3LK2B

Crystal structure of capz bound to the uncapping motif from carmil
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
242
structure length
242
Chain Sequence
b'SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-1
molecule tags Protein binding
source organism Gallus gallus
publication title Structural characterization of a capping protein interaction motif defines a family of actin filament regulators
doi rcsb
total genus 79
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lk2B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3lk2B02
3LK42 2KZ7A 3LK3A 1IZNA 3LK41 3AA6B 3AAAB 3AA0B 3LK3B 3AA7A 3AAEB 2KZ7B 4AKRB 3LK2B 3AAEA 5ADXL 4AKRA 2KXPB 3AA6A 3AAAA 2KXPA 5AFUK 1IZNB 5ADXK 3AA1B 5AFUL 3LK2A 3AA0A 3AA1A 3AA7B
chains in the Genus database with same CATH superfamily
3K8PC 3PF1A 1QSDA 5JVDE 4X66T 4LMLA 2BKNA 3JC6D 2CHOA 1MMDA 4UELA 4A56A 5CA1E 3N2KE 3OTOT 5AQLB 5FVLA 2IHR1 3HI2A 3P50A 3RIAA 3TLTA 2QA7A 4FMSA 4C90A 3FZFB 1O3XA 2N2MA 4O3ZA 4EYUA 4UF0A 2F4VT 3AEBA 2E9XD 3POUA 5LBMA 4HGAA 3TKLB 1KNPA 2IW5B 1IZNB 2O4VA 4B6XA 2I0MA 3AE5A 5HXCA 2LFUA 2BBJA 4XNKA 3UU4A 2E9XC 3PORA 4IGUA 1ZOYA 5HEHA 4IL9A 5JRCB 5L3EB 5LGUB 4JI8T 3UPGA 4DV1T 3T1YT 4ANJA 3FXEB 2XTQA 3POXA 2Z6EA 3PU3A 1GFOA 4PK6A 2VL8A 1GFQA 4IDNA 3HKDE 3A0HO 4LFCT 3HOEA 3UT5E 2QVAA 3BQLA 1WRDA 1HG5A 2NTXA 5FXZA 3VU7H 2YDRA 2V7LA 3F31A 2XSBA 2FJEA 2LSKA 4B3RT 2VKOA 2M67A 2R8AA 2XG6A 2JIWA 2J1NA 5ABGA 4L5GA 1UK5A 2FJBA 5H6QB 2KNDA 4QX7B 2M6IA 3SOLA 4Z90A 5EK4A 3VKGA 1SA0E 5GV0A 2WJQA 4YFSA 2L3LA 2V7KA 2XQ5A 4TZ4C 1OEDE 2D5UA 4IIJE 5AQHB 2WJRA 2MOZA 4LMKA 3TLSA 1E2AA 4QWNB 3LK2B 5AQOB 1U5PA 5JQGE 4ZI3C 3HKBE 1XZYA 4UXNB 5ADXK 2RA1A 1KFYA 1V9DA 3FB2A 2Q9QA 3K3NA 4XAXB 2YKSA 2H88A 3PGUA 5HEGA 4DR5T 2PRNA 3N5LA 4YSXA 3U78A 2VVNA 2DHRA 4ILCA 2XQ4A 3AVRA 4UV9B 1IJ5A 2PFVA 3O1JA 1BR2A 2CCQA 4TV9E 4HN9A 5DJQC 4ADZA 3FHNA 4YT0A 4CI1B 3ETVA 2W00A 2J62A 4JI6T 2WCAA 3ZMTB 2YNKA 3AA6A 5FY0A 5L47A 4KR4A 4BJMA 3F2EA 1ZHWA 4KX6A 2V7MA 2V1DB 3KV5A 5LHGB 5IWAT 4YHHT 2ODUA 5AQPB 4IE5A 4QH4A 2G0UA 4UVAB 4KMCA 3AVSA 2XSAA 4OYJA 1ORMA 3LBXB 3T20A 1NEKA 5ABEA 4IDOA 2Y8DA 2HH7A 3HWBA 1KNZA 4B3TT 3PJAJ 1WCRA 4U74A 1VRBA 4O4JE 2DI4A 4GHBA 4PNIA 3W15B 1OXZA 1D1BA 3PUZF 3VHLA 1WFDA 2UXBT 1LKXA 5DL7A 3G7GA 5LXTE 4EYYR 4CQIA 2Q9QB 3C5OA 4AYEC 4HFHA 5KAFO 2CBIA 3SY7A 4DV3T 5LMNT 3AEAA 2XASB 4HE8A 2R88A 3K3OA 2LM2A 3K3QC 4ILAA 2YK0A 4DV2T 5LCYA 2LSGA 4HEAA 3RC8A 4ZI7E 5HEOA 2YU1A 1NENA 4X1IE 4BJNA 2CWOA 3OBVE 1CUNA 3A2SX 3RLFF 3GN5A 2F1VA 3CQCB 1DU2A 4GCPA 5G38A 3GMIA 1FMVA 5CGMA 5B5EO 4PK4A 5HAXA 3O1IA 2WBLA 3UUBA 4AI6A 2X51A 1ZHXA 5LG4A 4DR1T 4FUVA 1PHOA 2H7OA 3ZMVB 3O4XE 4NXMT 4H9PC 2A3DA 2XE1A 2ZFGA 1YS5A 3LK42 1S94A 2X9WA 4FOZA 3PUAA 4TV8E 3A7MA 5H2FO 3ZMSB 3I9WA 2M07A 1HS7A 2UUCT 3N9MA 3N2OA 5LJNA 2CHNA 2LKHA 3RQUA 3DWOX 2ES0A 4FZLA 3TZGA 2KLQA 2JRKA 2Q9QD 4QKNA 3AB3B 2EHOB 8PRNA 3LFMA 2XQ3A 3PGRA 3N9LA 4GK5E 4KUMB 4AKHA 1ZHYA 3UU5A 5AQIB 1IAPA 1FIOA 3N9QA 3PQUA 3ZPOA 4N59A 4GCSA 2VKHA 5DL6A 5AQTB 1QLBA 2Y48B 3AEEA 4LF5T 2ODJA 1OWAA 3AE6A 4FZNA 5TAOA 3CVRA 1H6S1 2NP9A 2P9BA 4U3CA 2MYSA 1Z8UA 3ESLA 3P4WA 2F1CX 4ZI2D 3Q5EA 5G3AA 4HWFA 1FJGT 2DLRA 4I50E 3UAQA 3CQXC 3S4UA 4F8HA 2YU2A 2PG8A 4K0UA 3P4SA 2CE7A 5LBQB 3V8UA 2QGSA 4HKAA 2MNHA 2CXLA 5HXSA 5JDQA 4OX9T 4J2CA 1S5LO 5FL0A 2KT9A 1I6ZA 4NUVA 3KV4A 3P8CD 2NW9A 4KHPT 1BR0A 2VL0A 4X20E 4CXXA 2IWWA 4DV0T 4FRXA 2VB6A 3ZC1A 1ZKEA 4ASKA 2WY2A 2ACXA 2E2AA 4LSIA 2W0GA 3HKEE 2XAHB 3AXJA 4JEUB 3A5XA 4DR6T 2XM2A 4O4UA 4GYSA 4PJLA 5ABFB 2BKPA 4IE7A 2V8SV 2XQYA 5LOVE 3PV0F 4LFBT 2LHNA 3L39A 1ZV4X 3RC3A 4O3XB 3LSVA 2N2NA 4WNKA 4Z3TA 2X0LB 3HR0A 4EB6E 4GF4A 3OYXA 1J5ET 2VASA 1Q9GA 2W4XA 2R4NA 2WMNA 4PK5A 4JLEA 4IT4A 3WU2O 3PRNA 3MZKB 4CZZB 2CMRA 3HA4A 3VR9A 3LJCA 4HFBA 4LF9T 2LHFA 5GTHO 4JUYA 1T8BA 4O4HE 5LA6E 2H89A 2UU9T 3DP7A 3IHRA 1KEYA 1WLXA 1P4TA 4QQ1A 3R6NA 5AQFB 4JI4T 2RP4A 1VCSA 5HEUA 1YXRA 2J4GA 4CXWA 3QNUA 2LEHA 4UEMA 5JDFA 3UU6A 2VK9A 2XAQB 2KSRA 2V5CA 1LVFA 4FJOA 4H63V 4FZMA 3CKDA 2CRBA 3QC9A 3B5MA 3M65A 3KBTA 4Z8XA 2LHRA 2D0UA 1IBMT 2NOXA 1XMQT 5AQMB 2A72A 4ZI3D 4IE0A 3CQGB 2IIUA 3WI4A 4A5XA 4E1TA 3POQA 3PU8A 2WQYA 5L3CB 5PRNA 3DWNA 2XHEB 2WDVA 4IDPA 3MA9A 4PW8A 4X65T 2W62A 4AZLA 4JBWF 1ZHZA 3SYBA 3CMLA 3O0EA 3VZTX 3FBZA 3SFEA 4DMVA 3C98B 3JCFA 2B76A 4WZXA 4U2YA 1ZHCA 3L3PA 4IE6A 5F3JA 5GTIO 1MIYA 3ZJ1A 1HFAA 4N58A 5FVKA 4U9CA 3QUJA 1UCUA 4TWDA 1N33T 2XTRA 4Z91A 3O9XA 5HEJA 4LF4T 2BBHA 1T7SA 4FSOA 1YKEB 1BT9A 3ZT6A 4YTNA 1XDPA 2Y2XA 3KINB 3AECA 2CLYB 3B57A 1VCTA 2K5BB 3ZMUB 4EEDA 2BVLA 1KNRA 2XMXA 2JPFA 4FI5A 2DWGA 5DQWA 1WR6A 3RIFA 4PJJA 2ZMAA 3RF1A 2XPKA 4PFOA 4QXCB 3ZT7A 3LBXA 2VKJA 3RX6A 3ZSSA 4YSYA 2N9DA 4ISSA 4U33A 4RLCA 2NW8A 3GP6A 4K3CA 3NZPA 4CXYA 5HYAA 5JR9A 2J47A 2LLYA 3DA3A 4DMWA 5LB7B 3FZHB 2IDOB 3HL6A 5G26A 4AYNA 2FBWA 3MACA 5LYJE 1IZNA 2X9KA 4E1SA 5L3GB 5FKYA 3L8RA 2MAWA 5IUXA 2JQHA 3X1DA 1VOMA 3KDSE 5L3BB 1UGOA 1XMOT 7PRNA 4GKJT 1WR0A 2ODVA 3PUSA 5FVNA 3AAAB 2X67A 3FZLB 5JDGA 2JMHA 2XUEA 2QYWA 2AE9A 3VZWX 4D64A 3BQIA 4YY3T 4YLHA 2WZIA 1BR1A 4NIQA 4LF6T 1X9BA 2IAKA 5KXJA 5HWYA 3UU8A 3ZN0B 1W09A 4NUUA 2KZ7B 3PURA 5FL1A 2BVMA 2UUBT 4QXBB 1AJ3A 4C00A 2KXPA 3VE1A 4H63H 2Q9QC 3MJXA 3QRAA 3I0OA 3ZT5A 5DQVA 2MTQA 5AQVB 5JR9C 4CN4A 2CEAA 3K1SA 3SS1A 5AQKB 3VY9X 3EMNX 4D5UA 2WU2A 