3LK2B

Crystal structure of capz bound to the uncapping motif from carmil
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
242
structure length
242
Chain Sequence
b'SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-1
publication title Structural characterization of a capping protein interaction motif defines a family of actin filament regulators
doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 79
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lk2B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3lk2B02
3AA7B 2KZ7A 3AA1B 2KXPB 3AAEA 3AA7A 3LK41 2KXPA 3AA1A 3AAAB 3AAAA 3LK42 1IZNB 3AA0B 5AFUL 3AA6B 3LK3B 1IZNA 3AA6A 3LK3A 3LK2B 3AA0A 4AKRB 5ADXL 3LK2A 4AKRA 5AFUK 5ADXK 2KZ7B 3AAEB
chains in the Genus database with same CATH superfamily
5JDGA 3RQUA 3JCUO 1NWMX 2IHR1 5L3GB 4J2CA 1W0BA 2BS4A 4XAXB 1D1BA 1ZHWA 4FOZA 5L3EB 2X9KA 3ZT5A 2XTQA 4YJ3E 2D0UA 3IHRA 5G38A 4ZI3C 5FNVE 4IREA 2AE9A 5HWXA 3ZC0A 3ZCJA 2XMXA 4E7SA 4AQFC 5B66O 1T72A 3UT5E 3I0OA 4OYKA 3OVUA 2H3RA 2D9DA 4BJMA 4X5TA 3OJAA 3VE1A 3MACA 4WYVA 4H63H 3AE7A 4N78D 2XE1A 3I1AA 1GQEA 4UXNB 2MBGA 2XZEA 3UAQA 3ZMUB 2BG9A 3CX8B 4C00A 2C0SA 2WMNA 1HX8A 4H9PC 3JAEA 4O4IE 5GTIO 4H9QC 2WU5A 1XNRT 2Q9QC 4PK6A 4KR8A 2X0YA 3J7Yq 2A9UA 3QNUA 2JQ9A 3OTOT 1VRBA 1OEDC 3EDUA 5LHHB 3HKCE 5L3BB 3EAMA 4HTEA 3MK7C 3RF1A 4IL9A 2P9BA 3N9NA 3FBLA 4Z8XA 3PUVF 2IAKA 5CJ5A 3VRAA 3DTOA 1T7SA 2V7MA 4JI2T 4UIGA 5AQPB 2W61A 3ZLIA 4NXMT 3OPCA 3SY7A 2FGRA 2LHNA 4LF6T 3BRZA 2C5JA 3ZMSB 2KZ7B 2VWAA 2CLYB 3RX6A 5FL1A 3PUGA 1MIYA 5BMVE 4KUMB 1CHUA 4PNIA 3AAAB 5LG4A 4AQFA 5H6RB 3LK42 4JI7T 3AA0B 2E5VA 4HWFA 4MHCA 4AYEC 4JI8T 1Z8UA 5JDNA 3PJAJ 2M6IA 4LMLA 3GN5A 4WBNE 1MM5A 1GFQA 3CPZA 3RC3A 4GCQA 3TLVA 2LSKA 4XNKA 4U2ZA 4UR9A 4O3YA 1ZEEA 2W63A 4CTDA 3W15B 3LG7A 2NOXA 2LSIA 3T1HT 2BG9B 4KI0F 4AI6A 4WW0A 4UV9B 4O8SA 4PJ0O 5KMGP 4FZLA 4QXCB 1KEYA 2CXFA 2Q9QA 4JI4T 3CQXC 5AQRB 4GF4A 5HYAA 4QHOA 3UU4A 2NW7A 2XASB 2OV9A 4DR3T 1OEDA 4QH5A 1YD8G 2LFUA 1YQ3A 3ZMVB 2IC9A 3UUXB 4IE0A 4K3BA 2XTLA 3UPGA 4DV2T 3FYXA 3EI0A 1WCRA 1YXRA 2VQET 4QXBB 4DV5T 4GK0E 3PTRB 2J4GA 3ZYLA 4P0AA 2YPVA 1M7KA 4X62T 4QX7B 1US7B 3HW9A 2HN1A 5FY7A 1UX5A 3C4ZA 2QGSA 4U72A 1VCSA 4N74A 3CVRA 1IZNA 2K0LA 2BS3A 3I0QA 1J5ET 3QUJA 3DA4A 2UXBT 3KV4A 2Y8DA 1N36T 4A97A 5F5WA 4DUZT 2WZHA 3N5LA 4CI1B 3RHWA 2V7IA 1N32T 1KF6A 2ZM2A 3GN5B 4P09A 2W66A 5A1LA 2N9DA 3AA7A 2YKSA 2MTQA 5IYUA 2HPLA 3AXJA 3ESLA 3M65A 2BDEA 2M6BA 4U7IA 4GIWA 4JV5T 2IMLA 2KWHA 1ZHCA 1UURA 3PUQA 3RGLA 2N2MA 1GFPA 3SYSA 5L4HA 4XNLA 1EZ3A 4HFEA 5GONE 4WNKA 3CIRA 2Y0LA 1ZHXA 3GWHA 4HEAA 4E1TA 3O1JA 4D5UA 3RI5A 4ILBA 3L3PA 4ZEYA 2R4OA 2J62A 4CN6A 5AFUK 3ZEFB 4OFZA 4AKMA 2J47A 2CRBA 2WP9A 3JADA 2YEVC 3T8OA 2LEHA 5FXZA 5LYJE 4DR2T 2KWIB 3O4XE 4C4VA 5EZYE 5J2TE 3H3MA 2F4VT 3LK41 2UUCT 4LF8T 3P4QA 4I43B 4YY3T 1MMDA 2H7OA 1MNEA 1Y01A 4FUVA 2K9AA 3SFDA 3AE2A 4A5XA 3ONLC 4O3WA 5FMNA 4I50E 1G90A 5FY1A 4PUXA 5LCYA 4UVAB 4FZMA 3O1HA 2X9YA 2QVAA 3CMLA 5C3JA 2BKNA 3RYCE 4EOZB 3PGUA 2Y0KA 4IIJE 1S5LO 4DV4T 1ZHZA 1Q9FA 2KDYA 3RYFE 3NWIA 1SE7A 3ZC1A 3PGRA 3KV9A 4X66T 2OA5A 3BQKA 2WVPA 3B13A 1R8IA 2K5BB 3FXDB 3AXJB 1UGOA 2X0LB 2XSAA 5FL0A 2XSBA 2ZLYA 4AZLA 4PFOA 3PQSA 3AVSA 3GMIA 3A0HO 3POUA 5AQLB 3Q5DA 3ABVA 2LKGA 3PV0F 2ZLDA 1HNWT 2BKPA 2GE4A 5HEOA 4O4LE 2KC0A 2N2LA 3RYHE 3RKGA 4ZI3D 5HXEA 4D65A 2WZIA 4I0UA 2PBIA 3HKDE 5JDPA 4N59A 1VOMA 2LKHA 5DJQC 2UXDT 2XTRA 3GP6A 4WZXA 3FZFB 1UCUA 4A98A 3EVYA 4K0KT 3KVBA 3T20A 5FY0A 5EE2A 2BKOA 1YW0A 4IDNA 4HWIB 1B7TA 5HCJA 3N2KE 3P8CD 2LOSA 2WDVA 1KK7A 4ASKA 4BAYB 2R89A 1ZOYA 1UX4A 3J9X1 3SZVA 4NUUA 3WI5A 5JH7E 2XQ6A 2CXLA 2Q9QD 5EK4A 3HKEE 3HL6A 2MAWA 1N34T 4O2AE 5ABHA 2J1NA 4QXHB 2JMMA 3JC6C 4MLKA 2UU9T 4ZI7E 1W09A 2DCFA 5HWYA 4LFCT 2UXXB 4HFVA 3VR9A 1XZYA 2BS2A 4UEMA 2XQ8A 5G26A 2CLYC 2XAFB 3RBHA 5KAFO 1J1JA 3PU3A 2EHOB 3PJAA 5B5EO 3AEEA 1QSDA 1XNQT 4CI3B 4FJOA 4AKRA 3HI2A 1OWAA 2IWVA 4UVBB 2XG6A 5DL7A 4GKKT 3NKZA 5AQVB 4ZOLE 4LSEA 2I6HA 2IWWA 4YJ2E 3K19A 4F4BA 4TNVA 1T1LA 3EUHA 2KNDA 2A3DA 2CWOA 1HG2A 1IBMT 2W00A 4F6RC 2RP4A 4RL9A 4OX9T 5CA1E 3NSGA 3BK9A 3CK6A 4EB6E 5L3FB 3N9LA 5FVNA 1MNDA 3F31A 4DR4T 3VE2A 1MM4A 4G76A 3N2GE 5LJNA 3AEFA 4Z3TA 1BR4A 3I9YA 1NENA 3EHZA 2A2FX 3PUWF 3N9PA 3DP7A 3L8RA 4NXNT 5LG3A 1E54A 3TLSA 3ZKRA 1LKXA 1QUUA 4GK5E 1N33T 2Y6XA 3RLFF 3R84B 3AAEB 1FEWA 3K3QC 2KZ7A 4HFDA 4B6XA 5LP6E 4QH1A 2CHNA 3CQGB 3UU2A 3AAAA 4EZ4A 2XQ3A 3PGSA 5C8YE 1S94A 3TLUA 3AA0A 4AKRB 4BA9A 5HEUA 5L2LA 1GFOA 3SY9A 2CHOA 4ADZA 3UUNA 2XHEB 2NWBA 1KNRA 2YN6A 4C69X 1WLXA 4GYSA 3ZMZB 2FJBA 2PORA 2ODJA 1QLBA 3ANWB 4KRAA 3VZWX 4JI5T 5ADXK 2I59A 4MALA 2BBHA 3K1SA 4IT4A 3L09A 4EGWA 1E1HB 3C4XA 3PUXF 4O49A 2WAUA 2WB5A 2XQ5A 2F1VA 5FKYA 4ZHQE 4FQEA 3P4WA 2WY2A 3VY9X 3DWNA 1KNPA 2V5DA 1OXZA 5L3DB 3RQWA 3KFWX 2JJ9A 3IA3A 1IAPA 2JQKA 4YHHT 5ABFA 3V5UA 4RJWA 4JCHA 1T16A 4GHBA 5DL5A 4KP3C 2V1DB 3SFEA 4ZI2C 5AQQB 4PJNA 3DWOX 1H7CA 3C50A 3JTYA 4YTNA 3ZT7A 4QWNB 2H89A 2AXDS 2VKOA 5ADXL 3AB3B 4X20E 3PDYA 2R8AA 5JDMA 4B3RT 1HS7A 3TZGA 2XE5A 3PF1A 3BQIA 4TWHA 1WRDA 3WAKA 3EABA 2UUBT 4L9IA 1XDPA 3KZIO 4Z90A 4K3CA 4AISA 2C5IT 3K8PC 2M07A 3TKLB 4JEHB 3A7MA 1YS5A 1MMGA 3PE0A 5DABA 4AIUA 4AYNA 3K3NA 3RC8A 4AQGA 2RPAA 1ZKEA 4JEUB 4ILUA 3OYXA 5DQVA 5KX5E 2ACXA 2PG8A 3ETVA 4CQIA 3FXEB 2E9XB 4NPPA 3NZQA 1KFYA 5ABFB 1WR0A 