3LK2B

Crystal structure of capz bound to the uncapping motif from carmil
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
242
structure length
242
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of a capping protein interaction motif defines a family of actin filament regulators
doi rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
total genus 79
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lk2B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3lk2B02
5ADXL 3AA7A 3AA0A 1IZNA 3AAEB 5ADXK 3AA7B 3LK3B 1IZNB 3LK2B 2KXPB 4AKRB 2KZ7B 3AAEA 3LK41 3AAAB 3LK3A 3LK2A 3AA6B 2KXPA 4AKRA 2KZ7A 3LK42 3AA1B 3AAAA 3AA0B 5AFUK 3AA6A 3AA1A 5AFUL
chains in the Genus database with same CATH superfamily
2ZM8A 3FZHB 4FESA 4OYKA 2L9QA 2W2UA 2ACXA 4N75A 5FXWA 2K4TA 2WWUA 3UUMA 4G76A 2C5KT 3SS1A 2HPJA 1HNXT 1BR0A 3QUJA 2YPVA 5FY1A 3UTKA 2K3WA 4I50E 3BRYA 3K1SA 3VU7H 3C64A 5JDHA 3IF8B 3GN5B 4ILUA 2V7LA 4UR9A 1N32T 2BBHA 3LK42 4DR1T 2QVAA 4CXXA 1QLBA 2Y7SA 3G06A 3CQCB 3NRYA 3Q5WA 5KAFO 1HNWT 4X66T 1SA0E 5GV0A 2V26A 5H6RB 4UIGA 2D2SA 4X1YE 4JEUB 2E9XB 1JNRA 2XAJB 4K0UA 4AYMC 3W15B 2QA7A 3OYZA 4BAYB 2E5LT 2D0UA 2KSRA 5DL6A 4UV9B 3N5LA 3N9OA 4LF9T 2CA5A 4JI6T 2E9XD 4J2CA 4U33A 4AYNA 4LF6T 2WJQA 3M3ZB 2NW7A 4EYYR 4JCHA 1O3XA 4IE4A 4QXHB 4IL6O 3BQIA 1PHOA 4YY3T 1UUSA 2X9HA 4UELA 4GCSA 3QNUA 2ZMAA 2PTFA 3POXA 5JDNA 3UUNA 2V7KA 4IE7A 2MBGA 3WI3A 1IJ6A 3PU8A 1P4TA 1JNZA 1FMWA 4O3WA 3B57A 4AKGA 3WI4A 2BG9E 3PUSA 4RLCA 2EHOA 1D1AA 4UV8B 3LBXA 1N34T 3NVOA 5HCMA 2WP9A 3DP7A 1EZ3A 4IHJE 2H3RA 3HA4A 5AQFB 5L3FB 3AA0B 2KLQA 4F8HA 2X66A 2IDOB 2ODVA 3LSVA 3ZYKA 2W81C 4IE6A 3ANWA 1G8XA 5ABGA 4ZZBA 3VKGA 2Q9QA 5L47A 2B76A 4JI2T 2LRKA 5EE2A 4YHHT 4AYID 5AQRB 2V7JA 5JDQA 5IYUA 3PJAJ 1WYBA 4EB6E 4QH5A 5F8PA 4ZI3D 3T24A 3RI5A 2XAHB 2OMFA 2W80C 5JR9A 4K3BA 1HXXA 3VZWX 2NP9A 5G26A 2Q9QD 4HWHA 4CI2B 3ZSSA 2WQYA 2JRKA 3FZLB 4KI0F 4CZZB 2XQ3A 2J4GA 4M1PA 2LFUA 4I0UA 4AQFC 2PFVA 2FJEA 3OPCA 1W9RA 2WWVA 5J2TE 3GP6A 3K3NA 4C91A 4RLBA 5LGNB 4LFBT 3AB3B 3RYIE 4QHOA 2CHNA 4X65T 4EIWA 4JYAT 2A2FX 1QJPA 3EHZA 2ODUA 4ILCA 2LSJA 2L8KA 2RA1A 4TX5A 4PW8A 1HNZT 3ZMUB 3VE1A 3G7GA 3HI2A 4H9PC 4X5TA 3ZYLA 2XHEB 4A97A 1GFPA 1WR6A 3IA3A 4GOUA 2IWVA 3KV6A 4H9SE 4FJOA 1YKHB 1D0YA 5LGTB 2HPLA 2ERVA 3A0HO 4N58A 4A56A 2LHFA 5AFUL 4P0BA 5AQNB 2BKOA 3CX7B 4LF4T 4D64A 1WRDA 2XQ6A 3N9NA 3TLUA 5FY0A 4XAXB 4YTMA 4OYJA 3PJAA 3SYBA 5PRNA 4AKMA 3RKGA 5FNVE 3DA3A 2Y0KA 4AYDC 3CX6B 5HWYA 3P4RA 2D5UA 2NR4A 4EEDA 1MM5A 4QWNB 4UF0B 3PUAA 3CK6A 2BVMA 4TNWA 4DR4T 2JQYA 2MHLA 3O0EA 5KAIO 4IT4A 5JDGA 4E7SA 4Q25A 4FOZA 2JQKA 1WFDA 1B7TA 1E1HB 5LYJE 2HHHT 5FVKA 2BVLA 5DL7A 4U2YA 4UVCB 1LKXA 4P1NA 2W00A 4LSEA 5CB4E 2M06A 3AAEB 4Z3TA 5FYMA 1LVFA 3AAEA 4EZHA 4JFBA 2XPKA 2AE9A 2LOPA 3S4UA 4GCPA 2ZLYA 4DV5T 3QRCA 4H9QC 2WU2A 2VWAA 4O4IE 4JI1T 3NJTA 2DWKA 3UFGA 1WLXA 4NIQA 4B3ST 4O3XB 3JAFA 3PGRA 3ZMSB 3N2KE 4ILBA 4B6XA 2V6YA 3UU6A 2UUBT 4ZI2C 2YEVC 1GQEA 3TLVA 3ZT6A 5AQUB 3ZPOA 4CN4A 3Q5DA 5JTGA 1ORMA 2YINA 2RPAA 2YU2A 3E0ZA 3JC6D 1I94T 3HOEA 1T7SA 3UUBA 3PORA 3A0BO 3ZT5A 2JPFA 5JR9B 2J1NA 2XASB 5CA1E 1ZHZA 1E2AA 3HKEE 4DR3T 5E0OA 4ANJA 5KX5E 2KWHA 3DZMA 1HG5A 2OA5A 4AKIA 3F2EA 4MLKA 2HH7A 2W61A 5IWAT 2QRXA 4YSYA 4E1SA 2R4NA 7PRNA 1BT9A 4HFVA 4QXCB 3CQXC 2N2MA 3QB5K 2LEHA 4AI6A 1YQ3A 3N2OA 2XAGB 2Y8DA 4H9NC 3RIUC 1KK7A 2PG8A 4ZXLA 5FL0A 3AEBA 3SFDA 1LVKA 3VZUX 4U72A 3HW9A 3ZC1A 3ZYMA 4X1IE 4X64T 1OEDB 2VB6A 3PURA 5JR9C 5G3AA 1HTJF 4C90A 4QKNA 5G39A 3AE7A 5ABHA 3RHWA 4NXNT 2CHOA 4JI3T 2X68A 4IE0A 5IUXA 5LMUT 5HXRA 3CMLA 3ZMZB 4UB8O 2KXPB 5L2LA 2A9UA 3N9LA 3NZPA 3ZCIA 4IDNA 2E9XC 5DQWA 3Q5EA 5JRCB 5LCYA 1BR2A 3TLWA 3MK7C 4ZI3C 4HWDA 3P50A 1XNQT 2OV9A 2XAFB 3GA8A 4HFCA 3JCUO 3UULA 4EOZB 1IJ5A 3LK3B 5LHHB 3D0TA 2IC9A 5AQIB 1Z8UA 4X62T 3ZKRA 3H37A 4XNLA 3DJBA 2XSAA 4ZI7E 3GMIA 2CXFA 4HFIA 1MNDA 4DV7T 3O1HA 4F4BA 3GWHA 2WDQA 4YJ3E 2E9XA 4O4XA 3B13A 4AKRB 1OPFA 3POUA 1D0ZA 4YT0A 4B3RT 4FUVA 3SZVA 3R6NA 4UVAB 2YDSA 2HN2A 3MACA 3PRNA 2WU5A 8PRNA 3BK9A 4PJJA 2VURA 1J5ET 5CA0E 3OJAA 2XJ7A 1SE7A 3CIRA 3H3MA 1IZNB 2LJLA 4H63H 2X9KA 4U31A 5IYZE 5CJ5A 3ONJA 2DHRA 4DR2T 2DLRA 5HEGA 2M6IA 3RF1A 3RYHE 4O3ZA 5LG3A 3AA7A 4WNKA 2MYSA 2UU9T 3EAMA 2H7VC 5LB7B 5HXHA 2H88A 5LA6E 2C0SA 3I9WA 2CMRA 2K5BB 2WAUA 1VRBA 4OFZA 1MIWA 4PNIA 2CRBA 5H6QB 3FHNA 2I59A 2XTRA 4U9CA 5LJMA 2R8AA 2E5VA 2LSKA 1NENA 2LHNA 4AXPA 5F3JA 5LHIB 4U3CA 2JQ9A 4TWFA 5AQMB 1MIYA 2ZM0A 3KV9A 4E1TA 2WDVA 3VHLA 4DIDB 3P4QA 4CI1B 2ZM6T 4JI4T 1YW0A 2H7OA 3RRWA 3HL6A 1HS7A 2CLYB 2M6BA 2FJAA 2IC6A 2CXLA 3VY8X 1MMNA 2JMHA 4DV2T 4JI8T 4EV6A 2KXPA 3AE3A 4FQEA 1WYCA 1UURA 2XAQB 1N36T 4FRXA 1UCUA 4N74A 2X0YA 5L4EA 4U7IA 5ADXK 3UPGA 2D9DA 4GYRA 4TNVA 1U4QA 4G2AA 4O49A 2X51A 4NUVA 4IL4A 2N9DA 3I1AA 3L3PA 2MAWA 2MTQA 5DL8A 3RYCE 3AECA 1IBKT 4X20E 2XY8B 5LXTE 4IE5A 2V5CA 5JQGE 2KMFA 3A2SX 5FY7A 2JQQA 4RJXA 1ZOYA 4IDZA 2K48A 3EABA 4LSIA 3AEEA 5HXEA 3NSGA 2XQ5A 4XNKA 6PRNA 2XZEA 1PRNA 3U3IA 2YK0A 3ZT7A 1ZHCA 2WMOA 3FXEB 3QRAA 2X0LB 5AQQB 5DABA 3J9X1 4OK0A 1W09A 2R4PA 1WR0A 1HXUA 3VRAA 3CVRA 3VR8A 4QH4A 3LK3A 3JAEA 3MXZA 2CPTA 4BJMA 4MBQA 4O2AE 4V1Av 3O1IA 3AA1A 3DWNA 1Y01A 4DVDA 2UXDT 4U7YA 3E08A 2XQ8A 3RQUA 2IAKA 2I0MA 4DNDA 4YHJA 3EVYA 5AQTB 3B5MA 3AA6B 4IDPA 4GKJT 3AAAA 3ZLIA 2IUBA 3OVUA 3H3AA 1VCTA 4ILAA 3PUXF 