3LK2B

Crystal structure of capz bound to the uncapping motif from carmil
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
242
structure length
242
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
publication title Structural characterization of a capping protein interaction motif defines a family of actin filament regulators
doi rcsb
source organism Gallus gallus
total genus 79
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lk2B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3lk2B02
5ADXK 5ADXL 3LK3A 3AA1A 3AA6B 3AAEB 2KZ7A 3LK2A 1IZNA 3AA7A 3AA0A 2KXPA 4AKRB 3AAAB 5AFUK 3AA0B 3LK41 5AFUL 3LK42 3AA6A 3AAEA 3LK3B 3AA1B 3LK2B 1IZNB 2KZ7B 3AA7B 4AKRA 3AAAA 2KXPB
chains in the Genus database with same CATH superfamily
2LSGA 2LOPA 3E22E 3SZDA 3VR8A 1MMAA 2JQQA 3VE2A 1JNRA 2ACZA 1WCRA 5FYMA 3ZYLA 2W4XA 2V26A 2PRNA 3ZSSA 4JI5T 3AE9A 3Q9DA 1MMNA 2V7KA 3PUAA 3FZKB 3HW9A 3SWHA 2Z6EA 2IWWA 3ETUA 3PU8A 3NRXA 4N59A 4ZI3D 3O1HA 5IYZE 2XSBA 3KFWX 4TNVA 4BA9A 1U4QA 1I94T 4AKLA 1UX4A 4G63A 2WMNA 1FJGT 1W09A 4RJWA 4QXHB 1G90A 1U5PA 5FMNA 3IBPA 3LK2A 4PJJA 5JVDE 2ERVA 3FZLB 1THQA 3KDSE 2D5UA 4PK6A 4KR8A 2XY8B 2ZM8A 3D0TA 2CBIA 3J7Yq 4O3XB 5AQRB 2CWYA 4COFA 3MA9A 1N32T 3ZMZB 4KMCA 2CBJA 3WAKA 5DL8A 4IHJE 1KNPA 2DL1A 1IJ6A 3I0QA 3AB3B 3DWNA 3A5XA 1Z0PA 2GE4A 3F2EA 2MBGA 2H7VC 2LHRA 4H9PC 1J5ET 2LKHA 4Z90A 2MAWA 3RKOA 3LSVA 3QRCA 3FZFB 5ABEA 4AUIA 2X9KA 2CMRA 3SYSA 3GN5A 2VKJA 3O4XE 5CJ5A 3OBVE 5C8YE 3RQUA 4DV7T 4ZI3C 3ZEFB 2PJQA 4ZXLA 2R89A 1HXXA 2WM9A 4ADZA 2ZLYA 5AQSB 2H89A 1QJPA 1Y64B 3RBHA 5B5EO 2ACXA 3AA0B 3N9NA 4GKJT 3A2SX 1NWMX 3OJAA 3FXEB 3MXZA 2VVNA 1UK5A 3ABVA 3TLSA 2X27X 3ZMVB 2WMOA 4IL9A 3ETVA 2XAQB 4JI2T 4HFEA 2IC6A 4IDQA 5EE2A 4J2CA 4AQGA 4BAYB 3E08A 2WDQA 4DR5T 3CQXC 3RKGA 3OTOT 3BS0A 3WI5A 3PUZF 2J62A 3RC3A 5TISO 3L3PA 4ASKA 5ADXK 2R4OA 2QA7A 3HKEE 4E1SA 5ABFA 4DO0A 3P50A 4KX6A 2ZM2A 5L2LA 3POQA 2B76A 3BRYA 3AEBA 2C0SA 2DWGA 4DBRA 2OLTA 3F31A 4GHBA 3UUBA 5AQGB 4YHHT 1MM4A 1IBKT 3Q5WA 3JAEA 4HN9A 2E2AA 3PDYA 2LLYA 2XQ8A 5EK3A 1N36T 3IF8B 2QTKA 4AYID 4C4VA 4IDNA 1GFQA 3AA6A 3SY7A 3N2KE 4AZLA 5HEUA 4B3ST 5IHYA 3RIFA 2V6XA 1R8IA 1W9RA 4DR3T 4EB6E 4HWHA 4YSZA 2XM1A 1XDOA 4DR7T 1AJ3A 3AEDA 1GFOA 5L4EA 3QC9A 4AYMC 3UU5A 2KXPA 4RL9A 4NXMT 1UURA 4B61A 2BG9E 4HWIB 2WY2A 3SZVA 1KF6A 3K1SA 2IC9A 2XTRA 3AVRA 1G8XA 3VZTX 2DNXA 4P0BA 1T72A 2XQAA 2K9AA 2CXDA 2VWAA 3RF1A 1MMGA 4UXNB 3CX6B 5C2TA 1GFNA 4P1NA 2BS2A 4YXDA 3SY9A 3SFEA 3ZT7A 5AQOB 3UTKA 1MNDA 2WWVA 3I0OA 4HGAA 1HXTA 2JQKA 3QK6A 3BQKA 5L3DB 4OFZA 4I0UA 1XNRT 4PAGA 2EHOB 2OA5A 3EDVA 4DMWA 2XQ9A 4QXCB 1GQEA 2Q9QC 3AE6A 1J5WA 3C50A 4LF4T 3V5SA 2O4VA 3LFMA 3AA1A 2SPCA 4XZCA 3AAIA 2VASA 3I1AA 4PFOA 3G06A 4TN7B 1IBLT 4KBMB 3AAAB 2ODVA 2WAUA 3J9X1 4FUVA 4H9SE 4U2ZA 4LMLA 3O9XA 4F6RC 3RPUA 5LBQB 3UU2A 4C91A 4JBWF 3ANWB 4GOUA 3E0ZA 4B3RT 3ZMTB 1T1LA 3AE2A 5KAIO 3NKZA 4DV6T 2YU1A 4N74A 2E9XB 2XTLA 2UU9T 5LHHB 3ZPOA 1MIYA 3DTOA 3TZGA 5HEJA 4AKRA 5HEHA 2W80C 4IE4A 2R4LA 4AXPA 2LSIA 1OSMA 2R8AA 5J2UE 3AA7A 4HTEA 4CN4A 5JQGE 4LMJA 2YK0A 3EDUA 4AYEC 2V6YA 2W62A 3ZN1B 4P0AA 2Y2XA 3UU4A 2VQET 4LSIA 3UUMA 3QB5K 4EAHA 2UXBT 5JDFA 4ZOLE 2YKSA 3ZLIA 2WZIA 5B66O 5C3JA 3ZC1A 3VE1A 2XAHB 4O2AE 4AKGA 2A9UA 1XZYA 2PFVA 3O0EA 4IDOA 2ODUA 2BDEA 1O3XA 4DV5T 3NWIA 4HFCA 3W15B 1OXZA 1T16A 4AISA 2R6GF 4F4BA 1M62A 5JDHA 1P4TA 2YOEA 2ZMAA 4L9IA 2P9BA 4HFIA 2AXDS 2DCFA 3LJCA 3QNUA 3RYHE 4ZI2D 5CB4E 3JC6D 5J0ZA 2XE2A 3ZJ2A 3AE1A 2X9YA 2IWVA 4AI6A 2X67A 3HOEA 3POUA 1YD8G 2XG6A 4DR2T 3P4PA 4YJ2E 4UF0A 3ONJA 2UUAT 5JRCA 3VZWX 1J1JA 3L09A 2A72A 1BR0A 3A0HO 2ZM6T 3P8CD 4C90A 4DIDB 1S5LO 2UUCT 4C69X 4MFRA 3L8RA 3RRWA 4ILBA 2M6IA 2WP9A 5L3CB 5FY0A 5DQVA 1HR0T 3NZQA 5LHGB 1WYBA 1MIWA 2FJBA 5AFUK 4BJMA 5JDQA 4FZLA 4X1KE 3AE7A 3FZMB 2X0HA 1IBMT 2FGRA 2I59A 5G26A 5JREA 4H9OC 2M6BA 4JLEA 4U31A 3OPCA 4WW0A 2RA1A 4DV2T 4BUMX 4AKHA 4N75A 4GK5E 5LMUT 1SHZC 2WU2A 3KVDD 4ZI2C 3VZUX 3JC6C 2LOSA 3K3OA 2XQ7A 2D2SA 2FJEA 3DA4A 5F3JA 3P4SA 1ZHTA 2LKGA 5GONE 1QJ8A 3WAJA 4PNIA 3CK6A 4HWDA 6PRNA 2YU2A 1D0YA 2Y48B 4BJNA 2WDRA 5HCMA 4KUMB 5JDMA 4EGWA 2MOZA 3FHNA 4HWCA 4CN1A 5A1LA 4X1IE 3ZT6A 2L9QA 5GV0A 2XQ3A 5H6QB 2W00A 4PR7A 3HI2A 1WR0A 3BRZA 5HWYA 4JI1T 1YQ4A 1D0XA 4IREA 3DJBA 1US7B 4C00A 3NZPA 4XAXB 4B3TT 2MPKA 5DL5A 1LVKA 5L4HA 2EHOD 1YKEB 1ZOYA 1H6S1 2IDOB 2VVSA 3CMLA 3UT5E 1XMQT 3FBLA 4HFDA 4F8HA 5AQTB 4Z3TA 5KAFO 3AA0A 5AQUB 1UGOA 2BKNA 1ZEEA 1BXWA 4KP3C 4EZ4A 2JMMA 5H2FO 1IJ5A 3CIRA 3ZJ1A 3GMIA 5LMNT 4X20E 2V5DA 2M67A 3JCUO 2BG9B 4O4LE 3ONXA 2A3DA 3SFDA 2WCAA 4GF4A 4V1Av 2Y0HA 1HFAA 5AQFB 2V7JA 2UUBT 4CN6A 5FXXA 3OVUA 2N2MA 3SYBA 1G73A 4CZZB 1XMOT 2XAJB 2YPVA 2YEVC 3EMNX 5IYUA 4OX9T 2E9XD 4U2YA 4X64T 2W81C 2IIUA 2IW5B 4IL6O 2X51A 4PJLA 2V1DB 3LK42 1CHUA 3T1HT 3M3ZB 4JI8T 3Q5DA 3T8OA 4FJOA 3AE8A 3PUVF 3V5UA 2M07A 1LRZA 4CQIA 1KNRA 3QOFA 4CI2B 4A98A 4FESA 3RIAA 4IL4A 1HCIA 1WRDA 4OYKA 2WVPA 3CKDA 1LVFA 5TAOA 4OYJA 3IEEA 3N9MA 4E7ZA 3UULA 3C51A 4DUZT 2EHOC 3T0SA 4KRAA 4PJ0O 4RLCA 5F8PA 3QB5A 1NEKA 4IT4A 1BR1A 3EAMA 4UEMA 1X9BA 3LBXB 4LFBT 2HHHT 8PRNA 3CPZA 1M7KA 4DMVA 3R6NA 2XM2A 3EHZA 4I55E 4WYVA 3JTYA 5LJMA 2NWBA 3RQWA 4YTNA 3PGUA 4U7IA 3AXJB 2UXNB 4WZXA 3NJTA 2JQ9A 5L3GB 3LK2B 2LE8A 3FZHB 2E9XC 3OYZA 2XQYA 4IE6A 5DL7A 2NTYA 3RC8A 2CHNA 1VCSA 3H37A 5JDNA 2LSJA 4UV9B 