3SYSA 4JI1T 3ONJA 3ZN1B 1QJPA 2R6GF 3UU2A 2KDYA 2IMLA 3PJAA 2LT3A 2H7VC 3Q2MA 1QJ9A 4P1NA 2DL1A 2CM0A 5T5FA 4RJWA 2K0LA 3P4PA 2HHHT 3ZCIA 1OEDB 3JADA 4O3WA 2MBGA 4JV5T 2K4TA 1GFNA 2LJLA 1UX5A 5LHIB 4ZOLE 2LOPA 2Y0HA 4LSEA 1PRNA 1QUUA 4IHJE 3HW9A 3JAFA 3EDVA 2E9XB 4U31A 2NW7A 2H3RA 3UTKA 1WYBA 4H9QC 1MMGA 3AE1A 1D0YA 2XE5A 2DNXA 2XAJB 2OMFA 2VURA 2UXNB 3KZIO 4U7IA 4DV5T 5FY7A 4EAHA 4F4BA 2SPCA 2MHLA 3AEFA 3SZDA 3LK3B 2NR4A 3PDYA 3EDUA 3IEEA 3Q9DA 2ZLDA 2JQQA 2DCFA 5LHHB 2KXPB 4WBNE 4X62T 1I94T 2LSIA 4YSZA 5JDPA 3OVUA 4X5TA 1X79A 5IYZE 1Q9FA 2E8IA 5HCJA 4YHJA 2BG9A 2V7IA 5CA0E 4AQGA 3QB5K 2ACZA 1CHUA 4CI2B 2F1TA 4O8SA 1OSMA 4C69X 3WAKA 1D0ZA 4EXTA 5IYUA 3KBUA 4FQEA 3ZEFB 1MNDA 5AFUK 3PUYF 4L0RA 4LSHA 2X68A 4O4IE 1SHZC 3MK7C 4IL6O 3MKDA 2PBIA 2X27X 3VE2A 2WWUA 2W2UA 3ZLIA 4TWFA 4WW0A 4KBMB 4CI3B 2K48A 2LRKA 3KVBA 3KV6A 5HXEA 1JNZA 5J1GA 2E5LT 3QRCA 2NTYA 1MM4A 4JCHA 4K0KT 1YKHB 2X0HA 4AISA 4H9NC 3PGSA 3E22E 1N34T 1IBKT 1W0AA 2K9AA 2RPAA 1W9RA 1WYCA 5L2LA 3SFDA 5AQUB 2A2FX 2WU5A 3LK3A 4C91A 4I43B 3AA0B 1OEDC 4MFRA 4WYVA 3JAEA 1UUSA 4EIWA 4GYRA 5LP6E 3EI0A 4IDZA 5FP3A 1HF8A 3UU3A 4QHOA 4OK0A 3QOFA 5J0ZA 3LDQB 5KDMC 3UUNA 3PUXF 3T24A 2XAGB 3NRYA 1B7TA 1MMNA 4MLKA 2HPLA 3AA6B 3PUGA 1JNRA 2OA5A 2EHOA 2XQ6A 3ZMZB 5C3JA 4TN7B 4UB6O 4EZ4A 5FYMA 4HFVA 2WP9A 3OYZA 3EABA 2V6YB 1NAFA 1G73A 2BKOA 4JEHB 3ONLC 3Q5XA 3KV9A 2D0TA 4DBRA 3CX7B 4PJMA 3RYCE 4A98A 3RPUA 4O2AE 3A0BO 2CBJA 5IHYA 2R4LA 3T8OA 1T1LA 4UB8O 5JRCA 4PR7A 3E08A 3LK41 3FBLA 3NBXX 5FXXA 4HFCA 3UFGA 3JCUO 4U7YA 1M62A 4TUYE 4TX5A 4U72A 3UQ7A 4QH5A 3AAEA 2N2LA 4KHZF 2BS2A 3M3ZB 5AQGB 1E1HB 4I4TE 4YJ2E 3PQSA 2XZEA 3ZYKA 1ZHTA 5FMNA 5D5DA 4HFEA 3RBHA 1HXTA 3PTRB 3FYXA 4CTDA 2BS3A 4DUYT 3NWIA 2CXDA 5M4YA 4M1PA 4A97A 2M6BA 4X1KE 4YXDA 3EHZA 3C64A 1HNZT 1QJ8A 1MPFA 2LOSA 5FXWA 5ADXL 3BK9A 5J2UE 3V5SA 3UUXB 5DL8A 5LG3A 4Q25A 3AA1A 3CIRA 3RKGA 2FUPA 2W61A 5JTGA 3PUQA 2WDQA 3KVDD 3ZC0A 2DWKA 2QRXA 5JR9B 4H9RC 4JFBA 5JDLA 1G90A 2XAFB 5CB4E 4I55E 4C4VA 4IE4A 5F8PA 5HCMA 1N32T 2JQKA 5FY1A 3AA7A 4HWDA 3RI5A 2W66A 5EK2A 1XNRT 2Y0KA 3ZKRA 4DR7T 3MXZA 4AKLA 2AXDS 4G2AA 3O1HA 4JI0T 2V7JA 3ZJ2A 4LF8T 3WAJA 2NWBA 4BAYB 3RKOA 2YDSA 3AAEB 4WBOA 1KF6A 5J2TE 4I0UA 5LJMA 4LSFA 4TNWA 4OFZA 4OHFA 3SRZA 5JDMA 4HWCA 1HNWT 4HWHA 5CFBA 2FGQX 2KWHA 2KZ7A 4XZCA 2MPKA 3UQ4A 4CN6A 3U3IA 2W80C 5JREA 1L0VA 2PTFA 4EZHA 4CN1A 2J4UP 4O4LE 1HNXT 4UVBB 3AA1B 3Q5DA 4DNDA 2LM9A 5C2TA 3NJTA 3SZVA 3FXDB 5AQNB 2BG9E 2E5VA 3CWZB 1W0BA 4ZEYA 2EHOD 5TISO 4MHCA 4AKMA 2UXDT 3DJBA 3UFEA 1N36T 3IBPA 2XJ7A 5LNKA 4AYDC 2V26A 3CX8B 4COFA 3RYFE 4YTMA 4TWHA 4IL4A 2CXFA 4LFAT 5ETWA 2J1DG 3RRCA 2LKGA 1G8XA 3CPZA 1Z0PA 1U4QA 4JI3T 3QK6A 1MIVA 3RQWA 3LK2A 4PFPA 3EVYA 3ZCJA 2YINA 3IF8B 4ISTA 4O2BE 4QX8B 3P4RA 4XBFB 3AAIA 3R84B 4E7SA 1E54A 4RL9A 2CA5A 3NZQA 3QB5A 4IDQA 4YJ3E 2WZHA 4PUXA 4P0AA 2B1EA 4UV8B 1XDOA 4D65A 2ZM8A 2VWAA 4KI0F 2XM1A 4L9IA 1ZP0A 1HX1B 1T16A 2UUAT 1ZEEA 2W63A 2XQ8A 1FEWA 1NWMX 2IC9A 3GA8A 3VKHA 2XE2A 1BR4A 4NXNT 2LE8A 4KR8A 2A9UA 2BS4A 4P0BA 5KMGP 4B61A 4ZZBA 2WWVA 2HN2A 3AE8A 4FESA 2W81C 4BUMX 4AKRA 2W67A 2WMOA 2R4OA 6PRNA 3DTOA 3TLVA 5HXHA 2XQAA 3FZKB 5EZYE 3ZYMA 2VQFT 2IUBA 4ZXLA 4HFDA 4E7ZA 4BA9A 3EUHA 4DR4T 2VKDA 2XTLA 3ABVA 4UF0B 3JC6C 2V6XA 2Y6XA 3AAAA 3OKQA 3RH3A 3ZYLA 3DA4A 4B3ST 5E0OA 2ZM6T 5E79O 2BDEA 3VR8A 1J1JA 2VQET 1YQ3A 3RRWA 5AQQB 3BRZA 2K24A 4FSPA 1HR0T 1HXXA 5BR8T 4LMJA 4AFKA 4V1Av 1HCIA 3N9OA 4HWIB 3VRAA 3IA3A 1YD8G 3D0TA 1XNQT 4X64T 2LSYA 4GIWA 3NKZA 3ZSTA 3N9PA 2KINB 3CX6B 4JI7T 3K19A 4RJXA 4JI5T 2Y0LA 5EE2A 1MIWA 2C5IT 2CLYC 1IJ6A 4ILUA 4GK0E 3AA0A 2R89A 3BS0A 2IWVA 3ANWA 2D9DA 2XQ7A 4AKIA 4G75A 1YW0A 1HXUA 4ZI2C 5AQSB 3FZMB 2JQYA 2JMKA 3F57A 3DZMA 5JDHA 5KAIO 3GN5B 2Y7SA 3WI5A 1H7CA 3PUWF 1BH3A 1KK7A 2BG9C 2WDRA 4U2ZA 4K3BA 2JJ9A 4YTPA 4ZZCA 4QH1A 3AE3A 5G39A 2KC0A 4AKRB 4AYMC 4EOZB 4DV4T 5CJ5A 3OPCA 2GE4A 1OEDA 5JH7E 4OYKA 3GWHA 5HXRA 1Y01A 2V6YA 4UR9A 5HWXA 3PE0A 4IREA 2FGRA 5A1LA 2WM9A 3TLUA 5LGTB 2FJDA 2I6HA 1HG2A 4F6RC 2YEVC 2CWYA 2WVPA 4PAGA 1R8IA 5BMVE 3RHWA 4KP3C 2ZM2A 3G06A 2BZBA 1UX4A 4ILBA 3OJAA 3TLWA 5L3DB 1LRZA 4MBQA 2KMFA 4JYAT 1THQA 3HKCE 1S35A 2AXTO 5B66O 4HFIA 3ANWB 1D1CA 3AEDA 5FNVE 3AE7A 2JQ9A 2EHOC 2GK9A 3ETUA 3SWHA 3H3AA 3I0QA 4X1YE 5AQJB 4AXPA 1LVKA 3N2GE 1GFMA 2BG9B 3JTYA 2ZM0A 2YPVA 3BQKA 2YOEA 3H3MA 5L4EA 3VY8X 3VRBA 3ONXA 4G63A 5F5WA 4B3MT 5FXVA 4ERRA 3T1HT 2YN6A 2X9HA 4N75A 5DL5A 2XE3A 3SY9A 3LG7A 1BXWA 2X0YA 2LSJA 3C4XA 5H6RB 4EEBA 4FT6A 3AE9A 2JMMA 4XNLA 3VZUX 5GONE 2N1GA 1OPFA 4C4VB 2D2SA 3J9X1 3L09A 3AXJB 3AA7B 5ABHA 4AKGA 2WB5A 5ABFA 4JI2T 1IBLT 2LRLA 4PJ0O 3I9YA 2WS3A 2XQ9A 3WI3A 2XY8B 3BRYA 4DBQA 2ZLYA 5JDNA 4AQYT 3I1AA 3Q5WA 2ERVA 5EK3A 2I59A 4N78D 5C8YE 3RGLA 2VVSA 2C0SA 2E9XA 1MM5A 2KWIB 1SE7A 3N9NA 3HOLA 5LMUT 1HX8A 4AUIA 3P7IA 4AIUA 1YQ4A 2PJQA 4UIGA 2L9QA 2R4PA 4DO0A 2X66A 1J5WA 3NRXA 1GQEA 1D0XA 3P4QA 1Y64B 4GCQA 3NVOA 4HTEA 3AE4A 2WAUA 3RYIE 2X9XA 1E7PA 5KX5E 4O49A 2X9YA 1SUMB 4AYID 4TNVA 3V5UA 5L4HA 4PJNA 5AQRB 3UULA 4AQFC 3RIUA 3C4WA 2IC6A 3E0ZA 3H37A 4ZHQE 1MNEA 4GKKT 3C50A 3RIUC 4O4XA 2YDQA 4GOUA 3T0SA 4ZS3A 4DVDA 1M7KA 4LF7T 1US7B 2C5KT 2K3WA 1EZ3A 4RLBA 2OV9A 4ZS2A 2UXCT 4H9SE 4O3YA 3A8YC 1FMWA 4NPPA 3KVAA 3AEGA 3C4ZA 2L8KA 3C51A 2HN1A 3J7Yq 2UXXB 5DABA 1GFPA 4EV6A 2PORA 4MALA 2WSSV 1HTJF 3NSGA 1T72A 4P09A 2OLTA 2V5DA 4G76A 2HPJA 4KRAA 3PUVF 4DR2T 3EAMA 4AQFA 4DV7T 3CK6A 4DV6T 4UVCB 5L3FB 1D1AA 4EGWA 2C5JA 3AE2A 4DIDB 1UURA 2FJAA 4DR3T 4QXHB 4DUZT 5LGNB 4N74A 2QTKA 1T98A 3KFWX 2CPTA 3UUMA 2M06A 1XWMA 1MMAA 5AFUL 3RYHE 4H9OC 4FRTA 3B13A