4AKLA 3I0OA 3AEDA 1KNPA 2ODJA 2N2NA 2NTYA 5LGUB 2NW9A 4C69X 2XQ4A 2IMLA 3QOFA 2ES0A 3NBXX 4LMJA 1THQA 3SY9A 4YXDA 3HKCE 3PDYA 3PUGA 2R88A 3AA7B 3ETVA 2XQAA 2LOSA 3ONXA 4EZ4A 4B3TT 2W0GA 1ZHTA 1XWMA 2X9YA 2E8IA 2KWIB 4H63V 3DA4A 2V1DB 2C5JA 2P9BA 2EHOB 1DU2A 1E7PA 2K9AA 5TAOA 1T98A 3O1JA 3M65A 2N1GA 2UUCT 4FZNA 5AQKB 2PRNA 4PR7A 5L4HA 2Z6EA 3RIUA 1HCIA 2O4VA 3KVDD 4UB6O 3UU5A 5FXXA 4L0RA 1XDOA 5FXZA 1X79A 3N9PA 2Q9QB 4XZCA 5ABFB 5H2FO 5JDMA 4G75A 1VCSA 1HFAA 2G0UA 4DBRA 4DUYT 4O2BE 3KVAA 4HGAA 3L09A 4FZMA 4TV9E 1NWMX 2CEAA 4CN6A 3T8OA 2FGRA 1FMVA 2W4XA 5KMGP 2UXBT 2BS4A 2LE8A 4KHZF 3UU4A 3RC3A 3PV0F 4C4VB 4QH1A 1S35A 2F1TA 2GK9A 3UUXB 3U78A 2F4VT 5HEUA 3T20A 3MA9A 2MPKA 2K0LA 1X9BA 1D0XA 2VKHA 4TWHA 3N2GE 4TWDA 2DNXA 2CCQA 4U2ZA 2QGSA 1D1CA 4O4LE 2X9WA 3PTRB 2UXNB 4FRTA 3T1HT 4ZZCA 4CI3B 3RLFF 1E54A 3RBHA 2Q9QC 2V7IA 5J0ZA 2WVPA 1MMGA 3OBVE 4HN9A 3FZKB 2IWWA 3FBLA 3IBPA 2WB5A 1BH3A 4K3CA 5ETWA 3KVBA 2DL1A 1N33T 4GIWA 1GFNA 2PORA 1M7KA 3T0SA 2SPCA 5FXVA 4CQIA 3AAIA 4RL9A 1LRZA 4KHPT 2KT9A 4QX7B 2XM1A 3VE2A 1IAPA 3ETUA 4K0KT 5D5DA 4KMCA 5F5WA 1M62A 5BR8T 1BXWA 3MZKB 3RX6A 2KZ7A 5BMVE 1ZKEA 3UU2A 3AE6A 2V7MA 3RKOA 2LKGA 3AE1A 4YFSA 4YTNA 1OXZA 2V6XA 2WCAA 3OKQA 1G90A 4FI5A 3A7MA 4KX6A 2A3DA 4ISSA 1S5LO 2KINB 4KR4A 3T1YT 4AUIA 4HFBA 4C00A 1NAFA 4X1KE 3LBXB 1OEDE 2J47A 2BDEA 5JDLA 4I55E 5ABEA 4HE8A 1Q9FA 2YNKA 2VL8A 3DTOA 1AJ3A 2X27X 3P4WA 3PUVF 2A72A 2WMNA 3K8PC 2FBWA 3RPUA 2XUEA 4JLEA 4GCQA 2Y0HA 4RJWA 4CTDA 5LBQB 1UX5A 4TUYE 2R6GF 2W67A 1OEDC 3PQUA 3C4WA 3AEFA 4PUXA 1FIOA 2V5DA 3KV4A 4ZI2D 2BS2A 3FZMB 4CXYA 1MMAA 2KC0A 1ZHWA 3ZJ1A 4HFDA 4LMKA 1XNRT 4PJ0O 3RGLA 5JREA 3SFEA 4YSZA 1ZEEA 3KFWX 3P4SA 1MM4A 4L5GA 1YS5A 3RH3A 5FVLA 4GHBA 1T72A 3PQSA 2H89A 3ZCJA 3ZEFB 1FJGT 4NUUA 3NKZA 1T8BA 5IHYA 2BG9B 2WDRA 3OTOT 2BG9A 2FJDA 2WSSV 5HXCA 3EMNX 4DO0A 4AFKA 1BR1A 4KP3C 2VKDA 5JDFA 3F31A 2VVNA 3MJXA 3VRBA 4DV6T 1Y64B 2CE7A 4WYVA 5DJQC 2PBIA 2Y6XA 3FB2A 1YXRA 1OEDA 4A5XA 1FEWA 3GN5A 4UVBB 3UT5E 4DV4T 2DI4A 4FMSA 2QYWA 2XTQA 2BKPA 1J1JA 2AXDS 1GFOA 5HEJA 2YN6A 4H9RC 2VKOA 3EDVA 2NOXA 3L39A 3BQKA 3VR9A 2OLTA 4ZHQE 2E2AA 5L3GB 4KBMB 2JMMA 2YDQA 3PUYF 4JUYA 4ISTA 2LT3A 4B3MT 5HEOA 1YD8G 4O4HE 5J2UE 2XE2A 5ADXL 3V8UA 5TISO 4ASKA 2WZIA 4MFRA 4TV8E 3AE2A 3N9MA 1US7B 3K3OA 4P09A 3ZN0B 2CXDA 4PFPA 4WBNE 3ESLA 2WS3A 4LSHA 2W66A 2J4UP 3X1DA 4Z8XA 4KUMB 5HEHA 3WU2O 5AFUK 2XMXA 2JJ9A 3A8YC 2KNDA 2VQET 2XTLA 5AQSB 4JV5T 4AQGA 3RRCA 5FP3A 2N2LA 2CWOA 2IIUA 4ADZA 4MHCA 3ONLC 3UQ4A 4HWIB 4NXMT 2UXXB 3O4XE 1MPFA 3ZJ2A 2YDRA 3ZMTB 1YKEB 3Q2MA 3RIAA 3JCFA 2EHOD 4I4TE 3PU3A 2GE4A 3C51A 2LM9A 3LK2A 2WY2A 3KV5A 3E22E 5LHGB 4ZOLE 3NZQA 2LSIA 5HCJA 3V5SA 3HKBE 4DMWA 5L3CB 2M67A 2F1CX 1WCRA 3ANWB 4EXTA 1KNRA 5CFBA 4COFA 2CLYC 3LG7A 4HKAA 3J7Yq 3ABVA 2R4OA 4B61A 1T16A 4ZS3A 4EEBA 1GFQA 3P7IA 1HG2A 4GK5E 4OHFA 5AQLB 2M07A 5CGMA 2ZFGA 1IZNA 4A98A 5AQJB 3QC9A 5JH7E 4IDOA 4LF5T 3FBZA 5LOVE 4IL9A 4WZXA 4AIUA 1Q9GA 2R4LA 4HWCA 3JTYA 4L9IA 2FUPA 2WBLA 3ZN1B 4FT6A 2KDYA 4O8SA 5LG4A 3UU8A 3PE0A 2HN1A 4DV1T 5GTIO 3AE8A 1IBLT 2J62A 3RQWA 1QJ8A 2PJQA 4UEMA 5GTHO 5B5EO 3HWBA 1CUNA 3LFMA 3HOLA 2Y0LA 4KRAA 3EUHA 4DR6T 5FMNA 3WAKA 3KINB 3CQGB 3OYXA 2BBJA 1KFYA 2DCFA 3KDSE 2YU1A 2X9XA 2J1DG 4UF0A 4TZ4C 3QK6A 2VVSA 2XG6A 1SUMB 1OWAA 3K19A 1XMQT 2YOEA 2IW5B 2VQFT 2JQHA 2YKSA 1D1BA 4XBFB 4WW0A 2R89A 2LLYA 3RC8A 2MNHA 3NWIA 3Q5XA 5HXSA 2XQ7A 1ZP0A 4HFHA 4DV3T 4H9OC 3EI0A 2XE5A 4PFOA 4CXWA 3IEEA 4E7ZA 5E79O 4WBOA 4MALA 1VOMA 3V5UA 2LSGA 3FZFB 5LMNT 1H6S1 1OSMA 4D5UA 4O3YA 5DQVA 3AEAA 2UXCT 3PGSA 5HAXA 5AQOB 2IHR1 2BZBA 4JEHB 4IIJE 3RIFA 1KNZA 3AA1B 5L3BB 4PK6A 3RYFE 3BQLA 3JC6C 3K3QC 3AA0A 1KEYA 5JVDE 4ZEYA 4HWFA 5B66O 3CPZA 5JDPA 2XQYA 2XE1A 3CWZB 2L3LA 4LFCT 2VASA 4PJMA 3IHRA 1CHUA 5C8YE 2CBJA 1XDPA 4AKRA 5C3JA 5AQPB 3R84B 3FYXA 4PAGA 4AISA 3HR0A 3AXJB 1T1LA 4OX9T 3O9XA 4D65A 1UK5A 2NW8A 3AXJA 4PK5A 3FXDB 1QSDA 5LBMA 4HEAA 3ZC0A 3BRZA 1R8IA 3N9QA 2MOZA 5L3EB 2VK9A 2UUAT 4U74A 5EZYE 4LFAT 4JI7T 1V9DA 3AE4A 3AVRA 3SZDA 4O4JE 4TN7B 3NRXA 3ZSTA 3C50A 1QJ9A 4HTEA 5C2TA 2X67A 3PF1A 4DR7T 2NWBA 4EAHA 1NEKA 1ZV4X 5AQHB 3ZMVB 3P4PA 5T5FA 1SHZC 3HKDE 4DMVA 3PGUA 3VZTX 5KDMC 5EK4A 4QQ1A 2ACZA 4EGWA 1IBMT 4GK0E 4DV0T 3QB5A 2JMKA 3TLSA 2ZM2A 4DUZT 1MMDA 2XQ9A 4Z90A 4JBWF 1Z0PA 2ZLDA 2C5IT 1U5PA 4UXNB 3UQ7A 4Z91A 2W62A 3PUWF 4AQFA 4N59A 3WI5A 1XMOT 2FJBA 1HXTA 2BG9C 4GF4A 1J5WA 2DWGA 2CBIA 3SOLA 1L0VA 1HF8A 3KBTA 2BKNA 4I43B 3AVSA 3BS0A 4FSOA 3I0QA 4AQYT 5LP6E 3POQA 4C4VA 2K24A 2BS3A 2NTXA 3TZGA 4ERRA 3A5XA 2D0TA 4EYUA 3C5OA 3KBUA 3TLTA 3C98B 5A1LA 2XSBA 5HYAA 4QXBB 3LJCA 3EDUA 4AZLA 4LF8T 3LDQB 2Y2XA 4JI5T 2LSYA 5FKYA 4QX8B 2LKHA 3AE5A 3L8RA 5FL1A 2AXTO 4F6RC 2VL0A 2CM0A 3WAJA 5G38A 4LSFA 4BA9A 5AQGB 3LK41 4IREA 3KZIO 3SY7A 3SRZA 3F57A 4YTPA 5J1GA 3JADA 4PJLA 3TKLB 2WM9A 1I6ZA 1QUUA 3UFEA 5KXJA 5JRCA 3Q9DA 4N78D 1UX4A 2XM2A 2XE3A 4DBQA 3VY9X 4PK4A 2LRLA 4GYSA 1S94A 4IGUA 2LHRA 1UGOA 2CWYA 2W63A 1ZHYA 1ZHXA 4O4UA 5EK2A 3C4XA 2F1VA 5M4YA 2KZ7B 2EHOC 1HR0T 3AAAB 2LM2A 5LNKA 4CN1A 4G63A 5LJNA 3AA6A 4YJ2E 3PUQA 4JI0T 3DWOX 4YLHA 3AE9A 3CKDA 3VKHA 4AYEC 1MNEA 2X0HA 4BUMX 3UAQA 1GFMA 2VKJA 3CX8B 4PJNA 4AKHA 2JIWA 4IDQA 3SWHA 1BR4A 4DR5T 2V8SV 2B1EA 5AQVB 3UU3A 3MKDA 1XZYA 3PUZF 5L3DB 4FSPA 4KR8A 1W0AA 4LMLA 5DL5A 2I6HA 2Y48B 4HFEA 4P0AA 4NPPA 1KF6A 2RP4A 5GONE 1G73A 3C4ZA 2FGQX 3P8CD 5EK3A 1H7CA 3I9YA 2WZHA 2QTKA 5FVNA 1MIVA 3LK2B 4BJNA 4FZLA 5HWXA 4LF7T 3SYSA 2V6YB 1HX8A 1YQ4A 4YSXA 4GKKT 3AEGA 1W0BA 4ZS2A 1HX1B 2WJRA 5ABFA
