3LK2B

Crystal structure of capz bound to the uncapping motif from carmil
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
242
structure length
242
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-1
publication title Structural characterization of a capping protein interaction motif defines a family of actin filament regulators
doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 79
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lk2B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3lk2B02
5AFUL 1IZNA 3AA6A 2KZ7B 2KXPB 3AA0A 3LK2A 3AA1A 4AKRA 3AA7B 5ADXK 3AAAB 3LK42 2KZ7A 2KXPA 3LK3B 3AAEB 5AFUK 3LK2B 1IZNB 3AA6B 3AA0B 3AA7A 3AA1B 3AAAA 5ADXL 3LK3A 4AKRB 3LK41 3AAEA
chains in the Genus database with same CATH superfamily
4H9RC 4X1KE 1H6S1 4MFRA 2VQET 1PRNA 1E7PA 2JQ9A 5L47A 4P0BA 2I59A 1SUMB 3UU5A 4EV6A 4DR1T 1KFYA 3ONJA 4AYDC 3ZLIA 4CN1A 5ABFA 3AA6B 4UVBB 2E2AA 2NP9A 4GCPA 2QRXA 2R8AA 3G06A 2Y7SA 2OLTA 4TN7B 5E79O 3H37A 4DBQA 2W81C 1G73A 4C90A 3FZHB 1M7KA 1NEKA 5IHYA 3SRZA 5FMNA 2LM9A 1G8XA 2E9XD 3AA1B 2W80C 5AQKB 1T16A 2MBGA 4DV5T 4FT6A 4GHBA 2ES0A 5LP6E 4HEAA 4PK6A 1YW0A 4DV2T 2V6YB 1QJ9A 3MZKB 1MMNA 4IDPA 5JTGA 2V7MA 2I6HA 1XNQT 2CE7A 3DA3A 5TISO 4LMKA 4X65T 3TLWA 4F4BA 3ZC1A 3RHWA 4DUZT 4BA9A 1H7CA 4ILBA 4CI1B 4PK5A 4QQ1A 5KAIO 3SZDA 1GQEA 8PRNA 3HW9A 3HOEA 4ILCA 2LLYA 2WAUA 2CM0A 4KI0F 3VRBA 2XE3A 4YJ3E 5LMUT 3SYBA 5LBQB 4FQEA 2D9DA 3AEBA 3WAKA 4QKNA 1VOMA 1LKXA 2WDRA 4YFSA 3WI4A 4PUXA 2UUCT 1KNPA 2QVAA 5LGNB 4UEMA 3UQ4A 4O4IE 1U5PA 5HXHA 5LHGB 2WP9A 4N75A 3ETVA 4X1IE 2KDYA 1UUSA 2A3DA 2BS3A 1U4QA 1J5ET 2HN1A 2J47A 4ZZBA 3P4SA 2XHEB 3I9WA 4N59A 2PJQA 3UUMA 2B1EA 3LK3A 5HXSA 5HEOA 2LJLA 3UT5E 3RRCA 3BRZA 4DO0A 3SFDA 4EYYR 4DR5T 2HPJA 5JR9A 1E2AA 2DLRA 5CB4E 7PRNA 3PRNA 1HTJF 2K0LA 2UXDT 4NUUA 5ABFB 2VB6A 3RF1A 3WI5A 3AVRA 4HN9A 5CFBA 3RIAA 3HL6A 3ZSSA 1XMOT 4ASKA 2UUAT 4BJMA 5AFUL 3UU6A 2E8IA 1Z8UA 4YTMA 3T20A 3AE5A 4A98A 2XM1A 2DWGA 2WJRA 2HN2A 2XTLA 2AE9A 1ZKEA 2EHOB 3N9QA 4H63V 5GTIO 3V8UA 3CQXC 5JDGA 5L3CB 3PUXF 2Y0LA 3GMIA 5A1LA 1J1JA 2ODVA 3CMLA 4O3WA 2X0LB 4TWFA 4U2YA 3HKEE 1D0XA 4V1Av 1ZOYA 2XY8B 1B7TA 4JLEA 2XQ7A 4AI6A 3IF8B 4BUMX 2BZBA 2M07A 3O0EA 5JH7E 3I9YA 3NZPA 4LMJA 3KZIO 4O3XB 4X5TA 2R88A 1VCTA 3NBXX 4J2CA 3ZJ2A 5LJNA 5C8YE 2XJ7A 3KV5A 2NW7A 4NXMT 3AAAA 4JI3T 3TZGA 2IWVA 3C98B 3ZYMA 4PW8A 3IHRA 5LBMA 4AISA 2N2NA 3CIRA 3LFMA 2R4PA 3KVDD 3VU7H 3PGRA 3BRYA 1FMWA 3WAJA 2OMFA 5LJMA 4Q25A 2BBJA 4UR9A 3UU8A 4XNLA 4LF4T 4AYEC 4Z8XA 2BKOA 3KVAA 3ZN0B 1HNWT 4RLCA 5CGMA 2F1VA 2MTQA 3LK3B 2J4UP 4N74A 4N58A 2M6BA 3UULA 3T8OA 5JR9B 3GA8A 5ADXL 4JBWF 3K8PC 4D5UA 2V8SV 5FVNA 2CLYB 5T5FA 2AXTO 3ZJ1A 2ACXA 2RA1A 3GN5A 2PTFA 3P7IA 3HI2A 2ZM0A 2XE2A 4G63A 2HH7A 2L9QA 3A5XA 1VRBA 5LHHB 4KHPT 3RYFE 2E5VA 3F31A 3H3AA 3AE3A 4JCHA 4KR4A 3EABA 1BR0A 2KWIB 3K3OA 3ZC0A 1GFPA 3N2GE 3QB5K 5AQHB 3MA9A 3L39A 3RLFF 5AQFB 1YS5A 5AQIB 3BK9A 3OYZA 1ORMA 5ETWA 2KXPA 3UQ7A 2WU2A 5EZYE 3B13A 5H6QB 4I43B 5M4YA 4U7IA 1VCSA 4U33A 1WYCA 2J1NA 1MM5A 4LF5T 3OVUA 4P1NA 3PUYF 1YD8G 3NWIA 2YOEA 3ZCIA 2CHOA 4XBFB 5DQVA 3PUGA 2D0UA 5FXVA 3WU2O 3FB2A 4ZI7E 3ZN1B 1KEYA 3JAEA 2WM9A 3PUSA 2L8KA 3BS0A 3SOLA 5H6RB 5JDPA 2ACZA 2Y0HA 4GKKT 4O2BE 2V7IA 4ZOLE 3JCFA 1SHZC 3SZVA 3AEAA 3AAAB 2JRKA 5ABEA 3JTYA 3IA3A 3PTRB 2W4XA 5J2UE 3CWZB 3KBTA 3J9X1 3HKBE 2UXCT 1HX8A 4O49A 3RQWA 1KNZA 1UK5A 4C91A 1QUUA 5LXTE 2X9YA 3KFWX 1UURA 3AEFA 4FSPA 1CUNA 5DL8A 2FGQX 3CKDA 1D1AA 1FJGT 1IJ6A 2NTYA 4P0AA 2YINA 1R8IA 4UXNB 2WB5A 3AA1A 2J4GA 4AKRA 4ZI3C 3ZMTB 2XQ6A 4XNKA 3Q5EA 4Z91A 4UF0B 5LMNT 2R4LA 5B5EO 3PDYA 4LSHA 4K3CA 3A8YC 5DL7A 4CQIA 3GN5B 3AVSA 3C51A 2V1DB 3JC6C 3OYXA 2CWYA 2V5CA 1N33T 4HFBA 3C4ZA 4A5XA 2KC0A 2QTKA 2Y2XA 1MNDA 3SWHA 2KNDA 4CZZB 4EAHA 5AQOB 3QC9A 2ZM6T 4OX9T 2ODJA 4PK4A 2KXPB 2ZMAA 2WU5A 2CMRA 4XAXB 5LHIB 4JI2T 3B5MA 5L3BB 2VL0A 4PJMA 1BH3A 3UAQA 1GFQA 4IE5A 1I6ZA 2QA7A 3RKGA 5B66O 2X51A 3LJCA 3CX8B 1ZHCA 2C0SA 2N9DA 4TNVA 4NUVA 2NOXA 1XDOA 2XZEA 4HWHA 2R6GF 5FXWA 3KV4A 3N2KE 3P8CD 5AQMB 2CHNA 4OK0A 2MYSA 5J1GA 4DR3T 2IC9A 2WZHA 2XAJB 2Y0KA 3IEEA 4IL4A 2BG9E 5JQGE 2MAWA 1MPFA 2VKDA 4U2ZA 4HWFA 3EI0A 4EYUA 3MK7C 3EHZA 4KMCA 2WWVA 5LNKA 1OSMA 2X66A 3DWOX 5DQWA 2VL8A 2KWHA 4UVCB 5LG3A 3F2EA 2Q9QA 4DV0T 3K3QC 4PJLA 2V26A 3CK6A 3EUHA 4JEUB 2XQ5A 4QX7B 5TAOA 2LM2A 3FZMB 4OHFA 3PUQA 3DTOA 4L0RA 4AKRB 3HWBA 1WR6A 3N9PA 5L3DB 3KBUA 5DABA 3SY9A 2LKHA 2V7KA 1MIWA 2EHOA 3CPZA 2QYWA 1CHUA 2KLQA 3RYCE 4AQFA 1SA0E 1ZV4X 2IAKA 4HFDA 4H9QC 2VWAA 2KSRA 3KV6A 4AZLA 3ZYKA 1NENA 3HKDE 2PORA 4DV7T 3ZKRA 3N9NA 4PR7A 1BT9A 2IMLA 1OEDE 1NWMX 2L3LA 2OA5A 2W66A 1XDPA 2XASB 1XWMA 4QHOA 3S4UA 4DR7T 3N5LA 3P4QA 2K9AA 4AYID 4P09A 4YTPA 4OYJA 4E7SA 5EK3A 3MJXA 3PUVF 5J2TE 4PNIA 3U78A 2V7LA 2CPTA 4DBRA 3CQGB 2W63A 3LSVA 4YSYA 5F8PA 2IHR1 3C4WA 2NTXA 3PUWF 3KV9A 2CBIA 4HWCA 4QH4A 5L2LA 1E1HB 2YDRA 4A56A 3TLVA 4IE4A 2XQ9A 2JQKA 3P4PA 3KVBA 4EEBA 2WBLA 3UU3A 5AQLB 2ZLDA 4LSEA 3EVYA 4U9CA 2YDSA 3P4RA 3RYHE 4O4XA 4G2AA 4GYSA 4AXPA 3R6NA 2LFUA 3ZSTA 5FXXA 2V5DA 2XUEA 1WYBA 2EHOC 1HS7A 4ZI3D 1WR0A 5CA1E 4AQFC 5JRCA 3RC8A 1BR2A 4O2AE 4FI5A 2VKJA 2CCQA 2Q9QB 4U72A 4EIWA 2C5KT 4GKJT 3JC6D 4DVDA 3K19A 3L8RA 1JNRA 5KXJA 1JNZA 4IL9A 4HWIB 5LYJE 2DWKA 2FJEA 1WRDA 4IE7A 2N2LA 4WW0A 5EE2A 3RI5A 4ADZA 4N78D 5JDNA 4PFOA 4IDQA 2YKSA 