chains in the Genus database with same CATH topology
1ZKEA 4P0BA 4ASKA 5CA0E 3K8PC 5KMGP 4B61A 2ACXA 4AQGA 4FESA 4LSIA 1QSDA 5JVDE 2W0GA 3HKEE 2W81C 4CI2B 4BUMX 2XAHB 3JC6D 4JEUB 2F1TA 3A5XA 4O8SA 4AKRA 1MMDA 4UELA 1OSMA 4C69X 3WAKA 4A56A 3N2KE 1D0ZA 4GYSA 4PJLA 4EXTA 5CA1E 4O4UA 3KBUA 5IYUA 2WMOA 4IE7A 3ZEFB 1MNDA 5AFUK 6PRNA 4L0RA 3DTOA 4LSHA 2X68A 3HI2A 4O4IE 5HXHA 2XQYA 2QA7A 5LOVE 1SHZC 3MK7C 2LHNA 3MKDA 2PBIA 1ZV4X 5EZYE 3RC3A 3ZYMA 4FMSA 4O3XB 4C90A 2X27X 3VE2A 4E7ZA 2N2NA 4WNKA 4Z3TA 1O3XA 2WWUA 2N2MA 2X0LB 3HR0A 4BA9A 4UF0A 4EYUA 4EB6E 4O3ZA 3EUHA 3ZLIA 2E9XD 3POUA 4GF4A 2VKDA 5LBMA 2XTLA 3OYXA 4HGAA 4UF0B 4WW0A 3TKLB 3JC6C 2VASA 4KBMB 1Q9GA 2Y6XA 4CI3B 2K48A 3AAAA 2WMNA 2IW5B 3OKQA 1IZNB 3KVBA 4PK5A 3RH3A 3ZYLA 2O4VA 4JLEA 3DA4A 3KV6A 5E0OA 5HXEA 5J1GA 3QRCA 4B6XA 3PRNA 3MZKB 4CZZB 2BDEA 2CMRA 3HA4A 2NTYA 3RRWA 5HXCA 1MM4A 4FSPA 2K24A 4JCHA 1HXXA 3LJCA 1YKHB 2LFUA 4XNKA 2LHFA 4H9NC 4AFKA 4JUYA 2E9XC 3PORA 4V1Av 4IGUA 4O4HE 1HCIA 3E22E 3N9OA 5LA6E 1YD8G 3D0TA 2LSYA 4GIWA 2K9AA 5JRCB 5L3EB 3DP7A 5LGUB 3UPGA 3IHRA 1WYCA 3N9PA 2KINB 4ANJA 3FXEB 3CX6B 2XTQA 3K19A 5L2LA 3POXA 4RJXA 2Y0LA 5EE2A 2Z6EA 1MIWA 3PU3A 1WLXA 4PK6A 1GFOA 2C5IT 2A2FX 2CLYC 1P4TA 4QQ1A 1IJ6A 2VL8A 4ILUA 4GK0E 3R6NA 1GFQA 3AA0A 3LK3A 2RP4A 3ANWA 3HKDE 4C91A 4AKIA 4G75A 4I43B 3HOEA 3AA0B 1YW0A 1HXUA 4CXWA 3UT5E 4MFRA 4ZI2C 2LEHA 4UEMA 4EIWA 4GYRA 5LP6E 5JDFA 3BQLA 1WRDA 1HG5A 4IDZA 5FP3A 1HF8A 4QHOA 2JMKA 3F57A 2VK9A 2NTXA 3GN5B 5JDHA 4OK0A 5FXZA 2Y7SA 3WI5A 3VU7H 1H7CA 2XAQB 1BH3A 1KK7A 2V7LA 3F31A 5KDMC 2LSKA 3UUNA 2VKOA 1LVFA 2M67A 2XAGB 4FJOA 4H63V 3NRYA 1B7TA 3CKDA 2XG6A 4FZMA 2J1NA 4L5GA 1MMNA 3QC9A 2JJ9A 4MLKA 5H6QB 2HPLA 3M65A 3AA6B 3KBTA 3PUGA 4Z8XA 2LHRA 2D0UA 2KC0A 2KNDA 4AKRB 4QX7B 4AYMC 2NOXA 4EOZB 3SOLA 5EK4A 3VKGA 1SA0E 2A72A 2OA5A 2EHOA 4YFSA 4ZI3D 5GV0A 4IE0A 3ZMZB 3CQGB 2L3LA 2GE4A 5JH7E 2V7KA 4TN7B 4TZ4C 3WI4A 4OYKA 4EZ4A 3GWHA 5HXRA 2D5UA 4E1TA 3POQA 5FYMA 3PU8A 4HFVA 4IIJE 5HWXA 3PE0A 2MOZA 5L3CB 3OYZA 2FGRA 5A1LA 2WM9A 5PRNA 1NAFA 1G73A 5LGTB 4JEHB 2XHEB 1HG2A 4F6RC 4QWNB 3LK2B 3MA9A 4PW8A 2W62A 3Q5XA 4AZLA 2YEVC 1U5PA 3KV9A 5JQGE 2D0TA 4DBRA 1ZHZA 4ZI3C 2CWYA 3SYBA 3CMLA 3HKBE 3CX7B 3O0EA 3VZTX 3FBZA 4PJMA 3RYCE 3RPUA 4PAGA 4UXNB 5ADXK 2RA1A 4O2AE 1V9DA 4DMVA 3C98B 3FB2A 5IHYA 2Q9QA 3T8OA 3K3NA 5BMVE 4XAXB 5JRCA 4KP3C 2ZM2A 2BZBA 3E08A 3LK41 3FBLA 1UX4A 1ZHCA 3NBXX 3L3PA 5FXXA 3OJAA 4TUYE 4U72A 4TX5A 4IE6A 5L3DB 5F3JA 3AAEA 1LRZA 2N2LA 4MBQA 1MIYA 2KMFA 5D5DA 2PRNA 1E1HB 1HFAA 4I4TE 3ZJ1A 4YJ2E 3N5LA 3PQSA 4N58A 3ZYKA 3U78A 5FMNA 1THQA 3HKCE 1S35A 3QUJA 1ZHTA 2DHRA 4U9CA 1UCUA 3RBHA 3AVRA 1HXTA 3PTRB 3FYXA 3ANWB 1D1CA 2XTRA 4UV9B 3O9XA 1IJ5A 2PFVA 3O1JA 2CXDA 5FNVE 1BR2A 4M1PA 5M4YA 2CCQA 4FSOA 4TV9E 4HN9A 1YKEB 5DJQC 4ADZA 1BT9A 2EHOC 4X1KE 2GK9A 3ETUA 3FHNA 3SWHA 3C64A 3H3AA 3I0QA 4X1YE 4AXPA 1LVKA 3N2GE 1GFMA 4CI1B 2Y2XA 3KINB 1QJ8A 1MPFA 2LOSA 2CLYB 3B57A 2K5BB 3ETVA 2W00A 5FXWA 3ZMUB 5ADXL 2BVLA 3JTYA 2ZM0A 2YPVA 3BQKA 3BK9A 3ZMTB 5J2UE 2XMXA 2YNKA 3AA6A 2JPFA 4FI5A 3V5SA 3UUXB 5FY0A 3VY8X 2DWGA 5DQWA 5DL8A 3ONXA 1WR6A 4G63A 4KR4A 4BJMA 3F2EA 1ZHWA 2V7MA 4PJJA 2ZMAA 2V1DB 5FXVA 4ERRA 3KV5A 5LHGB 3AA1A 2X9HA 5DL5A 4PFOA 2XE3A 3SY9A 4QXCB 2W61A 3LG7A 2ODUA 1BXWA 3PUQA 4IE5A 3LBXA 2G0UA 4UVAB 2VKJA 4KMCA 3RX6A 2LSJA 3AVSA 3ZC1A 3C4XA 4OYJA 5H6RB 3KVDD 2N9DA 1ORMA 3LBXB 3T20A 4FT6A 3ZC0A 4ISSA 2JMMA 4RLCA 2NW8A 2DWKA 2Y8DA 2HH7A 5JR9B 3GP6A 1KNZA 3HWBA 4XNLA 3VZUX 5GONE 4H9RC 2N1GA 3NZPA 4CXYA 5HYAA 1OPFA 5JDLA 4JFBA 1G90A 5JR9A 2XAFB 4U74A 1VRBA 2D2SA 3J9X1 5CB4E 3L09A 4I55E 4O4JE 4DMWA 3DA3A 2DI4A 5G26A 3HL6A 4AYNA 3AA7B 4IE4A 5F8PA 4GHBA 4AKGA 3MACA 4PNIA 5LYJE 5FY1A 1IZNA 3W15B 1OXZA 1D1BA 3AA7A 4E1SA 5L3GB 4AYDC 3VHLA 5EK2A 2Y0KA 1VOMA 3I9YA 3MXZA 1LKXA 4AKLA 5DL7A 3G7GA 3KDSE 3WI3A 4G2AA 5LXTE 5L3BB 4EYYR 4DBQA 2ZLYA 5JDNA 3O1HA 4CQIA 2Q9QB 3I1AA 3C5OA 3Q5WA 2V7JA 3ZJ2A 2ERVA 4AYEC 7PRNA 3SY7A 2XASB 3WAJA 4HE8A 2I59A 2NWBA 2ODVA 5EK3A 4N78D 4BAYB 3PUSA 3K3OA 3RKOA 5C8YE 5FVNA 3AAAB 2X67A 3K3QC 5JDGA 2C0SA 3AAEB 4WBOA 2YK0A 2JMHA 5J2TE 2XUEA 5LCYA 2LSGA 4HEAA 5LJMA 2E9XA 1MM5A 3RC8A 4ZI7E 3T24A 4LSFA 2YU1A 2KWIB 3VZWX 4X1IE 4D64A 4OFZA 3BQIA 4BJNA 4OHFA 2CWOA 3OBVE 1CUNA 4YLHA 3SRZA 3N9NA 5JDMA 3HOLA 1BR1A 3A2SX 1HX8A 3GN5A 4AUIA 2IAKA 2F1VA 3CQCB 2FGQX 2KWHA 2KZ7A 3P7IA 4GCPA 3GMIA 1FMVA 4XZCA 5HWYA 3ZN0B 4NUUA 2KZ7B 4PK4A 2PJQA 5HAXA 4UIGA 2L9QA 3O1IA 3PURA 2WBLA 2BVMA 4DO0A 3U3IA 4AI6A 2X51A 4QXBB 1ZHXA 1AJ3A 2W80C 5LG4A 5JREA 4FUVA 2X66A 1PHOA 2KXPA 4EZHA 2H7OA 3NRXA 3ZMVB 1D0XA 3VE1A 3O4XE 2J4UP 4H63H 4O4LE 2Q9QC 3MJXA 4UVBB 4H9PC 2A3DA 3QRAA 3AA1B 3I0OA 5DQVA 2LM9A 4DNDA 2XE1A 2ZFGA 3SZVA 3FXDB 1Y64B 4GCQA 2MTQA 4HTEA 3CWZB 1YS5A 3LK42 1S94A 2WAUA 3RYIE 5JR9C 2X9WA 4FOZA 3PUAA 2CEAA 2EHOD 2X9XA 4TV8E 5KX5E 3SS1A 4O49A 2X9YA 2VB6A 3VY9X 4AYID 3EMNX 3ZMSB 4MHCA 4AKMA 3I9WA 2M07A 1HS7A 3V5UA 4D5UA 3N9MA 3N2OA 3SYSA 5LJNA 3DJBA 4PJNA 3UFEA 3UULA 3ZN1B 1QJPA 2ES0A 3IBPA 4AQFC 4FZLA 3C4WA 3TZGA 2KLQA 2JRKA 5LNKA 3UU2A 2Q9QD 2V26A 2IC6A 3E0ZA 3H37A 