chains in the Genus database with same CATH topology
2ZM8A 4L0RA 4FESA 5FXZA 1X79A 4OYKA 4AKIA 3N9PA 5LG4A 3F2EA 2Q9QB 4MLKA 4XZCA 2L9QA 2HH7A 5JDMA 3PE0A 2ACXA 2W61A 4G75A 5FXWA 2K4TA 1HFAA 2G0UA 2WWUA 4DBRA 1QJ8A 3UUMA 4O2BE 4G76A 4E1SA 2C5KT 3KVAA 4HGAA 2PJQA 3L09A 4UEMA 3SS1A 4FZMA 7PRNA 4TV9E 1BT9A 3HWBA 1CUNA 4HFVA 1NWMX 3LFMA 2CEAA 2Y0LA 2HPJA 4QXCB 2YNKA 3EUHA 3CQXC 2N2MA 3HOLA 5FMNA 3T8OA 3WAKA 2FGRA 3KINB 3QUJA 1BR0A 2LEHA 3CQGB 1FMVA 3OYXA 4AI6A 2YPVA 5FY1A 2DCFA 3KDSE 2YU1A 4I50E 2X9XA 3UTKA 4AKRA 3N2OA 2XAGB 2Y8DA 3VU7H 5KMGP 2J1DG 4H9NC 2LE8A 1KK7A 3C64A 2PG8A 4UF0A 5JDHA 3IF8B 3RC3A 3GN5B 1S35A 4ILUA 4TZ4C 3QK6A 1LVKA 2F1TA 3VZUX 2XG6A 2GK9A 4U72A 2V7LA 3UUXB 3HW9A 3U78A 2KDYA 3ZC1A 1OWAA 3ZYMA 4X1IE 3T20A 3MA9A 3K19A 3PURA 2VB6A 5JR9C 2K0LA 1HTJF 2IW5B 3LK42 4C90A 1D0XA 2VKHA 4QKNA 4CXXA 3N2GE 1D1BA 2Y7SA 4XBFB 3CQCB 3NRYA 4WW0A 3Q5WA 2DNXA 2X68A 2CCQA 4IE0A 2QGSA 1D1CA 4O4LE 3RC8A 1SA0E 5GV0A 2V26A 2X9WA 5HXRA 5H6RB 3CMLA 2MNHA 3Q5XA 5HXSA 3PTRB 3ZMZB 4UIGA 2UXNB 4FRTA 2D2SA 2KXPB 4X1YE 5L2LA 4H9OC 4CI3B 4JEUB 3N9LA 1E54A 3NZPA 3ZCIA 2Q9QC 3RBHA 2E9XB 2XE5A 4PFOA 2V7IA 4CXWA 2E9XC 1MMGA 5DQWA 3OBVE 4HN9A 5JRCB 2XAJB 3FBLA 3IBPA 4K0UA 5LCYA 1BH3A 3IEEA 1BR2A 4E7ZA 4WBOA 4MALA 1VOMA 5ETWA 3W15B 3KVBA 3V5UA 4AYMC 2QA7A 2LSGA 3MK7C 4ZI3C 1GFNA 4GIWA 3OYZA 2XAFB 3GA8A 4BAYB 2D0UA 1H6S1 3UULA 4EOZB 1OSMA 2PORA 4UV9B 5DL6A 4D5UA 3N5LA 3N9OA 1IJ5A 2CA5A 4O3YA 3LK3B 5DQVA 5LHHB 3T0SA 3D0TA 2IC9A 2E9XD 4J2CA 4AYNA 2SPCA 5HAXA 3H37A 2BZBA 4JEHB 5FXVA 4IIJE 4CQIA 4XNLA 3DJBA 1KNZA 3AA1B 5L3BB 2NW7A 4EYYR 4PK6A 4ZI7E 4JCHA 3AAIA 4RL9A 3RYFE 3GMIA 3BQLA 1LRZA 3JC6C 1O3XA 4IE4A 2CXFA 4QXHB 2KT9A 3K3QC 4QX7B 3AA0A 1MNDA 5JVDE 3BQIA 1PHOA 3O1HA 3CPZA 4F4BA 5JDPA 3GWHA 2X9HA 4YJ3E 2E9XA 4UELA 4O4XA 2XQYA 3VE2A 4GCSA 1IAPA 3B13A 2XE1A 3ETUA 4AKRB 2ZMAA 3CWZB 2L3LA 3POXA 5D5DA 1OPFA 4KMCA 5JDNA 2VASA 4PJMA 2V7KA 3IHRA 4IE7A 2MBGA 3UUNA 5C8YE 1BXWA 3MZKB 3POUA 1D0ZA 3RX6A 3WI3A 2KZ7A 3FYXA 4KRAA 3R84B 4FUVA 3SZVA 1IJ6A 4PAGA 3R6NA 3PU8A 4UVAB 5BMVE 1P4TA 1ZKEA 3HR0A 3MACA 3UU2A 2V7MA 3O9XA 4D65A 1FMWA 3RKOA 4YFSA 3PRNA 4O3WA 2NW8A 8PRNA 3B57A 3BK9A 4AKGA 4PJJA 3PUSA 4PK5A 1OXZA 3WI4A 3FXDB 1QSDA 5CA0E 2EHOA 3OJAA 5LBMA 4RLCA 4HEAA 3ZC0A 3OKQA 1G90A 4FI5A 1IZNB 1D1AA 2LJLA 4UV8B 3LBXA 4H63H 3N9QA 2A3DA 5IYZE 4ISSA 2KINB 2MOZA 3DP7A 5L3EB 2VK9A 4KR4A 2DHRA 4AUIA 1EZ3A 1NAFA 3LBXB 4IHJE 4U74A 4X1KE 2BDEA 5EZYE 4I55E 2H3RA 2DLRA 3HA4A 5JDLA 5L3FB 4HE8A 1Q9FA 3AA0B 1V9DA 2KLQA 2X66A 2ODVA 3RYHE 2VL8A 3DTOA 3AVRA 4IE6A 3ZYKA 1AJ3A 2W81C 3ANWA 4O4JE 2X27X 4TN7B 4O3ZA 3SZDA 1G8XA 3AA7A 4WNKA 3VKGA 2MYSA 3NRXA 2A72A 2WMNA 3K8PC 3RPUA 2XUEA 4JLEA 4GCQA 3C50A 2H7VC 1QJ9A 2Y0HA 2Q9QA 4HTEA 4RJWA 2X67A 5LBQB 1UX5A 4TUYE 5LA6E 5HXHA 5EE2A 2NWBA 3PQUA 2C0SA 3C4WA 3I9WA 4EAHA 2CMRA 1ZV4X 2K5BB 4PUXA 4AYID 2WAUA 1FIOA 3ZMVB 1VRBA 2V7JA 1SHZC 5JDQA 5T5FA 3KV4A 3HKDE 4OFZA 4DMVA 1MIWA 4PNIA 3VZTX 5IYUA 4ZI2D 5KDMC 1WYBA 5EK4A 4QQ1A 5H6QB 5F8PA 3FHNA 4EB6E 4ZI3D 3T24A 2I59A 2XAHB 4CXYA 2OMFA 2W80C 2XTRA 5JR9A 1MMAA 2KC0A 4U9CA 1ZHWA 5LJMA 3ZJ1A 4GK0E 1HXXA 2LSKA 5JREA 3VZWX 2JMKA 2NP9A 5G26A 2ZM2A 1ZEEA 2Q9QD 1MMDA 4CI2B 3KFWX 1MM4A 2LHNA 4L5GA 4AXPA 5F3JA 2JRKA 4CZZB 1YS5A 3RH3A 5LHIB 1Z0PA 4GHBA 2ZLDA 2C5IT 4M1PA 2LFUA 1MIYA 1U5PA 2ZM0A 4UXNB 3PQSA 3KV9A 4E1TA 4AQFC 3VHLA 2PFVA 3ZCJA 3ZEFB 4NUUA 4CI1B 2W62A 5IHYA 4AQFA 4N59A 5J2TE 3GP6A 3WI5A 3K3NA 4C91A 1YW0A 2H7OA 3RRWA 1HXTA 4RLBA 5LGNB 3HL6A 1HS7A 2CLYB 3AB3B 3RYIE 4GF4A 4QHOA 2IC6A 2CXLA 3VY8X 2DWGA 1MMNA 2WSSV 2JMHA 5HXCA 3SOLA 3EMNX 4DO0A 4AFKA 1BR1A 1HF8A 3KBTA 4EIWA 4I43B 2A2FX 2KXPA 4KP3C 1QJPA 2VKDA 1WYCA 2ODUA 3AVSA 2LSJA 5JDFA 2XAQB 4FSOA 3F31A 3I0QA 4FRXA 1UCUA 5LP6E 3POQA 3MJXA 2L8KA 2K24A 2RA1A 4TX5A 4PW8A 2NTXA 3ZMUB 3TZGA 3VE1A 3G7GA 4ERRA 1Y64B 3HI2A 2CE7A 5ADXK 3UPGA 5DJQC 4GYRA 2PBIA 1U4QA 2Y6XA 4G2AA 3A5XA 4H9PC 2D0TA 4O49A 3FB2A 3ZYLA 2XHEB 4EYUA 3C5OA 2X51A 3KBUA 1WR6A 1GFPA 4NUVA 3C98B 1FEWA 3GN5A 4UVBB 3UT5E 2DI4A 4GOUA 5A1LA 5HYAA 3KV6A 4QXBB 4H9SE 4FJOA 4FMSA 2N9DA 2XTQA 1YKHB 3LJCA 1D0YA 3EDUA 3I1AA 3L3PA 5LGTB 1GFOA 2MTQA 2HPLA 4H9RC 4AZLA 2VKOA 2ERVA 2Y2XA 4N58A 2LSYA 3EDVA 5DL8A 2NOXA 3RYCE 4A56A 2LHFA 4P0BA 4X20E 5AFUL 4QX8B 5LXTE 3BQKA 3CX7B 4IE5A 4D64A 5JQGE 2KMFA 3A2SX 5FY7A 1WRDA 2JQQA 3N9NA 4ZHQE 4F6RC 4RJXA 5FY0A 2CM0A 4IDZA 4XAXB 3WAJA 4OYJA 2K48A 4KBMB 5L3GB 4LSIA 4BA9A 4LSFA 3SYBA 2JMMA 5PRNA 3NSGA 5HXEA 3LK41 4AKMA 4JUYA 4XNKA 4ISTA 5FNVE 6PRNA 3DA3A 2LT3A 2Y0KA 3SY7A 3SRZA 3F57A 4AYDC 3CX6B 5HWYA 5J1GA 1YD8G 4PJLA 3TKLB 2D5UA 4O4HE 2WM9A 1PRNA 1MM5A 1QUUA 3U3IA 3UFEA 5J2UE 2XE2A 4QWNB 2YK0A 4UF0B 1ZHCA 2WMOA 3PUAA 5JRCA 3FXEB 3Q9DA 4N78D 2BVMA 3QRAA 5ADXL 2X0LB 1UX4A 3V8UA 4ASKA 2XE3A 5DABA 4DBQA 4MFRA 4TV8E 3N9MA 3VY9X 1US7B 3K3OA 4P09A 4OK0A 3J9X1 2CXDA 3ZN0B 2MHLA 4PFPA 4WBNE 3O0EA 3ESLA 4PK4A 5JDGA 1HXUA 4E7SA 3CVRA 4FOZA 4GYSA 3LK3A 1B7TA 4LSHA 1S94A 1E1HB 3MXZA 4IGUA 5LYJE 2J4UP 4Z8XA 4KUMB 4BJMA 4MBQA 4O2AE 2LHRA 2BVLA 4V1Av 2CWYA 3O1IA 5AFUK 5DL7A 2W63A 4UVCB 1ZHYA 2JJ9A 2XMXA 2KNDA 1LKXA 3AA1A 1ZHXA 4DVDA 2W00A 4LSEA 