1WR6A 4QKNA 5FXWA 4MFRA 5ABEA 7PRNA 1D0ZA 2KXPB 4YSZA 3Q5WA 4IE5A 4LF5T 1IBKT 2WS3A 4UB6O 2XQYA 1NAFA 2VKHA 4KHPT 1HNXT 4DV0T 1IBLT 3LK2B 5G3AA 2Y0HA 5G39A 4YTMA 5GV0A 2NW8A 5EK2A 3UUMA 4EXTA 2WDRA 1BR0A 4YFSA 2X9WA 3UU6A 4LSFA 5TISO 4CN4A 2GK9A 2SPCA 1FJGT 3N9MA 2EHOC 4TWFA 4JUYA 2LSJA 2R4LA 4H9SE 3N9QA 2IC6A 4FZNA 1U4QA 5AQKB 1IJ6A 3JC6D 4C91A 2XM1A 3PUYF 4JI6T 3UU3A 5AQFB 1I94T 4LSHA 4DNDA 2W80C 4PK5A 3NRYA 3K3OA 2ODVA 3CX6B 3G06A 4U7YA 2V7KA 3AEGA 2LRKA 3UFGA 1X9BA 3N9OA 2WJRA 5AQGB 3ZMTB 3MJXA 4HWCA 2D2SA 1XWMA 3C4WA 4PJMA 5LHGB 1DU2A 2Z6EA 2V5CA 2V6YA 2X0HA 5HXCA 1GFNA 3PU8A 4I55E 3P7IA 3PURA 1HR0T 2I0MA 1Q9GA 3JCFA 4LFBT 3HR0A 5C2TA 2V6XA 3LBXA 1I6ZA 2W4XA 2OMFA 3UQ4A 4TX5A 3P4RA 4U2YA 2VB6A 3KVAA 2A72A 2F1TA 3LDQB 3UU8A 4FT6A 1QJ8A 2C5KT 3JAFA 3T1YT 3ZN0B 3FZKB 2R4PA 4CZZB 3EDVA 3OBVE 4YSYA 3PQUA 5HEJA 3BS0A 2NTYA 1YQ4A 5LBMA 3A8YC 2EHOA 3AA6A 3O1IA 1G73A 2X9HA 2ZMAA 3P4SA 2W2UA 3F2EA 2YDSA 2JMKA 2BZBA 2X66A 3KVDD 4L0RA 3NRXA 2CCQA 2VQFT 2ACZA 2W62A 4DVDA 3ZJ1A 3PRNA 4PR7A 3IF8B 3P50A 5LGUB 3AAIA 3RIAA 4O3XB 2XM2A 4EAHA 5JR9B 2G0UA 2B1EA 2E5LT 4K0UA 3SWHA 4ZZCA 3KBUA 4O4JE 4DO0A 2BVLA 4PAGA 2DI4A 3KBTA 4HN9A 4L5GA 3T24A 2V6YB 3RYIE 5FXXA 3C64A 4C90A 4DR7T 1JNZA 4A56A 1G8XA 4I4TE 3B57A 3AA1B 2W67A 4X1KE 3EMNX 3LBXB 3OYZA 1KNZA 5GTHO 4DMVA 3N2OA 1O3XA 5FXVA 4HGAA 4X1IE 2K48A 3PUZF 1PHOA 5JTGA 2L8KA 4CXWA 1ZHYA 4JLEA 2AXTO 3AAEA 2VL0A 2DNXA 5JREA 1T98A 4IL6O 2LSYA 2PTFA 3QRAA 3FZHB 3AE6A 5D5DA 5HCMA 3AA6B 1SHZC 3RIFA 3AE5A 4CXXA 5J2UE 3DJBA 3PORA 4HFCA 1W0AA 5E79O 4BUMX 1THQA 2LJLA 4D64A 3LJCA 4RJXA 4HKAA 3RKOA 4DV1T 5AQNB 5L4EA 3L39A 4MBQA 2PFVA 4G75A 4ZI2D 2WWVA 3ANWA 4EYUA 5LBQB 3CX7B 3RRWA 2WSSV 3V8UA 2ES0A 4ZS3A 3AE1A 3IEEA 2VASA 2IDOB 3VHLA 1BH3A 2B76A 4B3TT 3ZPOA 2MHLA 5J0ZA 4ZZBA 2X9XA 4TN7B 3GA8A 2UUAT 5FVKA 2ERVA 5JDQA 4LF9T 3ONJA 1X79A 4H9OC 3RIUA 2WJQA 3AEDA 2D5UA 2L3LA 4GCPA 1QJPA 2OLTA 2KMFA 4P0BA 3FBZA 3DZMA 2E9XC 4AKLA 2JPFA 2JQQA 1T8BA 4TZ4C 4OYJA 2NP9A 1HXXA 5IHYA 4E7ZA 2MYSA 3VRBA 8PRNA 2M67A 4IHJE 2BG9E 3AEBA 2CXDA 2FJDA 3UQ7A 4HFBA 4DV6T 2WDQA 4YHJA 4DV7T 4X64T 3QB5A 2Y48B 4YT0A 3A2SX 1V9DA 5CGMA 2WQYA 4TUYE 3POQA 2LHFA 4RLBA 4PFPA 4B3ST 4FMSA 4ISTA 3E22E 4PJLA 3UTKA 2KSRA 4LMJA 3RH3A 1FMVA 5FVLA 2PRNA 2XQ9A 5ABGA 1H6S1 3SOLA 2VKJA 1JNRA 2NW9A 4HWHA 2V7JA 5AQOB 2IUBA 2XE2A 5TAOA 3PUAA 4B3MT 1OPFA 2RA1A 4GOUA 3ZSSA 4FESA 4JI0T 3NBXX 1MMNA 4JI1T 2V8SV 1FIOA 4KR4A 1Y64B 4PW8A 4IDQA 2UXCT 4H9NC 3VKGA 3NVOA 2EHOD 2IW5B 2CBJA 4EIWA 5JRCB 4G63A 2BBJA 3ETUA 2XAJB 2YDRA 1HF8A 3Q9DA 4JYAT 4FRTA 2K4TA 4JI3T 4ERRA 3QRCA 2H88A 2HN2A 2ODUA 3VR8A 2E9XA 3E0ZA 3B5MA 2LSGA 1BR1A 3AE3A 1XDOA 4FSOA 3SZDA 2H7VC 2LT3A 1ZHTA 3WI4A 4ZS2A 3VZTX 4LF4T 4EEDA 2KXPA 2WU2A 5IWAT 1MIWA 2LE8A 2M06A 2DHRA 1UUSA 4V1Av 3HOEA 3WI3A 1HTJF 2YU1A 4AKGA 3F57A 2XAQB 3LK2A 2PJQA 1OEDE 2CA5A 4Z91A 2DLRA 4HFIA 4E1SA 3UUBA 5HXRA 1L0VA 4ILCA 1Z0PA 4XBFB 4AQYT 3VU7H 2CEAA 1D1AA 2E2AA 3FHNA 4UV8B 2X27X 3UFEA 3AECA 5AQIB 4P1NA 2R88A 3I9WA 4DBQA 4DR1T 5JQGE 4O2BE 5HXSA 4O4XA 3FZMB 3MXZA 1HNZT 2XQ7A 4CXYA 5IUXA 3S4UA 2J1DG 2E8IA 1P4TA 5JDLA 2LLYA 4AKIA 3RRCA 4JFBA 2FJEA 3UULA 4EV6A 3LK3A 3AVRA 3AE4A 4UELA 3KDSE 4UF0A 5M4YA 4AUIA 2V26A 3MZKB 5LMUT 3POXA 2YDQA 5HXHA 2LHRA 2QTKA 3BQLA 5JR9C 2N2NA 5L3CB 5HAXA 4UB8O 1SUMB 2XAGB 4H9RC 3G7GA 3A0BO 2LM9A 5LMNT 4AYMC 2W0GA 4U31A 3VY8X 5EK3A 3X1DA 5CA0E 4YSXA 1NEKA 5KAIO 1E7PA 5IYZE 4NUVA 3BRYA 2YOEA 2KLQA 1OSMA 2MPKA 5LB7B 3Q5EA 3ZCIA 2MNHA 4FI5A 5H2FO 2K3WA 3WU2O 5AQHB 5LGTB 5F3JA 1BT9A 4X65T 3V5SA 4JBWF 3H3AA 1BXWA 3C98B 2W81C 1W9RA 1AJ3A 3VKHA 4LFAT 3KV6A 5DQWA 4U9CA 2FJAA 2VKDA 3AEAA 5H6QB 1MIVA 3DA3A 4IE6A 2XPKA 1BR2A 3C5OA 1CUNA 2XUEA 2FUPA 4U33A 3Q2MA 5LNKA 4PJJA 2ZM6T 2V7LA 2QYWA 4B61A 3AE8A 3U78A 2YNKA 1HCIA 1YKEB 3C51A 3LK3B 1LVFA 2JMHA 1WFDA 1SA0E 2XE3A 4TV8E 2VVSA 2Q9QB 4UF0B 1HXUA 4EYYR 4HE8A 4OHFA 2QA7A 3CKDA 5JR9A 1OEDB 3LSVA 4DIDB 5T5FA 3CQCB 1M62A 3MA9A 2BVMA 1MPFA 2JRKA 4YLHA 2VVNA 5AQJB 4CI2B 2K24A 2ZFGA 1ORMA 4DBRA 4UVCB 4GKJT 2CWYA 2N1GA 5KXJA 4X1YE 2F1CX 3NJTA 3A5XA 3ZJ2A 3SYBA 3QB5K 3AA1A 2NTXA 4BJNA 5LHIB 1D0XA 2WWUA 5F8PA 3VZUX 1IZNB 4KMCA 3WAJA 2VK9A 3TLTA 4LF7T 3FZLB 1D1CA 4WBOA 3SS1A 3T0SA 2Y2XA 4COFA 4H63V 4LMKA 2JQHA 2X67A 5L47A 3IBPA 3SRZA 2MOZA 5ETWA 3D0TA 3ZYKA 2J4UP 1LRZA 2UXNB 4AKHA 4YTPA 2ZM8A 3Q5XA 1PRNA 1WYCA 2XJ7A 1XMOT 2E9XD 4YXDA 5JDFA 2X51A 5FP3A 3M3ZB 4IDPA 3AA7B 4O4UA 4EZHA 3AE9A 1VCTA 4IDOA 4AYID 4IDZA 4IL4A 5JDHA 4O3ZA 1UK5A 2IIUA 4TV9E 5AFUL 4DR6T 4EEBA 1XMQT 2FGQX 4OK0A 4N58A 4IGUA 4AXPA 5FYMA 1S35A 3HWBA 5AQSB 2WBLA 2YU2A 5DL6A 3KV5A 3O0EA 4AYDC 4FRXA 5J1GA 4N75A 2CMRA 4TNWA 4O4HE 5CB4E 1FMWA 2WMOA 4IE7A 5BR8T 3P4PA 3H37A 5AQTB 3QK6A 4KX6A 4C4VB 5AQUB 2HHHT 2NR4A 5JVDE 3RIUC 3ZYMA 4DV3T 5KDMC 2KINB 2CM0A 3ONXA 4HFHA 2FBWA 4KBMB 3CWZB 2O4VA 3ZN1B 3MKDA 5PRNA 2JIWA 4F8HA 5LXTE 4TWDA 2XY8B 4Q25A 4ISSA 2CBIA 3R6NA 3E08A 1U5PA 4U3CA 3UU5A 4GCSA 1QJ9A 3NZPA 4ANJA 3FB2A 4QQ1A 1HXTA 5LOVE 2JQYA 3O9XA 2HH7A 1ZP0A 4NIQA 4DR5T 3QC9A 1WYBA 2VURA 2R4NA 5CFBA 4FSPA 4HWDA 4RLCA 2LM2A 2XQ4A 4PK4A 6PRNA 1LVKA 2CE7A 4LSIA 2DL1A 1HFAA 3OKQA 2LOPA 1YKHB 2QRXA 4ZXLA 3ZT6A 4AFKA 3HA4A 4IE4A 5LGNB 2KT9A 2DWKA 4XZCA 2DWGA 1HX1B 1D0YA 3TLWA 4CN1A 2XQAA 5HEGA 3LFMA 4DMWA 3ZSTA 2CPTA 2LRLA 2YK0A 1J5WA 4U74A 2ZM0A 2D0TA 2BG9C 4QH4A 2R6GF 2VL8A 4KHZF 3HKBE 2L9QA 1E2AA 2Y7SA 1ZV4X 5JRCA 5HEHA 4DUYT 4QX8B 5LA6E 4G2AA 3U3IA 5E0OA 3KINB 3HOLA 2WCAA 3RPUA 2X68A 3QOFA 3PUSA 1MMAA 4M1PA 5AQMB 2WM9A 4GYRA 2XAHB 4ILAA 1GFMA 5DL8A 2YINA 1HG5A 2HPJA 1IJ5A 5LJMA