5D5DA 1WR6A 4FQEA 1L0VA 3HL6A 3OYXA 2YDRA 3UU6A 1W0BA 2UXCT 3C4WA 4CI3B 2VL0A 2WJRA 2XUEA 3PUQA 1NENA 2EHOA 4QHOA 3VKGA 5FL0A 3G7GA 4D65A 1SE7A 4ISSA 3LK3A 1QLBA 5L3FB 2YINA 4IIJE 2HH7A 1GFMA 2MYSA 2OMFA 1KK7A 2CA5A 5JDPA 2I0MA 3DZMA 3AAAA 3BK9A 3PJAA 2N2NA 2LHFA 3ZCJA 2J1DG 4QH4A 4AIUA 3ZC0A 4ZZBA 2BBJA 4X1YE 4WNKA 5FXVA 3ANWA 4YT0A 2L8KA 2F4VT 4PJNA 4TNWA 4FOZA 3HR0A 4NPPA 2E9XA 2PTFA 2HPLA 2VKDA 3MACA 2CCQA 2HN1A 2JQHA 3CWZB 3ZMUB 4H9RC 3C4ZA 4LSFA 4JCHA 5JR9C 2X0YA 1MIVA 1YKHB 3N5LA 3PTRB 3EABA 3LG7A 1WYCA 4AQFC 3RLFF 1OEDE 2N9DA 1HS7A 2KZ7B 4ZI7E 4N78D 4CTDA 4PUXA 2FUPA 2B1EA 3RYIE 3TKLB 1HG2A 4N58A 5LBMA 2MNHA 3BQIA 4EEDA 1WLXA 4FMSA 5FVKA 2F1CX 5CA0E 4EYYR 3RHWA 1MM5A 3WI3A 2BKOA 5ABFB 5G3AA 2KMFA 3RI5A 2WQYA 4DV4T 3RIUC 3PQSA 5FL1A 4G2AA 1ZHXA 5FVLA 2LM9A 3MKDA 2YDSA 5BMVE 5AQPB 3PU3A 3Q2MA 1FEWA 4JI4T 2WB5A 1PRNA 4NIQA 2W61A 2MTQA 4GCSA 3PF1A 1DU2A 4K3BA 4C4VB 2CLYB 4WBNE 4DVDA 2IUBA 5LGTB 5JR9A 4QX8B 2UXDT 4UVCB 2LEHA 4JEUB 2XQ4A 4U33A 5LNKA 4AFKA 1V9DA 4AQFA 2RP4A 2NW9A 4B3MT 4O3WA 4LMKA 5EK2A 2KXPB 4UR9A 4QWNB 3OKQA 4UB6O 4E7SA 3N9PA 2KC0A 4X62T 2C5KT 3JAFA 3KV9A 5AQNB 3IA3A 3C64A 4YLHA 4CXXA 3I9YA 2DHRA 2D0TA 3RYFE 2Y7SA 4CXWA 4O49A 3UUXB 4XBFB 5J2TE 1ORMA 4DUYT 3RIUA 1YQ3A 5ADXL 7PRNA 3K3NA 4PW8A 1UUSA 1FMWA 2CWOA 4IGUA 4XNLA 4JI7T 4CI1B 2NR4A 2X9HA 3CQCB 1S35A 3KV6A 2LRLA 4D5UA 4LFAT 2RPAA 4EEBA 2K24A 2C5IT 4DV1T 1D1BA 4YY3T 2M06A 3HWBA 2X68A 4PK4A 4QX7B 5HXHA 4HKAA 5HCJA 3VRAA 4JFBA 4FI5A 1BR4A 2X9WA 4G75A 4YSXA 4JV5T 2K0LA 4OK0A 1BR2A 5T5FA 4AYDC 1PHOA 1CUNA 4LSEA 3HOLA 1T7SA 1HTJF 3MZKB 1QJ9A 4GCQA 2BG9C 5DL6A 1Y01A 1ZHYA 2MHLA 3PGSA 1N34T 4KHZF 4EIWA 1IZNA 1VRBA 2E8IA 1VCTA 2CRBA 4XNKA 3CVRA 3Q5EA 2XAGB 1X79A 3EI0A 4EOZB 2OV9A 2XAFB 1MNEA 1YS5A 4RJXA 4K3CA 4M1PA 2W2UA 4YTPA 5AQLB 3VY9X 4D64A 1BT9A 1ZKEA 3AVSA 2LSYA 4A56A 3VKHA 1ZHWA 1T98A 3AECA 2PORA 1MMDA 3T20A 3CX7B 4JUYA 2BS4A 2HN2A 4H63H 3S4UA 5LG4A 5IUXA 4O3YA 3X1DA 2VURA 2NTXA 5H6RB 3AA7B 1E1HB 4U72A 3BQLA 1ZHCA 2JIWA 1HNXT 2Q9QB 2W67A 3FBZA 4L5GA 5AQHB 4TWFA 4QQ1A 2IAKA 4KR4A 4FRXA 2JMHA 3SS1A 3K8PC 1WFDA 2BG9A 4UB8O 1JNZA 5G39A 1D1AA 2W66A 2XE5A 2KT9A 5ABHA 3UFGA 2PBIA 3K3QC 1XDPA 4K0UA 3QUJA 4P09A 3SOLA 3TLVA 4UV8B 4TWDA 2N1GA 2XE3A 5HXRA 4DV3T 5PRNA 4DR4T 3HKDE 3UAQA 2XJ7A 1ZP0A 4E1TA 1E2AA 3PV0F 1XNQT 4FT6A 3LK41 2XZEA 2FJDA 5M4YA 3KINB 2KNDA 2HPJA 2CHOA 4ZEYA 3PE0A 3MK7C 1VOMA 5AQMB 2R4NA 3JCFA 4AQYT 4HWFA 3DA3A 4H9QC 4AKMA 4ZZCA 3EUHA 4TX5A 3A0BO 3ZYMA 5AQVB 4ISTA 4B6XA 2IMLA 4CXYA 4DBQA 2XTQA 4Z8XA 3HKBE 2DLRA 3DP7A 3LBXA 2C5JA 2XASB 2H88A 5LGUB 5KXJA 1W0AA 3NBXX 4YJ3E 3N2GE 3AXJA 1LKXA 3NSGA 1MPFA 3ONLC 3L39A 4ILAA 2VB6A 3AEEA 2LHNA 3JADA 3VY8X 3I9WA 3QRAA 3AAEB 3A7MA 1HX8A 4YFSA 3VRBA 3AE3A 2E5VA 1GFPA 5HXCA 5L47A 4LF5T 1OEDB 2XSAA 5HXSA 3RYCE 2WDVA 4MHCA 4O8SA 1KNZA 3UU8A 2ODJA 1HF8A 2AE9A 2WJQA 3R84B 5HEOA 4EYUA 5E79O 5EZYE 1FMVA 2XQ6A 4MALA 1ZV4X 3KVBA 4ILUA 2WWUA 4PK5A 4X66T 3ZMSB 5CFBA 5JTGA 2ZFGA 4IE7A 2GK9A 5FNVE 5CA1E 2NOXA 2WS3A 4K0KT 3VR9A 3RH3A 4KHPT 2D0UA 2ZM0A 2J47A 4QH5A 3PQUA 2FGQX 3PORA 4U7YA 4LF8T 5AFUL 2Y6XA 2F1VA 2X66A 4YHJA 5ABGA 2XE1A 5LXTE 4TUYE 3U78A 5FVNA 2XMXA 2WSSV 3N9LA 2K48A 2J4UP 3WU2O 2VL8A 3ZYKA 2KDYA 3PUSA 3H3MA 2K4TA 4Z91A 3T1YT 2QGSA 4U9CA 4KI0F 2H7OA 3NRYA 2XPKA 1KEYA 2CLYC 1Q9GA 5BR8T 2F1TA 4JI3T 5FXWA 3RX6A 3KBUA 2LFUA 2NW7A 2LM2A 2N2LA 2NW8A 1NAFA 2CM0A 2JRKA 2KZ7A 1OPFA 4MLKA 2KINB 2KWHA 1E7PA 3F57A 5LB7B 4YSYA 5JDLA 1D1CA 4H9NC 1SA0E 5HXEA 4DR6T 5FKYA 5G38A 4O2BE 3AEAA 4IDZA 5HWXA 4NXNT 1SUMB 5E0OA 2V8SV 4IE5A 4A5XA 4ZS2A 3TLWA 2YDQA 3FB2A 2FJAA 3A8YC 4RLBA 4O3ZA 4UIGA 1Z8UA 4QKNA 3B13A 5FP3A 2R88A 3GN5B 4MBQA 5DQWA 4EZHA 3C98B 2L3LA 2Q9QD 3UQ7A 3RRCA 4QXBB 2H3RA 4O4XA 2CE7A 4H63V 4O4IE 3PUXF 1I6ZA 4GKKT 3UPGA 2CXFA 3AE4A 3PUGA 5HEGA 5LA6E 3PUWF 5FY7A 3UU3A 2I6HA 2J1NA 3CX8B 3FYXA 1IAPA 3LDQB 4ANJA 2BVLA 4LSHA 5JH7E 3KVAA 5LOVE 2V7IA 1HNWT 2JJ9A 3EVYA 4TWHA 3VU7H 4G76A 2BBHA 4GIWA 4HFVA 4IE0A 4UVAB 4I50E 3ESLA 1KFYA 4I4TE 4HEAA 1EZ3A 2LRKA 3POXA 3GWHA 4U3CA 4FZMA 5IWAT 1XWMA 5GTHO 3TLTA 2FBWA 2W0GA 2WBLA 5CGMA 5AQIB 4GYRA 3KZIO 3Q5XA 3LK3B 5AQKB 2KWIB 2BKPA 4GCPA 4ZS3A 4HFBA 4FSOA 4TZ4C 5F5WA 1T8BA 3B57A 3ZN0B 4DR1T 2QRXA 2Y0KA 3AA6B 4O4HE 2BS3A 3ZCIA 3ZSTA 2CXLA 2LSKA 4FSPA 2XQ5A 3ZKRA 4UELA 1YW0A 3O1JA 2JMKA 2LT3A 3PURA 5L3EB 1HXUA 3MJXA 3H3AA 3SRZA 2QYWA 4NUUA 2VKOA 2DWKA 5AQQB 4LF6T 1H7CA 3TLUA 5FXZA 5HAXA 5LP6E 3ZT5A 2J4GA 4LF7T 4Q25A 3O1IA 5EK4A 4HFHA 4A97A 1B7TA 2D9DA 2LJLA 3C5OA 4X5TA 5FY1A 3KV5A 2Y8DA 2Q9QA 2KSRA 4GYSA 2YN6A 5DABA 2IHR1 5LYJE 4QH1A 3AEFA 2R4PA 2PG8A 4EV6A 2Y0LA 1QUUA 2G0UA 4LFCT 4TV9E 5GTIO 3KV4A 4X65T 1YXRA 4LF9T 2KLQA 3AA1B 2ZLDA 5J1GA 2K3WA 3P7IA 4TV8E 1E54A 2BVMA 5LG3A 4IDPA 4U74A 1Q9FA 3P4RA 3GP6A 4FZNA 3PGRA 4AYNA 2UXXB 4ILCA 2JQYA 4L0RA 4FRTA 2VQFT 2V5CA 3B5MA 3IHRA 2ES0A 2DI4A 5JR9B 2XHEB 2V7MA 4JI6T 5HYAA 1N33T 4JEHB 4WBOA 5ETWA 4JYAT 5KDMC 2VKHA 2W63A 2CPTA 4EXTA 3FXDB 2WZHA 1OEDC 4ERRA 1ZHZA 3PUYF 4AKRB 2K5BB 3V8UA 5LCYA 3PJAJ 4O4JE 3GA8A 4HE8A 3M65A 3C4XA 2A2FX 1FIOA 1HG5A 2V7LA 1UX5A 4I43B 2V6YB 4DNDA 3UFEA 2AXTO 3P4WA 2WU5A 3AE5A 5AQJB 2JPFA 5JDGA 4NUVA 1QSDA 2VK9A 2X9XA 2NP9A 2BZBA 1UCUA 3NVOA 4YTMA 1HNZT 3CQGB 5KMGP 3N2OA 3KBTA 5L3BB 5DJQC 2QVAA 5LGNB 5LJNA 4O4UA 4AKIA 3P4QA 3HKCE 3AAEA 3DWOX 3AEGA 1S94A 1D0ZA 4PJMA 1HX1B 3WI4A 2CEAA 1OWAA 1BH3A 3K19A 4DV0T 2E5LT 2YNKA 3N9OA 1OEDA 4ZHQE 3VHLA 5KX5E 4PFPA 3UQ4A 3U3IA 2X0LB 3N9QA 3T24A 3RGLA 4UF0B 3PRNA 4OHFA 5JRCB 3UUNA 5LHIB 3HA4A 1IZNB 4UVBB 4GK0E 4JI0T