4O4UA 5CB4E 2XTLA 2M06A 5EK2A 3C4XA 3AAEB 4Z3TA 5FYMA 1LVFA 2F1VA 4AQGA 3E08A 3RRCA 5FP3A 2N2LA 2CWOA 5M4YA 4ADZA 2IAKA 2KZ7B 4MHCA 3AAEA 4DNDA 2EHOC 4EZHA 3AAAB 4JFBA 4YHJA 3EVYA 3AA6B 3AAAA 5LNKA 2LOPA 4G63A 5LJNA 3S4UA 2UXXB 3AA6A 4GCPA 2ZLYA 3PUQA 3ZLIA 4YJ2E 3O4XE 1MPFA 3QRCA 3H3AA 3ZJ2A 4YLHA 3ZMTB 3CKDA 4H9QC 3VKHA 4AKLA 3I0OA 2ODJA 2VWAA 1YKEB 2N2NA 4O4IE 3Q2MA 2NTYA 1MNEA 4AYEC 5LGUB 2DWKA 2EHOD 2NW9A 4C69X 4I4TE 4BUMX 3PU3A 2GE4A 1GFMA 3UAQA 1WLXA 3C51A 2VKJA 2LM9A 3LK2A 4O3XB 3KV5A 3CX8B 3ZMSB 3N2KE 3E22E 4PJNA 4B6XA 2ES0A 4AKHA 3NBXX 5LHGB 4ZOLE 3NZQA 2LSIA 3SWHA 1THQA 3SY9A 1BR4A 3V5SA 3HKBE 4DMWA 4ZI2C 2YEVC 2B1EA 3HKCE 2M67A 5L3CB 3PDYA 3PUGA 3ANWB 3MKDA 3AA7B 3ETVA 4EXTA 5L3DB 2CLYC 2LOSA 3LG7A 3ONXA 4FSPA 4KR8A 3ZPOA 4HKAA 4EZ4A 3J7Yq 5DL5A 2W0GA 1ZHTA 2Y48B 4B61A 2X9YA 4ZS3A 2E8IA 2KWIB 1ORMA 4H63V 3DA4A 4P0AA 2YINA 1GFQA 2RP4A 2YU2A 3P7IA 5GONE 2V1DB 1HG2A 2C5JA 1G73A 3C4ZA 2P9BA 4GK5E 3E0ZA 4OHFA 2M07A 2EHOB 2FGQX 3JC6D 3P8CD 5EK3A 1H7CA 2ZFGA 3HOEA 1IZNA 3I9YA 2QTKA 2K9AA 3PORA 2JPFA 5FVNA 5TAOA 1T98A 5JR9B 3QC9A 2J1NA 5JH7E 2XASB 1MIVA 3LK2B 3O1JA 4BJNA 5CA1E 3M65A 5HWXA 1ZHZA 4FZLA 2N1GA 3HKEE 3FBZA 3SYSA 4FZNA 5E0OA 5LOVE 1Q9GA 2PRNA 1HX8A 4ANJA 2Z6EA 3JTYA 1HCIA 4L9IA 2O4VA 3KVDD 2WBLA 5KX5E 4ZS2A 2KWHA 3ZN1B 4FT6A 1HG5A 5FXXA 2OA5A 4O8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ADX L;  3AA7 A;  3AA0 A;  1IZN A;  3AAE B;  5ADX K;  3AA7 B;  3LK3 B;  1IZN B;  3LK2 B;  2KXP B;  4AKR B;  2KZ7 B;  3AAE A;  3LK4 1;  3AAA B;  3LK3 A;  3LK2 A;  3AA6 B;  2KXP A;  4AKR A;  2KZ7 A;  3LK4 2;  3AA1 B;  3AAA A;  3AA0 B;  5AFU K;  3AA6 A;  3AA1 A;  5AFU L; 
#chains in the Genus database with same CATH topology
 2ZM8 A;  3FZH B;  4FES A;  4OYK A;  2L9Q A;  2W2U A;  2ACX A;  4N75 A;  5FXW A;  2K4T A;  2WWU A;  3UUM A;  4G76 A;  2C5K T;  3SS1 A;  2HPJ A;  1HNX T;  1BR0 A;  3QUJ A;  2YPV A;  5FY1 A;  3UTK A;  2K3W A;  4I50 E;  3BRY A;  3K1S A;  3VU7 H;  3C64 A;  5JDH A;  3IF8 B;  3GN5 B;  4ILU A;  2V7L A;  4UR9 A;  1N32 T;  2BBH A;  3LK4 2;  4DR1 T;  2QVA A;  4CXX A;  1QLB A;  2Y7S A;  3G06 A;  3CQC B;  3NRY A;  3Q5W A;  5KAF O;  1HNW T;  4X66 T;  1SA0 E;  5GV0 A;  2V26 A;  5H6R B;  4UIG A;  2D2S A;  4X1Y E;  4JEU B;  2E9X B;  1JNR A;  2XAJ B;  4K0U A;  4AYM C;  3W15 B;  2QA7 A;  3OYZ A;  4BAY B;  2E5L T;  2D0U A;  2KSR A;  5DL6 A;  4UV9 B;  3N5L A;  3N9O A;  4LF9 T;  2CA5 A;  4JI6 T;  2E9X D;  4J2C A;  4U33 A;  4AYN A;  4LF6 T;  2WJQ A;  3M3Z B;  2NW7 A;  4EYY R;  4JCH A;  1O3X A;  4IE4 A;  4QXH B;  4IL6 O;  3BQI A;  1PHO A;  4YY3 T;  1UUS A;  2X9H A;  4UEL A;  4GCS A;  3QNU A;  2ZMA A;  2PTF A;  3POX A;  5JDN A;  3UUN A;  2V7K A;  4IE7 A;  2MBG A;  3WI3 A;  1IJ6 A;  3PU8 A;  1P4T A;  1JNZ A;  1FMW A;  4O3W A;  3B57 A;  4AKG A;  3WI4 A;  2BG9 E;  3PUS A;  4RLC A;  2EHO A;  1D1A A;  4UV8 B;  3LBX A;  1N34 T;  3NVO A;  5HCM A;  2WP9 A;  3DP7 A;  1EZ3 A;  4IHJ E;  2H3R A;  3HA4 A;  5AQF B;  5L3F B;  3AA0 B;  2KLQ A;  4F8H A;  2X66 A;  2IDO B;  2ODV A;  3LSV A;  3ZYK A;  2W81 C;  4IE6 A;  3ANW A;  1G8X A;  5ABG A;  4ZZB A;  3VKG A;  2Q9Q A;  5L47 A;  2B76 A;  4JI2 T;  2LRK A;  5EE2 A;  4YHH T;  4AYI D;  5AQR B;  2V7J A;  5JDQ A;  5IYU A;  3PJA J;  1WYB A;  4EB6 E;  4QH5 A;  5F8P A;  4ZI3 D;  3T24 A;  3RI5 A;  2XAH B;  2OMF A;  2W80 C;  5JR9 A;  4K3B A;  1HXX A;  3VZW X;  2NP9 A;  5G26 A;  2Q9Q D;  4HWH A;  4CI2 B;  3ZSS A;  2WQY A;  2JRK A;  3FZL B;  4KI0 F;  4CZZ B;  2XQ3 A;  2J4G A;  4M1P A;  2LFU A;  4I0U A;  4AQF C;  2PFV A;  2FJE A;  3OPC A;  1W9R A;  2WWV A;  5J2T E;  3GP6 A;  3K3N A;  4C91 A;  4RLB A;  5LGN B;  4LFB T;  3AB3 B;  3RYI E;  4QHO A;  2CHN A;  4X65 T;  4EIW A;  4JYA T;  2A2F X;  1QJP A;  3EHZ A;  2ODU A;  4ILC A;  2LSJ A;  2L8K A;  2RA1 A;  4TX5 A;  4PW8 A;  1HNZ T;  3ZMU B;  3VE1 A;  3G7G A;  3HI2 A;  4H9P C;  4X5T A;  3ZYL A;  2XHE B;  4A97 A;  1GFP A;  1WR6 A;  3IA3 A;  4GOU A;  2IWV A;  3KV6 A;  4H9S E;  4FJO A;  1YKH B;  1D0Y A;  5LGT B;  2HPL A;  2ERV A;  3A0H O;  4N58 A;  4A56 A;  2LHF A;  5AFU L;  4P0B A;  5AQN B;  2BKO A;  3CX7 B;  4LF4 T;  4D64 A;  1WRD A;  2XQ6 A;  3N9N A;  3TLU A;  5FY0 A;  4XAX B;  4YTM A;  4OYJ A;  3PJA A;  3SYB A;  5PRN A;  4AKM A;  3RKG A;  5FNV E;  3DA3 A;  2Y0K A;  4AYD C;  3CX6 B;  5HWY A;  3P4R A;  2D5U A;  2NR4 A;  4EED A;  1MM5 A;  4QWN B;  4UF0 B;  3PUA A;  3CK6 A;  2BVM A;  4TNW A;  4DR4 T;  2JQY A;  2MHL A;  3O0E A;  5KAI O;  4IT4 A;  5JDG A;  4E7S A;  4Q25 A;  4FOZ A;  2JQK A;  1WFD A;  1B7T A;  1E1H B;  5LYJ E;  2HHH T;  5FVK A;  2BVL A;  5DL7 A;  4U2Y A;  4UVC B;  1LKX A;  4P1N A;  2W00 A;  4LSE A;  5CB4 E;  2M06 A;  3AAE B;  4Z3T A;  5FYM A;  1LVF A;  3AAE A;  4EZH A;  4JFB A;  2XPK A;  2AE9 A;  2LOP A;  3S4U A;  4GCP A;  2ZLY A;  4DV5 T;  3QRC A;  4H9Q C;  2WU2 A;  2VWA A;  4O4I E;  4JI1 T;  3NJT A;  2DWK A;  3UFG A;  1WLX A;  4NIQ A;  4B3S T;  4O3X B;  3JAF A;  3PGR A;  3ZMS B;  3N2K E;  4ILB A;  4B6X A;  2V6Y A;  3UU6 A;  2UUB T;  4ZI2 C;  2YEV C;  1GQE A;  3TLV A;  3ZT6 A;  5AQU B;  3ZPO A;  4CN4 A;  3Q5D A;  5JTG A;  1ORM A;  2YIN A;  2RPA A;  2YU2 A;  3E0Z A;  3JC6 D;  1I94 T;  3HOE A;  1T7S A;  3UUB A;  3POR A;  3A0B O;  3ZT5 A;  2JPF A;  5JR9 B;  2J1N A;  2XAS B;  5CA1 E;  1ZHZ A;  1E2A