2KDYA 4ZHQE 4QKNA 1MNEA 2LT3A 2H7VC 3AB3B 3Q2MA 3CX8B 1QJ9A 3C50A 2CM0A 5T5FA 4RJWA 2K0LA 2EHOB 3RYFE 8PRNA 4O4XA 3LFMA 3ZCIA 3N9LA 4GK5E 4KUMB 4AKHA 1ZHYA 2CXFA 4O3WA 2MBGA 1IAPA 1FIOA 3N9QA 3PQUA 3ZPOA 4N59A 2K4TA 4GOUA 1GFNA 4GCSA 3T0SA 2VKHA 5DL6A 2LJLA 5ETWA 4ZS3A 2J1DG 3RRCA 1UX5A 5LHIB 4DVDA 2Y48B 4ZOLE 1G8XA 1US7B 2LOPA 2C5KT 3CPZA 2ODJA 1PRNA 1Z0PA 2Y0HA 4LSEA 1EZ3A 1U4QA 1OWAA 4FZNA 1QUUA 4IHJE 3HW9A 4RLBA 5TAOA 3EDVA 2E9XB 2NW7A 3CVRA 4ZS2A 3QK6A 2H3RA 1MIVA 2NP9A 4H9SE 3UTKA 2P9BA 1H6S1 1FMWA 3LK2A 2MYSA 4O3YA 3KVAA 3C4ZA 4PFPA 3EVYA 1WYBA 3ESLA 3ZCJA 2L8KA 2YINA 3C51A 4H9QC 1MMGA 4ZI2D 3J7Yq 2UXXB 3IF8B 4ISTA 2DLRA 4O2BE 4QX8B 1D0YA 4I50E 5DABA 1GFPA 4XBFB 2XE5A 3AAIA 3UAQA 2DNXA 3CQXC 3R84B 2XAJB 2PORA 4E7SA 1E54A 4RL9A 3S4UA 2YU2A 2OMFA 2CA5A 2PG8A 4MALA 2UXNB 1HTJF 2WSSV 3NZQA 4K0UA 3NSGA 4YJ3E 4P09A 4PUXA 5FY7A 4EAHA 4F4BA 2SPCA 4G76A 2CE7A 4P0AA 5LBQB 3V8UA 2MHLA 2HPJA 4KRAA 4AQFA 3SZDA 2B1EA 4UV8B 2QGSA 4HKAA 2MNHA 2CXLA 4D65A 2ZM8A 4UVCB 2VWAA 5HXSA 1D1AA 5JDQA 5L3FB 4J2CA 3LK3B 4L9IA 3PDYA 2C5JA 3EDUA 3IEEA 3Q9DA 2ZLDA 2JQQA 2KT9A 2DCFA 4QXHB 5LGNB 5LHHB 2KXPB 4WBNE 2QTKA 2LSIA 1ZEEA 2W63A 1T98A 1FEWA 3KFWX 4NUVA 3UUMA 1NWMX 5JDPA 2M06A 1X79A 3KV4A 5IYZE 2IC9A 3P8CD 2NW9A 1BR0A 4X20E 3GA8A 1MMAA 1Q9FA 5AFUL 3VKHA 4CXXA 3RYHE 2XE2A 2E8IA 4H9OC 1BR4A 4YHJA 2LE8A 4FRXA 4KR8A 4FRTA 3B13A 2V7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LK4 2;  2KZ7 A;  3LK3 A;  1IZN A;  3LK4 1;  3AA6 B;  3AAA B;  3AA0 B;  3LK3 B;  3AA7 A;  3AAE B;  2KZ7 B;  4AKR B;  3LK2 B;  3AAE A;  5ADX L;  4AKR A;  2KXP B;  3AA6 A;  3AAA A;  2KXP A;  5AFU K;  1IZN B;  5ADX K;  3AA1 B;  5AFU L;  3LK2 A;  3AA0 A;  3AA1 A;  3AA7 B; 
#chains in the Genus database with same CATH topology
 3K8P C;  3PF1 A;  1QSD A;  5JVD E;  4X66 T;  4LML A;  2BKN A;  3JC6 D;  2CHO A;  1MMD A;  4UEL A;  4A56 A;  5CA1 E;  3N2K E;  3OTO T;  5AQL B;  5FVL A;  2IHR 1;  3HI2 A;  3P50 A;  3RIA A;  3TLT A;  2QA7 A;  4FMS A;  4C90 A;  3FZF B;  1O3X A;  2N2M A;  4O3Z A;  4EYU A;  4UF0 A;  2F4V T;  3AEB A;  2E9X D;  3POU A;  5LBM A;  4HGA A;  3TKL B;  1KNP A;  2IW5 B;  1IZN B;  2O4V A;  4B6X A;  2I0M A;  3AE5 A;  5HXC A;  2LFU A;  2BBJ A;  4XNK A;  3UU4 A;  2E9X C;  3POR A;  4IGU A;  1ZOY A;  5HEH A;  4IL9 A;  5JRC B;  5L3E B;  5LGU B;  4JI8 T;  3UPG A;  4DV1 T;  3T1Y T;  4ANJ A;  3FXE B;  2XTQ A;  3POX A;  2Z6E A;  3PU3 A;  1GFO A;  4PK6 A;  2VL8 A;  1GFQ A;  4IDN A;  3HKD E;  3A0H O;  4LFC T;  3HOE A;  3UT5 E;  2QVA A;  3BQL A;  1WRD A;  1HG5 A;  2NTX A;  5FXZ A;  3VU7 H;  2YDR A;  2V7L A;  3F31 A;  2XSB A;  2FJE A;  2LSK A;  4B3R T;  2VKO A;  2M67 A;  2R8A A;  2XG6 A;  2JIW A;  2J1N A;  5ABG A;  4L5G A;  1UK5 A;  2FJB A;  5H6Q B;  2KND A;  4QX7 B;  2M6I A;  3SOL A;  4Z90 A;  5EK4 A;  3VKG A;  1SA0 E;  5GV0 A;  2WJQ A;  4YFS A;  2L3L A;  2V7K A;  2XQ5 A;  4TZ4 C;  1OED E;  2D5U A;  4IIJ E;  5AQH B;  2WJR A;  2MOZ A;  4LMK A;  3TLS A;  1E2A A;  4QWN B;  3LK2 B;  5AQO B;  1U5P A;  5JQG E;  4ZI3 C;  3HKB E;  1XZY A;  4UXN B;  5ADX K;  2RA1 A;  1KFY A;  1V9D A;  3FB2 A;  2Q9Q A;  3K3N A;  4XAX B;  2YKS A;  2H88 A;  3PGU A;  5HEG A;  4DR5 T;  2PRN A;  3N5L A;  4YSX A;  3U78 A;  2VVN A;  2DHR A;  4ILC A;  2XQ4 A;  3AVR A;  4UV9 B;  1IJ5 A;  2PFV A;  3O1J A;  1BR2 A;  2CCQ A;  4TV9 E;  4HN9 A;  5DJQ C;  4ADZ A;  3FHN A;  4YT0 A;  4CI1 B;  3ETV A;  2W00 A;  2J62 A;  4JI6 T;  2WCA A;  3ZMT B;  2YNK A;  3AA6 A;  5FY0 A;  5L47 A;  4KR4 A;  4BJM A;  3F2E A;  1ZHW A;  4KX6 A;  2V7M A;  2V1D B;  3KV5 A;  5LHG B;  5IWA T;  4YHH T;  2ODU A;  5AQP B;  4IE5 A;  4QH4 A;  2G0U A;  4UVA B;  4KMC A;  3AVS A;  2XSA A;  4OYJ A;  1ORM A;  3LBX B;  3T20 A;  1NEK A;  5ABE A;  4IDO A;  2Y8D A;  2HH7 A;  3HWB A;  1KNZ A;  4B3T T;  3PJA J;  1WCR A;  4U74 A;  1VRB A;  4O4J E;  2DI4 A;  4GHB A;  4PNI A;  3W15 B;  1OXZ A;  1D1B A;  3PUZ F;  3VHL A;  1WFD A;  2UXB T;  1LKX A;  5DL7 A;  3G7G A;  5LXT E;  4EYY R;  4CQI A;  2Q9Q B;  3C5O A;  4AYE C;  4HFH A;  5KAF O;  2CBI A;  3SY7 A;  4DV3 T;  5LMN T;  3AEA A;  2XAS B;  4HE8 A;  2R88 A;  3K3O A;  2LM2 A;  3K3Q C;  4ILA A;  2YK0 A;  4DV2 T;  5LCY A;  2LSG A;  4HEA A;  3RC8 A;  4ZI7 E;  5HEO A;  2YU1 A;  1NEN A;  4X1I E;  4BJN A;  2CWO A;  3OBV E;  1CUN A;  3A2S X;  3RLF F;  3GN5 A;  2F1V A;  3CQC B;  1DU2 A;  4GCP A;  5G38 A;  3GMI A;  1FMV A;  5CGM A;  5B5E O;  4PK4 A;  5HAX A;  3O1I A;  2WBL A;  3UUB A;  4AI6 A;  2X51 A;  1ZHX A;  5LG4 A;  4DR1 T;  4FUV A;  1PHO A;  2H7O A;  3ZMV B;  3O4X E;  4NXM T;  4H9P C;  2A3D A;  2XE1 A;  2ZFG A;  1YS5 A;  3LK4 2;  1S94 A;  2X9W A;  4FOZ A;  3PUA A;  4TV8 E;  3A7M A;  5H2F O;  3ZMS B;  3I9W A;  2M07 A;  1HS7 A;  2UUC T;  3N9M A;  3N2O A;  5LJN A;  2CHN A;  2LKH A;  3RQU A;  3DWO X;  2ES0 A;  4FZL A;  3TZG A;  2KLQ A;  2JRK A;  2Q9Q D;  4QKN A;  3AB3 B;  2EHO B;  8PRN A;  3LFM A;  2XQ3 A;  3PGR A;  3N9L A;  4GK5 E;  4KUM B;  4AKH A;  1ZHY A;  3UU5 A;  5AQI B;  1IAP A;  1FIO A;  3N9Q A;  3PQU A;  3ZPO A;  4N59 A;  4GCS A;  2VKH A;  5DL6 A;  5AQT B;  1QLB A;  2Y48 B;  3AEE A;  4LF5 T;  2ODJ A;  1OWA A;  3AE6 A;  4FZN A;  5TAO A;  3CVR A;  1H6S 1;  2NP9 A;  2P9B A;  4U3C A;  2MYS A;  1Z8U A;  3ESL A;  3P4W A;  2F1C X;  4ZI2 D;  3Q5E A;  5G3A A;  4HWF A;  1FJG T;  