3M65A 1D1CA 2LKGA 3DJBA 5L3EB 3RC3A 3QNUA 2H7VC 4DR2T 1GFMA 2HHHT 4I50E 1QJ8A 5KDMC 4DMWA 2LHFA 2R89A 4CI3B 4EEDA 1N36T 3RPUA 4CI2B 1BR1A 2XPKA 2LSGA 2DHRA 4B3ST 3AXJB 1QLBA 4WBNE 3LK41 3VZTX 2X9WA 5IWAT 4QXHB 2BKPA 4I4TE 2XQ3A 3ABVA 4KR8A 2BVLA 3K3NA 2Y6XA 2CWOA 4AIUA 2WZIA 3QRCA 2IDOB 5FKYA 1D0ZA 1OPFA 3ZMVB 2MNHA 1UCUA 4O4LE 5DJQC 2YNKA 3TLSA 3QK6A 5EK4A 4KP3C 2J62A 3UU2A 3I0OA 3O1IA 3FBZA 1WLXA 4NPPA 3O1JA 2JMKA 2K3WA 2JJ9A 2E9XA 5JR9C 2M6IA 5L3FB 5HCJA 4UVAB 2KMFA 3P4WA 2CLYC 3AE8A 1Q9FA 3H3MA 2ODUA 5FXZA 3CVRA 4A97A 1AJ3A 3VKHA 2N2MA 4D65A 3B57A 2JQHA 3E22E 5LGTB 2BG9A 4UB8O 2DI4A 4PAGA 5AQNB 1V9DA 3POUA 4UIGA 3HA4A 2XQ4A 3DZMA 3WI3A 3PQUA 2IIUA 3K1SA 3SS1A 1IJ5A 4YXDA 1MM4A 2WMNA 1IAPA 4C69X 4IE6A 3RIFA 2J1DG 5LGUB 4GCQA 5KMGP 5JDFA 4UF0A 2H89A 5JRCB 1LVKA 2UUBT 4MBQA 3E0ZA 1KF6A 2WDVA 4JI6T 4ZXLA 3AA0A 4YSXA 3NKZA 2PBIA 3FHNA 5AQTB 4AYNA 3LK42 1HNXT 3RIUA 4KRAA 5ABHA 3HOLA 3MACA 4I55E 4GCSA 5AQUB 3AAEA 5ABGA 2VASA 3JCUO 4TWDA 5HWXA 2X0HA 4HFCA 2XAHB 4IDNA 4G75A 4AFKA 4AYMC 4LF9T 3RQUA 4JI5T 3ESLA 2A2FX 4Z3TA 3AEGA 3QOFA 5JVDE 1XNRT 3VZWX 4QXCB 2SPCA 1E54A 1OEDA 3TLUA 4H9OC 3FZLB 2LSJA 3PQSA 3VE1A 2ZM8A 3PU3A 4YSZA 1QJPA 2W61A 3NRYA 3Q5DA 2W00A 4UELA 4CXWA 3QUJA 5BR8T 2WY2A 2NW9A 2HPLA 4IDOA 4C4VA 3ETUA 3E08A 4RJXA 4JV5T 2BS2A 5G26A 3O9XA 4TWHA 5FL1A 3QRAA 4EGWA 3JADA 3FXDB 5KX5E 5AQJB 5G38A 2E9XB 2XQ8A 5IUXA 2XE1A 1ZHWA 1SE7A 2W0GA 1D1BA 4LSIA 2EHOD 1THQA 2Y8DA 2XAGB 4JUYA 2WDQA 2DNXA 1D0YA 4IE0A 1LVFA 4O4HE 2BG9B 3JAFA 4HGAA 4HFVA 3RRWA 2BKNA 1IBMT 3AA7A 5GONE 5FY7A 3SY7A 4ISTA 2VKHA 5E0OA 2CA5A 3BQIA 3EDUA 3UUBA 5G39A 5F3JA 3IBPA 1WCRA 5AQVB 4TV9E 2X27X 3SYSA 5DL6A 1ZEEA 3VE2A 3L3PA 5PRNA 4QWNB 3AA0B 5LB7B 4YY3T 4U3CA 3FXEB 3LG7A 4MLKA 1W9RA 4E1SA 3PORA 3TKLB 1X9BA 2UXNB 2GK9A 4ZI2C 3AAEB 1GFOA 4QH5A 1NAFA 2A9UA 5IYUA 3VZUX 2R4OA 4JYAT 1MIYA 3VR8A 3OBVE 4EZHA 2XTQA 2M06A 3ZYLA 2YEVC 4FZLA 2WMOA 5HXRA 1QSDA 1X79A 4ANJA 4E7ZA 4FRXA 4QX8B 1OEDB 3ZPOA 1OXZA 2W2UA 1ZP0A 2YDQA 4FSOA 5FP3A 3NJTA 4UV9B 1S94A 2XAFB 3ONXA 4YJ2E 4NIQA 4IT4A 3ZMZB 4FESA 4C4VB 2XTRA 4O4JE 1HNZT 1HR0T 4HTEA 4WZXA 3I1AA 2LEHA 2XQAA 4B6XA 2H7OA 2VQFT 3RH3A 2E5LT 2LSYA 4HFHA 5F5WA 4CXXA 1FEWA 1BR4A 1DU2A 2O4VA 4O4UA 1T7SA 3C4XA 2ZM2A 3VY9X 3T1HT 1BXWA 3RGLA 1W09A 2H3RA 2LHRA 4B3TT 1OWAA 1MMDA 4IREA 4DV4T 2N1GA 3AA7B 3RX6A 4LFCT 4KUMB 1Y01A 3R84B 1T98A 1HG5A 1I94T 3C50A 4PJ0O 3ZCJA 2BBHA 4RL9A 4WNKA 3EDVA 5LOVE 4LFBT 4JI0T 4FJOA 3AEDA 4GK5E 3RBHA 4HFEA 3V5UA 4AUIA 4K0KT 3CX7B 3AEEA 5AFUK 2D2SA 4M1PA 5FYMA 4HE8A 4DV3T 5JDLA 4RJWA 1XMQT 5AQQB 5HEGA 3AXJA 2X67A 2IW5B 4AKGA 4ILAA 4AKIA 2CBJA 2F1CX 4H9NC 4YLHA 2JQYA 5FY0A 5AQPB 4ZS2A 4MALA 5HWYA 5L4EA 2Y48B 4U31A 4DNDA 3X1DA 2YU1A 1L0VA 3LDQB 1EZ3A 2JMMA 3AE6A 2LSKA 3EAMA 4TX5A 4TUYE 1MIVA 2KZ7A 2JQQA 2VVSA 5HEJA 2R4NA 4DUYT 3LK2B 5CA0E 3C5OA 3SFEA 3V5SA 3L09A 2Q9QC 4CN6A 2X9HA 4LSFA 4FUVA 5KAFO 1MMGA 2YPVA 3HKCE 1T1LA 3MKDA 4K0UA 4BAYB 1W0BA 3AB3B 1YXRA 4IL6O 4DV6T 4X64T 1Q9GA 3ZT5A 4K3BA 5IYZE 4D64A 2H88A 4PFPA 4COFA 4YT0A 3FBLA 4KBMB 3PUAA 4DMVA 3Q9DA 4JI1T 4ZZCA 3AE1A 1HXUA 2VURA 3AECA 4GK0E 4OFZA 4UB6O 3Q5XA 3PE0A 4HKAA 2W62A 2Z6EA 3RYIE 5EK2A 4X62T 3BQKA 1ZHYA 4FZMA 4PJNA 1IBLT 1HFAA 4ZI2D 4NXNT 2XG6A 2NW8A 5ADXK 2RPAA 4JFBA 3LBXA 4EOZB 2XM2A 4LF6T 3DWNA 4GF4A 5AQRB 4YTNA 4TZ4C 2PFVA 2WJQA 4LMLA 3FYXA 4QH1A 5L3GB 2LOSA 1IBKT 2XSBA 4WBOA 2NWBA 4B3RT 1S5LO 1ZHXA 1XZYA 2XSAA 3D0TA 1KK7A 3OKQA 4JI7T 3POQA 2FGRA 4DIDB 2M67A 3TLTA 4I0UA 3C64A 4O3YA 2YK0A 3ONLC 2XE5A 4U7YA 4GOUA 2LHNA 2QGSA 2IUBA 4IIJE 4ZEYA 3DP7A 2VKOA 5LCYA 2ZFGA 3F57A 5J0ZA 3MXZA 1MMAA 4CTDA 4ILUA 1IZNA 2KZ7B 2V7JA 1WFDA 3VRAA 3POXA 3PUZF 1HG2A 3A0BO 2FJAA 1M62A 4FRTA 1UX5A 5CJ5A 2XQYA 4QXBB 5LA6E 3W15B 2WVPA 2PG8A 4HFIA 2V6XA 4BJNA 2UU9T 2IC6A 4F8HA 3N9OA 4F6RC 2MPKA 2GE4A 3ZT7A 1YKEB 2D5UA 3OTOT 3U3IA 3FZFB 6PRNA 2D0TA 2RP4A 3NZQA 5HXCA 2WQYA 3UTKA 2P9BA 3PURA 4O3ZA 3VKGA 2KT9A 1O3XA 2A72A 1HXTA 4FZNA 3A2SX 4AQYT 1Z0PA 3ZT6A 1HXXA 4ISSA 3G7GA 1S35A 1FMVA 2CRBA 4DV1T 4XZCA 2X68A 3ZEFB 2FUPA 2IWWA 2JPFA 3LBXB 2FJDA 4Z90A 4FOZA 1UGOA 4FMSA 1Y64B 4UV8B 2JIWA 2VK9A 3OJAA 4X66T 2LOPA 1HF8A 1HX1B 2E9XC 2BS4A 4AKMA 4LF8T 2KINB 2VVNA 3T1YT 3DA4A 2MHLA 4X20E 5FVKA 4RLBA 5FNVE 1HCIA 3M3ZB 3ANWA 2OV9A 3P50A 2B76A 3A0HO 4EXTA 1MNEA 2BG9C 5FVLA 4YHHT 2AXDS 3N2OA 2Q9QD 4X1YE 4MHCA 4B3MT 4CN4A 2FBWA 4OYKA 1US7B 3PGSA 4JI4T 4JEHB 5FL0A 5JDQA 3GWHA 2DL1A 3AE7A 5JREA 3CQCB 1IZNB 1G90A 1J5WA 4JI8T 3VY8X 4HWDA 3PF1A 3QB5A 3T0SA 3CX6B 4LF7T 3UFEA 4IDZA 4AQGA 3RIUC 3AE4A 4L9IA 2K5BB 2I0MA 3VR9A 3KDSE 3ZMSB 5JDMA 2CXDA 3PV0F 1T8BA 3N9MA 4GYRA 2F1TA 4C00A 2X0YA 4EB6E 3GP6A 4H9PC 1FIOA 3AE9A 2LRLA 2JMHA 3AA6A 4H63H 3UUNA 5GV0A 3PGUA 3ZMUB 4EZ4A 3AE2A 3HR0A 1P4TA 3OPCA 4WYVA 5HEUA 3UFGA 1ZHTA 3KINB 4YHJA 5D5DA 2K48A 5HXEA 3EMNX 1OEDC 4DR4T 5AQSB 4H9SE 2NR4A 1T72A 5HAXA 5HYAA 1N34T 1ZHZA 4PJJA 5HEHA 2C5JA 4ERRA 2LE8A 2V6YA 4U74A 3Q2MA 2WSSV 4ZHQE 2ERVA 5G3AA 2MOZA 3PU8A 3NRXA 4KHZF 3O1HA 4G76A 1UX4A 5JDHA 1YKHB 4CXYA 3NSGA 2YU2A 3UPGA 2YN6A 2UXXB 2DCFA 2G0UA 2X9XA 4GIWA 5HCMA 1W0AA 4O8SA 2W67A 2CXFA 3Q5WA 3N9LA 3J7Yq 2LT3A 1GFNA 1PHOA 4ZS3A 2C5IT 2PRNA 2UXBT 1KNRA 3AAIA 4L5GA 3ANWB 2WCAA 5C3JA 2XMXA 3LK2A 5C2TA 3A7MA 1N32T 5L4HA 3O4XE 3RKOA 4KX6A 2BDEA 3PJAJ 3UUXB 4IHJE 2FJBA 3T24A 5AQGB 5DL5A 4TNWA 4LFAT 4AKLA 5LG4A 3BQLA 2F4VT 5GTHO 3FZKB 4E1TA 2WWUA 2K4TA 3NVOA 1YQ3A 4TV8E 3UU4A 2WS3A 2BVMA 4DR6T 5H2FO 2LRKA 2ZLYA 2LSIA 3VHLA 2CEAA 2X9KA 2K24A 2XAQB 5FY1A 1LRZA 1YQ4A 4IGUA 4AKHA 3PJAA 5BMVE 2CXLA 4B61A 3I0QA