chains in the Genus database with same CATH topology
5JDGA 1IJ6A 3JC6D 4C91A 3VU7H 3EVYA 2CEAA 1D1AA 3KVBA 3FHNA 3T20A 5FY0A 4UV8B 1NWMX 2X27X 5EE2A 5L3GB 4J2CA 1YW0A 3UFEA 4XAXB 4LSHA 4DNDA 2W80C 4PK5A 1B7TA 1D1BA 3I9WA 3NRYA 1ZHWA 4FOZA 4DBQA 5L3EB 3N2KE 3K3OA 3P8CD 5JQGE 2LOSA 2ODVA 4O2BE 3CX6B 5HXSA 4O4XA 3MXZA 2XTQA 1KK7A 2V7KA 4YJ3E 4ASKA 4BAYB 1UX4A 2D0UA 3N9OA 3J9X1 3IHRA 3SZVA 3ZMTB 4NUUA 4CXYA 3WI5A 5JH7E 4ZI3C 3S4UA 2J1DG 5FNVE 3MJXA 2CXLA 2Q9QD 2E8IA 5EK4A 5HWXA 1P4TA 3ZC0A 3ZCJA 5JDLA 2XMXA 4AKIA 4E7SA 3HKEE 3RRCA 2D2SA 4JFBA 4AQFC 3C4WA 3HL6A 4PJMA 3UULA 5LHGB 2Z6EA 3UT5E 4O2AE 3LK3A 2J1NA 3I0OA 3AVRA 5HXCA 4OYKA 4QXHB 4UELA 3KDSE 1GFNA 3PU8A 4I55E 2JMMA 3JC6C 4MLKA 2H3RA 4UF0A 5M4YA 3P7IA 4ZI7E 3PURA 2DCFA 2V26A 3MZKB 2UXXB 4HFVA 5HWYA 5HXHA 1Q9GA 3POXA 4UEMA 5G26A 2LHRA 3HR0A 4BJMA 2QTKA 3OJAA 3VE1A 2CLYC 3BQLA 5JR9C 2N2NA 3LBXA 3MACA 4H63H 2XAFB 5L3CB 5HAXA 3RBHA 4N78D 2OMFA 2XE1A 2XAGB 3I1AA 4H9RC 3G7GA 3PU3A 4UXNB 2MBGA 2EHOB 3UAQA 2LM9A 4TX5A 4AYMC 3ZMUB 2VB6A 2W0GA 1QSDA 3CX8B 2C0SA 2WMNA 3KVAA 1HX8A 4H9PC 2A72A 3VY8X 2F1TA 5EK3A 4O4IE 4FJOA 4CI3B 5CA0E 3HI2A 1OWAA 4AKRA 4UVBB 4FT6A 4H9QC 2XG6A 5DL7A 2Q9QC 4PK6A 2C5KT 1QJ8A 4KR8A 3ZN0B 5IYZE 4AUIA 4ZOLE 3J7Yq 4NUVA 1VRBA 4LSEA 4CZZB 3EDVA 3EDUA 3OBVE 2KLQA 5LHHB 1OSMA 3PQUA 3HKCE 4YJ2E 5L3BB 3K19A 2NTYA 4F4BA 3ZCIA 5LBMA 2MNHA 4HTEA 3MK7C 2EHOA 3AA6A 3EUHA 2P9BA 1G73A 2KNDA 3O1IA 4FI5A 2A3DA 2CWOA 1HG2A 2X9HA 2W00A 3N9NA 2ZMAA 3FBLA 4Z8XA 4F6RC 3F2EA 2JMKA 5LGTB 5F3JA 2IAKA 2BZBA 1BT9A 3V5SA 3H3AA 1BXWA 2RP4A 3C98B 2X66A 3KVDD 4RL9A 4L0RA 3DTOA 3NRXA 2W81C 2CCQA 5CA1E 1AJ3A 3NSGA 3BK9A 4EB6E 3VKHA 2V7MA 2W62A 3KV6A 4UIGA 5DQWA 5L3FB 4U9CA 2W61A 3ZLIA 3N9LA 4DVDA 2VKDA 3ZJ1A 3PRNA 5FVNA 5H6QB 3SY7A 3IF8B 1MIVA 2FGRA 3DA3A 2LHNA 4IE6A 1MNDA 5LGUB 3AAIA 3F31A 1BR2A 3C5OA 2C5JA 1CUNA 3ZMSB 2XUEA 2KZ7B 2VWAA 4O3XB 4EAHA 3VE2A 2CLYB 5JR9B 2G0UA 2B1EA 3RX6A 1MM4A 4G76A 3N2GE 3Q2MA 3PUGA 5LJNA 1MIYA 5LNKA 4K0UA 3SWHA 4PJJA 2V7LA 5BMVE 4Z3TA 4B61A 1BR4A 3KBUA 4KUMB 3U78A 2YNKA 4PNIA 1HCIA 3AAAB 3I9YA 4O4JE 4DO0A 5LG4A 2BVLA 4AQFA 5H6RB 1YKEB 3C51A 2A2FX 4PAGA 3LK42 3N9PA 3DP7A 2DI4A 3AA0B 3LK3B 3KBTA 4HN9A 1LVFA 2JMHA 4L5GA 3T24A 1E54A 1SA0E 4MHCA 4AYEC 3RYIE 2XE3A 5FXXA 4TV8E 3C64A 4C90A 1LKXA 2Q9QB 5JDNA 4UF0B 1QUUA 4GK5E 4A56A 1G8XA 3GN5A 1HXUA 2Y6XA 4EYYR 4HE8A 3R84B 4WBNE 4I4TE 4OHFA 2QA7A 3CKDA 3AAEB 1FEWA 3CPZA 3K3QC 1GFQA 1MM5A 3RC3A 3B57A 2KZ7A 4GCQA 3AA1B 4X1KE 3EMNX 5JR9A 3LBXB 3OYZA 4B6XA 5LP6E 2LSKA 1KNZA 4XNKA 5T5FA 3CQCB 3MA9A 4O3YA 2BVMA 4DMVA 1MPFA 3CQGB 2JRKA 4YLHA 1ZEEA 2W63A 3UU2A 3AAAA 3W15B 3LG7A 4CI2B 2NOXA 2K24A 2LSIA 3N2OA 4EZ4A 1O3XA 1ORMA 2ZFGA 4AI6A 4WW0A 1S94A 4UV9B 4O8SA 5C8YE 4DBRA 4UVCB 4HGAA 5FXVA 3AA0A 4X1IE 5KMGP 4AKRB 4FZLA 4BA9A 2CWYA 2K48A 4QXCB 1PHOA 2N1GA 5L2LA 2CXFA 2L8KA 2Q9QA 4X1YE 1GFOA 3SY9A 3CQXC 4GF4A 4ADZA 4QHOA 3A5XA 5HYAA 4CXWA 1ZHYA 3UUNA 4JLEA 2XHEB 3ZJ2A 3AAEA 3SYBA 2DNXA 2NWBA 5JREA 2NW7A 1T98A 2XASB 3AA1A 2NTXA 4C69X 2LSYA 1WLXA 4BJNA 5LHIB 1D0XA 1YD8G 2WWUA 4GYSA 3ZMZB 2LFUA 2PORA 3QRAA 5F8PA 3ZMVB 2IC9A 3UUXB 3VZUX 1IZNB 5D5DA 4KMCA 3AA6B 4IE0A 1SHZC 3WAJA 2ODJA 4CXXA 2XTLA 3ANWB 3UPGA 2VK9A 4KRAA 5J2UE 3FYXA 3VZWX 3DJBA 1D1CA 4WBOA 3SS1A 3T0SA 2Y2XA 4QXBB 4H63V 3PORA 5ADXK 2I59A 4MALA 4BUMX 4GK0E 3PTRB 3L09A 2X67A 1THQA 2LJLA 3ZYLA 4P0AA 3IBPA 1E1HB 3C4XA 2YPVA 4D64A 3SRZA 4QX7B 1US7B 3LJCA 2MOZA 5ETWA 2WAUA 3HW9A 4O49A 3D0TA 4RJXA 3ZYKA 5FY7A 4HKAA 2J4UP 2F1VA 3RKOA 1LRZA 1UX5A 4ZHQE 2UXNB 4MBQA 4AKHA 2PFVA 2QGSA 3C4ZA 4U72A 2ZM8A 4G75A 4ZI2D 3Q5XA 3CVRA 1IZNA 2K0LA 3I0QA 3QUJA 1PRNA 1WYCA 3DA4A 3ANWA 4EYUA 3VY9X 2E9XD 5JDFA 5LBQB 3KV4A 3CX7B 3RRWA 2WSSV 2Y8DA 3V8UA 2X51A 2ES0A 5FP3A 4ZS3A 3AA7B 3IEEA 4O4UA 4EZHA 1OXZA 2VASA 5L3DB 1BH3A 4IDZA 3VHLA 4AYID 3KFWX 2JJ9A 3N5LA 5JDHA 4O3ZA 4CI1B 2V7IA 1IAPA 3ZPOA 4TV9E 5AFUL 2MHLA 2FGQX 2ZM2A 4OK0A 2X9XA 4N58A 4IGUA 4TN7B 4AXPA 3V5UA 3GA8A 3GN5B 4P09A 5FYMA 4RJWA 2ERVA 4JCHA 5JDQA 1X79A 4H9OC 4GHBA 1S35A 3HWBA 5DL5A 4KP3C 5A1LA 2N9DA 3AA7A 2V1DB 2MTQA 2WBLA 2YU2A 2HPLA 5DL6A 5IYUA 3KV5A 3O0EA 4AYDC 4FRXA 3ESLA 2D5UA 2L3LA 5J1GA 4GCPA 3M65A 2CMRA 4ZI2C 4PJNA 2BDEA 1QJPA 1H7CA 2KMFA 4O4HE 3C50A 4P0BA 5CB4E 3FBZA 3JTYA 1FMWA 2WMOA 4GIWA 4IE7A 4QWNB 2E9XC 4AKLA 2KWHA 1ZHCA 2JPFA 2JQQA 2VKOA 3H37A 3AB3B 3QK6A 4TZ4C 3PUQA 5ADXL 4OYJA 2N2MA 4X20E 2NP9A 1GFPA 1HXXA 3SYSA 5IHYA 4E7ZA 2MYSA 8PRNA 2M67A 4IHJE 4XNLA 3PDYA 1EZ3A 5JDMA 5GONE 4WNKA 5JVDE 3ZYMA 1ZHXA 3GWHA 2Y0LA 5KDMC 4HEAA 4E1TA 2KINB 1HS7A 2CM0A 3ONXA 3TZGA 3O1JA 2CXDA 2XE5A 3BQIA 4D5UA 1WRDA 4KBMB 3WAKA 4YHJA 3CWZB 2O4VA 3ZN1B 3L3PA 3MKDA 5PRNA 2Y48B 3A2SX 1V9DA 5LXTE 5AFUK 3ZEFB 4OFZA 4AKMA 4L9IA 4TUYE 3POQA 2YEVC 3T8OA 2LHFA 2LEHA 5FXZA 4ISSA 5LYJE 2KWIB 3O4XE 4RLBA 4PFPA 5EZYE 3R6NA 5J2TE 3E08A 2C5IT 3K8PC 1U5PA 3LK41 4GCSA 1QJ9A 3NZPA 4FMSA 4ISTA 3E22E 4I43B 1MMDA 4PJLA 2M07A 3TKLB 2H7OA 1MNEA 3UTKA 4ANJA 4FUVA 3FB2A 4JEHB 2K9AA 3RH3A 4QQ1A 1YS5A 1MMGA 5LOVE 1HXTA 1FMVA 3PE0A 3O9XA 5DABA 2PRNA 4AYNA 2HH7A 1H6S1 3K3NA 3RC8A 4O3WA 5FMNA 4I50E 