chains in the Genus database with same CATH topology
2LSGA 2LOPA 3E22E 2B1EA 3ZYKA 5JDHA 3SZDA 4F4BA 1P4TA 2KDYA 1MMAA 2JQQA 3RYIE 2ZMAA 3VE2A 3PUSA 3TKLB 1HG2A 4L9IA 2P9BA 5FYMA 4N58A 5LBMA 2K4TA 3ZYLA 2QGSA 4U9CA 2DCFA 2V26A 2MNHA 3BQIA 3LJCA 1WLXA 2H7OA 3RYHE 4FMSA 3NRYA 2PRNA 5CA0E 4EYYR 4ZI2D 5CB4E 3JC6D 2CLYC 2XE2A 3ZJ2A 1Q9GA 2F1TA 1MM5A 3WI3A 2X9YA 3Q9DA 4AI6A 1MMNA 2X67A 5FXWA 3HOEA 2V7KA 3PUAA 3RX6A 3HW9A 3POUA 1YD8G 2KMFA 2XG6A 3SWHA 2Z6EA 3KBUA 4YJ2E 2LFUA 2NW7A 4UF0A 5LHIB 5JRCA 3PQSA 4G2AA 3VZWX 3ETUA 2N2LA 1ZHXA 2JRKA 1NAFA 2CM0A 2NW8A 3PU8A 2KZ7A 3L09A 1OPFA 2A72A 4MLKA 3NRXA 2LM9A 1BR0A 3P8CD 2KINB 2KWHA 3O1HA 5IYZE 3KFWX 4C90A 4ZI3D 4N59A 3MKDA 4BA9A 1U4QA 5BMVE 3F57A 4MFRA 4C69X 5JDLA 1D1CA 3PU3A 4H9NC 1SA0E 3Q2MA 5HXEA 1FEWA 4AKLA 1UX4A 3RRWA 4G63A 4O2BE 1PRNA 2W61A 2MTQA 4IDZA 5HWXA 4GCSA 2WMNA 5E0OA 4IE5A 4RJWA 4QXHB 1G90A 1U5PA 5L3CB 4ZS2A 2CLYB 4WBNE 5FY0A 4DVDA 5DQVA 5LGTB 5FMNA 3NZQA 5LHGB 5JR9A 3IBPA 3LK2A 1WYBA 4PJJA 1MIWA 4QX8B 5JVDE 4UVCB 2ERVA 2LEHA 3FB2A 5AFUK 4BJMA 4JEUB 5JDQA 1THQA 3KDSE 2D5UA 4PK6A 4FZLA 4KR8A 5LNKA 4X1KE 4AFKA 1V9DA 4AQFA 4RLBA 4O3ZA 2RP4A 2NW9A 2ZM8A 2FGRA 3D0TA 4UIGA 2I59A 4QKNA 3B13A 5EK2A 2KXPB 5FP3A 5JREA 4O3WA 5G26A 3GN5B 3J7Yq 4MBQA 4QWNB 3OKQA 5DQWA 4O3XB 4H9OC 4EZHA 4E7SA 3C98B 3N9PA 4JLEA 2CWYA 2L3LA 2KC0A 3MA9A 2C5KT 3KV9A 2Q9QD 3C64A 4YLHA 4CXXA 3ZMZB 3I9YA 4KMCA 3RRCA 2DHRA 3WAKA 5DL8A 4QXBB 2D0TA 4IHJE 4WW0A 3RYFE 4CXWA 2Y7SA 2RA1A 2H3RA 4BUMX 4AKHA 4GK5E 1SHZC 1IJ6A 3UUXB 4O49A 3I0QA 4O4XA 2CE7A 3AB3B 3A5XA 4H63V 4XBFB 1Z0PA 2GE4A 3F2EA 5J2TE 2MBGA 4O4IE 3KVDD 1ORMA 2H7VC 2LHRA 4ZI2C 3JC6C 2LOSA 3K3OA 4H9PC 3VZUX 3UPGA 2CXFA 2D2SA 5ADXL 7PRNA 1HS7A 3K3NA 3DA4A 3RKOA 4PW8A 3QRCA 3PUGA 5LA6E 1FMWA 5F3JA 4AUIA 5FY7A 2CMRA 2CWOA 3GN5A 1ZHTA 4IGUA 3SYSA 2VKJA 4XNLA 3O4XE 4CI1B 5GONE 2J1NA 3CX8B 3WAJA 4PNIA 1QJ8A 2X9HA 3FYXA 3OBVE 3CQCB 1S35A 1IAPA 4ANJA 5C8YE 3KV6A 4D5UA 2BVLA 4LSHA 6PRNA 2YU2A 1D0YA 2Y48B 4ZI3C 2K24A 4BJNA 3ZEFB 2C5IT 2PJQA 5JH7E 1HXXA 1D1BA 3KVAA 5LOVE 4KUMB 2M06A 2V7IA 5JDMA 3HWBA 2JJ9A 2WM9A 2X68A 2MOZA 4ADZA 4PK4A 3EVYA 4QX7B 3VU7H 5HXHA 2ZLYA 4HKAA 4G76A 3FHNA 1QJPA 1Y64B 4JFBA 4FI5A 1BR4A 2X9WA 4GIWA 4G75A 3RBHA 4HFVA 2ACXA 4IE0A 3AA0B 4UVAB 5A1LA 2K0LA 4I50E 3N9NA 4X1IE 4OK0A 3ESLA 1BR2A 2L9QA 5T5FA 4I4TE 4AYDC 4HEAA 5GV0A 5H6QB 1PHOA 3A2SX 1CUNA 2W00A 4LSEA 1NWMX 1EZ3A 3OJAA 3HOLA 3HI2A 1HTJF 3FXEB 3MXZA 3MZKB 5HWYA 3POXA 2X27X 3ZMVB 1D0XA 3GWHA 3DJBA 2WMOA 1QJ9A 1US7B 4GCQA 3ETVA 4FZMA 3NZPA 2XAQB 5DL6A 4XAXB 1ZHYA 2MHLA 2IC6A 2W0GA 4EIWA 1IZNA 2WBLA 4J2CA 1VRBA 2E8IA 5EE2A 4AQGA 4BAYB 4XNKA 5DL5A 3CVRA 1LVKA 3E08A 2EHOD 1YKEB 1H6S1 2XAGB 3CQXC 1X79A 4GYRA 3CMLA 3WI5A 3UT5E 4EOZB 3Q5XA 2XAFB 1YS5A 1MNEA 3LK3B 3FBLA 4RJXA 2KWIB 3RC3A 4Z3TA 4M1PA 4GCPA 4ZS3A 3L3PA 4FSOA 3AA0A 4TZ4C 3VY9X 4D64A 1ZEEA 1BT9A 1BXWA 4ASKA 1ZKEA 5ADXK 3B57A 4KP3C 3AVSA 3ZN0B 2LSYA 4EZ4A 4A56A 2QA7A 3VKHA 3HKEE 1T98A 1ZHWA 2JMMA 4E1SA 2PORA 2Y0KA 3AA6B 1MMDA 3T20A 1IJ5A 4O4HE 3CX7B 4DO0A 3ZJ1A 4JUYA 3ZCIA 3GMIA 4H63H 4X20E 2ZM2A 5L2LA 3S4UA 3POQA 5LG4A 2CXLA 2C0SA 2M67A 4O3YA 2DWGA 4DBRA 2LSKA 4O4LE 3F31A 2A3DA 3ONXA 4GHBA 4FSPA 2NTXA 5H6RB 3AA7B 1E1HB 4GF4A 4UELA 4V1Av 1MM4A 1YW0A 1HFAA 2Y0HA 4U72A 3BQLA 2V7JA 3O1JA 3Q5WA 2JMKA 4HN9A 2LT3A 5FXXA 1ZHCA 2N2MA 3SYBA 3PURA 5L3EB 1G73A 2Q9QB 3PDYA 1HXUA 4CZZB 3FBZA 3MJXA 2XAJB 4L5GA 2YPVA 5EK3A 3H3AA 2YEVC 4NUUA 3SRZA 3EMNX 5IYUA 2E9XD 2VKOA 2DWKA 3IF8B 2W81C 2QTKA 4AYID 2IW5B 2X51A 4PJLA 2V1DB 3LK42 4QQ1A 1GFQA 3AA6A 3SY7A 3N2KE 4AZLA 2IAKA 4KR4A 1H7CA 4FRXA 5IHYA 2JMHA 4FJOA 3T8OA 3SS1A 5FXZA 4EB6E 3V5UA 5HAXA 2M07A 5LP6E 3K8PC 1LRZA 4CQIA 3O1IA 5EK4A 4CI2B 1B7TA 1AJ3A 1GFOA 4FESA 1HCIA 2LJLA 3C5OA 1D1AA 1WRDA 3QC9A 4AYMC 5FY1A 4OYKA 2KXPA 3CKDA 4RL9A 1LVFA 5TAOA 4OYJA 3IEEA 4B61A 2XE5A 3KV5A 2Y8DA 2KT9A 2Q9QA 2PBIA 3K3QC 3N9MA 3SZVA 4K0UA 4E7ZA 3UULA 3QUJA 4GYSA 2IC9A 3C51A 4P09A 4UV8B 3SOLA 2XTRA 3AVRA 5DABA 1G8XA 2N1GA 5LYJE 2EHOC 3VZTX 2DNXA 2XE3A 3T0SA 4KRAA 5HXRA 4P0BA 4RLCA 5PRNA 5F8PA 2K9AA 3HKDE 2CXDA 1BR1A 2PG8A 3UAQA 2Y0LA 1QUUA 2G0UA 2VWAA 1MMGA 4UEMA 4E1TA 4UXNB 3CX6B 4TV9E 1GFNA 3LBXB 3LK41 4FT6A 8PRNA 3CPZA 3KV4A 3SY9A 4DMVA 3UTKA 5M4YA 1MNDA 3KINB 2KNDA 2HPJA 3R6NA 2KLQA 3AA1B 3I0OA 4HGAA 4I55E 1HXTA 3JTYA 3PE0A 3MK7C 5LJMA 2ZLDA 5J1GA 1VOMA 3P7IA 2NWBA 3DA3A 4TV8E 1E54A 2BVMA 4H9QC 4AKMA 3QK6A 3EUHA 4U74A 1Q9FA 3BQKA 3GP6A 5L3DB 4TX5A 4FZNA 2UXNB 4OFZA 4AYNA 2UXXB 4PAGA 3ZYMA 4L0RA 2EHOB 2OA5A 4FRTA 3EDVA 4DMWA 4ISTA 4B6XA 4QXCB 4CXYA 3IHRA 2ES0A 4DBQA 2DI4A 5L3GB 4Z8XA 2XTQA 2Q9QC 5JR9B 3HKBE 3LK2B 3C50A 2LE8A 2XHEB 2DLRA 2E9XC 3DP7A 3LBXA 2V7MA 2C5JA 3OYZA 5HYAA 2XQYA 4IE6A 5DL7A 4JEHB 2NTYA 4WBOA 3RC8A 5ETWA 3V5SA 5JDNA 3H37A 2XASB 5KDMC 2VKHA 2W63A 5LGUB 4EXTA 2LSJA 3FXDB 3LFMA 2O4VA 3AA1A 4UV9B 4ERRA 2SPCA 4XZCA 3AAIA 1ZHZA 5D5DA 2VASA 3I1AA 4PFOA 4TN7B 1WR6A 4KBMB 3HL6A 3NBXX 4AKRB 2K5BB 3AAAB 4YJ3E 3V8UA 3OYXA 5LCYA 3N2GE 2ODVA 2WAUA 3J9X1 4FUVA 4H9SE 4O4JE 3GA8A 1LKXA 4F6RC 3O9XA 3C4WA 4HE8A 4CI3B 3M65A 3RPUA 2XUEA 3PUQA 3NSGA 5LBQB 3C4XA 1MPFA 