chains in the Genus database with same CATH topology
1V9DA 4H9RC 1HX8A 4X1KE 1H6S1 4MFRA 4O49A 3POUA 4UIGA 4PFPA 1PRNA 3FBLA 4KBMB 3PUAA 1KNZA 4DMVA 3HA4A 4C91A 1QUUA 3WI3A 3PQUA 3Q9DA 5LXTE 3SS1A 2X9YA 4P0BA 1IJ5A 2I59A 1HXUA 3KFWX 4FSPA 4AYDC 1CUNA 4GK0E 1MM4A 2WMNA 4OFZA 1IAPA 4C69X 3ZLIA 4IE6A 2J1DG 5LGUB 5DL8A 2FGQX 3Q5XA 3AA6B 4UVBB 4GCQA 3CKDA 3PE0A 1D1AA 2NP9A 5KMGP 4HKAA 4GCPA 5JDFA 2W62A 1IJ6A 2NTYA 4UF0A 4P0AA 5JRCB 1LVKA 2Z6EA 3RYIE 2YINA 4UXNB 4MBQA 2Y7SA 3E0ZA 5EK2A 3AA0A 3BQKA 2PBIA 4TN7B 3AA1A 1ZHYA 4FZMA 3H37A 3FHNA 4PJNA 4ZI3C 3ZMTB 4DBQA 2W81C 4XNKA 4AKRA 1G73A 1HFAA 4C90A 4ZI2D 2XG6A 2NW8A 4AYNA 5ADXK 3LK42 4UF0B 5IHYA 4KRAA 3SRZA 5FMNA 4JFBA 3LBXA 3PDYA 4EOZB 4LSHA 3HOLA 2LM9A 1G8XA 2E9XD 3AA1B 5DL7A 3MACA 4CQIA 3GN5B 4I55E 3AVSA 2W80C 4GCSA 4GF4A 3AAEA 3C51A 2MBGA 4TZ4C 4FT6A 4GHBA 2ES0A 2PFVA 2V1DB 2VASA 3JC6C 5HWXA 5LP6E 4HEAA 2XAHB 1YW0A 4PK6A 3FYXA 3OYXA 5L3GB 2CWYA 2LOSA 1QJ9A 3MZKB 1MMNA 4G75A 4AFKA 4AYMC 3C4ZA 4WBOA 2NWBA 2V7MA 3ESLA 1ZHXA 2CE7A 3DA3A 2A2FX 4Z3TA 2KC0A 2QTKA 2Y2XA 1MNDA 4F4BA 3D0TA 3SWHA 1KK7A 2KNDA 3OKQA 4CZZB 3ZC1A 5JVDE 4EAHA 3QC9A 3POQA 3VZWX 4BA9A 2FGRA 4QXCB 1H7CA 2SPCA 4PK4A 2M67A 1E54A 4CI1B 2KXPB 4PK5A 2ODJA 2ZMAA 5LHIB 2CMRA 4H9OC 4XAXB 3C64A 4QQ1A 5L3BB 4O3YA 2YK0A 3SZDA 2LSJA 3PQSA 4PJMA 1BH3A 8PRNA 3VE1A 2XE5A 3UAQA 2ZM8A 3PU3A 1GFQA 1QJPA 3HW9A 4GOUA 2LHNA 2QGSA 2W61A 3NRYA 2W00A 4IE5A 3HOEA 2QA7A 4UELA 2X51A 3LJCA 3CX8B 1ZHCA 2C0SA 4IIJE 4CXWA 3QUJA 2WAUA 3DP7A 2N9DA 2CM0A 2VKOA 5LCYA 2ZFGA 4NUVA 2NOXA 2HPLA 2NW9A 3F57A 2XE3A 3MXZA 4YJ3E 3SYBA 5FXWA 3ETUA 1MMAA 3E08A 5LBQB 4RJXA 4ILUA 1IZNA 2KZ7B 2V7JA 5G26A 3O9XA 3POXA 3KV4A 1HG2A 3N2KE 3WAKA 4QKNA 1UX5A 3QRAA 1VOMA 3P8CD 1LKXA 4FRTA 4OK0A 3FXDB 2MYSA 2XQYA 4QXBB 5J1GA 5KX5E 4YFSA 3WI4A 4PUXA 2IC9A 2XAJB 2E9XB 2Y0KA 5LA6E 3W15B 3IEEA 5LGNB 4UEMA 1ZHWA 2XE1A 2PG8A 2W0GA 4O4IE 1U5PA 1D1BA 4LSIA 2EHOD 5HXHA 5LHGB 1THQA 5JQGE 2Y8DA 2XAGB 4BJNA 2IC6A 4JUYA 1MPFA 2VKDA 4EYUA 3ETVA 2DNXA 3MK7C 1D0YA 4IE0A 3N9OA 4X1IE 4F6RC 2KDYA 1LVFA 2A3DA 2GE4A 4O4HE 1U4QA 1YKEB 4KMCA 4HGAA 2D5UA 4HFVA 5LNKA 3RRWA 1OSMA 2X66A 2XHEB 3I9WA 3U3IA 4N59A 5DQWA 3AA7A 2PJQA 2VL8A 5GONE 5FY7A 2KWHA 4UVCB 3UUMA 4ISTA 2VKHA 2B1EA 3SY7A 6PRNA 5E0OA 2CA5A 3LK3A 3BQIA 3EDUA 2D0TA 2RP4A 3NZQA 5HXSA 5HXCA 2LJLA 5F3JA 3UTKA 2P9BA 3IBPA 3RRCA 3UT5E 3F2EA 3PURA 4DO0A 2Q9QA 4O3ZA 4EYYR 4TV9E 2HPJA 5JR9A 2DLRA 5CB4E 3VKGA 7PRNA 2X27X 3PRNA 1HTJF 3K3QC 4PJLA 2K0LA 2KT9A 4NUUA 1O3XA 2V26A 3SYSA 3EUHA 4JEUB 5DL6A 1ZEEA 4QX7B 3VE2A 2A72A 5TAOA 3L3PA 1HXTA 5PRNA 2VB6A 4QWNB 4FZNA 3A2SX 3WI5A 1Z0PA 4OHFA 3AVRA 3PUQA 4HN9A 3AA0B 3DTOA 3HL6A 1HXXA 4L0RA 4ASKA 4AKRB 4ISSA 4BJMA 3G7GA 5AFUL 1WR6A 3N9PA 5L3DB 3HWBA 3KBUA 1S35A 2E8IA 1FMVA 5DABA 4XZCA 2X68A 3ZEFB 3SY9A 3FXEB 3LG7A 2V7KA 2JPFA 3LBXB 4MLKA 3T20A 1MIWA 2EHOA 3CPZA 3PORA 3TKLB 4E1SA 4FOZA 2KLQA 4FMSA 1Y64B 2UXNB 4UV8B 2GK9A 4ZI2C 2DWGA 3AAEB 3RYCE 4AQFA 1GFOA 1SA0E 1ZV4X 2IAKA 1NAFA 5IYUA 2XTLA 2VK9A 3OJAA 4H9QC 2LOPA 3VZUX 1HF8A 1ZKEA 2VWAA 2EHOB 3KV6A 4AZLA 2E9XC 1MIYA 3N9QA 3OBVE 4EZHA 3ZYKA 2KINB 4AKMA 4H63V 2XTQA 3HKDE 2M06A 2PORA 3ZYLA 3DA4A 3V8UA 3CQXC 4X20E 2MHLA 2YEVC 3N9NA 5JDGA 5L3CB 2Y0LA 4FZLA 4RLBA 3GMIA 5FNVE 1BT9A 1NWMX 2WMOA 5HXRA 5A1LA 1HCIA 1QSDA 2L3LA 1X79A 3ANWA 2ODVA 2OA5A 4ANJA 4E7ZA 3CMLA 4FRXA 2XASB 4O3WA 4EXTA 2X0LB 4QX8B 4QHOA 1MNEA 3S4UA 3N5LA 2K9AA 3HKEE 1D0XA 3N2OA 4V1Av 4AYID 4P09A 3ZPOA 1OXZA 4OYJA 2Q9QD 4X1YE 1B7TA 4JLEA 4MHCA 4E7SA 5EK3A 4AI6A 3IF8B 3MJXA 4FSOA 4BUMX 2BZBA 2M07A 3O0EA 5J2TE 4PNIA 5FP3A 4OYKA 1US7B 3U78A 5JH7E 3I9YA 2V7LA 3NZPA 4JEHB 4DBRA 3CQGB 4O3XB 4UV9B 1S94A 2W63A 2XAFB 5JDQA 3GWHA 3ONXA 4YJ2E 3NBXX 5F8PA 4J2CA 5JREA 3ZJ2A 5LJNA 5C8YE 3ZMZB 4FESA 3C4WA 3CQCB 3KV5A 2XTRA 1IZNB 2NW7A 4O4JE 2NTXA 1G90A 3KV9A 4HTEA 3AAAA 3VY8X 3I1AA 5L2LA 1E1HB 2LEHA 4B6XA 3TZGA 2H7OA 3T0SA 4A56A 4IE4A 3CX6B 3KVBA 3RH3A 3C98B 3ZYMA 4PW8A 2LSYA 2WBLA 4CXXA 1FEWA 3UFEA 1BR4A 4IDZA 3IHRA 2ZLDA 4AQGA 4LSEA 2O4VA 5LBMA 4L9IA 3EVYA 4O4UA 2K5BB 4U9CA 3C4XA 2ZM2A 3RYHE 4O4XA 3VY9X 2N2NA 3LFMA 3ZMSB 3KDSE 5JDMA 2CXDA 3KVDD 3VU7H 3N9MA 4G2AA 4GYSA 4GYRA 2F1TA 4AXPA 3R6NA 1FMWA 4EB6E 3WAJA 2OMFA 5LJMA 1BXWA 3GP6A 2LFUA 5FXXA 4H9PC 1FIOA 2XUEA 1WYBA 2EHOC 2JMHA 4XNLA 3AA6A 1HS7A 4AYEC 4H63H 4Z8XA 4ZI3D 3UUNA 2H3RA 3KVAA 2LHRA 3ZN0B 1OWAA 5GV0A 1MMDA 3ZMUB 4EZ4A 5CA1E 4RLCA 3HR0A 1P4TA 2N1GA 4AQFC 5JRCA 3AA7B 3RX6A 3RC8A 4D64A 4KUMB 1BR2A 2F1VA 2MTQA 1ZHTA 4O2AE 3LK3B 4FI5A 2J4UP 3KINB 3R84B 1T98A 4N58A 2VKJA 3UULA 2CCQA 3T8OA 2Q9QB 4U72A 1HG5A 4YHJA 4EIWA 5JR9B 3GA8A 5ADXL 2C5KT 3C50A 5D5DA 3ZCJA 2K48A 3K8PC 5HXEA 3JC6D 4RL9A 4WNKA 4D5UA 3EMNX 3EDVA 4DVDA 3K19A 5LOVE 4H9SE 5FVNA 2CLYB 4FJOA 5T5FA 5HAXA 5HYAA 3ZJ1A 4GK5E 2ACXA 2RA1A 3GN5A 3RBHA 3P7IA 3HI2A 3V5UA 2ZM0A 4AUIA 2XE2A 4G63A 1ZHZA 4PJJA 5LYJE 2C5JA 2HH7A 2DWKA 2L9QA 3CX7B 1WRDA 4IE7A 4ERRA 5AFUK 3A5XA 2N2LA 1VRBA 4WW0A 5EE2A 2D2SA 2LE8A 5LHHB 4ADZA 4N78D 4U74A 4M1PA 5FYMA 4HE8A 3Q2MA 4PFOA 5JDNA 2WSSV 4ZHQE 3M65A 1D1CA 2ERVA 3RYFE 2MOZA 3F31A 3PU8A 3H3AA 3DJBA 3NRXA 4JCHA 