4AQGA 1G90A 5FY1A 2VKJA 3SOLA 4PUXA 5LCYA 1ZKEA 4UVAB 2NW9A 4FZMA 2V7JA 3O1HA 2X9YA 4JEUB 3QC9A 1WYBA 4ILUA 3CMLA 2XE2A 5TAOA 3RYCE 3OYXA 3PUAA 4EOZB 1OPFA 4FSPA 2RA1A 5DQVA 5KX5E 2Y0KA 4IIJE 2ACXA 2PG8A 4GOUA 4RLCA 4FESA 3NBXX 4PK4A 1ZHZA 1Q9FA 6PRNA 1MMNA 2KDYA 1LVKA 3RYFE 1FIOA 2CE7A 3ETVA 4CQIA 1HFAA 3FXEB 4LSIA 4KR4A 2E9XB 3NZQA 1Y64B 3OKQA 2LOPA 1WR6A 1YKHB 4PW8A 3ZC1A 4QKNA 4H9NC 5FXWA 3VKGA 4AFKA 2EHOD 3HA4A 3KV9A 2OA5A 4IE4A 5LGNB 2KT9A 2IW5B 3BQKA 2DWKA 4MFRA 4XZCA 4EIWA 5JRCB 4G63A 2DWGA 3ETUA 2XAJB 7PRNA 1D0ZA 1HF8A 1D0YA 2KXPB 3Q9DA 3Q5WA 3B13A 4IE5A 4FRTA 2K4TA 2K5BB 3FXDB 3LFMA 4DMWA 2X0LB 4ERRA 3QRCA 2ZLYA 4AZLA 2YK0A 2XQYA 4PFOA 1NAFA 4U74A 2ODUA 3PQSA 2VKHA 2E9XA 2ZM0A 2D0TA 3AVSA 3E0ZA 3GMIA 3LK2B 2Y0HA 2LSGA 2VL8A 3POUA 3HKBE 1BR1A 2L9QA 2Y7SA 5GV0A 4FSOA 3SZDA 1ZV4X 2H7VC 2LT3A 2ZLDA 2GE4A 2NW8A 1ZHTA 5JRCA 3WI4A 4ZS2A 4O4LE 5EK2A 3UUMA 4EXTA 2KC0A 2N2LA 4QX8B 3VZTX 5LA6E 4G2AA 3RYHE 3U3IA 5E0OA 2KXPA 1BR0A 3KINB 4YFSA 1MIWA 2LE8A 4ZI3D 2X9WA 5HXEA 2M06A 2DHRA 4D65A 3HOLA 4LSFA 3RPUA 2X68A 3PUSA 4V1Av 1MMAA 3HOEA 2GK9A 2SPCA 2PBIA 3WI3A 1HTJF 4M1PA 2YU1A 4AKGA 3F57A 3HKDE 5JDPA 3N9MA 2WM9A 2EHOC 2XAQB 4JUYA 4N59A 1VOMA 4GYRA 3LK2A 2PJQA 2XAHB 1GFMA 5DJQC 2CA5A 2LSJA 2DLRA 4E1SA 5DL8A 4H9SE 2XTRA 2YINA 3GP6A 3N9QA 1HG5A 2HPJA 5HXRA 2IC6A 1Z0PA 4FZNA 1IJ5A 1U4QA 4XBFB 5LJMA 1UCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AA7 B;  2KZ7 A;  3AA1 B;  2KXP B;  3AAE A;  3AA7 A;  3LK4 1;  2KXP A;  3AA1 A;  3AAA B;  3AAA A;  3LK4 2;  1IZN B;  3AA0 B;  5AFU L;  3AA6 B;  3LK3 B;  1IZN A;  3AA6 A;  3LK3 A;  3LK2 B;  3AA0 A;  4AKR B;  5ADX L;  3LK2 A;  4AKR A;  5AFU K;  5ADX K;  2KZ7 B;  3AAE B; 
#chains in the Genus database with same CATH topology
 5JDG A;  3RQU A;  3JCU O;  1NWM X;  2IHR 1;  5L3G B;  4J2C A;  1W0B A;  2BS4 A;  4XAX B;  1D1B A;  1ZHW A;  4FOZ A;  5L3E B;  2X9K A;  3ZT5 A;  2XTQ A;  4YJ3 E;  2D0U A;  3IHR A;  5G38 A;  4ZI3 C;  5FNV E;  4IRE A;  2AE9 A;  5HWX A;  3ZC0 A;  3ZCJ A;  2XMX A;  4E7S A;  4AQF C;  5B66 O;  1T72 A;  3UT5 E;  3I0O A;  4OYK A;  3OVU A;  2H3R A;  2D9D A;  4BJM A;  4X5T A;  3OJA A;  3VE1 A;  3MAC A;  4WYV A;  4H63 H;  3AE7 A;  4N78 D;  2XE1 A;  3I1A A;  1GQE A;  4UXN B;  2MBG A;  2XZE A;  3UAQ A;  3ZMU B;  2BG9 A;  3CX8 B;  4C00 A;  2C0S A;  2WMN A;  1HX8 A;  4H9P C;  3JAE A;  4O4I E;  5GTI O;  4H9Q C;  2WU5 A;  1XNR T;  2Q9Q C;  4PK6 A;  4KR8 A;  2X0Y A;  3J7Y q;  2A9U A;  3QNU A;  2JQ9 A;  3OTO T;  1VRB A;  1OED C;  3EDU A;  5LHH B;  3HKC E;  5L3B B;  3EAM A;  4HTE A;  3MK7 C;  3RF1 A;  4IL9 A;  2P9B A;  3N9N A;  3FBL A;  4Z8X A;  3PUV F;  2IAK A;  5CJ5 A;  3VRA A;  3DTO A;  1T7S A;  2V7M A;  4JI2 T;  4UIG A;  5AQP B;  2W61 A;  3ZLI A;  4NXM T;  3OPC A;  3SY7 A;  2FGR A;  2LHN A;  4LF6 T;  3BRZ A;  2C5J A;  3ZMS B;  2KZ7 B;  2VWA A;  2CLY B;  3RX6 A;  5FL1 A;  3PUG A;  1MIY A;  5BMV E;  4KUM B;  1CHU A;  4PNI A;  3AAA B;  5LG4 A;  4AQF A;  5H6R B;  3LK4 2;  4JI7 T;  3AA0 B;  2E5V A;  4HWF A;  4MHC A;  4AYE C;  4JI8 T;  1Z8U A;  5JDN A;  3PJA J;  2M6I A;  4LML A;  3GN5 A;  4WBN E;  1MM5 A;  1GFQ A;  3CPZ A;  3RC3 A;  4GCQ A;  3TLV A;  2LSK A;  4XNK A;  4U2Z A;  4UR9 A;  4O3Y A;  1ZEE A;  2W63 A;  4CTD A;  3W15 B;  3LG7 A;  2NOX A;  2LSI A;  3T1H T;  2BG9 B;  4KI0 F;  4AI6 A;  4WW0 A;  4UV9 B;  4O8S A;  4PJ0 O;  5KMG P;  4FZL A;  4QXC B;  1KEY A;  2CXF A;  2Q9Q A;  4JI4 T;  3CQX C;  5AQR B;  4GF4 A;  5HYA A;  4QHO A;  3UU4 A;  2NW7 A;  2XAS B;  2OV9 A;  4DR3 T;  1OED A;  4QH5 A;  1YD8 G;  2LFU A;  1YQ3 A;  3ZMV B;  2IC9 A;  3UUX B;  4IE0 A;  4K3B A;  2XTL A;  3UPG A;  4DV2 T;  3FYX A;  3EI0 A;  1WCR A;  1YXR A;  2VQE T;  4QXB B;  4DV5 T;  4GK0 E;  3PTR B;  2J4G A;  3ZYL A;  4P0A A;  2YPV A;  1M7K A;  4X62 T;  4QX7 B;  1US7 B;  3HW9 A;  2HN1 A;  5FY7 A;  1UX5 A;  3C4Z A;  2QGS A;  4U72 A;  1VCS A;  4N74 A;  3CVR A;  1IZN A;  2K0L A;  2BS3 A;  3I0Q A;  1J5E T;  3QUJ A;  3DA4 A;  2UXB T;  3KV4 A;  2Y8D A;  1N36 T;  4A97 A;  5F5W A;  4DUZ T;  2WZH A;  3N5L A;  4CI1 B;  3RHW A;  2V7I A;  1N32 T;  1KF6 A;  2ZM2 A;  3GN5 B;  4P09 A;  2W66 A;  5A1L A;  2N9D A;  3AA7 A;  2YKS A;  2MTQ A;  5IYU A;  2HPL A;  3AXJ A;  3ESL A;  3M65 A;  2BDE A;  2M6B A;  4U7I A;  4GIW A;  4JV5 T;  2IML A;  2KWH A;  1ZHC A;  1UUR A;  3PUQ A;  3RGL A;  2N2M A;  1GFP A;  3SYS A;  5L4H A;  4XNL A;  1EZ3 A;  4HFE A;  5GON E;  4WNK A;  3CIR A;  2Y0L A;  1ZHX A;  3GWH A;  4HEA A;  4E1T A;  3O1J A;  4D5U A;  3RI5 A;  4ILB A;  3L3P A;  4ZEY A;  2R4O A;  2J62 A;  4CN6 A;  5AFU K;  3ZEF B;  4OFZ A;  4AKM A;  2J47 A;  2CRB A;  2WP9 A;  3JAD A;  2YEV C;  3T8O A;  2LEH A;  5FXZ A;  5LYJ E;  4DR2 T;  2KWI B;  3O4X E;  4C4V A;  5EZY E;  5J2T E;  3H3M A;  2F4V T;  3LK4 1;  2UUC T;  4LF8 T;  3P4Q A;  4I43 B;  4YY3 T;  1MMD A;  2H7O A;  1MNE A;  1Y01 A;  4FUV A;  2K9A A;  3SFD A;  3AE2 A;  4A5X A;  3ONL C;  4O3W A;  5FMN A;  4I50 E;  1G90 A;  5FY1 A;  4PUX A;  5LCY A;  4UVA B;  4FZM A;  3O1H A;  2X9Y A;  2QVA A;  3CML A;  5C3J A;  2BKN A;  3RYC E;  4EOZ B;  3PGU A;  2Y0K A;  4IIJ E;  1S5L O;  4DV4 T;  1ZHZ A;  1Q9F A;  2KDY A;  3RYF E;  3NWI A;  1SE7 A;  3ZC1 A;  3PGR A;  3KV9 A;  4X66 T;  2OA5 A;  3BQK A;  2WVP A;  3B13 A;  1R8I A;  2K5B B;  3FXD B;  3AXJ B;  1UGO A;  2X0L