5L2L A;  4FES A;  4TN7 B;  4PJM A;  1U5P A;  3LJC A;  4QXH B;  4ZOL E;  4ILU A;  4Z3T A;  2H7V C;  2X0L B;  2YIN A;  4RJW A;  2CMR A;  4DO0 A;  3EMN X;  2Q9Q B;  5H6Q B;  2X27 X;  3N2K E;  2E9X B;  1GFP A;  5F3J A;  4G76 A;  4JEH B;  1OXZ A;  3NBX X;  4CI1 B;  5JDP A;  4J2C A;  1HXT A;  4ASK A;  1HF8 A;  5LJN A;  5HYA A;  1UX4 A;  2MHL A;  3AAE A;  3T24 A;  2LSK A;  2KT9 A;  1P4T A;  1OPF A;  4CXX A;  3RRW A;  5M4Y A;  3SRZ A;  4QKN A;  1LVF A;  2KWH A;  3O9X A;  4FZN A;  5A1L A;  2CLY C;  2BDE A;  4EXT A;  4KBM B;  1HTJ F;  1HXU A;  4O4I E;  3HW9 A;  2LSG A;  3KV9 A;  2E9X C;  3ZYK A;  5IYU A;  4JUY A;  4GCQ A;  3J7Y q;  3IBP A;  4HKA A;  4O4U A;  3GWH A;  1G90 A;  3F2E A;  2L3L A;  3POX A;  6PRN A;  3PU8 A;  4FZM A;  2E8I A;  2HH7 A;  2OA5 A;  3PUQ A;  1QSD A;  5LJM A;  3PUS A;  3W15 B;  3GN5 A;  5HXC A;  3WAJ A;  2K5B B;  2NOX A;  3CX6 B;  5FNV E;  8PRN A;  1CUN A;  2K4T A;  4N59 A;  4P0B A;  3IEE A;  2X66 A;  3P8C D;  1US7 B;  3NZP A;  3CML A;  4I55 E;  3I9W A;  5DJQ C;  5JR9 A;  4D5U A;  4H9S E;  2VWA A;  4MBQ A;  5LHI B;  2WMN A;  2J1D G;  4PAG A;  4QX8 B;  5ETW A;  5FXZ A;  2MBG A;  2XUE A;  3L3P A;  4FJO A;  4OK0 A;  5JDM A;  3VHL A;  1MIY A;  3MK7 C;  1ZV4 X;  2WMO A;  4IE5 A;  3BK9 A;  3C4X A;  4HGA A;  4P0A A;  3RC8 A;  4RL9 A;  3WI4 A;  2UXX B;  1YW0 A;  3AVR A;  3MKD A;  4AUI A;  3HWB A;  4F6R C;  3LFM A;  1E54 A;  5LGN B;  5AFU L;  4QHO A;  4XAX B;  5L3B B;  4CQI A;  4UVB B;  2NWB A;  3QC9 A;  2XTR A;  5DQW A;  2JMH A;  5JDL A;  2KC0 A;  4O3X B;  3LK2 B;  1FIO A;  3C64 A;  2NW8 A;  2XAG B;  2XAQ B;  1H7C A;  1OWA A;  3O1H A;  4AKR A;  1G73 A;  4V1A v;  3RC3 A;  3ZEF B;  4YJ2 E;  1BT9 A;  2VB6 A;  2IW5 B;  1H6S 1;  1Y64 B;  2YK0 A;  2LE8 A;  2XE3 A;  1IJ6 A;  4X1K E;  3AA7 A;  4BJN A;  4H9O C;  1LVK A;  4HN9 A;  5LA6 E;  5L3F B;  2X9W A;  1V9D A;  4ADZ A;  5LGT B;  4TX5 A;  4C69 X;  3C4Z A;  3PUA A;  4DMW A;  2ZMA A;  3AA1 A;  4AKH A;  4AQG A;  5KDM C;  2WM9 A;  4ZI7 E;  5C8Y E;  5DL8 A;  1LRZ A;  1ZHC A;  3ANW A;  4UEL A;  1ORM A;  2LM9 A;  3PTR B;  5BMV E;  2XMX A;  2Y0L A;  3TZG A;  4IIJ E;  5HXR A;  5HXS A;  5HXE A;  3UPG A;  4OFZ A;  4PJL A;  1MMA A;  3CX7 B;  3H37 A;  3N9M A;  4O3W A;  3ZPO A;  4PK5 A;  3KVB A;  5T5F A;  4GYS A;  4UV8 B;  