4KR4A 5L3EB 1BR0A 5JDLA 3RC3A 4RJWA 2KWIB 3O1HA 2H7VC 3K3OA 3ZC0A 4G76A 1GFPA 1UX4A 2X67A 3N2GE 5JDHA 1GFMA 1YKHB 4CXYA 3NSGA 2YU2A 3MA9A 4I50E 2IW5B 5KDMC 4DMWA 4AKGA 1QJ8A 1YS5A 2LHFA 3UPGA 3BK9A 2UXXB 3OYZA 4CI3B 2DCFA 4AKIA 1ORMA 2G0UA 2X9XA 5ETWA 3RPUA 4GIWA 4CI2B 4H9NC 4YLHA 2KXPA 1BR1A 4O8SA 2LSGA 2CXFA 5EZYE 3B13A 3Q5WA 5FY0A 3N9LA 4ZS2A 5H6QB 3J7Yq 4I43B 2DHRA 2LT3A 4MALA 5HWYA 5M4YA 1GFNA 4ZS3A 4WBNE 2C5IT 1WYCA 2Y48B 1PHOA 2J1NA 2PRNA 4DNDA 1MM5A 3AAIA 3LK41 2X9WA 4L5GA 3VZTX 3ANWB 4QXHB 4I4TE 1YD8G 3ZCIA 4KR8A 4XBFB 2BVLA 2YU1A 3K3NA 2Y6XA 5DQVA 2XMXA 3LK2A 1EZ3A 2JMMA 2CWOA 3QRCA 3O4XE 2LSKA 3PUGA 2D0UA 3RKOA 1D0ZA 2BDEA 5FXVA 1OPFA 3FB2A 3ZN1B 4ZI7E 3UUXB 3ZMVB 4TX5A 4IHJE 4TUYE 2WM9A 2MNHA 1MIVA 1UCUA 3T24A 2KZ7A 4O4LE 5DJQC 3PUSA 2YNKA 2JQQA 3QK6A 5DL5A 5EK4A 3LK2B 4KP3C 5CA0E 3UU2A 2L8KA 3I0OA 3O1IA 3FBZA 1WLXA 3C5OA 4AKLA 3SOLA 5H6RB 5LG4A 3BQLA 3O1JA 2JMKA 5JDPA 3V5SA 2Y0HA 4E1TA 2WWUA 2K4TA 2JJ9A 3L09A 2Q9QC 2E9XA 5JR9C 2X9HA 4O2BE 2V7IA 4LSFA 4ZOLE 4TV8E 5L3FB 4FUVA 1MMGA 2YPVA 3HKCE 1SHZC 4UVAB 2KMFA 3MKDA 3SZVA 2BVMA 4K0UA 4BAYB 2CLYC 1Q9FA 2ZLYA 2LSIA 3VHLA 3AB3B 2CEAA 2ODUA 3AAAB 3CVRA 5FXZA 2K24A 2XAQB 1AJ3A 3VKHA 2JRKA 2N2MA 5FY1A 3B57A 1LRZA 1Q9GA 4D65A 3JTYA 3PTRB 3E22E 5LGTB 4IGUA 4AKHA 5J2UE 2DI4A 3CWZB 5BMVE 3KBTA 2CXLA 4PAGA 4B61A 3J9X1 3HKBE 3I0QA 5IYZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFU L;  1IZN A;  3AA6 A;  2KZ7 B;  2KXP B;  3AA0 A;  3LK2 A;  3AA1 A;  4AKR A;  3AA7 B;  5ADX K;  3AAA B;  3LK4 2;  2KZ7 A;  2KXP A;  3LK3 B;  3AAE B;  5AFU K;  3LK2 B;  1IZN B;  3AA6 B;  3AA0 B;  3AA7 A;  3AA1 B;  3AAA A;  5ADX L;  3LK3 A;  4AKR B;  3LK4 1;  3AAE A; 
#chains in the Genus database with same CATH topology
 4H9R C;  4X1K E;  1H6S 1;  4MFR A;  2VQE T;  1PRN A;  1E7P A;  2JQ9 A;  5L47 A;  4P0B A;  2I59 A;  1SUM B;  3UU5 A;  4EV6 A;  4DR1 T;  1KFY A;  3ONJ A;  4AYD C;  3ZLI A;  4CN1 A;  5ABF A;  3AA6 B;  4UVB B;  2E2A A;  2NP9 A;  4GCP A;  2QRX A;  2R8A A;  3G06 A;  2Y7S A;  2OLT A;  4TN7 B;  5E79 O;  3H37 A;  4DBQ A;  2W81 C;  1G73 A;  4C90 A;  3FZH B;  1M7K A;  1NEK A;  5IHY A;  3SRZ A;  5FMN A;  2LM9 A;  1G8X A;  2E9X D;  3AA1 B;  2W80 C;  5AQK B;  1T16 A;  2MBG A;  4DV5 T;  4FT6 A;  4GHB A;  2ES0 A;  5LP6 E;  4HEA A;  4PK6 A;  1YW0 A;  4DV2 T;  2V6Y B;  1QJ9 A;  3MZK B;  1MMN A;  4IDP A;  5JTG A;  2V7M A;  2I6H A;  1XNQ T;  2CE7 A;  3DA3 A;  5TIS O;  4LMK A;  4X65 T;  3TLW A;  4F4B A;  3ZC1 A;  3RHW A;  4DUZ T;  4BA9 A;  1H7C A;  4ILB A;  4CI1 B;  4PK5 A;  4QQ1 A;  5KAI O;  3SZD A;  1GQE A;  8PRN A;  3HW9 A;  3HOE A;  4ILC A;  2LLY A;  2WAU A;  2CM0 A;  4KI0 F;  3VRB A;  2XE3 A;  4YJ3 E;  5LMU T;  3SYB A;  5LBQ B;  4FQE A;  2D9D A;  3AEB A;  3WAK A;  4QKN A;  1VOM A;  1LKX A;  2WDR A;  4YFS A;  3WI4 A;  4PUX A;  2UUC T;  1KNP A;  2QVA A;  5LGN B;  4UEM A;  3UQ4 A;  4O4I E;  1U5P A;  5HXH A;  5LHG B;  2WP9 A;  4N75 A;  3ETV A;  4X1I E;  2KDY A;  1UUS A;  2A3D A;  2BS3 A;  1U4Q A;  1J5E T;  2HN1 A;  2J47 A;  4ZZB A;  3P4S A;  2XHE B;  3I9W A;  4N59 A;  2PJQ A;  3UUM A;  2B1E A;  3LK3 A;  5HXS A;  5HEO A;  2LJL A;  3UT5 E;  3RRC A;  3BRZ A;  4DO0 A;  3SFD A;  4EYY R;  4DR5 T;  2HPJ A;  5JR9 A;  1E2A A;  2DLR A;  5CB4 E;  7PRN A;  3PRN A;  1HTJ F;  2K0L A;  2UXD T;  4NUU A;  5ABF B;  2VB6 A;  3RF1 A;  3WI5 A;  3AVR A;  4HN9 A;  5CFB A;  3RIA A;  3HL6 A;  3ZSS A;  1XMO T;  4ASK A;  2UUA T;  4BJM A;  5AFU L;  3UU6 A;  2E8I A;  1Z8U A;  4YTM A;  3T20 A;  3AE5 A;  4A98 A;  2XM1 A;  2DWG A;  2WJR A;  2HN2 A;  2XTL A;  2AE9 A;  1ZKE A;  2EHO B;  3N9Q A;  4H63 V;  5GTI O;  3V8U A;  3CQX C;  5JDG A;  5L3C B;  3PUX F;  2Y0L A;  3GMI A;  5A1L A;  1J1J A;  2ODV A;  3CML A;  4O3W A;  2X0L B;  4TWF A;  4U2Y A;  3HKE E;  1D0X A;  4V1A v;  1ZOY A;  2XY8 B;  1B7T A;  4JLE A;  2XQ7 A;  4AI6 A;  3IF8 B;  4BUM X;  2BZB A;  2M07 A;  3O0E A;  5JH7 E;  3I9Y A;  3NZP A;  4LMJ A;  3KZI O;  4O3X B;  4X5T A;  2R88 A;  1VCT A;  3NBX X;  4J2C A;  3ZJ2 A;  5LJN A;  5C8Y E;  2XJ7 A;  3KV5 A;  2NW7 A;  4NXM T;  3AAA A;  4JI3 T;  3TZG A;  2IWV A;  3C98 B;  3ZYM A;  4PW8 A;  3IHR A;  5LBM A;  4AIS A;  2N2N A;  3CIR A;  3LFM A;  2R4P A;  3KVD D;  3VU7 H;  3PGR A;  3BRY A;  1FMW A;  3WAJ A;  2OMF A;  5LJM A;  4Q25 A;  2BBJ A;  4UR9 A;  3UU8 A;  4XNL A;  4LF4 T;  4AYE C;  4Z8X A;  2BKO A;  3KVA A;  3ZN0 B;  1HNW T;  4RLC A;  5CGM A;  2F1V A;  2MTQ A;  3LK3 B;  2J4U P;  4N74 A;  4N58 A;  2M6B A;  3UUL A;  3T8O A;  5JR9 B;  3GA8 A;  5ADX L;  4JBW F;  3K8P C;  4D5U A;  2V8S V;  5FVN A;  2CLY B;  5T5F A;  2AXT O;  3ZJ1 A;  2ACX A;  2RA1 A;  3GN5 A;  2PTF A;  3P7I A;  3HI2 A;  2ZM0 A;  2XE2 A;  4G63 A;  2HH7 A;  2L9Q A;  3A5X A;  1VRB A;  5LHH B;  4KHP T;  3RYF E;  2E5V A;  3F31 A;  3H3A A;  3AE3 A;  4JCH A;  4KR4 A;  3EAB A;  1BR0 A;  2KWI B;  3K3O A;  3ZC0 A;  1GFP A;  3N2G E;  3QB5 K;  5AQH B;  3MA9 A;  3L39 A;  3RLF F;  5AQF B;  1YS5 A;  5AQI B;  3BK9 A;  3OYZ A;  1ORM A;  5ETW A;  2KXP A;  3UQ7 A;  2WU2 A;  5EZY E;  3B13 A;  5H6Q B;  4I43 B;  5M4Y A;  4U7I A;  1VCS A;  4U33 A;  1WYC A;  2J1N A;  1MM5 A;  4LF5 T;  3OVU A;  4P1N A;  3PUY F;  1YD8 G;  3NWI A;  2YOE A;  3ZCI A;  2CHO A;  4XBF B;  5DQV A;  3PUG A;  2D0U A;  5FXV A;  3WU2 O;  3FB2 A;  4ZI7 E;  3ZN1 B;  1KEY