2DLR A;  4I50 E;  3UAQ A;  3CQX C;  3S4U A;  4F8H A;  2YU2 A;  2PG8 A;  4K0U A;  3P4S A;  2CE7 A;  5LBQ B;  3V8U A;  2QGS A;  4HKA A;  2MNH A;  2CXL A;  5HXS A;  5JDQ A;  4OX9 T;  4J2C A;  1S5L O;  5FL0 A;  2KT9 A;  1I6Z A;  4NUV A;  3KV4 A;  3P8C D;  2NW9 A;  4KHP T;  1BR0 A;  2VL0 A;  4X20 E;  4CXX A;  2IWW A;  4DV0 T;  4FRX A;  2VB6 A;  3ZC1 A;  1ZKE A;  4ASK A;  2WY2 A;  2ACX A;  2E2A A;  4LSI A;  2W0G A;  3HKE E;  2XAH B;  3AXJ A;  4JEU B;  3A5X A;  4DR6 T;  2XM2 A;  4O4U A;  4GYS A;  4PJL A;  5ABF B;  2BKP A;  4IE7 A;  2V8S V;  2XQY A;  5LOV E;  3PV0 F;  4LFB T;  2LHN A;  3L39 A;  1ZV4 X;  3RC3 A;  4O3X B;  3LSV A;  2N2N A;  4WNK A;  4Z3T A;  2X0L B;  3HR0 A;  4EB6 E;  4GF4 A;  3OYX A;  1J5E T;  2VAS A;  1Q9G A;  2W4X A;  2R4N A;  2WMN A;  4PK5 A;  4JLE A;  4IT4 A;  3WU2 O;  3PRN A;  3MZK B;  4CZZ B;  2CMR A;  3HA4 A;  3VR9 A;  3LJC A;  4HFB A;  4LF9 T;  2LHF A;  5GTH O;  4JUY A;  1T8B A;  4O4H E;  5LA6 E;  2H89 A;  2UU9 T;  3DP7 A;  3IHR A;  1KEY A;  1WLX A;  1P4T A;  4QQ1 A;  3R6N A;  5AQF B;  4JI4 T;  2RP4 A;  1VCS A;  5HEU A;  1YXR A;  2J4G A;  4CXW A;  3QNU A;  2LEH A;  4UEM A;  5JDF A;  3UU6 A;  2VK9 A;  2XAQ B;  2KSR A;  2V5C A;  1LVF A;  4FJO A;  4H63 V;  4FZM A;  3CKD A;  2CRB A;  3QC9 A;  3B5M A;  3M65 A;  3KBT A;  4Z8X A;  2LHR A;  2D0U A;  1IBM T;  2NOX A;  1XMQ T;  5AQM B;  2A72 A;  4ZI3 D;  4IE0 A;  3CQG B;  2IIU A;  3WI4 A;  4A5X A;  4E1T A;  3POQ A;  3PU8 A;  2WQY A;  5L3C B;  5PRN A;  3DWN A;  2XHE B;  2WDV A;  4IDP A;  3MA9 A;  4PW8 A;  4X65 T;  2W62 A;  4AZL A;  4JBW F;  1ZHZ A;  3SYB A;  3CML A;  3O0E A;  3VZT X;  3FBZ A;  3SFE A;  4DMV A;  3C98 B;  3JCF A;  2B76 A;  4WZX A;  4U2Y A;  1ZHC A;  3L3P A;  4IE6 A;  5F3J A;  5GTI O;  1MIY A;  3ZJ1 A;  1HFA A;  4N58 A;  5FVK A;  4U9C A;  3QUJ A;  1UCU A;  4TWD A;  1N33 T;  2XTR A;  4Z91 A;  3O9X A;  5HEJ A;  4LF4 T;  2BBH A;  1T7S A;  4FSO A;  1YKE B;  1BT9 A;  3ZT6 A;  4YTN A;  1XDP A;  2Y2X A;  3KIN B;  3AEC A;  2CLY B;  3B57 A;  1VCT A;  2K5B B;  3ZMU B;  4EED A;  2BVL A;  1KNR A;  2XMX A;  2JPF A;  4FI5 A;  2DWG A;  5DQW A;  1WR6 A;  3RIF A;  4PJJ A;  2ZMA A;  3RF1 A;  2XPK A;  4PFO A;  4QXC B;  3ZT7 A;  3LBX A;  2VKJ A;  3RX6 A;  3ZSS A;  4YSY A;  2N9D A;  4ISS A;  4U33 A;  4RLC A;  2NW8 A;  3GP6 A;  4K3C A;  3NZP A;  4CXY A;  5HYA A;  5JR9 A;  2J47 A;  2LLY A;  3DA3 A;  4DMW A;  5LB7 B;  3FZH B;  2IDO B;  3HL6 A;  5G26 A;  4AYN A;  2FBW A;  3MAC A;  5LYJ E;  1IZN A;  2X9K A;  4E1S A;  5L3G B;  5FKY A;  3L8R A;  2MAW A;  5IUX A;  2JQH A;  3X1D A;  1VOM A;  3KDS E;  5L3B B;  1UGO A;  1XMO T;  7PRN A;  4GKJ T;  1WR0 A;  2ODV A;  3PUS A;  5FVN A;  3AAA B;  2X67 A;  3FZL B;  5JDG A;  2JMH A;  2XUE A;  2QYW A;  2AE9 A;  3VZW X;  4D64 A;  3BQI A;  4YY3 T;  4YLH A;  2WZI A;  1BR1 A;  4NIQ A;  4LF6 T;  1X9B A;  2IAK A;  5KXJ A;  5HWY A;  3UU8 A;  3ZN0 B;  1W09 A;  4NUU A;  2KZ7 B;  3PUR A;  5FL1 A;  2BVM A;  2UUB T;  4QXB B;  1AJ3 A;  4C00 A;  2KXP A;  3VE1 A;  4H63 H;  2Q9Q C;  3MJX A;  3QRA A;  3I0O A;  3ZT5 A;  5DQV A;  2MTQ A;  5AQV B;  5JR9 C;  4CN4 A;  2CEA A;  3K1S A;  3SS1 A;  5AQK B;  3VY9 X;  3EMN X;  4D5U A;  2WU2 A;  3SYS A;  4JI1 T;  3ONJ A;  3ZN1 B;  1QJP A;  2R6G F;  3UU2 A;  2KDY A;  2IML A;  3PJA A;  2LT3 A;  2H7V C;  3Q2M A;  1QJ9 A;  4P1N A;  2DL1 A;  2CM0 A;  5T5F A;  4RJW A;  2K0L A;  3P4P A;  2HHH T;  3ZCI A;  1OED B;  3JAD A;  4O3W A;  2MBG A;  4JV5 T;  2K4T A;  1GFN A;  2LJL A;  1UX5 A;  5LHI B;  4ZOL E;  2LOP A;  2Y0H A;  4LSE A;  1PRN A;  1QUU A;  4IHJ E;  3HW9 A;  3JAF A;  3EDV A;  2E9X B;  4U31 A;  2NW7 A;  2H3R A;  3UTK A;  1WYB A;  4H9Q C;  1MMG A;  3AE1 A;  1D0Y A;  2XE5 A;  2DNX A;  2XAJ B;  2OMF A;  2VUR A;  2UXN B;  3KZI O;  4U7I A;  4DV5 T;  5FY7 A;  4EAH A;  4F4B A;  2SPC A;  2MHL A;  3AEF A;  3SZD A;  3LK3 B;  2NR4 A;  3PDY A;  3EDU A;  3IEE A;  3Q9D A;  2ZLD A;  2JQQ A;  2DCF A;  5LHH B;  2KXP B;  4WBN E;  4X62 T;  1I94 T;  2LSI A;  4YSZ A;  5JDP A;  3OVU A;  4X5T A;  1X79 A;  5IYZ E;  1Q9F A;  2E8I A;  5HCJ A;  4YHJ A;  2BG9 A;  2V7I A;  5CA0 E;  4AQG A;  3QB5 K;  2ACZ A;  1CHU A;  4CI2 B;  2F1T A;  4O8S A;  1OSM A;  4C69 X;  3WAK A;  1D0Z A;  4EXT A;  5IYU A;  3KBU A;  4FQE A;  3ZEF B;  1MND A;  5AFU K;  3PUY F;  4L0R A;  4LSH A;  2X68 A;  4O4I E;  1SHZ C;  3MK7 C;  4IL6 O;  3MKD A;  2PBI A;  2X27 X;  3VE2 A;  2WWU A;  2W2U A;  3ZLI A;  4TWF A;  4WW0 A;  4KBM B;  4CI3 B;  2K48 A;  2LRK A;  3KVB A;  3KV6 A;  5HXE A;  1JNZ A;  5J1G A;  2E5L T;  3QRC A;  2NTY A;  1MM4 A;  4JCH A;  4K0K T;  1YKH B;  2X0H A;  4AIS A;  4H9N C;  3PGS A;  3E22 E;  1N34 T;  1IBK T;  1W0A A;  2K9A A;  2RPA A;  1W9R A;  1WYC A;  5L2L A;  3SFD A;  5AQU B;  2A2F X;  2WU5 A;  3LK3 A;  4C91 A;  4I43 B;  3AA0 B;  1OED C;  4MFR A;  4WYV A;  3JAE A;  1UUS A;  4EIW A;  4GYR A;  5LP6 E;  3EI0 A;  4IDZ A;  5FP3 A;  1HF8 A;  3UU3 A;  4QHO A;  4OK0 A;  3QOF A;  5J0Z A;  3LDQ B;  5KDM C;  3UUN A;  3PUX F;  3T24 A;  2XAG B;  3NRY A;  1B7T A;  1MMN A;  4MLK A;  2HPL A;  3AA6 B;  3PUG A;  1JNR A;  2OA5 A;  2EHO A;  2XQ6 A;  3ZMZ B;  5C3J A;  4TN7 B;  4UB6 O;  4EZ4 A;  5FYM A;  4HFV A;  2WP9 A;  3OYZ A;  3EAB A;  2V6Y B;  1NAF A;  1G73 A;  2BKO A;  4JEH B;  3ONL C;  3Q5X A;  3KV9 A;  2D0T A;  4DBR A;  3CX7 B;  4PJM A;  