B;  2XSA A;  5FL0 A;  2XSB A;  2ZLY A;  4AZL A;  4PFO A;  3PQS A;  3AVS A;  3GMI A;  3A0H O;  3POU A;  5AQL B;  3Q5D A;  3ABV A;  2LKG A;  3PV0 F;  2ZLD A;  1HNW T;  2BKP A;  2GE4 A;  5HEO A;  4O4L E;  2KC0 A;  2N2L A;  3RYH E;  3RKG A;  4ZI3 D;  5HXE A;  4D65 A;  2WZI A;  4I0U A;  2PBI A;  3HKD E;  5JDP A;  4N59 A;  1VOM A;  2LKH A;  5DJQ C;  2UXD T;  2XTR A;  3GP6 A;  4WZX A;  3FZF B;  1UCU A;  4A98 A;  3EVY A;  4K0K T;  3KVB A;  3T20 A;  5FY0 A;  5EE2 A;  2BKO A;  1YW0 A;  4IDN A;  4HWI B;  1B7T A;  5HCJ A;  3N2K E;  3P8C D;  2LOS A;  2WDV A;  1KK7 A;  4ASK A;  4BAY B;  2R89 A;  1ZOY A;  1UX4 A;  3J9X 1;  3SZV A;  4NUU A;  3WI5 A;  5JH7 E;  2XQ6 A;  2CXL A;  2Q9Q D;  5EK4 A;  3HKE E;  3HL6 A;  2MAW A;  1N34 T;  4O2A E;  5ABH A;  2J1N A;  4QXH B;  2JMM A;  3JC6 C;  4MLK A;  2UU9 T;  4ZI7 E;  1W09 A;  2DCF A;  5HWY A;  4LFC T;  2UXX B;  4HFV A;  3VR9 A;  1XZY A;  2BS2 A;  4UEM A;  2XQ8 A;  5G26 A;  2CLY C;  2XAF B;  3RBH A;  5KAF O;  1J1J A;  3PU3 A;  2EHO B;  3PJA A;  5B5E O;  3AEE A;  1QSD A;  1XNQ T;  4CI3 B;  4FJO A;  4AKR A;  3HI2 A;  1OWA A;  2IWV A;  4UVB B;  2XG6 A;  5DL7 A;  4GKK T;  3NKZ A;  5AQV B;  4ZOL E;  4LSE A;  2I6H A;  2IWW A;  4YJ2 E;  3K19 A;  4F4B A;  4TNV A;  1T1L A;  3EUH A;  2KND A;  2A3D A;  2CWO A;  1HG2 A;  1IBM T;  2W00 A;  4F6R C;  2RP4 A;  4RL9 A;  4OX9 T;  5CA1 E;  3NSG A;  3BK9 A;  3CK6 A;  4EB6 E;  5L3F B;  3N9L A;  5FVN A;  1MND A;  3F31 A;  4DR4 T;  3VE2 A;  1MM4 A;  4G76 A;  3N2G E;  5LJN A;  3AEF A;  4Z3T A;  1BR4 A;  3I9Y A;  1NEN A;  3EHZ A;  2A2F X;  3PUW F;  3N9P A;  3DP7 A;  3L8R A;  4NXN T;  5LG3 A;  1E54 A;  3TLS A;  3ZKR A;  1LKX A;  1QUU A;  4GK5 E;  1N33 T;  2Y6X A;  3RLF F;  3R84 B;  3AAE B;  1FEW A;  3K3Q C;  2KZ7 A;  4HFD A;  4B6X A;  5LP6 E;  4QH1 A;  2CHN A;  3CQG B;  3UU2 A;  3AAA A;  4EZ4 A;  2XQ3 A;  3PGS A;  5C8Y E;  1S94 A;  3TLU A;  3AA0 A;  4AKR B;  4BA9 A;  5HEU A;  5L2L A;  1GFO A;  3SY9 A;  2CHO A;  4ADZ A;  3UUN A;  2XHE B;  2NWB A;  1KNR A;  2YN6 A;  4C69 X;  1WLX A;  4GYS A;  3ZMZ B;  2FJB A;  2POR A;  2ODJ A;  1QLB A;  3ANW B;  4KRA A;  3VZW X;  4JI5 T;  5ADX K;  2I59 A;  4MAL A;  2BBH A;  3K1S A;  4IT4 A;  3L09 A;  4EGW A;  1E1H B;  3C4X A;  3PUX F;  4O49 A;  2WAU A;  2WB5 A;  2XQ5 A;  2F1V A;  5FKY A;  4ZHQ E;  4FQE A;  3P4W A;  2WY2 A;  3VY9 X;  3DWN A;  1KNP A;  2V5D A;  1OXZ A;  5L3D B;  3RQW A;  3KFW X;  2JJ9 A;  3IA3 A;  1IAP A;  2JQK A;  4YHH T;  5ABF A;  3V5U A;  4RJW A;  4JCH A;  1T16 A;  4GHB A;  5DL5 A;  4KP3 C;  2V1D B;  3SFE A;  4ZI2 C;  5AQQ B;  4PJN A;  3DWO X;  1H7C A;  3C50 A;  3JTY A;  4YTN A;  3ZT7 A;  4QWN B;  2H89 A;  2AXD S;  2VKO A;  5ADX L;  3AB3 B;  4X20 E;  3PDY A;  2R8A A;  5JDM A;  4B3R T;  1HS7 A;  3TZG A;  2XE5 A;  3PF1 A;  3BQI A;  4TWH A;  1WRD A;  3WAK A;  3EAB A;  2UUB T;  4L9I A;  1XDP A;  3KZI O;  4Z90 A;  4K3C A;  4AIS A;  2C5I T;  3K8P C;  2M07 A;  3TKL B;  4JEH B;  3A7M A;  1YS5 A;  1MMG A;  3PE0 A;  5DAB A;  4AIU A;  4AYN A;  3K3N A;  3RC8 A;  4AQG A;  2RPA A;  1ZKE A;  4JEU B;  4ILU A;  3OYX A;  5DQV A;  5KX5 E;  2ACX A;  2PG8 A;  3ETV A;  4CQI A;  3FXE B;  2E9X B;  4NPP A;  3NZQ A;  1KFY A;  5ABF B;  1WR0 A;  1WR6 A;  4QKN A;  5FXW A;  4MFR A;  5ABE A;  7PRN A;  1D0Z A;  2KXP B;  4YSZ A;  3Q5W A;  4IE5 A;  4LF5 T;  1IBK T;  2WS3 A;  4UB6 O;  2XQY A;  1NAF A;  2VKH A;  4KHP T;  1HNX T;  4DV0 T;  1IBL T;  3LK2 B;  5G3A A;  2Y0H A;  5G39 A;  4YTM A;  5GV0 A;  2NW8 A;  5EK2 A;  3UUM A;  4EXT A;  2WDR A;  1BR0 A;  4YFS A;  2X9W A;  3UU6 A;  4LSF A;  5TIS O;  4CN4 A;  2GK9 A;  2SPC A;  1FJG T;  3N9M A;  2EHO C;  4TWF A;  4JUY A;  2LSJ A;  2R4L A;  4H9S E;  3N9Q A;  2IC6 A;  4FZN A;  1U4Q A;  5AQK B;  1IJ6 A;  3JC6 D;  4C91 A;  2XM1 A;  3PUY F;  4JI6 T;  3UU3 A;  5AQF B;  1I94 T;  4LSH A;  4DND A;  2W80 C;  4PK5 A;  3NRY A;  3K3O A;  2ODV A;  3CX6 B;  3G06 A;  4U7Y A;  2V7K A;  3AEG A;  2LRK A;  3UFG A;  1X9B A;  3N9O A;  2WJR A;  5AQG B;  3ZMT B;  3MJX A;  4HWC A;  2D2S A;  1XWM A;  3C4W A;  4PJM A;  5LHG B;  1DU2 A;  2Z6E A;  2V5C A;  2V6Y A;  2X0H A;  5HXC A;  1GFN A;  3PU8 A;  4I55 E;  3P7I A;  3PUR A;  1HR0 T;  2I0M A;  1Q9G A;  3JCF A;  4LFB T;  3HR0 A;  5C2T A;  2V6X A;  3LBX A;  1I6Z A;  2W4X A;  2OMF A;  3UQ4 A;  4TX5 A;  3P4R A;  4U2Y A;  2VB6 A;  3KVA A;  2A72 A;  2F1T A;  3LDQ B;  3UU8 A;  4FT6 A;  1QJ8 A;  2C5K T;  3JAF A;  3T1Y T;  3ZN0 B;  3FZK B;  2R4P A;  4CZZ B;  3EDV A;  3OBV E;  4YSY A;  3PQU A;  5HEJ A;  3BS0 A;  2NTY A;  1YQ4 A;  5LBM A;  3A8Y C;  2EHO A;  3AA6 A;  3O1I A;  1G73 A;  2X9H A;  2ZMA A;  3P4S A;  2W2U A;  3F2E A;  2YDS A;  2JMK A;  2BZB A;  2X66 A;  3KVD D;  4L0R A;  3NRX A;  2CCQ A;  2VQF T;  2ACZ A;  2W62 A;  4DVD A;  3ZJ1 A;  3PRN A;  4PR7 A;  3IF8 B;  3P50 A;  5LGU B;  3AAI A;  3RIA A;  4O3X B;  2XM2 A;  4EAH A;  5JR9 B;  2G0U A;  2B1E A;  2E5L T;  4K0U A;  3SWH A;  4ZZC A;  3KBU A;  4O4J E;  4DO0 A;  2BVL A;  4PAG A;  2DI4 A;  3KBT A;  4HN9 A;  4L5G A;  3T24 A;  2V6Y B;  3RYI E;  5FXX A;  3C64 A;  4C90 A;  4DR7 T;  1JNZ A;  4A56 A;  1G8X A;  4I4T E;  3B57 A;  3AA1 B;  2W67 A;  4X1K E;  3EMN X;  3LBX B;  3OYZ A;  1KNZ A;  5GTH O;  4DMV A;  3N2O A;  1O3X A;  5FXV A;  4HGA A;  4X1I E;  2K48 A;  3PUZ F;  1PHO A;  5JTG A;  2L8K A;  4CXW A;  