A;  3HKE E;  4DR3 T;  5E0O A;  4ANJ A;  5KX5 E;  2KWH A;  3DZM A;  1HG5 A;  2OA5 A;  4AKI A;  3F2E A;  4MLK A;  2HH7 A;  2W61 A;  5IWA T;  2QRX A;  4YSY A;  4E1S A;  2R4N A;  7PRN A;  1BT9 A;  4HFV A;  4QXC B;  3CQX C;  2N2M A;  3QB5 K;  2LEH A;  4AI6 A;  1YQ3 A;  3N2O A;  2XAG B;  2Y8D A;  4H9N C;  3RIU C;  1KK7 A;  2PG8 A;  4ZXL A;  5FL0 A;  3AEB A;  3SFD A;  1LVK A;  3VZU X;  4U72 A;  3HW9 A;  3ZC1 A;  3ZYM A;  4X1I E;  4X64 T;  1OED B;  2VB6 A;  3PUR A;  5JR9 C;  5G3A A;  1HTJ F;  4C90 A;  4QKN A;  5G39 A;  3AE7 A;  5ABH A;  3RHW A;  4NXN T;  2CHO A;  4JI3 T;  2X68 A;  4IE0 A;  5IUX A;  5LMU T;  5HXR A;  3CML A;  3ZMZ B;  4UB8 O;  2KXP B;  5L2L A;  2A9U A;  3N9L A;  3NZP A;  3ZCI A;  4IDN A;  2E9X C;  5DQW A;  3Q5E A;  5JRC B;  5LCY A;  1BR2 A;  3TLW A;  3MK7 C;  4ZI3 C;  4HWD A;  3P50 A;  1XNQ T;  2OV9 A;  2XAF B;  3GA8 A;  4HFC A;  3JCU O;  3UUL A;  4EOZ B;  1IJ5 A;  3LK3 B;  5LHH B;  3D0T A;  2IC9 A;  5AQI B;  1Z8U A;  4X62 T;  3ZKR A;  3H37 A;  4XNL A;  3DJB A;  2XSA A;  4ZI7 E;  3GMI A;  2CXF A;  4HFI A;  1MND A;  4DV7 T;  3O1H A;  4F4B A;  3GWH A;  2WDQ A;  4YJ3 E;  2E9X A;  4O4X A;  3B13 A;  4AKR B;  1OPF A;  3POU A;  1D0Z A;  4YT0 A;  4B3R T;  4FUV A;  3SZV A;  3R6N A;  4UVA B;  2YDS A;  2HN2 A;  3MAC A;  3PRN A;  2WU5 A;  8PRN A;  3BK9 A;  4PJJ A;  2VUR A;  1J5E T;  5CA0 E;  3OJA A;  2XJ7 A;  1SE7 A;  3CIR A;  3H3M A;  1IZN B;  2LJL A;  4H63 H;  2X9K A;  4U31 A;  5IYZ E;  5CJ5 A;  3ONJ A;  2DHR A;  4DR2 T;  2DLR A;  5HEG A;  2M6I A;  3RF1 A;  3RYH E;  4O3Z A;  5LG3 A;  3AA7 A;  4WNK A;  2MYS A;  2UU9 T;  3EAM A;  2H7V C;  5LB7 B;  5HXH A;  2H88 A;  5LA6 E;  2C0S A;  3I9W A;  2CMR A;  2K5B B;  2WAU A;  1VRB A;  4OFZ A;  1MIW A;  4PNI A;  2CRB A;  5H6Q B;  3FHN A;  2I59 A;  2XTR A;  4U9C A;  5LJM A;  2R8A A;  2E5V A;  2LSK A;  1NEN A;  2LHN A;  4AXP A;  5F3J A;  5LHI B;  4U3C A;  2JQ9 A;  4TWF A;  5AQM B;  1MIY A;  2ZM0 A;  3KV9 A;  4E1T A;  2WDV A;  3VHL A;  4DID B;  3P4Q A;  4CI1 B;  2ZM6 T;  4JI4 T;  1YW0 A;  2H7O A;  3RRW A;  3HL6 A;  1HS7 A;  2CLY B;  2M6B A;  2FJA A;  2IC6 A;  2CXL A;  3VY8 X;  1MMN A;  2JMH A;  4DV2 T;  4JI8 T;  4EV6 A;  2KXP A;  3AE3 A;  4FQE A;  1WYC A;  1UUR A;  2XAQ B;  1N36 T;  4FRX A;  1UCU A;  4N74 A;  2X0Y A;  5L4E A;  4U7I A;  5ADX K;  3UPG A;  2D9D A;  4GYR A;  4TNV A;  1U4Q A;  4G2A A;  4O49 A;  2X51 A;  4NUV A;  4IL4 A;  2N9D A;  3I1A A;  3L3P A;  2MAW A;  2MTQ A;  5DL8 A;  3RYC E;  3AEC A;  1IBK T;  4X20 E;  2XY8 B;  5LXT E;  4IE5 A;  2V5C A;  5JQG E;  2KMF A;  3A2S X;  5FY7 A;  2JQQ A;  4RJX A;  1ZOY A;  4IDZ A;  2K48 A;  3EAB A;  4LSI A;  3AEE A;  5HXE A;  3NSG A;  2XQ5 A;  4XNK A;  6PRN A;  2XZE A;  1PRN A;  3U3I A;  2YK0 A;  3ZT7 A;  1ZHC A;  2WMO A;  3FXE B;  3QRA A;  2X0L B;  5AQQ B;  5DAB A;  3J9X 1;  4OK0 A;  1W09 A;  2R4P A;  1WR0 A;  1HXU A;  3VRA A;  3CVR A;  3VR8 A;  4QH4 A;  3LK3 A;  3JAE A;  3MXZ A;  2CPT A;  4BJM A;  4MBQ A;  4O2A E;  4V1A v;  3O1I A;  3AA1 A;  3DWN A;  1Y01 A;  4DVD A;  2UXD T;  4U7Y A;  3E08 A;  2XQ8 A;  3RQU A;  2IAK A;  2I0M A;  4DND A;  4YHJ A;  3EVY A;  5AQT B;  3B5M A;  3AA6 B;  4IDP A;  4GKJ T;  3AAA A;  3ZLI A;  2IUB A;  3OVU A;  3H3A A;  1VCT A;  4ILA A;  3PUX F;  4AKL A;  3I0O A;  3AED A;  1KNP A;  2ODJ A;  2N2N A;  2NTY A;  5LGU B;  2NW9 A;  4C69 X;  2XQ4 A;  2IML A;  3QOF A;  2ES0 A;  3NBX X;  4LMJ A;  1THQ A;  3SY9 A;  4YXD A;  3HKC E;  3PDY A;  3PUG A;  2R88 A;  3AA7 B;  3ETV A;  2XQA A;  2LOS A;  3ONX A;  4EZ4 A;  4B3T T;  2W0G A;  1ZHT A;  1XWM A;  2X9Y A;  2E8I A;  2KWI B;  4H63 V;  3DA4 A;  2V1D B;  2C5J A;  2P9B A;  2EHO B;  1DU2 A;  1E7P A;  2K9A A;  5TAO A;  1T98 A;  3O1J A;  3M65 A;  2N1G A;  2UUC T;  4FZN A;  5AQK B;  2PRN A;  4PR7 A;  5L4H A;  2Z6E A;  3RIU A;  1HCI A;  2O4V A;  3KVD D;  4UB6 O;  3UU5 A;  5FXX A;  4L0R A;  1XDO A;  5FXZ A;  1X79 A;  3N9P A;  2Q9Q B;  4XZC A;  5ABF B;  5H2F O;  5JDM A;  4G75 A;  1VCS A;  1HFA A;  2G0U A;  4DBR A;  4DUY T;  4O2B E;  3KVA A;  4HGA A;  3L09 A;  4FZM A;  4TV9 E;  1NWM X;  2CEA A;  4CN6 A;  3T8O A;  2FGR A;  1FMV A;  2W4X A;  5KMG P;  2UXB T;  2BS4 A;  2LE8 A;  4KHZ F;  3UU4 A;  3RC3 A;  3PV0 F;  4C4V B;  4QH1 A;  1S35 A;  2F1T A;  2GK9 A;  3UUX B;  3U78 A;  2F4V T;  5HEU A;  3T20 A;  3MA9 A;  2MPK A;  2K0L A;  1X9B A;  1D0X A;  2VKH A;  4TWH A;  3N2G E;  4TWD A;  2DNX A;  2CCQ A;  4U2Z A;  2QGS A;  1D1C A;  4O4L E;  2X9W A;  3PTR B;  2UXN B;  4FRT A;  3T1H T;  4ZZC A;  4CI3 B;  3RLF F;  1E54 A;  3RBH A;  2Q9Q C;  2V7I A;  5J0Z A;  2WVP A;  1MMG A;  3OBV E;  4HN9 A;  3FZK B;  2IWW A;  3FBL A;  3IBP A;  2WB5 A;  1BH3 A;  4K3C A;  5ETW A;  3KVB A;  2DL1 A;  1N33 T;  4GIW A;  1GFN A;  2POR A;  1M7K A;  3T0S A;  2SPC A;  5FXV A;  4CQI A;  3AAI A;  4RL9 A;  1LRZ A;  4KHP T;  2KT9 A;  4QX7 B;  2XM1 A;  3VE2 A;  1IAP A;  3ETU A;  4K0K T;  5D5D A;  4KMC A;  5F5W A;  1M62 A;  5BR8 T;  1BXW A;  3MZK B;  3RX6 A;  2KZ7 A;  5BMV E;  1ZKE A;  3UU2 A;  3AE6 A;  2V7M A;  3RKO A;  2LKG A;  3AE1 A;  4YFS A;  4YTN A;  1OXZ A;  2V6X A;  2WCA A;  3OKQ A;  1G90 A;  4FI5 A;  3A7M A;  4KX6 A;  2A3D A;  4ISS A;  1S5L O;  2KIN B;  4KR4 A;  3T1Y T;  4AUI A;  4HFB A;  4C00 A;  1NAF A;  4X1K E;  3LBX B;  1OED E;  2J47 A;  2BDE A;  5JDL A;  4I55 E;  5ABE