3RYC E;  4A98 A;  3RPU A;  4O2A E;  3A0B O;  2CBJ A;  5IHY A;  2R4L A;  3T8O A;  1T1L A;  4UB8 O;  5JRC A;  4PR7 A;  3E08 A;  3LK4 1;  3FBL A;  3NBX X;  5FXX A;  4HFC A;  3UFG A;  3JCU O;  4U7Y A;  1M62 A;  4TUY E;  4TX5 A;  4U72 A;  3UQ7 A;  4QH5 A;  3AAE A;  2N2L A;  4KHZ F;  2BS2 A;  3M3Z B;  5AQG B;  1E1H B;  4I4T E;  4YJ2 E;  3PQS A;  2XZE A;  3ZYK A;  1ZHT A;  5FMN A;  5D5D A;  4HFE A;  3RBH A;  1HXT A;  3PTR B;  3FYX A;  4CTD A;  2BS3 A;  4DUY T;  3NWI A;  2CXD A;  5M4Y A;  4M1P A;  4A97 A;  2M6B A;  4X1K E;  4YXD A;  3EHZ A;  3C64 A;  1HNZ T;  1QJ8 A;  1MPF A;  2LOS A;  5FXW A;  5ADX L;  3BK9 A;  5J2U E;  3V5S A;  3UUX B;  5DL8 A;  5LG3 A;  4Q25 A;  3AA1 A;  3CIR A;  3RKG A;  2FUP A;  2W61 A;  5JTG A;  3PUQ A;  2WDQ A;  3KVD D;  3ZC0 A;  2DWK A;  2QRX A;  5JR9 B;  4H9R C;  4JFB A;  5JDL A;  1G90 A;  2XAF B;  5CB4 E;  4I55 E;  4C4V A;  4IE4 A;  5F8P A;  5HCM A;  1N32 T;  2JQK A;  5FY1 A;  3AA7 A;  4HWD A;  3RI5 A;  2W66 A;  5EK2 A;  1XNR T;  2Y0K A;  3ZKR A;  4DR7 T;  3MXZ A;  4AKL A;  2AXD S;  4G2A A;  3O1H A;  4JI0 T;  2V7J A;  3ZJ2 A;  4LF8 T;  3WAJ A;  2NWB A;  4BAY B;  3RKO A;  2YDS A;  3AAE B;  4WBO A;  1KF6 A;  5J2T E;  4I0U A;  5LJM A;  4LSF A;  4TNW A;  4OFZ A;  4OHF A;  3SRZ A;  5JDM A;  4HWC A;  1HNW T;  4HWH A;  5CFB A;  2FGQ X;  2KWH A;  2KZ7 A;  4XZC A;  2MPK A;  3UQ4 A;  4CN6 A;  3U3I A;  2W80 C;  5JRE A;  1L0V A;  2PTF A;  4EZH A;  4CN1 A;  2J4U P;  4O4L E;  1HNX T;  4UVB B;  3AA1 B;  3Q5D A;  4DND A;  2LM9 A;  5C2T A;  3NJT A;  3SZV A;  3FXD B;  5AQN B;  2BG9 E;  2E5V A;  3CWZ B;  1W0B A;  4ZEY A;  2EHO D;  5TIS O;  4MHC A;  4AKM A;  2UXD T;  3DJB A;  3UFE A;  1N36 T;  3IBP A;  2XJ7 A;  5LNK A;  4AYD C;  2V26 A;  3CX8 B;  4COF A;  3RYF E;  4YTM A;  4TWH A;  4IL4 A;  2CXF A;  4LFA T;  5ETW A;  2J1D G;  3RRC A;  2LKG A;  1G8X A;  3CPZ A;  1Z0P A;  1U4Q A;  4JI3 T;  3QK6 A;  1MIV A;  3RQW A;  3LK2 A;  4PFP A;  3EVY A;  3ZCJ A;  2YIN A;  3IF8 B;  4IST A;  4O2B E;  4QX8 B;  3P4R A;  4XBF B;  3AAI A;  3R84 B;  4E7S A;  1E54 A;  4RL9 A;  2CA5 A;  3NZQ A;  3QB5 A;  4IDQ A;  4YJ3 E;  2WZH A;  4PUX A;  4P0A A;  2B1E A;  4UV8 B;  1XDO A;  4D65 A;  2ZM8 A;  2VWA A;  4KI0 F;  2XM1 A;  4L9I A;  1ZP0 A;  1HX1 B;  1T16 A;  2UUA T;  1ZEE A;  2W63 A;  2XQ8 A;  1FEW A;  1NWM X;  2IC9 A;  3GA8 A;  3VKH A;  2XE2 A;  1BR4 A;  4NXN T;  2LE8 A;  4KR8 A;  2A9U A;  2BS4 A;  4P0B A;  5KMG P;  4B61 A;  4ZZB A;  2WWV A;  2HN2 A;  3AE8 A;  4FES A;  2W81 C;  4BUM X;  4AKR A;  2W67 A;  2WMO A;  2R4O A;  6PRN A;  3DTO A;  3TLV A;  5HXH A;  2XQA A;  3FZK B;  5EZY E;  3ZYM A;  2VQF T;  2IUB A;  4ZXL A;  4HFD A;  4E7Z A;  4BA9 A;  3EUH A;  4DR4 T;  2VKD A;  2XTL A;  3ABV A;  4UF0 B;  3JC6 C;  2V6X A;  2Y6X A;  3AAA A;  3OKQ A;  3RH3 A;  3ZYL A;  3DA4 A;  4B3S T;  5E0O A;  2ZM6 T;  5E79 O;  2BDE A;  3VR8 A;  1J1J A;  2VQE T;  1YQ3 A;  3RRW A;  5AQQ B;  3BRZ A;  2K24 A;  4FSP A;  1HR0 T;  1HXX A;  5BR8 T;  4LMJ A;  4AFK A;  4V1A v;  1HCI A;  3N9O A;  4HWI B;  3VRA A;  3IA3 A;  1YD8 G;  3D0T A;  1XNQ T;  4X64 T;  2LSY A;  4GIW A;  3NKZ A;  3ZST A;  3N9P A;  2KIN B;  3CX6 B;  4JI7 T;  3K19 A;  4RJX A;  4JI5 T;  2Y0L A;  5EE2 A;  1MIW A;  2C5I T;  2CLY C;  1IJ6 A;  4ILU A;  4GK0 E;  3AA0 A;  2R89 A;  3BS0 A;  2IWV A;  3ANW A;  2D9D A;  2XQ7 A;  4AKI A;  4G75 A;  1YW0 A;  1HXU A;  4ZI2 C;  5AQS B;  3FZM B;  2JQY A;  2JMK A;  3F57 A;  3DZM A;  5JDH A;  5KAI O;  3GN5 B;  2Y7S A;  3WI5 A;  1H7C A;  3PUW F;  1BH3 A;  1KK7 A;  2BG9 C;  2WDR A;  4U2Z A;  4K3B A;  2JJ9 A;  4YTP A;  4ZZC A;  4QH1 A;  3AE3 A;  5G39 A;  2KC0 A;  4AKR B;  4AYM C;  4EOZ B;  4DV4 T;  5CJ5 A;  3OPC A;  2GE4 A;  1OED A;  5JH7 E;  4OYK A;  3GWH A;  5HXR A;  1Y01 A;  2V6Y A;  4UR9 A;  5HWX A;  3PE0 A;  4IRE A;  2FGR A;  5A1L A;  2WM9 A;  3TLU A;  5LGT B;  2FJD A;  2I6H A;  1HG2 A;  4F6R C;  2YEV C;  2CWY A;  2WVP A;  4PAG A;  1R8I A;  5BMV E;  3RHW A;  4KP3 C;  2ZM2 A;  3G06 A;  2BZB A;  1UX4 A;  4ILB A;  3OJA A;  3TLW A;  5L3D B;  1LRZ A;  4MBQ A;  2KMF A;  4JYA T;  1THQ A;  3HKC E;  1S35 A;  2AXT O;  5B66 O;  4HFI A;  3ANW B;  1D1C A;  3AED A;  5FNV E;  3AE7 A;  2JQ9 A;  2EHO C;  2GK9 A;  3ETU A;  3SWH A;  3H3A A;  3I0Q A;  4X1Y E;  5AQJ B;  4AXP A;  1LVK A;  3N2G E;  1GFM A;  2BG9 B;  3JTY A;  2ZM0 A;  2YPV A;  3BQK A;  2YOE A;  3H3M A;  5L4E A;  3VY8 X;  3VRB A;  3ONX A;  4G63 A;  5F5W A;  4B3M T;  5FXV A;  4ERR A;  3T1H T;  2YN6 A;  2X9H A;  4N75 A;  5DL5 A;  2XE3 A;  3SY9 A;  3LG7 A;  1BXW A;  2X0Y A;  2LSJ A;  3C4X A;  5H6R B;  4EEB A;  4FT6 A;  3AE9 A;  2JMM A;  4XNL A;  3VZU X;  5GON E;  2N1G A;  1OPF A;  4C4V B;  2D2S A;  3J9X 1;  3L09 A;  3AXJ B;  3AA7 B;  5ABH A;  4AKG A;  2WB5 A;  5ABF A;  4JI2 T;  1IBL T;  2LRL A;  4PJ0 O;  3I9Y A;  2WS3 A;  2XQ9 A;  3WI3 A;  2XY8 B;  3BRY A;  4DBQ A;  2ZLY A;  5JDN A;  4AQY T;  3I1A A;  3Q5W A;  2ERV A;  5EK3 A;  2I59 A;  4N78 D;  5C8Y E;  3RGL A;  2VVS A;  2C0S A;  2E9X A;  1MM5 A;  2KWI B;  1SE7 A;  3N9N A;  3HOL A;  5LMU T;  1HX8 A;  4AUI A;  3P7I A;  4AIU A;  1YQ4 A;  2PJQ A;  4UIG A;  2L9Q A;  2R4P A;  4DO0 A;  2X66 A;  1J5W A;  3NRX A;  1GQE A;  1D0X A;  3P4Q A;  1Y64 B;  4GCQ A;  3NVO A;  4HTE A;  3AE4 A;  2WAU A;  3RYI E;  2X9X A;  1E7P A;  5KX5 E;  4O49 A;  2X9Y A;  1SUM B;  