1ZHY A;  4JLE A;  2AXT O;  3AAE A;  2VL0 A;  2DNX A;  5JRE A;  1T98 A;  4IL6 O;  2LSY A;  2PTF A;  3QRA A;  3FZH B;  3AE6 A;  5D5D A;  5HCM A;  3AA6 B;  1SHZ C;  3RIF A;  3AE5 A;  4CXX A;  5J2U E;  3DJB A;  3POR A;  4HFC A;  1W0A A;  5E79 O;  4BUM X;  1THQ A;  2LJL A;  4D64 A;  3LJC A;  4RJX A;  4HKA A;  3RKO A;  4DV1 T;  5AQN B;  5L4E A;  3L39 A;  4MBQ A;  2PFV A;  4G75 A;  4ZI2 D;  2WWV A;  3ANW A;  4EYU A;  5LBQ B;  3CX7 B;  3RRW A;  2WSS V;  3V8U A;  2ES0 A;  4ZS3 A;  3AE1 A;  3IEE A;  2VAS A;  2IDO B;  3VHL A;  1BH3 A;  2B76 A;  4B3T T;  3ZPO A;  2MHL A;  5J0Z A;  4ZZB A;  2X9X A;  4TN7 B;  3GA8 A;  2UUA T;  5FVK A;  2ERV A;  5JDQ A;  4LF9 T;  3ONJ A;  1X79 A;  4H9O C;  3RIU A;  2WJQ A;  3AED A;  2D5U A;  2L3L A;  4GCP A;  1QJP A;  2OLT A;  2KMF A;  4P0B A;  3FBZ A;  3DZM A;  2E9X C;  4AKL A;  2JPF A;  2JQQ A;  1T8B A;  4TZ4 C;  4OYJ A;  2NP9 A;  1HXX A;  5IHY A;  4E7Z A;  2MYS A;  3VRB A;  8PRN A;  2M67 A;  4IHJ E;  2BG9 E;  3AEB A;  2CXD A;  2FJD A;  3UQ7 A;  4HFB A;  4DV6 T;  2WDQ A;  4YHJ A;  4DV7 T;  4X64 T;  3QB5 A;  2Y48 B;  4YT0 A;  3A2S X;  1V9D A;  5CGM A;  2WQY A;  4TUY E;  3POQ A;  2LHF A;  4RLB A;  4PFP A;  4B3S T;  4FMS A;  4IST A;  3E22 E;  4PJL A;  3UTK A;  2KSR A;  4LMJ A;  3RH3 A;  1FMV A;  5FVL A;  2PRN A;  2XQ9 A;  5ABG A;  1H6S 1;  3SOL A;  2VKJ A;  1JNR A;  2NW9 A;  4HWH A;  2V7J A;  5AQO B;  2IUB A;  2XE2 A;  5TAO A;  3PUA A;  4B3M T;  1OPF A;  2RA1 A;  4GOU A;  3ZSS A;  4FES A;  4JI0 T;  3NBX X;  1MMN A;  4JI1 T;  2V8S V;  1FIO A;  4KR4 A;  1Y64 B;  4PW8 A;  4IDQ A;  2UXC T;  4H9N C;  3VKG A;  3NVO A;  2EHO D;  2IW5 B;  2CBJ A;  4EIW A;  5JRC B;  4G63 A;  2BBJ A;  3ETU A;  2XAJ B;  2YDR A;  1HF8 A;  3Q9D A;  4JYA T;  4FRT A;  2K4T A;  4JI3 T;  4ERR A;  3QRC A;  2H88 A;  2HN2 A;  2ODU A;  3VR8 A;  2E9X A;  3E0Z A;  3B5M A;  2LSG A;  1BR1 A;  3AE3 A;  1XDO A;  4FSO A;  3SZD A;  2H7V C;  2LT3 A;  1ZHT A;  3WI4 A;  4ZS2 A;  3VZT X;  4LF4 T;  4EED A;  2KXP A;  2WU2 A;  5IWA T;  1MIW A;  2LE8 A;  2M06 A;  2DHR A;  1UUS A;  4V1A v;  3HOE A;  3WI3 A;  1HTJ F;  2YU1 A;  4AKG A;  3F57 A;  2XAQ B;  3LK2 A;  2PJQ A;  1OED E;  2CA5 A;  4Z91 A;  2DLR A;  4HFI A;  4E1S A;  3UUB A;  5HXR A;  1L0V A;  4ILC A;  1Z0P A;  4XBF B;  4AQY T;  3VU7 H;  2CEA A;  1D1A A;  2E2A A;  3FHN A;  4UV8 B;  2X27 X;  3UFE A;  3AEC A;  5AQI B;  4P1N A;  2R88 A;  3I9W A;  4DBQ A;  4DR1 T;  5JQG E;  4O2B E;  5HXS A;  4O4X A;  3FZM B;  3MXZ A;  1HNZ T;  2XQ7 A;  4CXY A;  5IUX A;  3S4U A;  2J1D G;  2E8I A;  1P4T A;  5JDL A;  2LLY A;  4AKI A;  3RRC A;  4JFB A;  2FJE A;  3UUL A;  4EV6 A;  3LK3 A;  3AVR A;  3AE4 A;  4UEL A;  3KDS E;  4UF0 A;  5M4Y A;  4AUI A;  2V26 A;  3MZK B;  5LMU T;  3POX A;  2YDQ A;  5HXH A;  2LHR A;  2QTK A;  3BQL A;  5JR9 C;  2N2N A;  5L3C B;  5HAX A;  4UB8 O;  1SUM B;  2XAG B;  4H9R C;  3G7G A;  3A0B O;  2LM9 A;  5LMN T;  4AYM C;  2W0G A;  4U31 A;  3VY8 X;  5EK3 A;  3X1D A;  5CA0 E;  4YSX A;  1NEK A;  5KAI O;  1E7P A;  5IYZ E;  4NUV A;  3BRY A;  2YOE A;  2KLQ A;  1OSM A;  2MPK A;  5LB7 B;  3Q5E A;  3ZCI A;  2MNH A;  4FI5 A;  5H2F O;  2K3W A;  3WU2 O;  5AQH B;  5LGT B;  5F3J A;  1BT9 A;  4X65 T;  3V5S A;  4JBW F;  3H3A A;  1BXW A;  3C98 B;  2W81 C;  1W9R A;  1AJ3 A;  3VKH A;  4LFA T;  3KV6 A;  5DQW A;  4U9C A;  2FJA A;  2VKD A;  3AEA A;  5H6Q B;  1MIV A;  3DA3 A;  4IE6 A;  2XPK A;  1BR2 A;  3C5O A;  1CUN A;  2XUE A;  2FUP A;  4U33 A;  3Q2M A;  5LNK A;  4PJJ A;  2ZM6 T;  2V7L A;  2QYW A;  4B61 A;  3AE8 A;  3U78 A;  2YNK A;  1HCI A;  1YKE B;  3C51 A;  3LK3 B;  1LVF A;  2JMH A;  1WFD A;  1SA0 E;  2XE3 A;  4TV8 E;  2VVS A;  2Q9Q B;  4UF0 B;  1HXU A;  4EYY R;  4HE8 A;  4OHF A;  2QA7 A;  3CKD A;  5JR9 A;  1OED B;  3LSV A;  4DID B;  5T5F A;  3CQC B;  1M62 A;  3MA9 A;  2BVM A;  1MPF A;  2JRK A;  4YLH A;  2VVN A;  5AQJ B;  4CI2 B;  2K24 A;  2ZFG A;  1ORM A;  4DBR A;  4UVC B;  4GKJ T;  2CWY A;  2N1G A;  5KXJ A;  4X1Y E;  2F1C X;  3NJT A;  3A5X A;  3ZJ2 A;  3SYB A;  3QB5 K;  3AA1 A;  2NTX A;  4BJN A;  5LHI B;  1D0X A;  2WWU A;  5F8P A;  3VZU X;  1IZN B;  4KMC A;  3WAJ A;  2VK9 A;  3TLT A;  4LF7 T;  3FZL B;  1D1C A;  4WBO A;  3SS1 A;  3T0S A;  2Y2X A;  4COF A;  4H63 V;  4LMK A;  2JQH A;  2X67 A;  5L47 A;  3IBP A;  3SRZ A;  2MOZ A;  5ETW A;  3D0T A;  3ZYK A;  2J4U P;  1LRZ A;  2UXN B;  4AKH A;  4YTP A;  2ZM8 A;  3Q5X A;  1PRN A;  1WYC A;  2XJ7 A;  1XMO T;  2E9X D;  4YXD A;  5JDF A;  2X51 A;  5FP3 A;  3M3Z B;  4IDP A;  3AA7 B;  4O4U A;  4EZH A;  3AE9 A;  1VCT A;  4IDO A;  4AYI D;  4IDZ A;  4IL4 A;  5JDH A;  4O3Z A;  1UK5 A;  2IIU A;  4TV9 E;  5AFU L;  4DR6 T;  4EEB A;  1XMQ T;  2FGQ X;  4OK0 A;  4N58 A;  4IGU A;  4AXP A;  5FYM A;  1S35 A;  3HWB A;  5AQS B;  2WBL A;  2YU2 A;  5DL6 A;  3KV5 A;  3O0E A;  4AYD C;  4FRX A;  5J1G A;  4N75 A;  2CMR A;  4TNW A;  4O4H E;  5CB4 E;  1FMW A;  2WMO A;  4IE7 A;  5BR8 T;  3P4P A;  3H37 A;  5AQT B;  3QK6 A;  4KX6 A;  4C4V B;  5AQU B;  2HHH T;  2NR4 A;  5JVD E;  3RIU C;  3ZYM A;  4DV3 T;  5KDM C;  2KIN B;  2CM0 A;  3ONX A;  4HFH A;  2FBW A;  4KBM B;  3CWZ B;  2O4V A;  3ZN1 B;  3MKD A;  5PRN A;  2JIW A;  4F8H A;  5LXT E;  4TWD A;  2XY8 B;  4Q25 A;  4ISS A;  2CBI A;  3R6N A;  3E08 A;  1U5P A;  4U3C A;  3UU5 A;  4GCS A;  1QJ9 A;  3NZP A;  4ANJ A;  3FB2 