2A2FX 2EHOA 1FIOA 3UU2A 1HG5A 4C91A 2VB6A 4QHOA 3VKGA 3G7GA 4D65A 2LHNA 3ANWB 3VY8X 3I9WA 3E0ZA 4GOUA 4ISSA 2V7LA 1UX5A 4I43B 3ZMTB 3LK3A 3QRAA 3AAEB 2J4UP 1HX8A 5L3FB 4YFSA 4DNDA 2YINA 2YU1A 2E9XB 3UFEA 4IIJE 2XTLA 2HH7A 1GFPA 2MYSA 5LHHB 1GFMA 1KK7A 2OMFA 3ZPOA 1MIYA 2JPFA 5HXCA 5JDGA 3DTOA 3TZGA 2CA5A 5JDPA 4NUVA 1QSDA 5HXSA 2VK9A 4AKRA 2X9XA 2NP9A 2BZBA 2W80C 3AAAA 3RYCE 4IE4A 1UCUA 3BK9A 2N2NA 4AXPA 4MHCA 4O8SA 1KNZA 2LHFA 3CQGB 5KMGP 2LSIA 1OSMA 3ZCJA 2ODJA 2J1DG 5J2UE 3ZC0A 1HF8A 3AA7A 4HTEA 4X1YE 3N2OA 3R84B 3KBTA 4EYUA 5L3BB 4WNKA 5FXVA 5JQGE 5DJQC 5EZYE 3ANWA 1FMVA 4MALA 2L8KA 1ZV4X 2YK0A 3KVBA 2WWUA 4ILUA 4PK5A 4PJNA 5LGNB 3EDUA 5LJNA 4AKIA 4O4UA 3HKCE 3AAEA 5FVNA 4AYEC 3ZMSB 2W62A 2ZFGA 3ZN1B 4FOZA 4P0AA 4IE7A 3HR0A 2GK9A 1S94A 2Y2XA 1D0ZA 2E9XA 5FNVE 4PJMA 5CA1E 4LSIA 3UUMA 2NOXA 3WI4A 2CEAA 2HPLA 4EAHA 1OWAA 3RH3A 5JDFA 1BH3A 2VKDA 3MACA 3K19A 4ZOLE 2CCQA 2YNKA 3N9OA 2D0UA 3ZLIA 3CWZB 2ZM0A 4H9RC 3ZMUB 4ZHQE 3VHLA 3C4ZA 4LSFA 3ZC1A 3VE1A 2XAHB 5KX5E 4JCHA 5JR9C 4O2AE 4PFPA 4AKGA 3PQUA 2FGQX 3PORA 3U3IA 2X0LB 1MIVA 1YKHB 3N5LA 5AFUL 3N9QA 2Y6XA 2F1VA 2PFVA 2X66A 3PTRB 3O0EA 3T24A 3PRNA 2ODUA 4UF0B 2BDEA 4YHJA 4OHFA 1O3XA 3LG7A 5JRCB 1WYCA 4AQFC 2XE1A 3UUNA 3W15B 5LXTE 2N9DA 3HA4A 4TUYE 1IZNB 2KZ7B 4UVBB 2WSSV 4GK0E 4N78D 3U78A 4ZI7E 3N9LA 2K48A 2XMXA 4PUXA 1OXZA 2VL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ADX K;  5ADX L;  3LK3 A;  3AA1 A;  3AA6 B;  3AAE B;  2KZ7 A;  3LK2 A;  1IZN A;  3AA7 A;  3AA0 A;  2KXP A;  4AKR B;  3AAA B;  5AFU K;  3AA0 B;  3LK4 1;  5AFU L;  3LK4 2;  3AA6 A;  3AAE A;  3LK3 B;  3AA1 B;  3LK2 B;  1IZN B;  2KZ7 B;  3AA7 B;  4AKR A;  3AAA A;  2KXP B; 
#chains in the Genus database with same CATH topology
 2LSG A;  2LOP A;  3E22 E;  3SZD A;  3VR8 A;  1MMA A;  2JQQ A;  3VE2 A;  1JNR A;  2ACZ A;  1WCR A;  5FYM A;  3ZYL A;  2W4X A;  2V26 A;  2PRN A;  3ZSS A;  4JI5 T;  3AE9 A;  3Q9D A;  1MMN A;  2V7K A;  3PUA A;  3FZK B;  3HW9 A;  3SWH A;  2Z6E A;  2IWW A;  3ETU A;  3PU8 A;  3NRX A;  4N59 A;  4ZI3 D;  3O1H A;  5IYZ E;  2XSB A;  3KFW X;  4TNV A;  4BA9 A;  1U4Q A;  1I94 T;  4AKL A;  1UX4 A;  4G63 A;  2WMN A;  1FJG T;  1W09 A;  4RJW A;  4QXH B;  1G90 A;  1U5P A;  5FMN A;  3IBP A;  3LK2 A;  4PJJ A;  5JVD E;  2ERV A;  3FZL B;  1THQ A;  3KDS E;  2D5U A;  4PK6 A;  4KR8 A;  2XY8 B;  2ZM8 A;  3D0T A;  2CBI A;  3J7Y q;  4O3X B;  5AQR B;  2CWY A;  4COF A;  3MA9 A;  1N32 T;  3ZMZ B;  4KMC A;  2CBJ A;  3WAK A;  5DL8 A;  4IHJ E;  1KNP A;  2DL1 A;  1IJ6 A;  3I0Q A;  3AB3 B;  3DWN A;  3A5X A;  1Z0P A;  2GE4 A;  3F2E A;  2MBG A;  2H7V C;  2LHR A;  4H9P C;  1J5E T;  2LKH A;  4Z90 A;  2MAW A;  3RKO A;  3LSV A;  3QRC A;  3FZF B;  5ABE A;  4AUI A;  2X9K A;  2CMR A;  3SYS A;  3GN5 A;  2VKJ A;  3O4X E;  5CJ5 A;  3OBV E;  5C8Y E;  3RQU A;  4DV7 T;  4ZI3 C;  3ZEF B;  2PJQ A;  4ZXL A;  2R89 A;  1HXX A;  2WM9 A;  4ADZ A;  2ZLY A;  5AQS B;  2H89 A;  1QJP A;  1Y64 B;  3RBH A;  5B5E O;  2ACX A;  3AA0 B;  3N9N A;  4GKJ T;  3A2S X;  1NWM X;  3OJA A;  3FXE B;  3MXZ A;  2VVN A;  1UK5 A;  3ABV A;  3TLS A;  2X27 X;  3ZMV B;  2WMO A;  4IL9 A;  3ETV A;  2XAQ B;  4JI2 T;  4HFE A;  2IC6 A;  4IDQ A;  5EE2 A;  4J2C A;  4AQG A;  4BAY B;  3E08 A;  2WDQ A;  4DR5 T;  3CQX C;  3RKG A;  3OTO T;  3BS0 A;  3WI5 A;  3PUZ F;  2J62 A;  3RC3 A;  5TIS O;  3L3P A;  4ASK A;  5ADX K;  2R4O A;  2QA7 A;  3HKE E;  4E1S A;  5ABF A;  4DO0 A;  3P50 A;  4KX6 A;  2ZM2 A;  5L2L A;  3POQ A;  2B76 A;  3BRY A;  3AEB A;  2C0S A;  2DWG A;  4DBR A;  2OLT A;  3F31 A;  4GHB A;  3UUB A;  5AQG B;  4YHH T;  1MM4 A;  1IBK T;  3Q5W A;  3JAE A;  4HN9 A;  2E2A A;  3PDY A;  2LLY A;  2XQ8 A;  5EK3 A;  1N36 T;  3IF8 B;  2QTK A;  4AYI D;  4C4V A;  4IDN A;  1GFQ A;  3AA6 A;  3SY7 A;  3N2K E;  4AZL A;  5HEU A;  4B3S T;  5IHY A;  3RIF A;  2V6X A;  1R8I A;  1W9R A;  4DR3 T;  4EB6 E;  4HWH A;  4YSZ A;  2XM1 A;  1XDO A;  4DR7 T;  1AJ3 A;  3AED A;  1GFO A;  5L4E A;  3QC9 A;  4AYM C;  3UU5 A;  2KXP A;  4RL9 A;  4NXM T;  1UUR A;  4B61 A;  2BG9 E;  4HWI B;  2WY2 A;  3SZV A;  1KF6 A;  3K1S A;  2IC9 A;  2XTR A;  3AVR A;  1G8X A;  3VZT X;  2DNX A;  4P0B A;  1T72 A;  2XQA A;  2K9A A;  2CXD A;  2VWA A;  3RF1 A;  1MMG A;  4UXN B;  3CX6 B;  5C2T A;  1GFN A;  4P1N A;  2BS2 A;  4YXD A;  3SY9 A;  3SFE A;  3ZT7 A;  5AQO B;  3UTK A;  1MND A;  2WWV A;  3I0O A;  4HGA A;  1HXT A;  2JQK A;  3QK6 A;  3BQK A;  5L3D B;  4OFZ A;  4I0U A;  1XNR T;  4PAG A;  2EHO B;  2OA5 A;  3EDV A;  4DMW A;  2XQ9 A;  4QXC B;  1GQE A;  2Q9Q C;  3AE6 A;  1J5W A;  3C50 A;  4LF4 T;  3V5S A;  2O4V A;  3LFM A;  3AA1 A;  2SPC A;  4XZC A;  3AAI A;  2VAS A;  3I1A A;  4PFO A;  3G06 A;  4TN7 B;  1IBL T;  4KBM B;  3AAA B;  2ODV A;  2WAU A;  3J9X 1;  4FUV A;  4H9S E;  4U2Z A;  4LML A;  3O9X A;  4F6R C;  3RPU A;  5LBQ B;  3UU2 A;  4C91 A;  4JBW F;  3ANW B;  4GOU A;  3E0Z A;  4B3R T;  3ZMT B;  1T1L A;  3AE2 A;  5KAI O;  3NKZ A;  4DV6 T;  2YU1 A;  4N74 A;  2E9X B;  2XTL A;  2UU9 T;  5LHH B;  3ZPO A;  1MIY A;  3DTO A;  3TZG A;  5HEJ A;  4AKR A;  5HEH A;  2W80 C;  4IE4 A;  2R4L A;  4AXP A;  2LSI A;  1OSM A;  2R8A A;  5J2U E;  3AA7 A;  4HTE A;  4CN4 A;  5JQG E;  4LMJ A;  2YK0 A;  3EDU A;  4AYE C;  2V6Y A;  2W62 A;  3ZN1 B;  4P0A A;  2Y2X A;  3UU4 A;  2VQE T;  4LSI A;  3UUM A;  3QB5 K;  