A;  3JAE A;  2WM9 A;  3PUS A;  2L8K A;  3BS0 A;  3SOL A;  5H6R B;  5JDP A;  2ACZ A;  2Y0H A;  4GKK T;  4O2B E;  2V7I A;  4ZOL E;  3JCF A;  1SHZ C;  3SZV A;  3AEA A;  3AAA B;  2JRK A;  5ABE A;  3JTY A;  3IA3 A;  3PTR B;  2W4X A;  5J2U E;  3CWZ B;  3KBT A;  3J9X 1;  3HKB E;  2UXC T;  1HX8 A;  4O49 A;  3RQW A;  1KNZ A;  1UK5 A;  4C91 A;  1QUU A;  5LXT E;  2X9Y A;  3KFW X;  1UUR A;  3AEF A;  4FSP A;  1CUN A;  5DL8 A;  2FGQ X;  3CKD A;  1D1A A;  1FJG T;  1IJ6 A;  2NTY A;  4P0A A;  2YIN A;  1R8I A;  4UXN B;  2WB5 A;  3AA1 A;  2J4G A;  4AKR A;  4ZI3 C;  3ZMT B;  2XQ6 A;  4XNK A;  3Q5E A;  4Z91 A;  4UF0 B;  5LMN T;  2R4L A;  5B5E O;  3PDY A;  4LSH A;  4K3C A;  3A8Y C;  5DL7 A;  4CQI A;  3GN5 B;  3AVS A;  3C51 A;  2V1D B;  3JC6 C;  3OYX A;  2CWY A;  2V5C A;  1N33 T;  4HFB A;  3C4Z A;  4A5X A;  2KC0 A;  2QTK A;  2Y2X A;  1MND A;  3SWH A;  2KND A;  4CZZ B;  4EAH A;  5AQO B;  3QC9 A;  2ZM6 T;  4OX9 T;  2ODJ A;  4PK4 A;  2KXP B;  2ZMA A;  2WU5 A;  2CMR A;  4XAX B;  5LHI B;  4JI2 T;  3B5M A;  5L3B B;  2VL0 A;  4PJM A;  1BH3 A;  3UAQ A;  1GFQ A;  4IE5 A;  1I6Z A;  2QA7 A;  3RKG A;  5B66 O;  2X51 A;  3LJC A;  3CX8 B;  1ZHC A;  2C0S A;  2N9D A;  4TNV A;  4NUV A;  2NOX A;  1XDO A;  2XZE A;  4HWH A;  2R6G F;  5FXW A;  3KV4 A;  3N2K E;  3P8C D;  5AQM B;  2CHN A;  4OK0 A;  2MYS A;  5J1G A;  4DR3 T;  2IC9 A;  2WZH A;  2XAJ B;  2Y0K A;  3IEE A;  4IL4 A;  2BG9 E;  5JQG E;  2MAW A;  1MPF A;  2VKD A;  4U2Z A;  4HWF A;  3EI0 A;  4EYU A;  3MK7 C;  3EHZ A;  4KMC A;  2WWV A;  5LNK A;  1OSM A;  2X66 A;  3DWO X;  5DQW A;  2VL8 A;  2KWH A;  4UVC B;  5LG3 A;  3F2E A;  2Q9Q A;  4DV0 T;  3K3Q C;  4PJL A;  2V26 A;  3CK6 A;  3EUH A;  4JEU B;  2XQ5 A;  4QX7 B;  5TAO A;  2LM2 A;  3FZM B;  4OHF A;  3PUQ A;  3DTO A;  4L0R A;  4AKR B;  3HWB A;  1WR6 A;  3N9P A;  5L3D B;  3KBU A;  5DAB A;  3SY9 A;  2LKH A;  2V7K A;  1MIW A;  2EHO A;  3CPZ A;  2QYW A;  1CHU A;  2KLQ A;  3RYC E;  4AQF A;  1SA0 E;  1ZV4 X;  2IAK A;  4HFD A;  4H9Q C;  2VWA A;  2KSR A;  3KV6 A;  4AZL A;  3ZYK A;  1NEN A;  3HKD E;  2POR A;  4DV7 T;  3ZKR A;  3N9N A;  4PR7 A;  1BT9 A;  2IML A;  1OED E;  1NWM X;  2L3L A;  2OA5 A;  2W66 A;  1XDP A;  2XAS B;  1XWM A;  4QHO A;  3S4U A;  4DR7 T;  3N5L A;  3P4Q A;  2K9A A;  4AYI D;  4P09 A;  4YTP A;  4OYJ A;  4E7S A;  5EK3 A;  3MJX A;  3PUV F;  5J2T E;  4PNI A;  3U78 A;  2V7L A;  2CPT A;  4DBR A;  3CQG B;  2W63 A;  3LSV A;  4YSY A;  5F8P A;  2IHR 1;  3C4W A;  2NTX A;  3PUW F;  3KV9 A;  2CBI A;  4HWC A;  4QH4 A;  5L2L A;  1E1H B;  2YDR A;  4A56 A;  3TLV A;  4IE4 A;  2XQ9 A;  2JQK A;  3P4P A;  3KVB A;  4EEB A;  2WBL A;  3UU3 A;  5AQL B;  2ZLD A;  4LSE A;  3EVY A;  4U9C A;  2YDS A;  3P4R A;  3RYH E;  4O4X A;  4G2A A;  4GYS A;  4AXP A;  3R6N A;  2LFU A;  3ZST A;  5FXX A;  2V5D A;  2XUE A;  1WYB A;  2EHO C;  1HS7 A;  4ZI3 D;  1WR0 A;  5CA1 E;  4AQF C;  5JRC A;  3RC8 A;  1BR2 A;  4O2A E;  4FI5 A;  2VKJ A;  2CCQ A;  2Q9Q B;  4U72 A;  4EIW A;  2C5K T;  4GKJ T;  3JC6 D;  4DVD A;  3K19 A;  3L8R A;  1JNR A;  5KXJ A;  1JNZ A;  4IL9 A;  4HWI B;  5LYJ E;  2DWK A;  2FJE A;  1WRD A;  4IE7 A;  2N2L A;  4WW0 A;  5EE2 A;  3RI5 A;  4ADZ A;  4N78 D;  5JDN A;  4PFO A;  4IDQ A;  2YKS A;  3M65 A;  1D1C A;  2LKG A;  3DJB A;  5L3E B;  3RC3 A;  3QNU A;  2H7V C;  4DR2 T;  1GFM A;  2HHH T;  4I50 E;  1QJ8 A;  5KDM C;  4DMW A;  2LHF A;  2R89 A;  4CI3 B;  4EED A;  1N36 T;  3RPU A;  4CI2 B;  1BR1 A;  2XPK A;  2LSG A;  2DHR A;  4B3S T;  3AXJ B;  1QLB A;  4WBN E;  3LK4 1;  3VZT X;  2X9W A;  5IWA T;  4QXH B;  2BKP A;  4I4T E;  2XQ3 A;  3ABV A;  4KR8 A;  2BVL A;  3K3N A;  2Y6X A;  2CWO A;  4AIU A;  2WZI A;  3QRC A;  2IDO B;  5FKY A;  1D0Z A;  1OPF A;  3ZMV B;  2MNH A;  1UCU A;  4O4L E;  5DJQ C;  2YNK A;  3TLS A;  3QK6 A;  5EK4 A;  4KP3 C;  2J62 A;  3UU2 A;  3I0O A;  3O1I A;  3FBZ A;  1WLX A;  4NPP A;  3O1J A;  2JMK A;  2K3W A;  2JJ9 A;  2E9X A;  5JR9 C;  2M6I A;  5L3F B;  5HCJ A;  4UVA B;  2KMF A;  3P4W A;  2CLY C;  3AE8 A;  1Q9F A;  3H3M A;  2ODU A;  5FXZ A;  3CVR A;  4A97 A;  1AJ3 A;  3VKH A;  2N2M A;  4D65 A;  3B57 A;  2JQH A;  3E22 E;  5LGT B;  2BG9 A;  4UB8 O;  2DI4 A;  4PAG A;  5AQN B;  1V9D A;  3POU A;  4UIG A;  3HA4 A;  2XQ4 A;  3DZM A;  3WI3 A;  3PQU A;  2IIU A;  3K1S A;  3SS1 A;  1IJ5 A;  4YXD A;  1MM4 A;  2WMN A;  1IAP A;  4C69 X;  4IE6 A;  3RIF A;  2J1D G;  5LGU B;  4GCQ A;  5KMG P;  5JDF A;  4UF0 A;  2H89 A;  5JRC B;  1LVK A;  2UUB T;  4MBQ A;  3E0Z A;  1KF6 A;  2WDV A;  4JI6 T;  4ZXL A;  3AA0 A;  4YSX A;  3NKZ A;  2PBI A;  3FHN A;  5AQT B;  4AYN A;  3LK4 2;  1HNX T;  3RIU A;  4KRA A;  5ABH A;  3HOL A;  3MAC A;  4I55 E;  4GCS A;  5AQU B;  3AAE A;  5ABG A;  2VAS A;  3JCU O;  4TWD A;  5HWX A;  2X0H A;  4HFC A;  2XAH B;  4IDN A;  4G75 A;  4AFK A;  4AYM C;  4LF9 T;  3RQU A;  4JI5 T;  3ESL A;  2A2F X;  4Z3T A;  3AEG A;  3QOF A;  5JVD E;  1XNR T;  3VZW X;  4QXC B;  2SPC A;  1E54 A;  1OED A;  3TLU A;  4H9O C;  3FZL B;  2LSJ A;  3PQS A;  3VE1 A;  2ZM8 A;  3PU3 A;  4YSZ A;  1QJP A;  2W61 A;  3NRY A;  3Q5D A;  2W00 A;  4UEL A;  4CXW A;  3QUJ A;  5BR8 T;  2WY2 A;  2NW9 A;  2HPL A;  4IDO A;  4C4V A;  3ETU A;  3E08 A;  4RJX A;  4JV5 T;  2BS2 A;  5G26 A;  3O9X A;  4TWH A;  5FL1 A;  3QRA A;  4EGW A;  3JAD A;  3FXD B;  5KX5 E;  5AQJ B;  5G38 A;  2E9X B;  