4AYI D;  4TNV A;  3V5U A;  5L4H A;  4PJN A;  5AQR B;  3UUL A;  4AQF C;  3RIU A;  3C4W A;  2IC6 A;  3E0Z A;  3H37 A;  4ZHQ E;  1MNE A;  4GKK T;  3C50 A;  3RIU C;  4O4X A;  2YDQ A;  4GOU A;  3T0S A;  4ZS3 A;  4DVD A;  1M7K A;  4LF7 T;  1US7 B;  2C5K T;  2K3W A;  1EZ3 A;  4RLB A;  2OV9 A;  4ZS2 A;  2UXC T;  4H9S E;  4O3Y A;  3A8Y C;  1FMW A;  4NPP A;  3KVA A;  3AEG A;  3C4Z A;  2L8K A;  3C51 A;  2HN1 A;  3J7Y q;  2UXX B;  5DAB A;  1GFP A;  4EV6 A;  2POR A;  4MAL A;  2WSS V;  1HTJ F;  3NSG A;  1T72 A;  4P09 A;  2OLT A;  2V5D A;  4G76 A;  2HPJ A;  4KRA A;  3PUV F;  4DR2 T;  3EAM A;  4AQF A;  4DV7 T;  3CK6 A;  4DV6 T;  4UVC B;  5L3F B;  1D1A A;  4EGW A;  2C5J A;  3AE2 A;  4DID B;  1UUR A;  2FJA A;  4DR3 T;  4QXH B;  4DUZ T;  5LGN B;  4N74 A;  2QTK A;  1T98 A;  3KFW X;  2CPT A;  3UUM A;  2M06 A;  1XWM A;  1MMA A;  5AFU L;  3RYH E;  4H9O C;  4FRT A;  3B13 A; 
#chains in the Genus database with same CATH homology
 1ZKE A;  4P0B A;  4ASK A;  5CA0 E;  3K8P C;  5KMG P;  4B61 A;  2ACX A;  4AQG A;  4FES A;  4LSI A;  1QSD A;  5JVD E;  2W0G A;  3HKE E;  2W81 C;  4CI2 B;  4BUM X;  2XAH B;  3JC6 D;  4JEU B;  2F1T A;  3A5X A;  4O8S A;  4AKR A;  1MMD A;  4UEL A;  1OSM A;  4C69 X;  3WAK A;  4A56 A;  3N2K E;  1D0Z A;  4GYS A;  4PJL A;  4EXT A;  5CA1 E;  4O4U A;  3KBU A;  5IYU A;  2WMO A;  4IE7 A;  3ZEF B;  1MND A;  5AFU K;  6PRN A;  4L0R A;  3DTO A;  4LSH A;  2X68 A;  3HI2 A;  4O4I E;  5HXH A;  2XQY A;  2QA7 A;  5LOV E;  1SHZ C;  3MK7 C;  2LHN A;  3MKD A;  2PBI A;  1ZV4 X;  5EZY E;  3RC3 A;  3ZYM A;  4FMS A;  4O3X B;  4C90 A;  2X27 X;  3VE2 A;  4E7Z A;  2N2N A;  4WNK A;  4Z3T A;  1O3X A;  2WWU A;  2N2M A;  2X0L B;  3HR0 A;  4BA9 A;  4UF0 A;  4EYU A;  4EB6 E;  4O3Z A;  3EUH A;  3ZLI A;  2E9X D;  3POU A;  4GF4 A;  2VKD A;  5LBM A;  2XTL A;  3OYX A;  4HGA A;  4UF0 B;  4WW0 A;  3TKL B;  3JC6 C;  2VAS A;  4KBM B;  1Q9G A;  2Y6X A;  4CI3 B;  2K48 A;  3AAA A;  2WMN A;  2IW5 B;  3OKQ A;  1IZN B;  3KVB A;  4PK5 A;  3RH3 A;  3ZYL A;  2O4V A;  4JLE A;  3DA4 A;  3KV6 A;  5E0O A;  5HXE A;  5J1G A;  3QRC A;  4B6X A;  3PRN A;  3MZK B;  4CZZ B;  2BDE A;  2CMR A;  3HA4 A;  2NTY A;  3RRW A;  5HXC A;  1MM4 A;  4FSP A;  2K24 A;  4JCH A;  1HXX A;  3LJC A;  1YKH B;  2LFU A;  4XNK A;  2LHF A;  4H9N C;  4AFK A;  4JUY A;  2E9X C;  3POR A;  4V1A v;  4IGU A;  4O4H E;  1HCI A;  3E22 E;  3N9O A;  5LA6 E;  1YD8 G;  3D0T A;  2LSY A;  4GIW A;  2K9A A;  5JRC B;  5L3E B;  3DP7 A;  5LGU B;  3UPG A;  3IHR A;  1WYC A;  3N9P A;  2KIN B;  4ANJ A;  3FXE B;  3CX6 B;  2XTQ A;  3K19 A;  5L2L A;  3POX A;  4RJX A;  2Y0L A;  5EE2 A;  2Z6E A;  1MIW A;  3PU3 A;  1WLX A;  4PK6 A;  1GFO A;  2C5I T;  2A2F X;  2CLY C;  1P4T A;  4QQ1 A;  1IJ6 A;  2VL8 A;  4ILU A;  4GK0 E;  3R6N A;  1GFQ A;  3AA0 A;  3LK3 A;  2RP4 A;  3ANW A;  3HKD E;  4C91 A;  4AKI A;  4G75 A;  4I43 B;  3HOE A;  3AA0 B;  1YW0 A;  1HXU A;  4CXW A;  3UT5 E;  4MFR A;  4ZI2 C;  2LEH A;  4UEM A;  4EIW A;  4GYR A;  5LP6 E;  5JDF A;  3BQL A;  1WRD A;  1HG5 A;  4IDZ A;  5FP3 A;  1HF8 A;  4QHO A;  2JMK A;  3F57 A;  2VK9 A;  2NTX A;  3GN5 B;  5JDH A;  4OK0 A;  5FXZ A;  2Y7S A;  3WI5 A;  3VU7 H;  1H7C A;  2XAQ B;  1BH3 A;  1KK7 A;  2V7L A;  3F31 A;  5KDM C;  2LSK A;  3UUN A;  2VKO A;  1LVF A;  2M67 A;  2XAG B;  4FJO A;  4H63 V;  3NRY A;  1B7T A;  3CKD A;  2XG6 A;  4FZM A;  2J1N A;  4L5G A;  1MMN A;  3QC9 A;  2JJ9 A;  4MLK A;  5H6Q B;  2HPL A;  3M65 A;  3AA6 B;  3KBT A;  3PUG A;  4Z8X A;  2LHR A;  2D0U A;  2KC0 A;  2KND A;  4AKR B;  4QX7 B;  4AYM C;  2NOX A;  4EOZ B;  3SOL A;  5EK4 A;  3VKG A;  1SA0 E;  2A72 A;  2OA5 A;  2EHO A;  4YFS A;  4ZI3 D;  5GV0 A;  4IE0 A;  3ZMZ B;  3CQG B;  2L3L A;  2GE4 A;  5JH7 E;  2V7K A;  4TN7 B;  4TZ4 C;  3WI4 A;  4OYK A;  4EZ4 A;  3GWH A;  5HXR A;  2D5U A;  4E1T A;  3POQ A;  5FYM A;  3PU8 A;  4HFV A;  4IIJ E;  5HWX A;  3PE0 A;  2MOZ A;  5L3C B;  3OYZ A;  2FGR A;  5A1L A;  2WM9 A;  5PRN A;  1NAF A;  1G73 A;  5LGT B;  4JEH B;  2XHE B;  1HG2 A;  4F6R C;  4QWN B;  3LK2 B;  3MA9 A;  4PW8 A;  2W62 A;  3Q5X A;  4AZL A;  2YEV C;  1U5P A;  3KV9 A;  5JQG E;  2D0T A;  4DBR A;  1ZHZ A;  4ZI3 C;  2CWY A;  3SYB A;  3CML A;  3HKB E;  3CX7 B;  3O0E A;  3VZT X;  3FBZ A;  4PJM A;  3RYC E;  3RPU A;  4PAG A;  4UXN B;  5ADX K;  2RA1 A;  4O2A E;  1V9D A;  4DMV A;  3C98 B;  3FB2 A;  5IHY A;  2Q9Q A;  3T8O A;  3K3N A;  5BMV E;  4XAX B;  5JRC A;  4KP3 C;  2ZM2 A;  2BZB A;  3E08 A;  3LK4 1;  3FBL A;  1UX4 A;  1ZHC A;  3NBX X;  3L3P A;  5FXX A;  3OJA A;  4TUY E;  4U72 A;  4TX5 A;  4IE6 A;  5L3D B;  5F3J A;  3AAE A;  1LRZ A;  2N2L A;  4MBQ A;  1MIY A;  2KMF A;  5D5D A;  2PRN A;  1E1H B;  1HFA A;  4I4T E;  3ZJ1 A;  4YJ2 E;  3N5L A;  3PQS A;  4N58 A;  3ZYK A;  3U78 A;  5FMN A;  1THQ A;  3HKC E;  1S35 A;  3QUJ A;  1ZHT A;  2DHR A;  4U9C A;  1UCU A;  3RBH A;  3AVR A;  1HXT A;  3PTR B;  3FYX A;  3ANW B;  1D1C A;  2XTR A;  4UV9 B;  3O9X A;  1IJ5 A;  2PFV A;  3O1J A;  2CXD A;  5FNV E;  1BR2 A;  4M1P A;  5M4Y A;  2CCQ A;  4FSO A;  4TV9 E;  4HN9 A;  1YKE B;  5DJQ C;  4ADZ A;  1BT9 A;  2EHO C;  4X1K E;  2GK9 A;  3ETU A;  3FHN A;  3SWH A;  3C64 A;  3H3A A;  3I0Q A;  4X1Y E;  4AXP A;  1LVK A;  3N2G E;  1GFM A;  4CI1 B;  2Y2X A;  3KIN B;  1QJ8 A;  1MPF A;  2LOS A;  2CLY B;  3B57 A;  2K5B B;  3ETV A;  2W00 