4EAH A;  2UXB T;  5JDF A;  4ZOL E;  2YKS A;  3ZLI A;  2WZI A;  5B66 O;  5C3J A;  3ZC1 A;  3VE1 A;  2XAH B;  4O2A E;  4AKG A;  2A9U A;  1XZY A;  2PFV A;  3O0E A;  4IDO A;  2ODU A;  2BDE A;  1O3X A;  4DV5 T;  3NWI A;  4HFC A;  3W15 B;  1OXZ A;  1T16 A;  4AIS A;  2R6G F;  4F4B A;  1M62 A;  5JDH A;  1P4T A;  2YOE A;  2ZMA A;  4L9I A;  2P9B A;  4HFI A;  2AXD S;  2DCF A;  3LJC A;  3QNU A;  3RYH E;  4ZI2 D;  5CB4 E;  3JC6 D;  5J0Z A;  2XE2 A;  3ZJ2 A;  3AE1 A;  2X9Y A;  2IWV A;  4AI6 A;  2X67 A;  3HOE A;  3POU A;  1YD8 G;  2XG6 A;  4DR2 T;  3P4P A;  4YJ2 E;  4UF0 A;  3ONJ A;  2UUA T;  5JRC A;  3VZW X;  1J1J A;  3L09 A;  2A72 A;  1BR0 A;  3A0H O;  2ZM6 T;  3P8C D;  4C90 A;  4DID B;  1S5L O;  2UUC T;  4C69 X;  4MFR A;  3L8R A;  3RRW A;  4ILB A;  2M6I A;  2WP9 A;  5L3C B;  5FY0 A;  5DQV A;  1HR0 T;  3NZQ A;  5LHG B;  1WYB A;  1MIW A;  2FJB A;  5AFU K;  4BJM A;  5JDQ A;  4FZL A;  4X1K E;  3AE7 A;  3FZM B;  2X0H A;  1IBM T;  2FGR A;  2I59 A;  5G26 A;  5JRE A;  4H9O C;  2M6B A;  4JLE A;  4U31 A;  3OPC A;  4WW0 A;  2RA1 A;  4DV2 T;  4BUM X;  4AKH A;  4N75 A;  4GK5 E;  5LMU T;  1SHZ C;  2WU2 A;  3KVD D;  4ZI2 C;  3VZU X;  3JC6 C;  2LOS A;  3K3O A;  2XQ7 A;  2D2S A;  2FJE A;  3DA4 A;  5F3J A;  3P4S A;  1ZHT A;  2LKG A;  5GON E;  1QJ8 A;  3WAJ A;  4PNI A;  3CK6 A;  4HWD A;  6PRN A;  2YU2 A;  1D0Y A;  2Y48 B;  4BJN A;  2WDR A;  5HCM A;  4KUM B;  5JDM A;  4EGW A;  2MOZ A;  3FHN A;  4HWC A;  4CN1 A;  5A1L A;  4X1I E;  3ZT6 A;  2L9Q A;  5GV0 A;  2XQ3 A;  5H6Q B;  2W00 A;  4PR7 A;  3HI2 A;  1WR0 A;  3BRZ A;  5HWY A;  4JI1 T;  1YQ4 A;  1D0X A;  4IRE A;  3DJB A;  1US7 B;  4C00 A;  3NZP A;  4XAX B;  4B3T T;  2MPK A;  5DL5 A;  1LVK A;  5L4H A;  2EHO D;  1YKE B;  1ZOY A;  1H6S 1;  2IDO B;  2VVS A;  3CML A;  3UT5 E;  1XMQ T;  3FBL A;  4HFD A;  4F8H A;  5AQT B;  4Z3T A;  5KAF O;  3AA0 A;  5AQU B;  1UGO A;  2BKN A;  1ZEE A;  1BXW A;  4KP3 C;  4EZ4 A;  2JMM A;  5H2F O;  1IJ5 A;  3CIR A;  3ZJ1 A;  3GMI A;  5LMN T;  4X20 E;  2V5D A;  2M67 A;  3JCU O;  2BG9 B;  4O4L E;  3ONX A;  2A3D A;  3SFD A;  2WCA A;  4GF4 A;  4V1A v;  2Y0H A;  1HFA A;  5AQF B;  2V7J A;  2UUB T;  4CN6 A;  5FXX A;  3OVU A;  2N2M A;  3SYB A;  1G73 A;  4CZZ B;  1XMO T;  2XAJ B;  2YPV A;  2YEV C;  3EMN X;  5IYU A;  4OX9 T;  2E9X D;  4U2Y A;  4X64 T;  2W81 C;  2IIU A;  2IW5 B;  4IL6 O;  2X51 A;  4PJL A;  2V1D B;  3LK4 2;  1CHU A;  3T1H T;  3M3Z B;  4JI8 T;  3Q5D A;  3T8O A;  4FJO A;  3AE8 A;  3PUV F;  3V5U A;  2M07 A;  1LRZ A;  4CQI A;  1KNR A;  3QOF A;  4CI2 B;  4A98 A;  4FES A;  3RIA A;  4IL4 A;  1HCI A;  1WRD A;  4OYK A;  2WVP A;  3CKD A;  1LVF A;  5TAO A;  4OYJ A;  3IEE A;  3N9M A;  4E7Z A;  3UUL A;  3C51 A;  4DUZ T;  2EHO C;  3T0S A;  4KRA A;  4PJ0 O;  4RLC A;  5F8P A;  3QB5 A;  1NEK A;  4IT4 A;  1BR1 A;  3EAM A;  4UEM A;  1X9B A;  3LBX B;  4LFB T;  2HHH T;  8PRN A;  3CPZ A;  1M7K A;  4DMV A;  3R6N A;  2XM2 A;  3EHZ A;  4I55 E;  4WYV A;  3JTY A;  5LJM A;  2NWB A;  3RQW A;  4YTN A;  3PGU A;  4U7I A;  3AXJ B;  2UXN B;  4WZX A;  3NJT A;  2JQ9 A;  5L3G B;  3LK2 B;  2LE8 A;  3FZH B;  2E9X C;  3OYZ A;  2XQY A;  4IE6 A;  5DL7 A;  2NTY A;  3RC8 A;  2CHN A;  1VCS A;  3H37 A;  5JDN A;  2LSJ A;  4UV9 B;  5D5D A;  1WR6 A;  4FQE A;  1L0V A;  3HL6 A;  3OYX A;  2YDR A;  3UU6 A;  1W0B A;  2UXC T;  3C4W A;  4CI3 B;  2VL0 A;  2WJR A;  2XUE A;  3PUQ A;  1NEN A;  2EHO A;  4QHO A;  3VKG A;  5FL0 A;  3G7G A;  4D65 A;  1SE7 A;  4ISS A;  3LK3 A;  1QLB A;  5L3F B;  2YIN A;  4IIJ E;  2HH7 A;  1GFM A;  2MYS A;  2OMF A;  1KK7 A;  2CA5 A;  5JDP A;  2I0M A;  3DZM A;  3AAA A;  3BK9 A;  3PJA A;  2N2N A;  2LHF A;  3ZCJ A;  2J1D G;  4QH4 A;  4AIU A;  3ZC0 A;  4ZZB A;  2BBJ A;  4X1Y E;  4WNK A;  5FXV A;  3ANW A;  4YT0 A;  2L8K A;  2F4V T;  4PJN A;  4TNW A;  4FOZ A;  3HR0 A;  4NPP A;  2E9X A;  2PTF A;  2HPL A;  2VKD A;  3MAC A;  2CCQ A;  2HN1 A;  2JQH A;  3CWZ B;  3ZMU B;  4H9R C;  3C4Z A;  4LSF A;  4JCH A;  5JR9 C;  2X0Y A;  1MIV A;  1YKH B;  3N5L A;  3PTR B;  3EAB A;  3LG7 A;  1WYC A;  4AQF C;  3RLF F;  1OED E;  2N9D A;  1HS7 A;  2KZ7 B;  4ZI7 E;  4N78 D;  4CTD A;  4PUX A;  2FUP A;  2B1E A;  3RYI E;  3TKL B;  1HG2 A;  4N58 A;  5LBM A;  2MNH A;  3BQI A;  4EED A;  1WLX A;  4FMS A;  5FVK A;  2F1C X;  5CA0 E;  4EYY R;  3RHW A;  1MM5 A;  3WI3 A;  2BKO A;  5ABF B;  5G3A A;  2KMF A;  3RI5 A;  2WQY A;  4DV4 T;  3RIU C;  3PQS A;  5FL1 A;  4G2A A;  1ZHX A;  5FVL A;  2LM9 A;  3MKD A;  2YDS A;  5BMV E;  5AQP B;  3PU3 A;  3Q2M A;  1FEW A;  4JI4 T;  2WB5 A;  1PRN A;  4NIQ A;  2W61 A;  2MTQ A;  4GCS A;  3PF1 A;  1DU2 A;  4K3B A;  4C4V B;  2CLY B;  4WBN E;  4DVD A;  2IUB A;  5LGT B;  5JR9 A;  4QX8 B;  2UXD T;  4UVC B;  2LEH A;  4JEU B;  2XQ4 A;  4U33 A;  5LNK A;  4AFK A;  1V9D A;  4AQF A;  2RP4 A;  2NW9 A;  4B3M T;  4O3W A;  4LMK A;  5EK2 A;  2KXP B;  4UR9 A;  4QWN B;  3OKQ A;  4UB6 O;  4E7S A;  3N9P A;  2KC0 A;  4X62 T;  2C5K T;  3JAF A;  3KV9 A;  5AQN B;  3IA3 A;  3C64 A;  4YLH A;  4CXX A;  3I9Y A;  2DHR A;  2D0T A;  3RYF E;  2Y7S A;  4CXW A;  4O49 A;  3UUX B;  4XBF B;  5J2T E;  1ORM A;  4DUY T;  3RIU A;  1YQ3 A;  5ADX L;  7PRN A;  3K3N A;  4PW8 A;  1UUS A;  1FMW A;  2CWO A;  4IGU A;  4XNL A;  4JI7 T;  4CI1 B;  2NR4 A;  2X9H A;  3CQC B;  1S35 A;  3KV6 A;  2LRL A;  4D5U A;  4LFA T;  