A;  4HE8 A;  1Q9F A;  2YNK A;  2VL8 A;  3DTO A;  1AJ3 A;  2X27 X;  3P4W A;  3PUV F;  2A72 A;  2WMN A;  3K8P C;  2FBW A;  3RPU A;  2XUE A;  4JLE A;  4GCQ A;  2Y0H A;  4RJW A;  4CTD A;  5LBQ B;  1UX5 A;  4TUY E;  2R6G F;  2W67 A;  1OED C;  3PQU A;  3C4W A;  3AEF A;  4PUX A;  1FIO A;  2V5D A;  3KV4 A;  4ZI2 D;  2BS2 A;  3FZM B;  4CXY A;  1MMA A;  2KC0 A;  1ZHW A;  3ZJ1 A;  4HFD A;  4LMK A;  1XNR T;  4PJ0 O;  3RGL A;  5JRE A;  3SFE A;  4YSZ A;  1ZEE A;  3KFW X;  3P4S A;  1MM4 A;  4L5G A;  1YS5 A;  3RH3 A;  5FVL A;  4GHB A;  1T72 A;  3PQS A;  2H89 A;  3ZCJ A;  3ZEF B;  1FJG T;  4NUU A;  3NKZ A;  1T8B A;  5IHY A;  2BG9 B;  2WDR A;  3OTO T;  2BG9 A;  2FJD A;  2WSS V;  5HXC A;  3EMN X;  4DO0 A;  4AFK A;  1BR1 A;  4KP3 C;  2VKD A;  5JDF A;  3F31 A;  2VVN A;  3MJX A;  3VRB A;  4DV6 T;  1Y64 B;  2CE7 A;  4WYV A;  5DJQ C;  2PBI A;  2Y6X A;  3FB2 A;  1YXR A;  1OED A;  4A5X A;  1FEW A;  3GN5 A;  4UVB B;  3UT5 E;  4DV4 T;  2DI4 A;  4FMS A;  2QYW A;  2XTQ A;  2BKP A;  1J1J A;  2AXD S;  1GFO A;  5HEJ A;  2YN6 A;  4H9R C;  2VKO A;  3EDV A;  2NOX A;  3L39 A;  3BQK A;  3VR9 A;  2OLT A;  4ZHQ E;  2E2A A;  5L3G B;  4KBM B;  2JMM A;  2YDQ A;  3PUY F;  4JUY A;  4IST A;  2LT3 A;  4B3M T;  5HEO A;  1YD8 G;  4O4H E;  5J2U E;  2XE2 A;  5ADX L;  3V8U A;  5TIS O;  4ASK A;  2WZI A;  4MFR A;  4TV8 E;  3AE2 A;  3N9M A;  1US7 B;  3K3O A;  4P09 A;  3ZN0 B;  2CXD A;  4PFP A;  4WBN E;  3ESL A;  2WS3 A;  4LSH A;  2W66 A;  2J4U P;  3X1D A;  4Z8X A;  4KUM B;  5HEH A;  3WU2 O;  5AFU K;  2XMX A;  2JJ9 A;  3A8Y C;  2KND A;  2VQE T;  2XTL A;  5AQS B;  4JV5 T;  4AQG A;  3RRC A;  5FP3 A;  2N2L A;  2CWO A;  2IIU A;  4ADZ A;  4MHC A;  3ONL C;  3UQ4 A;  4HWI B;  4NXM T;  2UXX B;  3O4X E;  1MPF A;  3ZJ2 A;  2YDR A;  3ZMT B;  1YKE B;  3Q2M A;  3RIA A;  3JCF A;  2EHO D;  4I4T E;  3PU3 A;  2GE4 A;  3C51 A;  2LM9 A;  3LK2 A;  2WY2 A;  3KV5 A;  3E22 E;  5LHG B;  4ZOL E;  3NZQ A;  2LSI A;  5HCJ A;  3V5S A;  3HKB E;  4DMW A;  5L3C B;  2M67 A;  2F1C X;  1WCR A;  3ANW B;  4EXT A;  1KNR A;  5CFB A;  4COF A;  2CLY C;  3LG7 A;  4HKA A;  3J7Y q;  3ABV A;  2R4O A;  4B61 A;  1T16 A;  4ZS3 A;  4EEB A;  1GFQ A;  3P7I A;  1HG2 A;  4GK5 E;  4OHF A;  5AQL B;  2M07 A;  5CGM A;  2ZFG A;  1IZN A;  4A98 A;  5AQJ B;  3QC9 A;  5JH7 E;  4IDO A;  4LF5 T;  3FBZ A;  5LOV E;  4IL9 A;  4WZX A;  4AIU A;  1Q9G A;  2R4L A;  4HWC A;  3JTY A;  4L9I A;  2FUP A;  2WBL A;  3ZN1 B;  4FT6 A;  2KDY A;  4O8S A;  5LG4 A;  3UU8 A;  3PE0 A;  2HN1 A;  4DV1 T;  5GTI O;  3AE8 A;  1IBL T;  2J62 A;  3RQW A;  1QJ8 A;  2PJQ A;  4UEM A;  5GTH O;  5B5E O;  3HWB A;  1CUN A;  3LFM A;  3HOL A;  2Y0L A;  4KRA A;  3EUH A;  4DR6 T;  5FMN A;  3WAK A;  3KIN B;  3CQG B;  3OYX A;  2BBJ A;  1KFY A;  2DCF A;  3KDS E;  2YU1 A;  2X9X A;  2J1D G;  4UF0 A;  4TZ4 C;  3QK6 A;  2VVS A;  2XG6 A;  1SUM B;  1OWA A;  3K19 A;  1XMQ T;  2YOE A;  2IW5 B;  2VQF T;  2JQH A;  2YKS A;  1D1B A;  4XBF B;  4WW0 A;  2R89 A;  2LLY A;  3RC8 A;  2MNH A;  3NWI A;  3Q5X A;  5HXS A;  2XQ7 A;  1ZP0 A;  4HFH A;  4DV3 T;  4H9O C;  3EI0 A;  2XE5 A;  4PFO A;  4CXW A;  3IEE A;  4E7Z A;  5E79 O;  4WBO A;  4MAL A;  1VOM A;  3V5U A;  2LSG A;  3FZF B;  5LMN T;  1H6S 1;  1OSM A;  4D5U A;  4O3Y A;  5DQV A;  3AEA A;  2UXC T;  3PGS A;  5HAX A;  5AQO B;  2IHR 1;  2BZB A;  4JEH B;  4IIJ E;  3RIF A;  1KNZ A;  3AA1 B;  5L3B B;  4PK6 A;  3RYF E;  3BQL A;  3JC6 C;  3K3Q C;  3AA0 A;  1KEY A;  5JVD E;  4ZEY A;  4HWF A;  5B66 O;  3CPZ A;  5JDP A;  2XQY A;  2XE1 A;  3CWZ B;  2L3L A;  4LFC T;  2VAS A;  4PJM A;  3IHR A;  1CHU A;  5C8Y E;  2CBJ A;  1XDP A;  4AKR A;  5C3J A;  5AQP B;  3R84 B;  3FYX A;  4PAG A;  4AIS A;  3HR0 A;  3AXJ B;  1T1L A;  4OX9 T;  3O9X A;  4D65 A;  1UK5 A;  2NW8 A;  3AXJ A;  4PK5 A;  3FXD B;  1QSD A;  5LBM A;  4HEA A;  3ZC0 A;  3BRZ A;  1R8I A;  3N9Q A;  2MOZ A;  5L3E B;  2VK9 A;  2UUA T;  4U74 A;  5EZY E;  4LFA T;  4JI7 T;  1V9D A;  3AE4 A;  3AVR A;  3SZD A;  4O4J E;  4TN7 B;  3NRX A;  3ZST A;  3C50 A;  1QJ9 A;  4HTE A;  5C2T A;  2X67 A;  3PF1 A;  4DR7 T;  2NWB A;  4EAH A;  1NEK A;  1ZV4 X;  5AQH B;  3ZMV B;  3P4P A;  5T5F A;  1SHZ C;  3HKD E;  4DMV A;  3PGU A;  3VZT X;  5KDM C;  5EK4 A;  4QQ1 A;  2ACZ A;  4EGW A;  1IBM T;  4GK0 E;  4DV0 T;  3QB5 A;  2JMK A;  3TLS A;  2ZM2 A;  4DUZ T;  1MMD A;  2XQ9 A;  4Z90 A;  4JBW F;  1Z0P A;  2ZLD A;  2C5I T;  1U5P A;  4UXN B;  3UQ7 A;  4Z91 A;  2W62 A;  3PUW F;  4AQF A;  4N59 A;  3WI5 A;  1XMO T;  2FJB A;  1HXT A;  2BG9 C;  4GF4 A;  1J5W A;  2DWG A;  2CBI A;  3SOL A;  1L0V A;  1HF8 A;  3KBT A;  2BKN A;  4I43 B;  3AVS A;  3BS0 A;  4FSO A;  3I0Q A;  4AQY T;  5LP6 E;  3POQ A;  4C4V A;  2K24 A;  2BS3 A;  2NTX A;  3TZG A;  4ERR A;  3A5X A;  2D0T A;  4EYU A;  3C5O A;  3KBU A;  3TLT A;  3C98 B;  5A1L A;  2XSB A;  5HYA A;  4QXB B;  3LJC A;  3EDU A;  4AZL A;  4LF8 T;  3LDQ B;  2Y2X A;  4JI5 T;  2LSY A;  5FKY A;  4QX8 B;  2LKH A;  3AE5 A;  3L8R A;  5FL1 A;  2AXT O;  4F6R C;  2VL0 A;  2CM0 A;  3WAJ A;  5G38 A;  4LSF A;  4BA9 A;  5AQG B;  3LK4 1;  4IRE A;  3KZI O;  3SY7 A;  3SRZ A;  3F57 A;  4YTP A;  5J1G A;  3JAD A;  4PJL A;  3TKL B;  2WM9 A;  1I6Z A;  1QUU A;  3UFE A;  5KXJ A;  5JRC A;  3Q9D A;  4N78 D;  1UX4 A;  2XM2 A;  2XE3 A;  4DBQ A;  3VY9 X;  4PK4 A;  2LRL A;  4GYS A;  1S94 A;  