3N2G E;  2IAK A;  2LFU A;  3CQX C;  5FY1 A;  3PRN A;  4EB6 E;  3FBL A;  4E1T A;  3T0S A;  2W0G A;  4KUM B;  2PFV A;  5EK3 A;  4H9R C;  1PHO A;  5JDG A;  2X51 A;  3FBZ A;  3VZT X;  3OYX A;  2JMK A;  3DJB A;  5JDN A;  2LJL A;  2W00 A;  5J2T E;  3VU7 H;  2JJ9 A;  4O2B E;  4EOZ B;  3CWZ B;  5LG4 A;  1UCU A;  3CX8 B;  5JR9 C;  4P09 A;  4DVD A;  4ANJ A;  3GP6 A;  1HCI A;  3VKG A;  5LNK A;  2A3D A;  1MND A;  3MXZ A;  3LK4 2;  3QUJ A;  1MPF A;  4IHJ E;  2N9D A;  3IHR A;  2CWO A;  2WAU A;  4U72 A;  4UXN B;  4X1I E;  4ZS2 A;  4U74 A;  5FXX A;  1BXW A;  4H9N C;  5AFU K;  3K3N A;  3EVY A;  3BQI A;  2SPC A;  1D0Y A;  2XAJ B;  4XNK A;  3PUG A;  4RJX A;  2V7I A;  4QWN B;  4B6X A;  4C90 A;  2M07 A;  2YPV A;  3V5S A;  2E9X A;  2CXD A;  4YHJ A;  2EHO B;  5DL7 A;  1D0X A;  3ZMT B;  4X20 E;  4EIW A;  1WR6 A;  1QJ8 A;  5ADX K;  4IE4 A;  5FVN A;  3KV5 A;  2LOS A;  2KIN B;  2CM0 A;  1IZN A;  2VKD A;  4O4X A;  2C5J A;  5CA0 E;  3VZU X;  4NUV A;  2ZFG A;  1X79 A;  4H63 H;  1Z0P A;  2Y7S A;  3POQ A;  4G75 A;  3ZMS B;  3NZQ A;  4JFB A;  4KRA A;  1Q9G A;  3ZC0 A;  3C50 A;  5TAO A;  2ZLD A;  3KFW X;  3LK3 B;  1WRD A;  5DAB A;  3SS1 A;  2V7J A;  3PQS A;  5IYZ E;  4FSP A;  2W63 A;  3U3I A;  3O1I A;  1E1H B;  4LSI A;  4C91 A;  2QA7 A;  1SA0 E;  4FT6 A;  5JRC B;  5FXW A;  3EDV A;  3IF8 B;  4UIG A;  2DLR A;  3DTO A;  3HA4 A;  3O1J A;  4DBQ A;  2KMF A;  2XAH B;  4AFK A;  4D65 A;  2VK9 A;  2Q9Q C;  5EK4 A;  5HAX A;  2VL8 A;  3MA9 A;  1ZHT A;  4KR8 A;  4E7S A;  1ZHZ A;  4X1Y E;  4FOZ A;  1Q9F A;  2B1E A;  4GF4 A;  4IGU A;  3POU A;  1BH3 A;  3PDY A;  3EUH A;  2Y2X A;  5D5D A;  3RBH A;  3ANW B;  5LYJ E;  2M67 A;  3DP7 A;  5L3D B;  3N9P A;  5LGU B;  5LP6 E;  2DI4 A;  3I0Q A;  5LBM A;  2CWY A;  4DBR A;  2CXL A;  3ZC1 A;  1HX8 A;  5JRC A;  5KX5 E;  3D0T A;  4UF0 B;  2ACX A;  3ZCJ A;  2NW7 A;  1D1C A;  1NWM X;  3VE2 A;  2WSS V;  2QTK A;  4AKI A;  4WBN E;  2W80 C;  2LHF A;  4O3Y A;  2DHR A;  3UT5 E;  4EYY R;  1LKX A;  2DCF A;  4QXB B;  2XTL A;  4WBO A;  3RYI E;  4HEA A;  4FSO A;  1HFA A;  1S35 A;  3RPU A;  5F8P A;  3I0O A;  2CA5 A;  4PW8 A;  3K19 A;  3AA6 B;  3VKH A;  2E9X D;  1FMW A;  2N1G A;  3HKE E;  3BQK A;  4PK6 A;  3UFE A;  2ODU A;  1MNE A;  2POR A;  4EZH A;  4GK5 E;  2JQQ A;  2LHR A;  2LOP A;  1IJ5 