A;  4QQ1 A;  1HXT A;  5LOV E;  2JQY A;  3O9X A;  2HH7 A;  1ZP0 A;  4NIQ A;  4DR5 T;  3QC9 A;  1WYB A;  2VUR A;  2R4N A;  5CFB A;  4FSP A;  4HWD A;  4RLC A;  2LM2 A;  2XQ4 A;  4PK4 A;  6PRN A;  1LVK A;  2CE7 A;  4LSI A;  2DL1 A;  1HFA A;  3OKQ A;  2LOP A;  1YKH B;  2QRX A;  4ZXL A;  3ZT6 A;  4AFK A;  3HA4 A;  4IE4 A;  5LGN B;  2KT9 A;  2DWK A;  4XZC A;  2DWG A;  1HX1 B;  1D0Y A;  3TLW A;  4CN1 A;  2XQA A;  5HEG A;  3LFM A;  4DMW A;  3ZST A;  2CPT A;  2LRL A;  2YK0 A;  1J5W A;  4U74 A;  2ZM0 A;  2D0T A;  2BG9 C;  4QH4 A;  2R6G F;  2VL8 A;  4KHZ F;  3HKB E;  2L9Q A;  1E2A A;  2Y7S A;  1ZV4 X;  5JRC A;  5HEH A;  4DUY T;  4QX8 B;  5LA6 E;  4G2A A;  3U3I A;  5E0O A;  3KIN B;  3HOL A;  2WCA A;  3RPU A;  2X68 A;  3QOF A;  3PUS A;  1MMA A;  4M1P A;  5AQM B;  2WM9 A;  4GYR A;  2XAH B;  4ILA A;  1GFM A;  5DL8 A;  2YIN A;  1HG5 A;  2HPJ A;  1IJ5 A;  5LJM A; 
#chains in the Genus database with same CATH homology
 5JDG A;  1IJ6 A;  3JC6 D;  4C91 A;  3VU7 H;  3EVY A;  2CEA A;  1D1A A;  3KVB A;  3FHN A;  3T20 A;  5FY0 A;  4UV8 B;  1NWM X;  2X27 X;  5EE2 A;  5L3G B;  4J2C A;  1YW0 A;  3UFE A;  4XAX B;  4LSH A;  4DND A;  2W80 C;  4PK5 A;  1B7T A;  1D1B A;  3I9W A;  3NRY A;  1ZHW A;  4FOZ A;  4DBQ A;  5L3E B;  3N2K E;  3K3O A;  3P8C D;  5JQG E;  2LOS A;  2ODV A;  4O2B E;  3CX6 B;  5HXS A;  4O4X A;  3MXZ A;  2XTQ A;  1KK7 A;  2V7K A;  4YJ3 E;  4ASK A;  4BAY B;  1UX4 A;  2D0U A;  3N9O A;  3J9X 1;  3IHR A;  3SZV A;  3ZMT B;  4NUU A;  4CXY A;  3WI5 A;  5JH7 E;  4ZI3 C;  3S4U A;  2J1D G;  5FNV E;  3MJX A;  2CXL A;  2Q9Q D;  2E8I A;  5EK4 A;  5HWX A;  1P4T A;  3ZC0 A;  3ZCJ A;  5JDL A;  2XMX A;  4AKI A;  4E7S A;  3HKE E;  3RRC A;  2D2S A;  4JFB A;  4AQF C;  3C4W A;  3HL6 A;  4PJM A;  3UUL A;  5LHG B;  2Z6E A;  3UT5 E;  4O2A E;  3LK3 A;  2J1N A;  3I0O A;  3AVR A;  5HXC A;  4OYK A;  4QXH B;  4UEL A;  3KDS E;  1GFN A;  3PU8 A;  4I55 E;  2JMM A;  3JC6 C;  4MLK A;  2H3R A;  4UF0 A;  5M4Y A;  3P7I A;  4ZI7 E;  3PUR A;  2DCF A;  2V26 A;  3MZK B;  2UXX B;  4HFV A;  5HWY A;  5HXH A;  1Q9G A;  3POX A;  4UEM A;  5G26 A;  2LHR A;  3HR0 A;  4BJM A;  2QTK A;  3OJA A;  3VE1 A;  2CLY C;  3BQL A;  5JR9 C;  2N2N A;  3LBX A;  3MAC A;  4H63 H;  2XAF B;  5L3C B;  5HAX A;  3RBH A;  4N78 D;  2OMF A;  2XE1 A;  2XAG B;  3I1A A;  4H9R C;  3G7G A;  3PU3 A;  4UXN B;  2MBG A;  2EHO B;  3UAQ A;  2LM9 A;  4TX5 A;  4AYM C;  3ZMU B;  2VB6 A;  2W0G A;  1QSD A;  3CX8 B;  2C0S A;  2WMN A;  3KVA A;  1HX8 A;  4H9P C;  2A72 A;  3VY8 X;  2F1T A;  5EK3 A;  4O4I E;  4FJO A;  4CI3 B;  5CA0 E;  3HI2 A;  1OWA A;  4AKR A;  4UVB B;  4FT6 A;  4H9Q C;  2XG6 A;  5DL7 A;  2Q9Q C;  4PK6 A;  2C5K T;  1QJ8 A;  4KR8 A;  3ZN0 B;  5IYZ E;  4AUI A;  4ZOL E;  3J7Y q;  4NUV A;  1VRB A;  4LSE A;  4CZZ B;  3EDV A;  3EDU A;  3OBV E;  2KLQ A;  5LHH B;  1OSM A;  3PQU A;  3HKC E;  4YJ2 E;  5L3B B;  3K19 A;  2NTY A;  4F4B A;  3ZCI A;  5LBM A;  2MNH A;  4HTE A;  3MK7 C;  2EHO A;  3AA6 A;  3EUH A;  2P9B A;  1G73 A;  2KND A;  3O1I A;  4FI5 A;  2A3D A;  2CWO A;  1HG2 A;  2X9H A;  2W00 A;  3N9N A;  2ZMA A;  3FBL A;  4Z8X A;  4F6R C;  3F2E A;  2JMK A;  5LGT B;  5F3J A;  2IAK A;  2BZB A;  1BT9 A;  3V5S A;  3H3A A;  1BXW A;  2RP4 A;  3C98 B;  2X66 A;  3KVD D;  4RL9 A;  4L0R A;  3DTO A;  3NRX A;  2W81 C;  2CCQ A;  5CA1 E;  1AJ3 A;  3NSG A;  3BK9 A;  4EB6 E;  3VKH A;  2V7M A;  2W62 A;  3KV6 A;  4UIG A;  5DQW A;  5L3F B;  4U9C A;  2W61 A;  3ZLI A;  3N9L A;  4DVD A;  2VKD A;  3ZJ1 A;  3PRN A;  5FVN A;  5H6Q B;  3SY7 A;  3IF8 B;  1MIV A;  2FGR A;  3DA3 A;  2LHN A;  4IE6 A;  1MND A;  5LGU B;  3AAI A;  3F31 A;  1BR2 A;  3C5O A;  2C5J A;  1CUN A;  3ZMS B;  2XUE A;  2KZ7 B;  2VWA A;  4O3X B;  4EAH A;  3VE2 A;  2CLY B;  5JR9 B;  2G0U A;  2B1E A;  3RX6 A;  1MM4 A;  4G76 A;  3N2G E;  3Q2M A;  3PUG A;  5LJN A;  1MIY A;  5LNK A;  4K0U A;  3SWH A;  4PJJ A;  2V7L A;  5BMV E;  4Z3T A;  4B61 A;  1BR4 A;  3KBU A;  4KUM B;  3U78 A;  2YNK A;  4PNI A;  1HCI A;  3AAA B;  3I9Y A;  4O4J E;  4DO0 A;  5LG4 A;  2BVL A;  4AQF A;  5H6R B;  1YKE B;  3C51 A;  2A2F X;  4PAG A;  3LK4 2;  3N9P A;  3DP7 A;  2DI4 A;  3AA0 B;  3LK3 B;  3KBT A;  4HN9 A;  1LVF A;  2JMH A;  4L5G A;  3T24 A;  1E54 A;  1SA0 E;  4MHC A;  4AYE C;  3RYI E;  2XE3 A;  5FXX A;  4TV8 E;  3C64 A;  4C90 A;  1LKX A;  2Q9Q B;  5JDN A;  4UF0 B;  1QUU A;  4GK5 E;  4A56 A;  1G8X A;  3GN5 A;  1HXU A;  2Y6X A;  4EYY R;  4HE8 A;  3R84 B;  4WBN E;  4I4T E;  4OHF A;  2QA7 A;  3CKD A;  3AAE B;  1FEW A;  3CPZ A;  3K3Q C;  1GFQ A;  1MM5 A;  3RC3 A;  3B57 A;  2KZ7 A;  4GCQ A;  3AA1 B;  4X1K E;  3EMN X;  5JR9 A;  3LBX B;  3OYZ A;  4B6X A;  5LP6 E;  2LSK A;  1KNZ A;  4XNK A;  5T5F A;  3CQC B;  3MA9 A;  4O3Y A;  2BVM A;  4DMV A;  1MPF A;  3CQG B;  2JRK A;  4YLH A;  1ZEE A;  2W63 A;  3UU2 A;  3AAA A;  3W15 B;  3LG7 A;  4CI2 B;  2NOX A;  2K24 A;  2LSI A;  3N2O A;  4EZ4 A;  1O3X A;  1ORM A;  2ZFG A;  4AI6 A;  4WW0 A;  1S94 A;  4UV9 B;  4O8S A;  5C8Y E;  4DBR A;  4UVC B;  4HGA A;  5FXV A;  3AA0 A;  4X1I E;  5KMG P;  4AKR B;  4FZL A;  4BA9 A;  2CWY A;  2K48 A;  4QXC B;  1PHO A;  2N1G A;  5L2L A;  2CXF A;  2L8K A;  2Q9Q A;  4X1Y E;  1GFO A;  3SY9 A;  3CQX C;  4GF4 A;  4ADZ A;  4QHO A;  3A5X A;  5HYA A;  4CXW A;  1ZHY A;  3UUN A;  4JLE A;  2XHE B;  3ZJ2 A;  3AAE A;  