4IGU A;  2LHR A;  1UGO A;  2CWY A;  2W63 A;  1ZHY A;  1ZHX A;  4O4U A;  5EK2 A;  3C4X A;  2F1V A;  5M4Y A;  2KZ7 B;  2EHO C;  1HR0 T;  3AAA B;  2LM2 A;  5LNK A;  4CN1 A;  4G63 A;  5LJN A;  3AA6 A;  4YJ2 E;  3PUQ A;  4JI0 T;  3DWO X;  4YLH A;  3AE9 A;  3CKD A;  3VKH A;  4AYE C;  1MNE A;  2X0H A;  4BUM X;  3UAQ A;  1GFM A;  2VKJ A;  3CX8 B;  4PJN A;  4AKH A;  2JIW A;  4IDQ A;  3SWH A;  1BR4 A;  4DR5 T;  2V8S V;  2B1E A;  5AQV B;  3UU3 A;  3MKD A;  1XZY A;  3PUZ F;  5L3D B;  4FSP A;  4KR8 A;  1W0A A;  4LML A;  5DL5 A;  2I6H A;  2Y48 B;  4HFE A;  4P0A A;  4NPP A;  1KF6 A;  2RP4 A;  5GON E;  1G73 A;  3C4Z A;  2FGQ X;  3P8C D;  5EK3 A;  1H7C A;  3I9Y A;  2WZH A;  2QTK A;  5FVN A;  1MIV A;  3LK2 B;  4BJN A;  4FZL A;  5HWX A;  4LF7 T;  3SYS A;  2V6Y B;  1HX8 A;  1YQ4 A;  4YSX A;  4GKK T;  3AEG A;  1W0B A;  4ZS2 A;  1HX1 B;  2WJR A;  5ABF A; 
#chains in the Genus database with same CATH homology
 2ZM8 A;  4L0R A;  4FES A;  5FXZ A;  1X79 A;  4OYK A;  4AKI A;  3N9P A;  5LG4 A;  3F2E A;  2Q9Q B;  4MLK A;  4XZC A;  2L9Q A;  2HH7 A;  5JDM A;  3PE0 A;  2ACX A;  2W61 A;  4G75 A;  5FXW A;  2K4T A;  1HFA A;  2G0U A;  2WWU A;  4DBR A;  1QJ8 A;  3UUM A;  4O2B E;  4G76 A;  4E1S A;  2C5K T;  3KVA A;  4HGA A;  2PJQ A;  3L09 A;  4UEM A;  3SS1 A;  4FZM A;  7PRN A;  4TV9 E;  1BT9 A;  3HWB A;  1CUN A;  4HFV A;  1NWM X;  3LFM A;  2CEA A;  2Y0L A;  2HPJ A;  4QXC B;  2YNK A;  3EUH A;  3CQX C;  2N2M A;  3HOL A;  5FMN A;  3T8O A;  3WAK A;  2FGR A;  3KIN B;  3QUJ A;  1BR0 A;  2LEH A;  3CQG B;  1FMV A;  3OYX A;  4AI6 A;  2YPV A;  5FY1 A;  2DCF A;  3KDS E;  2YU1 A;  4I50 E;  2X9X A;  3UTK A;  4AKR A;  3N2O A;  2XAG B;  2Y8D A;  3VU7 H;  5KMG P;  2J1D G;  4H9N C;  2LE8 A;  1KK7 A;  3C64 A;  2PG8 A;  4UF0 A;  5JDH A;  3IF8 B;  3RC3 A;  3GN5 B;  1S35 A;  4ILU A;  4TZ4 C;  3QK6 A;  1LVK A;  2F1T A;  3VZU X;  2XG6 A;  2GK9 A;  4U72 A;  2V7L A;  3UUX B;  3HW9 A;  3U78 A;  2KDY A;  3ZC1 A;  1OWA A;  3ZYM A;  4X1I E;  3T20 A;  3MA9 A;  3K19 A;  3PUR A;  2VB6 A;  5JR9 C;  2K0L A;  1HTJ F;  2IW5 B;  3LK4 2;  4C90 A;  1D0X A;  2VKH A;  4QKN A;  4CXX A;  3N2G E;  1D1B A;  2Y7S A;  4XBF B;  3CQC B;  3NRY A;  4WW0 A;  3Q5W A;  2DNX A;  2X68 A;  2CCQ A;  4IE0 A;  2QGS A;  1D1C A;  4O4L E;  3RC8 A;  1SA0 E;  5GV0 A;  2V26 A;  2X9W A;  5HXR A;  5H6R B;  3CML A;  2MNH A;  3Q5X A;  5HXS A;  3PTR B;  3ZMZ B;  4UIG A;  2UXN B;  4FRT A;  2D2S A;  2KXP B;  4X1Y E;  5L2L A;  4H9O C;  4CI3 B;  4JEU B;  3N9L A;  1E54 A;  3NZP A;  3ZCI A;  2Q9Q C;  3RBH A;  2E9X B;  2XE5 A;  4PFO A;  2V7I A;  4CXW A;  2E9X C;  1MMG A;  5DQW A;  3OBV E;  4HN9 A;  5JRC B;  2XAJ B;  3FBL A;  3IBP A;  4K0U A;  5LCY A;  1BH3 A;  3IEE A;  1BR2 A;  4E7Z A;  4WBO A;  4MAL A;  1VOM A;  5ETW A;  3W15 B;  3KVB A;  3V5U A;  4AYM C;  2QA7 A;  2LSG A;  3MK7 C;  4ZI3 C;  1GFN A;  4GIW A;  3OYZ A;  2XAF B;  3GA8 A;  4BAY B;  2D0U A;  1H6S 1;  3UUL A;  4EOZ B;  1OSM A;  2POR A;  4UV9 B;  5DL6 A;  4D5U A;  3N5L A;  3N9O A;  1IJ5 A;  2CA5 A;  4O3Y A;  3LK3 B;  5DQV A;  5LHH B;  3T0S A;  3D0T A;  2IC9 A;  2E9X D;  4J2C A;  4AYN A;  2SPC A;  5HAX A;  3H37 A;  2BZB A;  4JEH B;  5FXV A;  4IIJ E;  4CQI A;  4XNL A;  3DJB A;  1KNZ A;  3AA1 B;  5L3B B;  2NW7 A;  4EYY R;  4PK6 A;  4ZI7 E;  4JCH A;  3AAI A;  4RL9 A;  3RYF E;  3GMI A;  3BQL A;  1LRZ A;  3JC6 C;  1O3X A;  4IE4 A;  2CXF A;  4QXH B;  2KT9 A;  3K3Q C;  4QX7 B;  3AA0 A;  1MND A;  5JVD E;  3BQI A;  1PHO A;  3O1H A;  3CPZ A;  4F4B A;  5JDP A;  3GWH A;  2X9H A;  4YJ3 E;  2E9X A;  4UEL A;  4O4X A;  2XQY A;  3VE2 A;  4GCS A;  1IAP A;  3B13 A;  2XE1 A;  3ETU A;  4AKR B;  2ZMA A;  3CWZ B;  2L3L A;  3POX A;  5D5D A;  1OPF A;  4KMC A;  5JDN A;  2VAS A;  4PJM A;  2V7K A;  3IHR A;  4IE7 A;  2MBG A;  3UUN A;  5C8Y E;  1BXW A;  3MZK B;  3POU A;  1D0Z A;  3RX6 A;  3WI3 A;  2KZ7 A;  3FYX A;  4KRA A;  3R84 B;  4FUV A;  3SZV A;  1IJ6 A;  4PAG A;  3R6N A;  3PU8 A;  4UVA B;  5BMV E;  1P4T A;  1ZKE A;  3HR0 A;  3MAC A;  3UU2 A;  2V7M A;  3O9X A;  4D65 A;  1FMW A;  3RKO A;  4YFS A;  3PRN A;  4O3W A;  2NW8 A;  8PRN A;  3B57 A;  3BK9 A;  4AKG A;  4PJJ A;  3PUS A;  4PK5 A;  1OXZ A;  3WI4 A;  3FXD B;  1QSD A;  5CA0 E;  2EHO A;  3OJA A;  5LBM A;  4RLC A;  4HEA A;  3ZC0 A;  3OKQ A;  1G90 A;  4FI5 A;  1IZN B;  1D1A A;  2LJL A;  4UV8 B;  3LBX A;  4H63 H;  3N9Q A;  2A3D A;  5IYZ E;  4ISS A;  2KIN B;  2MOZ A;  3DP7 A;  5L3E B;  2VK9 A;  4KR4 A;  2DHR A;  4AUI A;  1EZ3 A;  1NAF A;  3LBX B;  4IHJ E;  4U74 A;  4X1K E;  2BDE A;  5EZY E;  4I55 E;  2H3R A;  2DLR A;  3HA4 A;  5JDL A;  5L3F B;  4HE8 A;  1Q9F A;  3AA0 B;  1V9D A;  2KLQ A;  2X66 A;  2ODV A;  3RYH E;  2VL8 A;  3DTO A;  3AVR A;  4IE6 A;  3ZYK A;  1AJ3 A;  2W81 C;  3ANW A;  4O4J E;  2X27 X;  4TN7 B;  4O3Z A;  3SZD A;  1G8X A;  3AA7 A;  4WNK A;  3VKG A;  2MYS A;  3NRX A;  2A72 A;  2WMN A;  3K8P C;  3RPU A;  2XUE A;  4JLE A;  4GCQ A;  3C50 A;  2H7V C;  1QJ9 A;  2Y0H A;  2Q9Q A;  4HTE A;  4RJW A;  2X67 A;  5LBQ B;  1UX5 A;  4TUY E;  5LA6 E;  5HXH A;  5EE2 A;  2NWB A;  3PQU A;  2C0S A;  3C4W A;  3I9W A;  4EAH A;  2CMR A;  1ZV4 X;  2K5B B;  4PUX A;  4AYI D;  2WAU A;  1FIO A;  3ZMV B;  1VRB A;  2V7J A;  1SHZ C;  5JDQ A;  5T5F A;  3KV4 A;  3HKD E;  4OFZ A;  4DMV A;  1MIW A;  4PNI A;  3VZT X;  5IYU