2RPA A;  4EEB A;  2K24 A;  2C5I T;  4DV1 T;  1D1B A;  4YY3 T;  2M06 A;  3HWB A;  2X68 A;  4PK4 A;  4QX7 B;  5HXH A;  4HKA A;  5HCJ A;  3VRA A;  4JFB A;  4FI5 A;  1BR4 A;  2X9W A;  4G75 A;  4YSX A;  4JV5 T;  2K0L A;  4OK0 A;  1BR2 A;  5T5F A;  4AYD C;  1PHO A;  1CUN A;  4LSE A;  3HOL A;  1T7S A;  1HTJ F;  3MZK B;  1QJ9 A;  4GCQ A;  2BG9 C;  5DL6 A;  1Y01 A;  1ZHY A;  2MHL A;  3PGS A;  1N34 T;  4KHZ F;  4EIW A;  1IZN A;  1VRB A;  2E8I A;  1VCT A;  2CRB A;  4XNK A;  3CVR A;  3Q5E A;  2XAG B;  1X79 A;  3EI0 A;  4EOZ B;  2OV9 A;  2XAF B;  1MNE A;  1YS5 A;  4RJX A;  4K3C A;  4M1P A;  2W2U A;  4YTP A;  5AQL B;  3VY9 X;  4D64 A;  1BT9 A;  1ZKE A;  3AVS A;  2LSY A;  4A56 A;  3VKH A;  1ZHW A;  1T98 A;  3AEC A;  2POR A;  1MMD A;  3T20 A;  3CX7 B;  4JUY A;  2BS4 A;  2HN2 A;  4H63 H;  3S4U A;  5LG4 A;  5IUX A;  4O3Y A;  3X1D A;  2VUR A;  2NTX A;  5H6R B;  3AA7 B;  1E1H B;  4U72 A;  3BQL A;  1ZHC A;  2JIW A;  1HNX T;  2Q9Q B;  2W67 A;  3FBZ A;  4L5G A;  5AQH B;  4TWF A;  4QQ1 A;  2IAK A;  4KR4 A;  4FRX A;  2JMH A;  3SS1 A;  3K8P C;  1WFD A;  2BG9 A;  4UB8 O;  1JNZ A;  5G39 A;  1D1A A;  2W66 A;  2XE5 A;  2KT9 A;  5ABH A;  3UFG A;  2PBI A;  3K3Q C;  1XDP A;  4K0U A;  3QUJ A;  4P09 A;  3SOL A;  3TLV A;  4UV8 B;  4TWD A;  2N1G A;  2XE3 A;  5HXR A;  4DV3 T;  5PRN A;  4DR4 T;  3HKD E;  3UAQ A;  2XJ7 A;  1ZP0 A;  4E1T A;  1E2A A;  3PV0 F;  1XNQ T;  4FT6 A;  3LK4 1;  2XZE A;  2FJD A;  5M4Y A;  3KIN B;  2KND A;  2HPJ A;  2CHO A;  4ZEY A;  3PE0 A;  3MK7 C;  1VOM A;  5AQM B;  2R4N A;  3JCF A;  4AQY T;  4HWF A;  3DA3 A;  4H9Q C;  4AKM A;  4ZZC A;  3EUH A;  4TX5 A;  3A0B O;  3ZYM A;  5AQV B;  4IST A;  4B6X A;  2IML A;  4CXY A;  4DBQ A;  2XTQ A;  4Z8X A;  3HKB E;  2DLR A;  3DP7 A;  3LBX A;  2C5J A;  2XAS B;  2H88 A;  5LGU B;  5KXJ A;  1W0A A;  3NBX X;  4YJ3 E;  3N2G E;  3AXJ A;  1LKX A;  3NSG A;  1MPF A;  3ONL C;  3L39 A;  4ILA A;  2VB6 A;  3AEE A;  2LHN A;  3JAD A;  3VY8 X;  3I9W A;  3QRA A;  3AAE B;  3A7M A;  1HX8 A;  4YFS A;  3VRB A;  3AE3 A;  2E5V A;  1GFP A;  5HXC A;  5L47 A;  4LF5 T;  1OED B;  2XSA A;  5HXS A;  3RYC E;  2WDV A;  4MHC A;  4O8S A;  1KNZ A;  3UU8 A;  2ODJ A;  1HF8 A;  2AE9 A;  2WJQ A;  3R84 B;  5HEO A;  4EYU A;  5E79 O;  5EZY E;  1FMV A;  2XQ6 A;  4MAL A;  1ZV4 X;  3KVB A;  4ILU A;  2WWU A;  4PK5 A;  4X66 T;  3ZMS B;  5CFB A;  5JTG A;  2ZFG A;  4IE7 A;  2GK9 A;  5FNV E;  5CA1 E;  2NOX A;  2WS3 A;  4K0K T;  3VR9 A;  3RH3 A;  4KHP T;  2D0U A;  2ZM0 A;  2J47 A;  4QH5 A;  3PQU A;  2FGQ X;  3POR A;  4U7Y A;  4LF8 T;  5AFU L;  2Y6X A;  2F1V A;  2X66 A;  4YHJ A;  5ABG A;  2XE1 A;  5LXT E;  4TUY E;  3U78 A;  5FVN A;  2XMX A;  2WSS V;  3N9L A;  2K48 A;  2J4U P;  3WU2 O;  2VL8 A;  3ZYK A;  2KDY A;  3PUS A;  3H3M A;  2K4T A;  4Z91 A;  3T1Y T;  2QGS A;  4U9C A;  4KI0 F;  2H7O A;  3NRY A;  2XPK A;  1KEY A;  2CLY C;  1Q9G A;  5BR8 T;  2F1T A;  4JI3 T;  5FXW A;  3RX6 A;  3KBU A;  2LFU A;  2NW7 A;  2LM2 A;  2N2L A;  2NW8 A;  1NAF A;  2CM0 A;  2JRK A;  2KZ7 A;  1OPF A;  4MLK A;  2KIN B;  2KWH A;  1E7P A;  3F57 A;  5LB7 B;  4YSY A;  5JDL A;  1D1C A;  4H9N C;  1SA0 E;  5HXE A;  4DR6 T;  5FKY A;  5G38 A;  4O2B E;  3AEA A;  4IDZ A;  5HWX A;  4NXN T;  1SUM B;  5E0O A;  2V8S V;  4IE5 A;  4A5X A;  4ZS2 A;  3TLW A;  2YDQ A;  3FB2 A;  2FJA A;  3A8Y C;  4RLB A;  4O3Z A;  4UIG A;  1Z8U A;  4QKN A;  3B13 A;  5FP3 A;  2R88 A;  3GN5 B;  4MBQ A;  5DQW A;  4EZH A;  3C98 B;  2L3L A;  2Q9Q D;  3UQ7 A;  3RRC A;  4QXB B;  2H3R A;  4O4X A;  2CE7 A;  4H63 V;  4O4I E;  3PUX F;  1I6Z A;  4GKK T;  3UPG A;  2CXF A;  3AE4 A;  3PUG A;  5HEG A;  5LA6 E;  3PUW F;  5FY7 A;  3UU3 A;  2I6H A;  2J1N A;  3CX8 B;  3FYX A;  1IAP A;  3LDQ B;  4ANJ A;  2BVL A;  4LSH A;  5JH7 E;  3KVA A;  5LOV E;  2V7I A;  1HNW T;  2JJ9 A;  3EVY A;  4TWH A;  3VU7 H;  4G76 A;  2BBH A;  4GIW A;  4HFV A;  4IE0 A;  4UVA B;  4I50 E;  3ESL A;  1KFY A;  4I4T E;  4HEA A;  1EZ3 A;  2LRK A;  3POX A;  3GWH A;  4U3C A;  4FZM A;  5IWA T;  1XWM A;  5GTH O;  3TLT A;  2FBW A;  2W0G A;  2WBL A;  5CGM A;  5AQI B;  4GYR A;  3KZI O;  3Q5X A;  3LK3 B;  5AQK B;  2KWI B;  2BKP A;  4GCP A;  4ZS3 A;  4HFB A;  4FSO A;  4TZ4 C;  5F5W A;  1T8B A;  3B57 A;  3ZN0 B;  4DR1 T;  2QRX A;  2Y0K A;  3AA6 B;  4O4H E;  2BS3 A;  3ZCI A;  3ZST A;  2CXL A;  2LSK A;  4FSP A;  2XQ5 A;  3ZKR A;  4UEL A;  1YW0 A;  3O1J A;  2JMK A;  2LT3 A;  3PUR A;  5L3E B;  1HXU A;  3MJX A;  3H3A A;  3SRZ A;  2QYW A;  4NUU A;  2VKO A;  2DWK A;  5AQQ B;  4LF6 T;  1H7C A;  3TLU A;  5FXZ A;  5HAX A;  5LP6 E;  3ZT5 A;  2J4G A;  4LF7 T;  4Q25 A;  3O1I A;  5EK4 A;  4HFH A;  4A97 A;  1B7T A;  2D9D A;  2LJL A;  3C5O A;  4X5T A;  5FY1 A;  3KV5 A;  2Y8D A;  2Q9Q A;  2KSR A;  4GYS A;  2YN6 A;  5DAB A;  2IHR 1;  5LYJ E;  4QH1 A;  3AEF A;  2R4P A;  2PG8 A;  4EV6 A;  2Y0L A;  1QUU A;  2G0U A;  4LFC T;  4TV9 E;  5GTI O;  3KV4 A;  4X65 T;  1YXR A;  4LF9 T;  2KLQ A;  3AA1 B;  2ZLD A;  5J1G A;  2K3W A;  3P7I A;  4TV8 E;  1E54 A;  2BVM A;  5LG3 A;  4IDP A;  4U74 A;  1Q9F A;  3P4R A;  3GP6 A;  4FZN A;  3PGR A;  4AYN A;  2UXX B;  4ILC A;  2JQY A;  4L0R A;  4FRT A;  2VQF T;  2V5C A;  3B5M A;  3IHR A;  2ES0 A;  2DI4 A;  5JR9 B;  2XHE B;  2V7M A;  4JI6 T;  5HYA A;  1N33 T;  4JEH B;  4WBO A;  5ETW A;  4JYA T;  5KDM C;  2VKH A;  2W63 A;  2CPT