A;  5FY0 A;  3HKB E;  4CXW A;  5L3C B;  1HG2 A;  4I43 B;  2Y8D A;  2EHO D;  3DA3 A;  3Q9D A;  4IE6 A;  5IHY A;  4L5G A;  1BR4 A;  2VKH A;  2FGR A;  3KVA A;  1THQ A;  1FMV A;  2J4U P;  4FI5 A;  2LSI A;  2YNK A;  2F1V A;  3RYH E;  2XG6 A;  4L9I A;  2KZ7 B;  3QK6 A;  3E22 E;  4G63 A;  2PBI A;  3GN5 B;  3HKD E;  2HPJ A;  4DMV A;  1MMD A;  5HWY A;  4O3Z A;  2C5I T;  3K3O A;  3T20 A;  2D0T A;  5LOV E;  1QUU A;  1SHZ C;  2D0U A;  4KP3 C;  3FYX A;  1HG5 A;  3SOL A;  4O8S A;  3KBT A;  3MZK B;  1ZHW A;  3AA0 A;  3UAQ A;  5GV0 A;  2LSJ A;  4GYR A;  4ZI2 C;  4AKG A;  3AAI A;  2V26 A;  1WLX A;  3R6N A;  3B57 A;  3AAA B;  5JDQ A;  3CQG B;  2WWU A;  3RH3 A;  2GK9 A;  3N9Q A;  4IE7 A;  4AYI D;  5HWX A;  3ZYM A;  3RYF E;  2NTY A;  4EYU A;  4AYN A;  4O4H E;  2Y48 B;  4TZ4 C;  4XNL A;  3NRY A;  2Q9Q A;  4ZI2 D;  3LK2 A;  2BVL A;  2XQY A;  3MAC A;  3U78 A;  1YKH B;  2YU2 A;  4IDZ A;  2XAS B;  4OYJ A;  5LHH B;  4D64 A;  2G0U A;  2W61 A;  3ETV A;  4WW0 A;  4BA9 A;  5E0O A;  3RX6 A;  3LBX B;  1O3X A;  4GOU A;  3WAK A;  2A2F X;  4LSF A;  5DL6 A;  4ZHQ E;  1MIV A;  5DQV A;  1MM5 A;  3FB2 A;  3H3A A;  3KV4 A;  3P7I A;  5L3G B;  4UVC B;  4AXP A;  3A5X A;  3C4W A;  3T8O A;  2KXP B;  2I59 A;  4E1S A;  2ZM8 A;  3ZN1 B;  2EHO A;  3K3Q C;  5LCY A;  4F4B A;  5JR9 B;  4LSH A;  1EZ3 A;  2DWG A;  2XE5 A;  1VRB A;  2CLY B;  3C51 A;  3RYC E;  3PE0 A;  4JEU B;  3SYS A;  2ZM0 A;  2ERV A;  3ZMV B;  3AB3 B;  2JMM A;  4HTE A;  3CQC B;  3UUM A;  2Y0K A;  3LK3 A;  3OKQ A;  3OJA A;  1G8X A;  3N2O A;  1HXX A;  5FXV A;  4QX7 B;  4CXY A;  4IST A;  3L09 A;  1KNZ A;  4UV9 B;  5FY7 A;  3ONX A;  3PQU A;  2YU1 A;  3C98 B;  3KV6 A;  3V8U A;  2MNH A;  3V5U A;  4GCP A;  2EHO C;  2VAS A;  3G7G A;  5DL5 A;  4K0U A;  2W62 A;  4ZI3 D;  5J2U E;  5FMN A;  2DWK A;  3UUX B;  5LHG B;  3ZMU B;  3AAE B;  4CI2 B;  2NP9 A;  4ZS3 A;  2PRN A;  3LK4 1;  2ZLY A;  3I1A A;  1ZKE A;  1BR0 A;  2ODJ A;  4PUX A;  2Z6E A;  1NAF A;  2XE1 A;  2IC9 A;  2ZM2 A;  4HE8 A;  3R84 B;  3HOE A;  2F1T A;  2RP4 A;  2Q9Q D;  1GFM A;  3VE1 A;  2Y6X A;  3EDU A;  3N5L A;  1D1B A;  3CPZ A;  2KLQ A;  3N9L A;  4FRT A;  5EK2 A;  3S4U A;  3SYB A;  1GFO A;  4XBF B;  4QQ1 A;  4AKM A;  2ES0 A;  4YFS A;  4XZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...