2XQ8 A;  5IUX A;  2XE1 A;  1ZHW A;  1SE7 A;  2W0G A;  1D1B A;  4LSI A;  2EHO D;  1THQ A;  2Y8D A;  2XAG B;  4JUY A;  2WDQ A;  2DNX A;  1D0Y A;  4IE0 A;  1LVF A;  4O4H E;  2BG9 B;  3JAF A;  4HGA A;  4HFV A;  3RRW A;  2BKN A;  1IBM T;  3AA7 A;  5GON E;  5FY7 A;  3SY7 A;  4IST A;  2VKH A;  5E0O A;  2CA5 A;  3BQI A;  3EDU A;  3UUB A;  5G39 A;  5F3J A;  3IBP A;  1WCR A;  5AQV B;  4TV9 E;  2X27 X;  3SYS A;  5DL6 A;  1ZEE A;  3VE2 A;  3L3P A;  5PRN A;  4QWN B;  3AA0 B;  5LB7 B;  4YY3 T;  4U3C A;  3FXE B;  3LG7 A;  4MLK A;  1W9R A;  4E1S A;  3POR A;  3TKL B;  1X9B A;  2UXN B;  2GK9 A;  4ZI2 C;  3AAE B;  1GFO A;  4QH5 A;  1NAF A;  2A9U A;  5IYU A;  3VZU X;  2R4O A;  4JYA T;  1MIY A;  3VR8 A;  3OBV E;  4EZH A;  2XTQ A;  2M06 A;  3ZYL A;  2YEV C;  4FZL A;  2WMO A;  5HXR A;  1QSD A;  1X79 A;  4ANJ A;  4E7Z A;  4FRX A;  4QX8 B;  1OED B;  3ZPO A;  1OXZ A;  2W2U A;  1ZP0 A;  2YDQ A;  4FSO A;  5FP3 A;  3NJT A;  4UV9 B;  1S94 A;  2XAF B;  3ONX A;  4YJ2 E;  4NIQ A;  4IT4 A;  3ZMZ B;  4FES A;  4C4V B;  2XTR A;  4O4J E;  1HNZ T;  1HR0 T;  4HTE A;  4WZX A;  3I1A A;  2LEH A;  2XQA A;  4B6X A;  2H7O A;  2VQF T;  3RH3 A;  2E5L T;  2LSY A;  4HFH A;  5F5W A;  4CXX A;  1FEW A;  1BR4 A;  1DU2 A;  2O4V A;  4O4U A;  1T7S A;  3C4X A;  2ZM2 A;  3VY9 X;  3T1H T;  1BXW A;  3RGL A;  1W09 A;  2H3R A;  2LHR A;  4B3T T;  1OWA A;  1MMD A;  4IRE A;  4DV4 T;  2N1G A;  3AA7 B;  3RX6 A;  4LFC T;  4KUM B;  1Y01 A;  3R84 B;  1T98 A;  1HG5 A;  1I94 T;  3C50 A;  4PJ0 O;  3ZCJ A;  2BBH A;  4RL9 A;  4WNK A;  3EDV A;  5LOV E;  4LFB T;  4JI0 T;  4FJO A;  3AED A;  4GK5 E;  3RBH A;  4HFE A;  3V5U A;  4AUI A;  4K0K T;  3CX7 B;  3AEE A;  5AFU K;  2D2S A;  4M1P A;  5FYM A;  4HE8 A;  4DV3 T;  5JDL A;  4RJW A;  1XMQ T;  5AQQ B;  5HEG A;  3AXJ A;  2X67 A;  2IW5 B;  4AKG A;  4ILA A;  4AKI A;  2CBJ A;  2F1C X;  4H9N C;  4YLH A;  2JQY A;  5FY0 A;  5AQP B;  4ZS2 A;  4MAL A;  5HWY A;  5L4E A;  2Y48 B;  4U31 A;  4DND A;  3X1D A;  2YU1 A;  1L0V A;  3LDQ B;  1EZ3 A;  2JMM A;  3AE6 A;  2LSK A;  3EAM A;  4TX5 A;  4TUY E;  1MIV A;  2KZ7 A;  2JQQ A;  2VVS A;  5HEJ A;  2R4N A;  4DUY T;  3LK2 B;  5CA0 E;  3C5O A;  3SFE A;  3V5S A;  3L09 A;  2Q9Q C;  4CN6 A;  2X9H A;  4LSF A;  4FUV A;  5KAF O;  1MMG A;  2YPV A;  3HKC E;  1T1L A;  3MKD A;  4K0U A;  4BAY B;  1W0B A;  3AB3 B;  1YXR A;  4IL6 O;  4DV6 T;  4X64 T;  1Q9G A;  3ZT5 A;  4K3B A;  5IYZ E;  4D64 A;  2H88 A;  4PFP A;  4COF A;  4YT0 A;  3FBL A;  4KBM B;  3PUA A;  4DMV A;  3Q9D A;  4JI1 T;  4ZZC A;  3AE1 A;  1HXU A;  2VUR A;  3AEC A;  4GK0 E;  4OFZ A;  4UB6 O;  3Q5X A;  3PE0 A;  4HKA A;  2W62 A;  2Z6E A;  3RYI E;  5EK2 A;  4X62 T;  3BQK A;  1ZHY A;  4FZM A;  4PJN A;  1IBL T;  1HFA A;  4ZI2 D;  4NXN T;  2XG6 A;  2NW8 A;  5ADX K;  2RPA A;  4JFB A;  3LBX A;  4EOZ B;  2XM2 A;  4LF6 T;  3DWN A;  4GF4 A;  5AQR B;  4YTN A;  4TZ4 C;  2PFV A;  2WJQ A;  4LML A;  3FYX A;  4QH1 A;  5L3G B;  2LOS A;  1IBK T;  2XSB A;  4WBO A;  2NWB A;  4B3R T;  1S5L O;  1ZHX A;  1XZY A;  2XSA A;  3D0T A;  1KK7 A;  3OKQ A;  4JI7 T;  3POQ A;  2FGR A;  4DID B;  2M67 A;  3TLT A;  4I0U A;  3C64 A;  4O3Y A;  2YK0 A;  3ONL C;  2XE5 A;  4U7Y A;  4GOU A;  2LHN A;  2QGS A;  2IUB A;  4IIJ E;  4ZEY A;  3DP7 A;  2VKO A;  5LCY A;  2ZFG A;  3F57 A;  5J0Z A;  3MXZ A;  1MMA A;  4CTD A;  4ILU A;  1IZN A;  2KZ7 B;  2V7J A;  1WFD A;  3VRA A;  3POX A;  3PUZ F;  1HG2 A;  3A0B O;  2FJA A;  1M62 A;  4FRT A;  1UX5 A;  5CJ5 A;  2XQY A;  4QXB B;  5LA6 E;  3W15 B;  2WVP A;  2PG8 A;  4HFI A;  2V6X A;  4BJN A;  2UU9 T;  2IC6 A;  4F8H A;  3N9O A;  4F6R C;  2MPK A;  2GE4 A;  3ZT7 A;  1YKE B;  2D5U A;  3OTO T;  3U3I A;  3FZF B;  6PRN A;  2D0T A;  2RP4 A;  3NZQ A;  5HXC A;  2WQY A;  3UTK A;  2P9B A;  3PUR A;  4O3Z A;  3VKG A;  2KT9 A;  1O3X A;  2A72 A;  1HXT A;  4FZN A;  3A2S X;  4AQY T;  1Z0P A;  3ZT6 A;  1HXX A;  4ISS A;  3G7G A;  1S35 A;  1FMV A;  2CRB A;  4DV1 T;  4XZC A;  2X68 A;  3ZEF B;  2FUP A;  2IWW A;  2JPF A;  3LBX B;  2FJD A;  4Z90 A;  4FOZ A;  1UGO A;  4FMS A;  1Y64 B;  4UV8 B;  2JIW A;  2VK9 A;  3OJA A;  4X66 T;  2LOP A;  1HF8 A;  1HX1 B;  2E9X C;  2BS4 A;  4AKM A;  4LF8 T;  2KIN B;  2VVN A;  3T1Y T;  3DA4 A;  2MHL A;  4X20 E;  5FVK A;  4RLB A;  5FNV E;  1HCI A;  3M3Z B;  3ANW A;  2OV9 A;  3P50 A;  2B76 A;  3A0H O;  4EXT A;  1MNE A;  2BG9 C;  5FVL A;  4YHH T;  2AXD S;  3N2O A;  2Q9Q D;  4X1Y E;  4MHC A;  4B3M T;  4CN4 A;  2FBW A;  4OYK A;  1US7 B;  3PGS A;  4JI4 T;  4JEH B;  5FL0 A;  5JDQ A;  3GWH A;  2DL1 A;  3AE7 A;  5JRE A;  3CQC B;  1IZN B;  1G90 A;  1J5W A;  4JI8 T;  3VY8 X;  4HWD A;  3PF1 A;  3QB5 A;  3T0S A;  3CX6 B;  4LF7 T;  3UFE A;  4IDZ A;  4AQG A;  3RIU C;  3AE4 A;  4L9I A;  2K5B B;  2I0M A;  3VR9 A;  3KDS E;  3ZMS B;  5JDM A;  2CXD A;  3PV0 F;  1T8B A;  3N9M A;  4GYR A;  2F1T A;  4C00 A;  2X0Y A;  4EB6 E;  3GP6 A;  4H9P C;  1FIO A;  3AE9 A;  2LRL A;  2JMH A;  3AA6 A;  4H63 H;  3UUN A;  5GV0 A;  3PGU A;  3ZMU B;  4EZ4 A;  3AE2 A;  3HR0 A;  1P4T A;  3OPC A;  4WYV A;  5HEU A;  3UFG A;  1ZHT A;  3KIN B;  4YHJ A;  5D5D A;  2K48 A;  5HXE A;  3EMN X;  1OED C;  4DR4 T;  5AQS B;  4H9S E;  2NR4 A;  1T72 A;  5HAX A;  5HYA A;  1N34 T;  1ZHZ A;  4PJJ A;  5HEH A;  2C5J A;  4ERR A;  2LE8 A;  2V6Y A;  4U74 A;  3Q2M A;  2WSS V;  4ZHQ E;  2ERV A;  