A;  4EXT A;  3FXD B;  2WZH A;  1OED C;  4ERR A;  1ZHZ A;  3PUY F;  4AKR B;  2K5B B;  3V8U A;  5LCY A;  3PJA J;  4O4J E;  3GA8 A;  4HE8 A;  3M65 A;  3C4X A;  2A2F X;  1FIO A;  1HG5 A;  2V7L A;  1UX5 A;  4I43 B;  2V6Y B;  4DND A;  3UFE A;  2AXT O;  3P4W A;  2WU5 A;  3AE5 A;  5AQJ B;  2JPF A;  5JDG A;  4NUV A;  1QSD A;  2VK9 A;  2X9X A;  2NP9 A;  2BZB A;  1UCU A;  3NVO A;  4YTM A;  1HNZ T;  3CQG B;  5KMG P;  3N2O A;  3KBT A;  5L3B B;  5DJQ C;  2QVA A;  5LGN B;  5LJN A;  4O4U A;  4AKI A;  3P4Q A;  3HKC E;  3AAE A;  3DWO X;  3AEG A;  1S94 A;  1D0Z A;  4PJM A;  1HX1 B;  3WI4 A;  2CEA A;  1OWA A;  1BH3 A;  3K19 A;  4DV0 T;  2E5L T;  2YNK A;  3N9O A;  1OED A;  4ZHQ E;  3VHL A;  5KX5 E;  4PFP A;  3UQ4 A;  3U3I A;  2X0L B;  3N9Q A;  3T24 A;  3RGL A;  4UF0 B;  3PRN A;  4OHF A;  5JRC B;  3UUN A;  5LHI B;  3HA4 A;  1IZN B;  4UVB B;  4GK0 E;  4JI0 T; 
#chains in the Genus database with same CATH homology
 2LSG A;  2LOP A;  3E22 E;  2B1E A;  3ZYK A;  5JDH A;  3SZD A;  4F4B A;  1P4T A;  2KDY A;  1MMA A;  2JQQ A;  3RYI E;  2ZMA A;  3VE2 A;  3PUS A;  3TKL B;  1HG2 A;  4L9I A;  2P9B A;  5FYM A;  4N58 A;  5LBM A;  2K4T A;  3ZYL A;  2QGS A;  4U9C A;  2DCF A;  2V26 A;  2MNH A;  3BQI A;  3LJC A;  1WLX A;  2H7O A;  3RYH E;  4FMS A;  3NRY A;  2PRN A;  5CA0 E;  4EYY R;  4ZI2 D;  5CB4 E;  3JC6 D;  2CLY C;  2XE2 A;  3ZJ2 A;  1Q9G A;  2F1T A;  1MM5 A;  3WI3 A;  2X9Y A;  3Q9D A;  4AI6 A;  1MMN A;  2X67 A;  5FXW A;  3HOE A;  2V7K A;  3PUA A;  3RX6 A;  3HW9 A;  3POU A;  1YD8 G;  2KMF A;  2XG6 A;  3SWH A;  2Z6E A;  3KBU A;  4YJ2 E;  2LFU A;  2NW7 A;  4UF0 A;  5LHI B;  5JRC A;  3PQS A;  4G2A A;  3VZW X;  3ETU A;  2N2L A;  1ZHX A;  2JRK A;  1NAF A;  2CM0 A;  2NW8 A;  3PU8 A;  2KZ7 A;  3L09 A;  1OPF A;  2A72 A;  4MLK A;  3NRX A;  2LM9 A;  1BR0 A;  3P8C D;  2KIN B;  2KWH A;  3O1H A;  5IYZ E;  3KFW X;  4C90 A;  4ZI3 D;  4N59 A;  3MKD A;  4BA9 A;  1U4Q A;  5BMV E;  3F57 A;  4MFR A;  4C69 X;  5JDL A;  1D1C A;  3PU3 A;  4H9N C;  1SA0 E;  3Q2M A;  5HXE A;  1FEW A;  4AKL A;  1UX4 A;  3RRW A;  4G63 A;  4O2B E;  1PRN A;  2W61 A;  2MTQ A;  4IDZ A;  5HWX A;  4GCS A;  2WMN A;  5E0O A;  4IE5 A;  4RJW A;  4QXH B;  1G90 A;  1U5P A;  5L3C B;  4ZS2 A;  2CLY B;  4WBN E;  5FY0 A;  4DVD A;  5DQV A;  5LGT B;  5FMN A;  3NZQ A;  5LHG B;  5JR9 A;  3IBP A;  3LK2 A;  1WYB A;  4PJJ A;  1MIW A;  4QX8 B;  5JVD E;  4UVC B;  2ERV A;  2LEH A;  3FB2 A;  5AFU K;  4BJM A;  4JEU B;  5JDQ A;  1THQ A;  3KDS E;  2D5U A;  4PK6 A;  4FZL A;  4KR8 A;  5LNK A;  4X1K E;  4AFK A;  1V9D A;  4AQF A;  4RLB A;  4O3Z A;  2RP4 A;  2NW9 A;  2ZM8 A;  2FGR A;  3D0T A;  4UIG A;  2I59 A;  4QKN A;  3B13 A;  5EK2 A;  2KXP B;  5FP3 A;  5JRE A;  4O3W A;  5G26 A;  3GN5 B;  3J7Y q;  4MBQ A;  4QWN B;  3OKQ A;  5DQW A;  4O3X B;  4H9O C;  4EZH A;  4E7S A;  3C98 B;  3N9P A;  4JLE A;  2CWY A;  2L3L A;  2KC0 A;  3MA9 A;  2C5K T;  3KV9 A;  2Q9Q D;  3C64 A;  4YLH A;  4CXX A;  3ZMZ B;  3I9Y A;  4KMC A;  3RRC A;  2DHR A;  3WAK A;  5DL8 A;  4QXB B;  2D0T A;  4IHJ E;  4WW0 A;  3RYF E;  4CXW A;  2Y7S A;  2RA1 A;  2H3R A;  4BUM X;  4AKH A;  4GK5 E;  1SHZ C;  1IJ6 A;  3UUX B;  4O49 A;  3I0Q A;  4O4X A;  2CE7 A;  3AB3 B;  3A5X A;  4H63 V;  4XBF B;  1Z0P A;  2GE4 A;  3F2E A;  5J2T E;  2MBG A;  4O4I E;  3KVD D;  1ORM A;  2H7V C;  2LHR A;  4ZI2 C;  3JC6 C;  2LOS A;  3K3O A;  4H9P C;  3VZU X;  3UPG A;  2CXF A;  2D2S A;  5ADX L;  7PRN A;  1HS7 A;  3K3N A;  3DA4 A;  3RKO A;  4PW8 A;  3QRC A;  3PUG A;  5LA6 E;  1FMW A;  5F3J A;  4AUI A;  5FY7 A;  2CMR A;  2CWO A;  3GN5 A;  1ZHT A;  4IGU A;  3SYS A;  2VKJ A;  4XNL A;  3O4X E;  4CI1 B;  5GON E;  2J1N A;  3CX8 B;  3WAJ A;  4PNI A;  1QJ8 A;  2X9H A;  3FYX A;  3OBV E;  3CQC B;  1S35 A;  1IAP A;  4ANJ A;  5C8Y E;  3KV6 A;  4D5U A;  2BVL A;  4LSH A;  6PRN A;  2YU2 A;  1D0Y A;  2Y48 B;  4ZI3 C;  2K24 A;  4BJN A;  3ZEF B;  2C5I T;  2PJQ A;  5JH7 E;  1HXX A;  1D1B A;  3KVA A;  5LOV E;  4KUM B;  2M06 A;  2V7I A;  5JDM A;  3HWB A;  2JJ9 A;  2WM9 A;  2X68 A;  2MOZ A;  4ADZ A;  4PK4 A;  3EVY A;  4QX7 B;  3VU7 H;  5HXH A;  2ZLY A;  4HKA A;  4G76 A;  3FHN A;  1QJP A;  1Y64 B;  4JFB A;  4FI5 A;  1BR4 A;  2X9W A;  4GIW A;  4G75 A;  3RBH A;  4HFV A;  2ACX A;  4IE0 A;  3AA0 B;  4UVA B;  5A1L A;  2K0L A;  4I50 E;  3N9N A;  4X1I E;  4OK0 A;  3ESL A;  1BR2 A;  2L9Q A;  5T5F A;  4I4T E;  4AYD C;  4HEA A;  5GV0 A;  5H6Q B;  1PHO A;  3A2S X;  1CUN A;  2W00 A;  4LSE A;  1NWM X;  1EZ3 A;  3OJA A;  3HOL A;  3HI2 A;  1HTJ F;  3FXE B;  3MXZ A;  3MZK B;  5HWY A;  3POX A;  2X27 X;  3ZMV B;  1D0X A;  3GWH A;  3DJB A;  2WMO A;  1QJ9 A;  1US7 B;  4GCQ A;  3ETV A;  4FZM A;  3NZP A;  2XAQ B;  5DL6 A;  4XAX B;  1ZHY A;  2MHL A;  2IC6 A;  2W0G A;  4EIW A;  1IZN A;  2WBL A;  4J2C A;  1VRB A;  2E8I A;  5EE2 A;  4AQG A;  4BAY B;  4XNK A;  5DL5 A;  3CVR A;  1LVK A;  3E08 A;  2EHO D;  1YKE B;  1H6S 1;  2XAG B;  3CQX C;  1X79 A;  4GYR A;  3CML A;  3WI5 A;  3UT5 E;  4EOZ B;  3Q5X A;  2XAF B;  1YS5 A;  1MNE A;  3LK3 B;  3FBL A;  4RJX A;  2KWI B;  3RC3 A;  4Z3T A;  4M1P A;  4GCP A;  4ZS3 A;  3L3P A;  4FSO A;  3AA0 A;  4TZ4 C;  3VY9 X;  4D64 A;  1ZEE A;  1BT9 A;  1BXW A;  4ASK A;  1ZKE A;  5ADX K;  3B57 A;  4KP3 C;  3AVS A;  3ZN0 B;  2LSY A;  4EZ4 A;  4A56 A;  2QA7 A;  3VKH A;  3HKE E;  1T98 