A;  5FXW A;  3ZMU B;  5ADX L;  2BVL A;  3JTY A;  2ZM0 A;  2YPV A;  3BQK A;  3BK9 A;  3ZMT B;  5J2U E;  2XMX A;  2YNK A;  3AA6 A;  2JPF A;  4FI5 A;  3V5S A;  3UUX B;  5FY0 A;  3VY8 X;  2DWG A;  5DQW A;  5DL8 A;  3ONX A;  1WR6 A;  4G63 A;  4KR4 A;  4BJM A;  3F2E A;  1ZHW A;  2V7M A;  4PJJ A;  2ZMA A;  2V1D B;  5FXV A;  4ERR A;  3KV5 A;  5LHG B;  3AA1 A;  2X9H A;  5DL5 A;  4PFO A;  2XE3 A;  3SY9 A;  4QXC B;  2W61 A;  3LG7 A;  2ODU A;  1BXW A;  3PUQ A;  4IE5 A;  3LBX A;  2G0U A;  4UVA B;  2VKJ A;  4KMC A;  3RX6 A;  2LSJ A;  3AVS A;  3ZC1 A;  3C4X A;  4OYJ A;  5H6R B;  3KVD D;  2N9D A;  1ORM A;  3LBX B;  3T20 A;  4FT6 A;  3ZC0 A;  4ISS A;  2JMM A;  4RLC A;  2NW8 A;  2DWK A;  2Y8D A;  2HH7 A;  5JR9 B;  3GP6 A;  1KNZ A;  3HWB A;  4XNL A;  3VZU X;  5GON E;  4H9R C;  2N1G A;  3NZP A;  4CXY A;  5HYA A;  1OPF A;  5JDL A;  4JFB A;  1G90 A;  5JR9 A;  2XAF B;  4U74 A;  1VRB A;  2D2S A;  3J9X 1;  5CB4 E;  3L09 A;  4I55 E;  4O4J E;  4DMW A;  3DA3 A;  2DI4 A;  5G26 A;  3HL6 A;  4AYN A;  3AA7 B;  4IE4 A;  5F8P A;  4GHB A;  4AKG A;  3MAC A;  4PNI A;  5LYJ E;  5FY1 A;  1IZN A;  3W15 B;  1OXZ A;  1D1B A;  3AA7 A;  4E1S A;  5L3G B;  4AYD C;  3VHL A;  5EK2 A;  2Y0K A;  1VOM A;  3I9Y A;  3MXZ A;  1LKX A;  4AKL A;  5DL7 A;  3G7G A;  3KDS E;  3WI3 A;  4G2A A;  5LXT E;  5L3B B;  4EYY R;  4DBQ A;  2ZLY A;  5JDN A;  3O1H A;  4CQI A;  2Q9Q B;  3I1A A;  3C5O A;  3Q5W A;  2V7J A;  3ZJ2 A;  2ERV A;  4AYE C;  7PRN A;  3SY7 A;  2XAS B;  3WAJ A;  4HE8 A;  2I59 A;  2NWB A;  2ODV A;  5EK3 A;  4N78 D;  4BAY B;  3PUS A;  3K3O A;  3RKO A;  5C8Y E;  5FVN A;  3AAA B;  2X67 A;  3K3Q C;  5JDG A;  2C0S A;  3AAE B;  4WBO A;  2YK0 A;  2JMH A;  5J2T E;  2XUE A;  5LCY A;  2LSG A;  4HEA A;  5LJM A;  2E9X A;  1MM5 A;  3RC8 A;  4ZI7 E;  3T24 A;  4LSF A;  2YU1 A;  2KWI B;  3VZW X;  4X1I E;  4D64 A;  4OFZ A;  3BQI A;  4BJN A;  4OHF A;  2CWO A;  3OBV E;  1CUN A;  4YLH A;  3SRZ A;  3N9N A;  5JDM A;  3HOL A;  1BR1 A;  3A2S X;  1HX8 A;  3GN5 A;  4AUI A;  2IAK A;  2F1V A;  3CQC B;  2FGQ X;  2KWH A;  2KZ7 A;  3P7I A;  4GCP A;  3GMI A;  1FMV A;  4XZC A;  5HWY A;  3ZN0 B;  4NUU A;  2KZ7 B;  4PK4 A;  2PJQ A;  5HAX A;  4UIG A;  2L9Q A;  3O1I A;  3PUR A;  2WBL A;  2BVM A;  4DO0 A;  3U3I A;  4AI6 A;  2X51 A;  4QXB B;  1ZHX A;  1AJ3 A;  2W80 C;  5LG4 A;  5JRE A;  4FUV A;  2X66 A;  1PHO A;  2KXP A;  4EZH A;  2H7O A;  3NRX A;  3ZMV B;  1D0X A;  3VE1 A;  3O4X E;  2J4U P;  4H63 H;  4O4L E;  2Q9Q C;  3MJX A;  4UVB B;  4H9P C;  2A3D A;  3QRA A;  3AA1 B;  3I0O A;  5DQV A;  2LM9 A;  4DND A;  2XE1 A;  2ZFG A;  3SZV A;  3FXD B;  1Y64 B;  4GCQ A;  2MTQ A;  4HTE A;  3CWZ B;  1YS5 A;  3LK4 2;  1S94 A;  2WAU A;  3RYI E;  5JR9 C;  2X9W A;  4FOZ A;  3PUA A;  2CEA A;  2EHO D;  2X9X A;  4TV8 E;  5KX5 E;  3SS1 A;  4O49 A;  2X9Y A;  2VB6 A;  3VY9 X;  4AYI D;  3EMN X;  3ZMS B;  4MHC A;  4AKM A;  3I9W A;  2M07 A;  1HS7 A;  3V5U A;  4D5U A;  3N9M A;  3N2O A;  3SYS A;  5LJN A;  3DJB A;  4PJN A;  3UFE A;  3UUL A;  3ZN1 B;  1QJP A;  2ES0 A;  3IBP A;  4AQF C;  4FZL A;  3C4W A;  3TZG A;  2KLQ A;  2JRK A;  5LNK A;  3UU2 A;  2Q9Q D;  2V26 A;  2IC6 A;  3E0Z A;  3H37 A;  2KDY A;  4ZHQ E;  4QKN A;  1MNE A;  2LT3 A;  2H7V C;  3AB3 B;  3Q2M A;  3CX8 B;  1QJ9 A;  3C50 A;  2CM0 A;  5T5F A;  4RJW A;  2K0L A;  2EHO B;  3RYF E;  8PRN A;  4O4X A;  3LFM A;  3ZCI A;  3N9L A;  4GK5 E;  4KUM B;  4AKH A;  1ZHY A;  2CXF A;  4O3W A;  2MBG A;  1IAP A;  1FIO A;  3N9Q A;  3PQU A;  3ZPO A;  4N59 A;  2K4T A;  4GOU A;  1GFN A;  4GCS A;  3T0S A;  2VKH A;  5DL6 A;  2LJL A;  5ETW A;  4ZS3 A;  2J1D G;  3RRC A;  1UX5 A;  5LHI B;  4DVD A;  2Y48 B;  4ZOL E;  1G8X A;  1US7 B;  2LOP A;  2C5K T;  3CPZ A;  2ODJ A;  1PRN A;  1Z0P A;  2Y0H A;  4LSE A;  1EZ3 A;  1U4Q A;  1OWA A;  4FZN A;  1QUU A;  4IHJ E;  3HW9 A;  4RLB A;  5TAO A;  3EDV A;  2E9X B;  2NW7 A;  3CVR A;  4ZS2 A;  3QK6 A;  2H3R A;  1MIV A;  2NP9 A;  4H9S E;  3UTK A;  2P9B A;  1H6S 1;  1FMW A;  3LK2 A;  2MYS A;  4O3Y A;  3KVA A;  3C4Z A;  4PFP A;  3EVY A;  1WYB A;  3ESL A;  3ZCJ A;  2L8K A;  2YIN A;  3C51 A;  4H9Q C;  1MMG A;  4ZI2 D;  3J7Y q;  2UXX B;  3IF8 B;  4IST A;  2DLR A;  4O2B E;  4QX8 B;  1D0Y A;  4I50 E;  5DAB A;  1GFP A;  4XBF B;  2XE5 A;  3AAI A;  3UAQ A;  2DNX A;  3CQX C;  3R84 B;  2XAJ B;  2POR A;  4E7S A;  1E54 A;  4RL9 A;  3S4U A;  2YU2 A;  2OMF A;  2CA5 A;  2PG8 A;  4MAL A;  2UXN B;  1HTJ F;  2WSS V;  3NZQ A;  4K0U A;  3NSG A;  4YJ3 E;  4P09 A;  4PUX A;  5FY7 A;  4EAH A;  4F4B A;  2SPC A;  4G76 A;  2CE7 A;  4P0A A;  5LBQ B;  3V8U A;  2MHL A;  2HPJ A;  4KRA A;  4AQF A;  3SZD A;  2B1E A;  4UV8 B;  2QGS A;  4HKA A;  2MNH A;  2CXL A;  4D65 A;  2ZM8 A;  4UVC B;  2VWA A;  5HXS A;  1D1A A;  5JDQ A;  5L3F B;  4J2C A;  3LK3 B;  4L9I A;  3PDY A;  2C5J A;  3EDU A;  3IEE A;  3Q9D A;  2ZLD A;  2JQQ A;  2KT9 A;  2DCF A;  4QXH B;  5LGN B;  5LHH B;  2KXP B;  4WBN E;  2QTK A;  2LSI A;  1ZEE A;  2W63 A;  1T98 A;  1FEW A;  3KFW X;  4NUV A;  3UUM A;  1NWM X;  5JDP A;  2M06 A;  1X79 A;  3KV4 A;  5IYZ E;  2IC9 A;  3P8C D;  2NW9 A;  1BR0 A;  4X20 E;  3GA8 A;  1MMA A;  1Q9F A;  5AFU L;  3VKH A;  4CXX A;  3RYH E;  2XE2 A;  2E8I A;  4H9O C;  1BR4 A;  4YHJ A;  2LE8 A;  4FRX A;  4KR8 A;  4FRT A;  3B13 A;  2V7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...