5G3A A;  2MOZ A;  3PU8 A;  3NRX A;  4KHZ F;  3O1H A;  4G76 A;  1UX4 A;  5JDH A;  1YKH B;  4CXY A;  3NSG A;  2YU2 A;  3UPG A;  2YN6 A;  2UXX B;  2DCF A;  2G0U A;  2X9X A;  4GIW A;  5HCM A;  1W0A A;  4O8S A;  2W67 A;  2CXF A;  3Q5W A;  3N9L A;  3J7Y q;  2LT3 A;  1GFN A;  1PHO A;  4ZS3 A;  2C5I T;  2PRN A;  2UXB T;  1KNR A;  3AAI A;  4L5G A;  3ANW B;  2WCA A;  5C3J A;  2XMX A;  3LK2 A;  5C2T A;  3A7M A;  1N32 T;  5L4H A;  3O4X E;  3RKO A;  4KX6 A;  2BDE A;  3PJA J;  3UUX B;  4IHJ E;  2FJB A;  3T24 A;  5AQG B;  5DL5 A;  4TNW A;  4LFA T;  4AKL A;  5LG4 A;  3BQL A;  2F4V T;  5GTH O;  3FZK B;  4E1T A;  2WWU A;  2K4T A;  3NVO A;  1YQ3 A;  4TV8 E;  3UU4 A;  2WS3 A;  2BVM A;  4DR6 T;  5H2F O;  2LRK A;  2ZLY A;  2LSI A;  3VHL A;  2CEA A;  2X9K A;  2K24 A;  2XAQ B;  5FY1 A;  1LRZ A;  1YQ4 A;  4IGU A;  4AKH A;  3PJA A;  5BMV E;  2CXL A;  4B61 A;  3I0Q A; 
#chains in the Genus database with same CATH homology
 1V9D A;  4H9R C;  1HX8 A;  4X1K E;  1H6S 1;  4MFR A;  4O49 A;  3POU A;  4UIG A;  4PFP A;  1PRN A;  3FBL A;  4KBM B;  3PUA A;  1KNZ A;  4DMV A;  3HA4 A;  4C91 A;  1QUU A;  3WI3 A;  3PQU A;  3Q9D A;  5LXT E;  3SS1 A;  2X9Y A;  4P0B A;  1IJ5 A;  2I59 A;  1HXU A;  3KFW X;  4FSP A;  4AYD C;  1CUN A;  4GK0 E;  1MM4 A;  2WMN A;  4OFZ A;  1IAP A;  4C69 X;  3ZLI A;  4IE6 A;  2J1D G;  5LGU B;  5DL8 A;  2FGQ X;  3Q5X A;  3AA6 B;  4UVB B;  4GCQ A;  3CKD A;  3PE0 A;  1D1A A;  2NP9 A;  5KMG P;  4HKA A;  4GCP A;  5JDF A;  2W62 A;  1IJ6 A;  2NTY A;  4UF0 A;  4P0A A;  5JRC B;  1LVK A;  2Z6E A;  3RYI E;  2YIN A;  4UXN B;  4MBQ A;  2Y7S A;  3E0Z A;  5EK2 A;  3AA0 A;  3BQK A;  2PBI A;  4TN7 B;  3AA1 A;  1ZHY A;  4FZM A;  3H37 A;  3FHN A;  4PJN A;  4ZI3 C;  3ZMT B;  4DBQ A;  2W81 C;  4XNK A;  4AKR A;  1G73 A;  1HFA A;  4C90 A;  4ZI2 D;  2XG6 A;  2NW8 A;  4AYN A;  5ADX K;  3LK4 2;  4UF0 B;  5IHY A;  4KRA A;  3SRZ A;  5FMN A;  4JFB A;  3LBX A;  3PDY A;  4EOZ B;  4LSH A;  3HOL A;  2LM9 A;  1G8X A;  2E9X D;  3AA1 B;  5DL7 A;  3MAC A;  4CQI A;  3GN5 B;  4I55 E;  3AVS A;  2W80 C;  4GCS A;  4GF4 A;  3AAE A;  3C51 A;  2MBG A;  4TZ4 C;  4FT6 A;  4GHB A;  2ES0 A;  2PFV A;  2V1D B;  2VAS A;  3JC6 C;  5HWX A;  5LP6 E;  4HEA A;  2XAH B;  1YW0 A;  4PK6 A;  3FYX A;  3OYX A;  5L3G B;  2CWY A;  2LOS A;  1QJ9 A;  3MZK B;  1MMN A;  4G75 A;  4AFK A;  4AYM C;  3C4Z A;  4WBO A;  2NWB A;  2V7M A;  3ESL A;  1ZHX A;  2CE7 A;  3DA3 A;  2A2F X;  4Z3T A;  2KC0 A;  2QTK A;  2Y2X A;  1MND A;  4F4B A;  3D0T A;  3SWH A;  1KK7 A;  2KND A;  3OKQ A;  4CZZ B;  3ZC1 A;  5JVD E;  4EAH A;  3QC9 A;  3POQ A;  3VZW X;  4BA9 A;  2FGR A;  4QXC B;  1H7C A;  2SPC A;  4PK4 A;  2M67 A;  1E54 A;  4CI1 B;  2KXP B;  4PK5 A;  2ODJ A;  2ZMA A;  5LHI B;  2CMR A;  4H9O C;  4XAX B;  3C64 A;  4QQ1 A;  5L3B B;  4O3Y A;  2YK0 A;  3SZD A;  2LSJ A;  3PQS A;  4PJM A;  1BH3 A;  8PRN A;  3VE1 A;  2XE5 A;  3UAQ A;  2ZM8 A;  3PU3 A;  1GFQ A;  1QJP A;  3HW9 A;  4GOU A;  2LHN A;  2QGS A;  2W61 A;  3NRY A;  2W00 A;  4IE5 A;  3HOE A;  2QA7 A;  4UEL A;  2X51 A;  3LJC A;  3CX8 B;  1ZHC A;  2C0S A;  4IIJ E;  4CXW A;  3QUJ A;  2WAU A;  3DP7 A;  2N9D A;  2CM0 A;  2VKO A;  5LCY A;  2ZFG A;  4NUV A;  2NOX A;  2HPL A;  2NW9 A;  3F57 A;  2XE3 A;  3MXZ A;  4YJ3 E;  3SYB A;  5FXW A;  3ETU A;  1MMA A;  3E08 A;  5LBQ B;  4RJX A;  4ILU A;  1IZN A;  2KZ7 B;  2V7J A;  5G26 A;  3O9X A;  3POX A;  3KV4 A;  1HG2 A;  3N2K E;  3WAK A;  4QKN A;  1UX5 A;  3QRA A;  1VOM A;  3P8C D;  1LKX A;  4FRT A;  4OK0 A;  3FXD B;  2MYS A;  2XQY A;  4QXB B;  5J1G A;  5KX5 E;  4YFS A;  3WI4 A;  4PUX A;  2IC9 A;  2XAJ B;  2E9X B;  2Y0K A;  5LA6 E;  3W15 B;  3IEE A;  5LGN B;  4UEM A;  1ZHW A;  2XE1 A;  2PG8 A;  2W0G A;  4O4I E;  1U5P A;  1D1B A;  4LSI A;  2EHO D;  5HXH A;  5LHG B;  1THQ A;  5JQG E;  2Y8D A;  2XAG B;  4BJN A;  2IC6 A;  4JUY A;  1MPF A;  2VKD A;  4EYU A;  3ETV A;  2DNX A;  3MK7 C;  1D0Y A;  4IE0 A;  3N9O A;  4X1I E;  4F6R C;  2KDY A;  1LVF A;  2A3D A;  2GE4 A;  4O4H E;  1U4Q A;  1YKE B;  4KMC A;  4HGA A;  2D5U A;  4HFV A;  5LNK A;  3RRW A;  1OSM A;  2X66 A;  2XHE B;  3I9W A;  3U3I A;  4N59 A;  5DQW A;  3AA7 A;  2PJQ A;  2VL8 A;  5GON E;  5FY7 A;  2KWH A;  4UVC B;  3UUM A;  4IST A;  2VKH A;  2B1E A;  3SY7 A;  6PRN A;  5E0O A;  2CA5 A;  3LK3 A;  3BQI A;  3EDU A;  2D0T A;  2RP4 A;  3NZQ A;  5HXS A;  5HXC A;  2LJL A;  5F3J A;  3UTK A;  2P9B A;  3IBP A;  3RRC A;  3UT5 E;  3F2E A;  3PUR A;  4DO0 A;  2Q9Q A;  4O3Z A;  4EYY R;  4TV9 E;  2HPJ A;  5JR9 A;  2DLR A;  5CB4 E;  3VKG A;  7PRN A;  2X27 X;  3PRN A;  1HTJ F;  3K3Q C;  4PJL A;  2K0L A;  2KT9 A;  4NUU A;  1O3X A;  2V26 A;  3SYS A;  3EUH A;  4JEU B;  5DL6 A;  1ZEE A;  4QX7 B;  3VE2 A;  2A72 A;  5TAO A;  3L3P A;  1HXT A;  5PRN A;  2VB6 A;  4QWN B;  4FZN A;  3A2S X;  3WI5 A;  1Z0P A;  4OHF A;  3AVR A;  3PUQ A;  4HN9 A;  3AA0 B;  3DTO A;  3HL6 A;  1HXX A;  4L0R A;  4ASK A;  4AKR B;  4ISS A;  4BJM A;  3G7G A;  5AFU L;  1WR6 A;  3N9P A;  5L3D B;  3HWB A;  3KBU A;  1S35 A;  2E8I A;  1FMV A;  5DAB A;  4XZC A;  2X68 A;  3ZEF B;  3SY9 A;  3FXE B;  3LG7 A;  2V7K A;  2JPF A;  3LBX B;  4MLK A;  3T20 A;  1MIW A;  2EHO A;  3CPZ A;  3POR A;  3TKL B;  4E1S A;  4FOZ A;  2KLQ A;  4FMS A;  1Y64 B;  2UXN B;  4UV8 B;  2GK9 A;  4ZI2 C;  2DWG A;  3AAE B;  3RYC E;  4AQF A;  1GFO