A;  1ZHW A;  2JMM A;  4E1S A;  2POR A;  2Y0K A;  3AA6 B;  1MMD A;  3T20 A;  1IJ5 A;  4O4H E;  3CX7 B;  4DO0 A;  3ZJ1 A;  4JUY A;  3ZCI A;  3GMI A;  4H63 H;  4X20 E;  2ZM2 A;  5L2L A;  3S4U A;  3POQ A;  5LG4 A;  2CXL A;  2C0S A;  2M67 A;  4O3Y A;  2DWG A;  4DBR A;  2LSK A;  4O4L E;  3F31 A;  2A3D A;  3ONX A;  4GHB A;  4FSP A;  2NTX A;  5H6R B;  3AA7 B;  1E1H B;  4GF4 A;  4UEL A;  4V1A v;  1MM4 A;  1YW0 A;  1HFA A;  2Y0H A;  4U72 A;  3BQL A;  2V7J A;  3O1J A;  3Q5W A;  2JMK A;  4HN9 A;  2LT3 A;  5FXX A;  1ZHC A;  2N2M A;  3SYB A;  3PUR A;  5L3E B;  1G73 A;  2Q9Q B;  3PDY A;  1HXU A;  4CZZ B;  3FBZ A;  3MJX A;  2XAJ B;  4L5G A;  2YPV A;  5EK3 A;  3H3A A;  2YEV C;  4NUU A;  3SRZ A;  3EMN X;  5IYU A;  2E9X D;  2VKO A;  2DWK A;  3IF8 B;  2W81 C;  2QTK A;  4AYI D;  2IW5 B;  2X51 A;  4PJL A;  2V1D B;  3LK4 2;  4QQ1 A;  1GFQ A;  3AA6 A;  3SY7 A;  3N2K E;  4AZL A;  2IAK A;  4KR4 A;  1H7C A;  4FRX A;  5IHY A;  2JMH A;  4FJO A;  3T8O A;  3SS1 A;  5FXZ A;  4EB6 E;  3V5U A;  5HAX A;  2M07 A;  5LP6 E;  3K8P C;  1LRZ A;  4CQI A;  3O1I A;  5EK4 A;  4CI2 B;  1B7T A;  1AJ3 A;  1GFO A;  4FES A;  1HCI A;  2LJL A;  3C5O A;  1D1A A;  1WRD A;  3QC9 A;  4AYM C;  5FY1 A;  4OYK A;  2KXP A;  3CKD A;  4RL9 A;  1LVF A;  5TAO A;  4OYJ A;  3IEE A;  4B61 A;  2XE5 A;  3KV5 A;  2Y8D A;  2KT9 A;  2Q9Q A;  2PBI A;  3K3Q C;  3N9M A;  3SZV A;  4K0U A;  4E7Z A;  3UUL A;  3QUJ A;  4GYS A;  2IC9 A;  3C51 A;  4P09 A;  4UV8 B;  3SOL A;  2XTR A;  3AVR A;  5DAB A;  1G8X A;  2N1G A;  5LYJ E;  2EHO C;  3VZT X;  2DNX A;  2XE3 A;  3T0S A;  4KRA A;  5HXR A;  4P0B A;  4RLC A;  5PRN A;  5F8P A;  2K9A A;  3HKD E;  2CXD A;  1BR1 A;  2PG8 A;  3UAQ A;  2Y0L A;  1QUU A;  2G0U A;  2VWA A;  1MMG A;  4UEM A;  4E1T A;  4UXN B;  3CX6 B;  4TV9 E;  1GFN A;  3LBX B;  3LK4 1;  4FT6 A;  8PRN A;  3CPZ A;  3KV4 A;  3SY9 A;  4DMV A;  3UTK A;  5M4Y A;  1MND A;  3KIN B;  2KND A;  2HPJ A;  3R6N A;  2KLQ A;  3AA1 B;  3I0O A;  4HGA A;  4I55 E;  1HXT A;  3JTY A;  3PE0 A;  3MK7 C;  5LJM A;  2ZLD A;  5J1G A;  1VOM A;  3P7I A;  2NWB A;  3DA3 A;  4TV8 E;  1E54 A;  2BVM A;  4H9Q C;  4AKM A;  3QK6 A;  3EUH A;  4U74 A;  1Q9F A;  3BQK A;  3GP6 A;  5L3D B;  4TX5 A;  4FZN A;  2UXN B;  4OFZ A;  4AYN A;  2UXX B;  4PAG A;  3ZYM A;  4L0R A;  2EHO B;  2OA5 A;  4FRT A;  3EDV A;  4DMW A;  4IST A;  4B6X A;  4QXC B;  4CXY A;  3IHR A;  2ES0 A;  4DBQ A;  2DI4 A;  5L3G B;  4Z8X A;  2XTQ A;  2Q9Q C;  5JR9 B;  3HKB E;  3LK2 B;  3C50 A;  2LE8 A;  2XHE B;  2DLR A;  2E9X C;  3DP7 A;  3LBX A;  2V7M A;  2C5J A;  3OYZ A;  5HYA A;  2XQY A;  4IE6 A;  5DL7 A;  4JEH B;  2NTY A;  4WBO A;  3RC8 A;  5ETW A;  3V5S A;  5JDN A;  3H37 A;  2XAS B;  5KDM C;  2VKH A;  2W63 A;  5LGU B;  4EXT A;  2LSJ A;  3FXD B;  3LFM A;  2O4V A;  3AA1 A;  4UV9 B;  4ERR A;  2SPC A;  4XZC A;  3AAI A;  1ZHZ A;  5D5D A;  2VAS A;  3I1A A;  4PFO A;  4TN7 B;  1WR6 A;  4KBM B;  3HL6 A;  3NBX X;  4AKR B;  2K5B B;  3AAA B;  4YJ3 E;  3V8U A;  3OYX A;  5LCY A;  3N2G E;  2ODV A;  2WAU A;  3J9X 1;  4FUV A;  4H9S E;  4O4J E;  3GA8 A;  1LKX A;  4F6R C;  3O9X A;  3C4W A;  4HE8 A;  4CI3 B;  3M65 A;  3RPU A;  2XUE A;  3PUQ A;  3NSG A;  5LBQ B;  3C4X A;  1MPF A;  2A2F X;  2EHO A;  1FIO A;  3UU2 A;  1HG5 A;  4C91 A;  2VB6 A;  4QHO A;  3VKG A;  3G7G A;  4D65 A;  2LHN A;  3ANW B;  3VY8 X;  3I9W A;  3E0Z A;  4GOU A;  4ISS A;  2V7L A;  1UX5 A;  4I43 B;  3ZMT B;  3LK3 A;  3QRA A;  3AAE B;  2J4U P;  1HX8 A;  5L3F B;  4YFS A;  4DND A;  2YIN A;  2YU1 A;  2E9X B;  3UFE A;  4IIJ E;  2XTL A;  2HH7 A;  1GFP A;  2MYS A;  5LHH B;  1GFM A;  1KK7 A;  2OMF A;  3ZPO A;  1MIY A;  2JPF A;  5HXC A;  5JDG A;  3DTO A;  3TZG A;  2CA5 A;  5JDP A;  4NUV A;  1QSD A;  5HXS A;  2VK9 A;  4AKR A;  2X9X A;  2NP9 A;  2BZB A;  2W80 C;  3AAA A;  3RYC E;  4IE4 A;  1UCU A;  3BK9 A;  2N2N A;  4AXP A;  4MHC A;  4O8S A;  1KNZ A;  2LHF A;  3CQG B;  5KMG P;  2LSI A;  1OSM A;  3ZCJ A;  2ODJ A;  2J1D G;  5J2U E;  3ZC0 A;  1HF8 A;  3AA7 A;  4HTE A;  4X1Y E;  3N2O A;  3R84 B;  3KBT A;  4EYU A;  5L3B B;  4WNK A;  5FXV A;  5JQG E;  5DJQ C;  5EZY E;  3ANW A;  1FMV A;  4MAL A;  2L8K A;  1ZV4 X;  2YK0 A;  3KVB A;  2WWU A;  4ILU A;  4PK5 A;  4PJN A;  5LGN B;  3EDU A;  5LJN A;  4AKI A;  4O4U A;  3HKC E;  3AAE A;  5FVN A;  4AYE C;  3ZMS B;  2W62 A;  2ZFG A;  3ZN1 B;  4FOZ A;  4P0A A;  4IE7 A;  3HR0 A;  2GK9 A;  1S94 A;  2Y2X A;  1D0Z A;  2E9X A;  5FNV E;  4PJM A;  5CA1 E;  4LSI A;  3UUM A;  2NOX A;  3WI4 A;  2CEA A;  2HPL A;  4EAH A;  1OWA A;  3RH3 A;  5JDF A;  1BH3 A;  2VKD A;  3MAC A;  3K19 A;  4ZOL E;  2CCQ A;  2YNK A;  3N9O A;  2D0U A;  3ZLI A;  3CWZ B;  2ZM0 A;  4H9R C;  3ZMU B;  4ZHQ E;  3VHL A;  3C4Z A;  4LSF A;  3ZC1 A;  3VE1 A;  2XAH B;  5KX5 E;  4JCH A;  5JR9 C;  4O2A E;  4PFP A;  4AKG A;  3PQU A;  2FGQ X;  3POR A;  3U3I A;  2X0L B;  1MIV A;  1YKH B;  3N5L A;  5AFU L;  3N9Q A;  2Y6X A;  2F1V A;  2PFV A;  2X66 A;  3PTR B;  3O0E A;  3T24 A;  3PRN A;  2ODU A;  4UF0 B;  2BDE A;  4YHJ A;  4OHF A;  1O3X A;  3LG7 A;  5JRC B;  1WYC A;  4AQF C;  2XE1 A;  3UUN A;  3W15 B;  5LXT E;  2N9D A;  3HA4 A;  4TUY E;  1IZN B;  2KZ7 B;  4UVB B;  2WSS V;  4GK0 E;  4N78 D;  3U78 A;  4ZI7 E;  3N9L A;  2K48 A;  2XMX A;  4PUX A;  1OXZ A;  2VL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...