A;  4ZI2 D;  5KDM C;  1WYB A;  5EK4 A;  4QQ1 A;  5H6Q B;  5F8P A;  3FHN A;  4EB6 E;  4ZI3 D;  3T24 A;  2I59 A;  2XAH B;  4CXY A;  2OMF A;  2W80 C;  2XTR A;  5JR9 A;  1MMA A;  2KC0 A;  4U9C A;  1ZHW A;  5LJM A;  3ZJ1 A;  4GK0 E;  1HXX A;  2LSK A;  5JRE A;  3VZW X;  2JMK A;  2NP9 A;  5G26 A;  2ZM2 A;  1ZEE A;  2Q9Q D;  1MMD A;  4CI2 B;  3KFW X;  1MM4 A;  2LHN A;  4L5G A;  4AXP A;  5F3J A;  2JRK A;  4CZZ B;  1YS5 A;  3RH3 A;  5LHI B;  1Z0P A;  4GHB A;  2ZLD A;  2C5I T;  4M1P A;  2LFU A;  1MIY A;  1U5P A;  2ZM0 A;  4UXN B;  3PQS A;  3KV9 A;  4E1T A;  4AQF C;  3VHL A;  2PFV A;  3ZCJ A;  3ZEF B;  4NUU A;  4CI1 B;  2W62 A;  5IHY A;  4AQF A;  4N59 A;  5J2T E;  3GP6 A;  3WI5 A;  3K3N A;  4C91 A;  1YW0 A;  2H7O A;  3RRW A;  1HXT A;  4RLB A;  5LGN B;  3HL6 A;  1HS7 A;  2CLY B;  3AB3 B;  3RYI E;  4GF4 A;  4QHO A;  2IC6 A;  2CXL A;  3VY8 X;  2DWG A;  1MMN A;  2WSS V;  2JMH A;  5HXC A;  3SOL A;  3EMN X;  4DO0 A;  4AFK A;  1BR1 A;  1HF8 A;  3KBT A;  4EIW A;  4I43 B;  2A2F X;  2KXP A;  4KP3 C;  1QJP A;  2VKD A;  1WYC A;  2ODU A;  3AVS A;  2LSJ A;  5JDF A;  2XAQ B;  4FSO A;  3F31 A;  3I0Q A;  4FRX A;  1UCU A;  5LP6 E;  3POQ A;  3MJX A;  2L8K A;  2K24 A;  2RA1 A;  4TX5 A;  4PW8 A;  2NTX A;  3ZMU B;  3TZG A;  3VE1 A;  3G7G A;  4ERR A;  1Y64 B;  3HI2 A;  2CE7 A;  5ADX K;  3UPG A;  5DJQ C;  4GYR A;  2PBI A;  1U4Q A;  2Y6X A;  4G2A A;  3A5X A;  4H9P C;  2D0T A;  4O49 A;  3FB2 A;  3ZYL A;  2XHE B;  4EYU A;  3C5O A;  2X51 A;  3KBU A;  1WR6 A;  1GFP A;  4NUV A;  3C98 B;  1FEW A;  3GN5 A;  4UVB B;  3UT5 E;  2DI4 A;  4GOU A;  5A1L A;  5HYA A;  3KV6 A;  4QXB B;  4H9S E;  4FJO A;  4FMS A;  2N9D A;  2XTQ A;  1YKH B;  3LJC A;  1D0Y A;  3EDU A;  3I1A A;  3L3P A;  5LGT B;  1GFO A;  2MTQ A;  2HPL A;  4H9R C;  4AZL A;  2VKO A;  2ERV A;  2Y2X A;  4N58 A;  2LSY A;  3EDV A;  5DL8 A;  2NOX A;  3RYC E;  4A56 A;  2LHF A;  4P0B A;  4X20 E;  5AFU L;  4QX8 B;  5LXT E;  3BQK A;  3CX7 B;  4IE5 A;  4D64 A;  5JQG E;  2KMF A;  3A2S X;  5FY7 A;  1WRD A;  2JQQ A;  3N9N A;  4ZHQ E;  4F6R C;  4RJX A;  5FY0 A;  2CM0 A;  4IDZ A;  4XAX B;  3WAJ A;  4OYJ A;  2K48 A;  4KBM B;  5L3G B;  4LSI A;  4BA9 A;  4LSF A;  3SYB A;  2JMM A;  5PRN A;  3NSG A;  5HXE A;  3LK4 1;  4AKM A;  4JUY A;  4XNK A;  4IST A;  5FNV E;  6PRN A;  3DA3 A;  2LT3 A;  2Y0K A;  3SY7 A;  3SRZ A;  3F57 A;  4AYD C;  3CX6 B;  5HWY A;  5J1G A;  1YD8 G;  4PJL A;  3TKL B;  2D5U A;  4O4H E;  2WM9 A;  1PRN A;  1MM5 A;  1QUU A;  3U3I A;  3UFE A;  5J2U E;  2XE2 A;  4QWN B;  2YK0 A;  4UF0 B;  1ZHC A;  2WMO A;  3PUA A;  5JRC A;  3FXE B;  3Q9D A;  4N78 D;  2BVM A;  3QRA A;  5ADX L;  2X0L B;  1UX4 A;  3V8U A;  4ASK A;  2XE3 A;  5DAB A;  4DBQ A;  4MFR A;  4TV8 E;  3N9M A;  3VY9 X;  1US7 B;  3K3O A;  4P09 A;  4OK0 A;  3J9X 1;  2CXD A;  3ZN0 B;  2MHL A;  4PFP A;  4WBN E;  3O0E A;  3ESL A;  4PK4 A;  5JDG A;  1HXU A;  4E7S A;  3CVR A;  4FOZ A;  4GYS A;  3LK3 A;  1B7T A;  4LSH A;  1S94 A;  1E1H B;  3MXZ A;  4IGU A;  5LYJ E;  2J4U P;  4Z8X A;  4KUM B;  4BJM A;  4MBQ A;  4O2A E;  2LHR A;  2BVL A;  4V1A v;  2CWY A;  3O1I A;  5AFU K;  5DL7 A;  2W63 A;  4UVC B;  1ZHY A;  2JJ9 A;  2XMX A;  2KND A;  1LKX A;  3AA1 A;  1ZHX A;  4DVD A;  2W00 A;  4LSE A;  4O4U A;  5CB4 E;  2XTL A;  2M06 A;  5EK2 A;  3C4X A;  3AAE B;  4Z3T A;  5FYM A;  1LVF A;  2F1V A;  4AQG A;  3E08 A;  3RRC A;  5FP3 A;  2N2L A;  2CWO A;  5M4Y A;  4ADZ A;  2IAK A;  2KZ7 B;  4MHC A;  3AAE A;  4DND A;  2EHO C;  4EZH A;  3AAA B;  4JFB A;  4YHJ A;  3EVY A;  3AA6 B;  3AAA A;  5LNK A;  2LOP A;  4G63 A;  5LJN A;  3S4U A;  2UXX B;  3AA6 A;  4GCP A;  2ZLY A;  3PUQ A;  3ZLI A;  4YJ2 E;  3O4X E;  1MPF A;  3QRC A;  3H3A A;  3ZJ2 A;  4YLH A;  3ZMT B;  3CKD A;  4H9Q C;  3VKH A;  4AKL A;  3I0O A;  2ODJ A;  2VWA A;  1YKE B;  2N2N A;  4O4I E;  3Q2M A;  2NTY A;  1MNE A;  4AYE C;  5LGU B;  2DWK A;  2EHO D;  2NW9 A;  4C69 X;  4I4T E;  4BUM X;  3PU3 A;  2GE4 A;  1GFM A;  3UAQ A;  1WLX A;  3C51 A;  2VKJ A;  2LM9 A;  3LK2 A;  4O3X B;  3KV5 A;  3CX8 B;  3ZMS B;  3N2K E;  3E22 E;  4PJN A;  4B6X A;  2ES0 A;  4AKH A;  3NBX X;  5LHG B;  4ZOL E;  3NZQ A;  2LSI A;  3SWH A;  1THQ A;  3SY9 A;  1BR4 A;  3V5S A;  3HKB E;  4DMW A;  4ZI2 C;  2YEV C;  2B1E A;  3HKC E;  2M67 A;  5L3C B;  3PDY A;  3PUG A;  3ANW B;  3MKD A;  3AA7 B;  3ETV A;  4EXT A;  5L3D B;  2CLY C;  2LOS A;  3LG7 A;  3ONX A;  4FSP A;  4KR8 A;  3ZPO A;  4HKA A;  4EZ4 A;  3J7Y q;  5DL5 A;  2W0G A;  1ZHT A;  2Y48 B;  4B61 A;  2X9Y A;  4ZS3 A;  2E8I A;  2KWI B;  1ORM A;  4H63 V;  3DA4 A;  4P0A A;  2YIN A;  1GFQ A;  2RP4 A;  2YU2 A;  3P7I A;  5GON E;  2V1D B;  1HG2 A;  2C5J A;  1G73 A;  3C4Z A;  2P9B A;  4GK5 E;  3E0Z A;  4OHF A;  2M07 A;  2EHO B;  2FGQ X;  3JC6 D;  3P8C D;  5EK3 A;  1H7C A;  2ZFG A;  3HOE A;  1IZN A;  3I9Y A;  2QTK A;  2K9A A;  3POR A;  2JPF A;  5FVN A;  5TAO A;  1T98 A;  5JR9 B;  3QC9 A;  2J1N A;  5JH7 E;  2XAS B;  1MIV A;  3LK2 B;  3O1J A;  4BJN A;  5CA1 E;  3M65 A;  5HWX A;  1ZHZ A;  4FZL A;  2N1G A;  3HKE E;  3FBZ A;  3SYS A;  4FZN A;  5E0O A;  5LOV E;  1Q9G A;  2PRN A;  1HX8 A;  4ANJ A;  2Z6E A;  3JTY A;  1HCI A;  4L9I A;  2O4V A;  3KVD D;  2WBL A;  5KX5 E;  4ZS2 A;  2KWH A;  3ZN1 B;  4FT6 A;  1HG5 A;  5FXX A;  2OA5 A;  4O8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...