A;  1SA0 E;  1ZV4 X;  2IAK A;  1NAF A;  5IYU A;  2XTL A;  2VK9 A;  3OJA A;  4H9Q C;  2LOP A;  3VZU X;  1HF8 A;  1ZKE A;  2VWA A;  2EHO B;  3KV6 A;  4AZL A;  2E9X C;  1MIY A;  3N9Q A;  3OBV E;  4EZH A;  3ZYK A;  2KIN B;  4AKM A;  4H63 V;  2XTQ A;  3HKD E;  2M06 A;  2POR A;  3ZYL A;  3DA4 A;  3V8U A;  3CQX C;  4X20 E;  2MHL A;  2YEV C;  3N9N A;  5JDG A;  5L3C B;  2Y0L A;  4FZL A;  4RLB A;  3GMI A;  5FNV E;  1BT9 A;  1NWM X;  2WMO A;  5HXR A;  5A1L A;  1HCI A;  1QSD A;  2L3L A;  1X79 A;  3ANW A;  2ODV A;  2OA5 A;  4ANJ A;  4E7Z A;  3CML A;  4FRX A;  2XAS B;  4O3W A;  4EXT A;  2X0L B;  4QX8 B;  4QHO A;  1MNE A;  3S4U A;  3N5L A;  2K9A A;  3HKE E;  1D0X A;  3N2O A;  4V1A v;  4AYI D;  4P09 A;  3ZPO A;  1OXZ A;  4OYJ A;  2Q9Q D;  4X1Y E;  1B7T A;  4JLE A;  4MHC A;  4E7S A;  5EK3 A;  4AI6 A;  3IF8 B;  3MJX A;  4FSO A;  4BUM X;  2BZB A;  2M07 A;  3O0E A;  5J2T E;  4PNI A;  5FP3 A;  4OYK A;  1US7 B;  3U78 A;  5JH7 E;  3I9Y A;  2V7L A;  3NZP A;  4JEH B;  4DBR A;  3CQG B;  4O3X B;  4UV9 B;  1S94 A;  2W63 A;  2XAF B;  5JDQ A;  3GWH A;  3ONX A;  4YJ2 E;  3NBX X;  5F8P A;  4J2C A;  5JRE A;  3ZJ2 A;  5LJN A;  5C8Y E;  3ZMZ B;  4FES A;  3C4W A;  3CQC B;  3KV5 A;  2XTR A;  1IZN B;  2NW7 A;  4O4J E;  2NTX A;  1G90 A;  3KV9 A;  4HTE A;  3AAA A;  3VY8 X;  3I1A A;  5L2L A;  1E1H B;  2LEH A;  4B6X A;  3TZG A;  2H7O A;  3T0S A;  4A56 A;  4IE4 A;  3CX6 B;  3KVB A;  3RH3 A;  3C98 B;  3ZYM A;  4PW8 A;  2LSY A;  2WBL A;  4CXX A;  1FEW A;  3UFE A;  1BR4 A;  4IDZ A;  3IHR A;  2ZLD A;  4AQG A;  4LSE A;  2O4V A;  5LBM A;  4L9I A;  3EVY A;  4O4U A;  2K5B B;  4U9C A;  3C4X A;  2ZM2 A;  3RYH E;  4O4X A;  3VY9 X;  2N2N A;  3LFM A;  3ZMS B;  3KDS E;  5JDM A;  2CXD A;  3KVD D;  3VU7 H;  3N9M A;  4G2A A;  4GYS A;  4GYR A;  2F1T A;  4AXP A;  3R6N A;  1FMW A;  4EB6 E;  3WAJ A;  2OMF A;  5LJM A;  1BXW A;  3GP6 A;  2LFU A;  5FXX A;  4H9P C;  1FIO A;  2XUE A;  1WYB A;  2EHO C;  2JMH A;  4XNL A;  3AA6 A;  1HS7 A;  4AYE C;  4H63 H;  4Z8X A;  4ZI3 D;  3UUN A;  2H3R A;  3KVA A;  2LHR A;  3ZN0 B;  1OWA A;  5GV0 A;  1MMD A;  3ZMU B;  4EZ4 A;  5CA1 E;  4RLC A;  3HR0 A;  1P4T A;  2N1G A;  4AQF C;  5JRC A;  3AA7 B;  3RX6 A;  3RC8 A;  4D64 A;  4KUM B;  1BR2 A;  2F1V A;  2MTQ A;  1ZHT A;  4O2A E;  3LK3 B;  4FI5 A;  2J4U P;  3KIN B;  3R84 B;  1T98 A;  4N58 A;  2VKJ A;  3UUL A;  2CCQ A;  3T8O A;  2Q9Q B;  4U72 A;  1HG5 A;  4YHJ A;  4EIW A;  5JR9 B;  3GA8 A;  5ADX L;  2C5K T;  3C50 A;  5D5D A;  3ZCJ A;  2K48 A;  3K8P C;  5HXE A;  3JC6 D;  4RL9 A;  4WNK A;  4D5U A;  3EMN X;  3EDV A;  4DVD A;  3K19 A;  5LOV E;  4H9S E;  5FVN A;  2CLY B;  4FJO A;  5T5F A;  5HAX A;  5HYA A;  3ZJ1 A;  4GK5 E;  2ACX A;  2RA1 A;  3GN5 A;  3RBH A;  3P7I A;  3HI2 A;  3V5U A;  2ZM0 A;  4AUI A;  2XE2 A;  4G63 A;  1ZHZ A;  4PJJ A;  5LYJ E;  2C5J A;  2HH7 A;  2DWK A;  2L9Q A;  3CX7 B;  1WRD A;  4IE7 A;  4ERR A;  5AFU K;  3A5X A;  2N2L A;  1VRB A;  4WW0 A;  5EE2 A;  2D2S A;  2LE8 A;  5LHH B;  4ADZ A;  4N78 D;  4U74 A;  4M1P A;  5FYM A;  4HE8 A;  3Q2M A;  4PFO A;  5JDN A;  2WSS V;  4ZHQ E;  3M65 A;  1D1C A;  2ERV A;  3RYF E;  2MOZ A;  3F31 A;  3PU8 A;  3H3A A;  3DJB A;  3NRX A;  4JCH A;  4KR4 A;  5L3E B;  1BR0 A;  5JDL A;  3RC3 A;  4RJW A;  2KWI B;  3O1H A;  2H7V C;  3K3O A;  3ZC0 A;  4G76 A;  1GFP A;  1UX4 A;  2X67 A;  3N2G E;  5JDH A;  1GFM A;  1YKH B;  4CXY A;  3NSG A;  2YU2 A;  3MA9 A;  4I50 E;  2IW5 B;  5KDM C;  4DMW A;  4AKG A;  1QJ8 A;  1YS5 A;  2LHF A;  3UPG A;  3BK9 A;  2UXX B;  3OYZ A;  4CI3 B;  2DCF A;  4AKI A;  1ORM A;  2G0U A;  2X9X A;  5ETW A;  3RPU A;  4GIW A;  4CI2 B;  4H9N C;  4YLH A;  2KXP A;  1BR1 A;  4O8S A;  2LSG A;  2CXF A;  5EZY E;  3B13 A;  3Q5W A;  5FY0 A;  3N9L A;  4ZS2 A;  5H6Q B;  3J7Y q;  4I43 B;  2DHR A;  2LT3 A;  4MAL A;  5HWY A;  5M4Y A;  1GFN A;  4ZS3 A;  4WBN E;  2C5I T;  1WYC A;  2Y48 B;  1PHO A;  2J1N A;  2PRN A;  4DND A;  1MM5 A;  3AAI A;  3LK4 1;  2X9W A;  4L5G A;  3VZT X;  3ANW B;  4QXH B;  4I4T E;  1YD8 G;  3ZCI A;  4KR8 A;  4XBF B;  2BVL A;  2YU1 A;  3K3N A;  2Y6X A;  5DQV A;  2XMX A;  3LK2 A;  1EZ3 A;  2JMM A;  2CWO A;  3QRC A;  3O4X E;  2LSK A;  3PUG A;  2D0U A;  3RKO A;  1D0Z A;  2BDE A;  5FXV A;  1OPF A;  3FB2 A;  3ZN1 B;  4ZI7 E;  3UUX B;  3ZMV B;  4TX5 A;  4IHJ E;  4TUY E;  2WM9 A;  2MNH A;  1MIV A;  1UCU A;  3T24 A;  2KZ7 A;  4O4L E;  5DJQ C;  3PUS A;  2YNK A;  2JQQ A;  3QK6 A;  5DL5 A;  5EK4 A;  3LK2 B;  4KP3 C;  5CA0 E;  3UU2 A;  2L8K A;  3I0O A;  3O1I A;  3FBZ A;  1WLX A;  3C5O A;  4AKL A;  3SOL A;  5H6R B;  5LG4 A;  3BQL A;  3O1J A;  2JMK A;  5JDP A;  3V5S A;  2Y0H A;  4E1T A;  2WWU A;  2K4T A;  2JJ9 A;  3L09 A;  2Q9Q C;  2E9X A;  5JR9 C;  2X9H A;  4O2B E;  2V7I A;  4LSF A;  4ZOL E;  4TV8 E;  5L3F B;  4FUV A;  1MMG A;  2YPV A;  3HKC E;  1SHZ C;  4UVA B;  2KMF A;  3MKD A;  3SZV A;  2BVM A;  4K0U A;  4BAY B;  2CLY C;  1Q9F A;  2ZLY A;  2LSI A;  3VHL A;  3AB3 B;  2CEA A;  2ODU A;  3AAA B;  3CVR A;  5FXZ A;  2K24 A;  2XAQ B;  1AJ3 A;  3VKH A;  2JRK A;  2N2M A;  5FY1 A;  3B57 A;  1LRZ A;  1Q9G A;  4D65 A;  3JTY A;  3PTR B;  3E22 E;  5LGT B;  4IGU A;  4AKH A;  5J2U E;  2DI4 A;  3CWZ B;  5BMV E;  3KBT A;  2CXL A;  4PAG A;  4B61 A;  3J9X 1;  3HKB E;  3I0Q A;  5IYZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...