3SYB A;  2DNX A;  2NWB A;  5JRE A;  2NW7 A;  1T98 A;  2XAS B;  3AA1 A;  2NTX A;  4C69 X;  2LSY A;  1WLX A;  4BJN A;  5LHI B;  1D0X A;  1YD8 G;  2WWU A;  4GYS A;  3ZMZ B;  2LFU A;  2POR A;  3QRA A;  5F8P A;  3ZMV B;  2IC9 A;  3UUX B;  3VZU X;  1IZN B;  5D5D A;  4KMC A;  3AA6 B;  4IE0 A;  1SHZ C;  3WAJ A;  2ODJ A;  4CXX A;  2XTL A;  3ANW B;  3UPG A;  2VK9 A;  4KRA A;  5J2U E;  3FYX A;  3VZW X;  3DJB A;  1D1C A;  4WBO A;  3SS1 A;  3T0S A;  2Y2X A;  4QXB B;  4H63 V;  3POR A;  5ADX K;  2I59 A;  4MAL A;  4BUM X;  4GK0 E;  3PTR B;  3L09 A;  2X67 A;  1THQ A;  2LJL A;  3ZYL A;  4P0A A;  3IBP A;  1E1H B;  3C4X A;  2YPV A;  4D64 A;  3SRZ A;  4QX7 B;  1US7 B;  3LJC A;  2MOZ A;  5ETW A;  2WAU A;  3HW9 A;  4O49 A;  3D0T A;  4RJX A;  3ZYK A;  5FY7 A;  4HKA A;  2J4U P;  2F1V A;  3RKO A;  1LRZ A;  1UX5 A;  4ZHQ E;  2UXN B;  4MBQ A;  4AKH A;  2PFV A;  2QGS A;  3C4Z A;  4U72 A;  2ZM8 A;  4G75 A;  4ZI2 D;  3Q5X A;  3CVR A;  1IZN A;  2K0L A;  3I0Q A;  3QUJ A;  1PRN A;  1WYC A;  3DA4 A;  3ANW A;  4EYU A;  3VY9 X;  2E9X D;  5JDF A;  5LBQ B;  3KV4 A;  3CX7 B;  3RRW A;  2WSS V;  2Y8D A;  3V8U A;  2X51 A;  2ES0 A;  5FP3 A;  4ZS3 A;  3AA7 B;  3IEE A;  4O4U A;  4EZH A;  1OXZ A;  2VAS A;  5L3D B;  1BH3 A;  4IDZ A;  3VHL A;  4AYI D;  3KFW X;  2JJ9 A;  3N5L A;  5JDH A;  4O3Z A;  4CI1 B;  2V7I A;  1IAP A;  3ZPO A;  4TV9 E;  5AFU L;  2MHL A;  2FGQ X;  2ZM2 A;  4OK0 A;  2X9X A;  4N58 A;  4IGU A;  4TN7 B;  4AXP A;  3V5U A;  3GA8 A;  3GN5 B;  4P09 A;  5FYM A;  4RJW A;  2ERV A;  4JCH A;  5JDQ A;  1X79 A;  4H9O C;  4GHB A;  1S35 A;  3HWB A;  5DL5 A;  4KP3 C;  5A1L A;  2N9D A;  3AA7 A;  2V1D B;  2MTQ A;  2WBL A;  2YU2 A;  2HPL A;  5DL6 A;  5IYU A;  3KV5 A;  3O0E A;  4AYD C;  4FRX A;  3ESL A;  2D5U A;  2L3L A;  5J1G A;  4GCP A;  3M65 A;  2CMR A;  4ZI2 C;  4PJN A;  2BDE A;  1QJP A;  1H7C A;  2KMF A;  4O4H E;  3C50 A;  4P0B A;  5CB4 E;  3FBZ A;  3JTY A;  1FMW A;  2WMO A;  4GIW A;  4IE7 A;  4QWN B;  2E9X C;  4AKL A;  2KWH A;  1ZHC A;  2JPF A;  2JQQ A;  2VKO A;  3H37 A;  3AB3 B;  3QK6 A;  4TZ4 C;  3PUQ A;  5ADX L;  4OYJ A;  2N2M A;  4X20 E;  2NP9 A;  1GFP A;  1HXX A;  3SYS A;  5IHY A;  4E7Z A;  2MYS A;  8PRN A;  2M67 A;  4IHJ E;  4XNL A;  3PDY A;  1EZ3 A;  5JDM A;  5GON E;  4WNK A;  5JVD E;  3ZYM A;  1ZHX A;  3GWH A;  2Y0L A;  5KDM C;  4HEA A;  4E1T A;  2KIN B;  1HS7 A;  2CM0 A;  3ONX A;  3TZG A;  3O1J A;  2CXD A;  2XE5 A;  3BQI A;  4D5U A;  1WRD A;  4KBM B;  3WAK A;  4YHJ A;  3CWZ B;  2O4V A;  3ZN1 B;  3L3P A;  3MKD A;  5PRN A;  2Y48 B;  3A2S X;  1V9D A;  5LXT E;  5AFU K;  3ZEF B;  4OFZ A;  4AKM A;  4L9I A;  4TUY E;  3POQ A;  2YEV C;  3T8O A;  2LHF A;  2LEH A;  5FXZ A;  4ISS A;  5LYJ E;  2KWI B;  3O4X E;  4RLB A;  4PFP A;  5EZY E;  3R6N A;  5J2T E;  3E08 A;  2C5I T;  3K8P C;  1U5P A;  3LK4 1;  4GCS A;  1QJ9 A;  3NZP A;  4FMS A;  4IST A;  3E22 E;  4I43 B;  1MMD A;  4PJL A;  2M07 A;  3TKL B;  2H7O A;  1MNE A;  3UTK A;  4ANJ A;  4FUV A;  3FB2 A;  4JEH B;  2K9A A;  3RH3 A;  4QQ1 A;  1YS5 A;  1MMG A;  5LOV E;  1HXT A;  1FMV A;  3PE0 A;  3O9X A;  5DAB A;  2PRN A;  4AYN A;  2HH7 A;  1H6S 1;  3K3N A;  3RC8 A;  4O3W A;  5FMN A;  4I50 E;  4AQG A;  1G90 A;  5FY1 A;  2VKJ A;  3SOL A;  4PUX A;  5LCY A;  1ZKE A;  4UVA B;  2NW9 A;  4FZM A;  2V7J A;  3O1H A;  2X9Y A;  4JEU B;  3QC9 A;  1WYB A;  4ILU A;  3CML A;  2XE2 A;  5TAO A;  3RYC E;  3OYX A;  3PUA A;  4EOZ B;  1OPF A;  4FSP A;  2RA1 A;  5DQV A;  5KX5 E;  2Y0K A;  4IIJ E;  2ACX A;  2PG8 A;  4GOU A;  4RLC A;  4FES A;  3NBX X;  4PK4 A;  1ZHZ A;  1Q9F A;  6PRN A;  1MMN A;  2KDY A;  1LVK A;  3RYF E;  1FIO A;  2CE7 A;  3ETV A;  4CQI A;  1HFA A;  3FXE B;  4LSI A;  4KR4 A;  2E9X B;  3NZQ A;  1Y64 B;  3OKQ A;  2LOP A;  1WR6 A;  1YKH B;  4PW8 A;  3ZC1 A;  4QKN A;  4H9N C;  5FXW A;  3VKG A;  4AFK A;  2EHO D;  3HA4 A;  3KV9 A;  2OA5 A;  4IE4 A;  5LGN B;  2KT9 A;  2IW5 B;  3BQK A;  2DWK A;  4MFR A;  4XZC A;  4EIW A;  5JRC B;  4G63 A;  2DWG A;  3ETU A;  2XAJ B;  7PRN A;  1D0Z A;  1HF8 A;  1D0Y A;  2KXP B;  3Q9D A;  3Q5W A;  3B13 A;  4IE5 A;  4FRT A;  2K4T A;  2K5B B;  3FXD B;  3LFM A;  4DMW A;  2X0L B;  4ERR A;  3QRC A;  2ZLY A;  4AZL A;  2YK0 A;  2XQY A;  4PFO A;  1NAF A;  4U74 A;  2ODU A;  3PQS A;  2VKH A;  2E9X A;  2ZM0 A;  2D0T A;  3AVS A;  3E0Z A;  3GMI A;  3LK2 B;  2Y0H A;  2LSG A;  2VL8 A;  3POU A;  3HKB E;  1BR1 A;  2L9Q A;  2Y7S A;  5GV0 A;  4FSO A;  3SZD A;  1ZV4 X;  2H7V C;  2LT3 A;  2ZLD A;  2GE4 A;  2NW8 A;  1ZHT A;  5JRC A;  3WI4 A;  4ZS2 A;  4O4L E;  5EK2 A;  3UUM A;  4EXT A;  2KC0 A;  2N2L A;  4QX8 B;  3VZT X;  5LA6 E;  4G2A A;  3RYH E;  3U3I A;  5E0O A;  2KXP A;  1BR0 A;  3KIN B;  4YFS A;  1MIW A;  2LE8 A;  4ZI3 D;  2X9W A;  5HXE A;  2M06 A;  2DHR A;  4D65 A;  3HOL A;  4LSF A;  3RPU A;  2X68 A;  3PUS A;  4V1A v;  1MMA A;  3HOE A;  2GK9 A;  2SPC A;  2PBI A;  3WI3 A;  1HTJ F;  4M1P A;  2YU1 A;  4AKG A;  3F57 A;  3HKD E;  5JDP A;  3N9M A;  2WM9 A;  2EHO C;  2XAQ B;  4JUY A;  4N59 A;  1VOM A;  4GYR A;  3LK2 A;  2PJQ A;  2XAH B;  1GFM A;  5DJQ C;  2CA5 A;  2LSJ A;  2DLR A;  4E1S A;  5DL8 A;  4H9S E;  2XTR A;  2YIN A;  3GP6 A;  3N9Q A;  1HG5 A;  2HPJ A;  5HXR A;  2IC6 A;  1Z0P A;  4FZN A;  1IJ5 A;  1U4Q A;  4XBF B;  5LJM A;  1UCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...