4O3XB

Crystal structure of the vaccine antigen transferrin binding protein b (tbpb) mutant phe-171-ala from actinobacillus pleuropneumoniae h49
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
241
structure length
241
Chain Sequence
PALGYVVKVPVSSFENKKVDISDIEVITNGNLDDVPYKANSSKYNYPDIKTKDSSLQYVRSGYVIDGEHSGSNEKGYVYYKGNSPAKELPVNQLLTYTGSWDFTSNANLNNEEGRPNYLNDDYYTKAIGKRVGLVSGDAKPAKHKYTSQFEVDFATKKMTGKLSDKEKTIYTVNADIRGNRFTGAATASDKNKGKGESYNFFSADSQSLEGGFYGPKAEEMAGKFVANDKSLFAVFSAKHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Transferrin binding protein B
publication title Nonbinding site-directed mutants of transferrin binding protein B exhibit enhanced immunogenicity and protective capabilities.
pubmed doi rcsb
source organism Actinobacillus pleuropneumoniae
total genus 64
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 4o3xB01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4o3xB02
4AYDC 4Z3TA 3V8UA 4AYEC 3HOEA 4O3XB 4U9CA 4O3ZA 5EE2A 2W80C 2KC0A 2KDYA 2W81C 3VE1A 3KVDD 2YPVA 5T5FA 4O3YA 3HOLA 3PQSA 2LFUA 4O4XA 4AYNA 3VE2A 3UAQA 4AYMC 4O4UA 4O49A 3PQUA 4QQ1A 1YS5A 2Y7SA 4AYID 4O3WA
chains in the Genus database with same CATH superfamily
4YH0A 4YGGA 1G90A 4IB9A 3GP6A 3ZWEA 1EI5A 2R4LA 2OFAA 2KXPB 4COTA 3CKFA 2YG2A 3O22A 5T5FA 1KL4A 1SMPI 4RLBA 2RTQB 1SY0A 4UB6O 4ORWA 4ORRA 4QQ1A 1ZNKA 1SXUA 3IA8A 5FAZA 1HBPA 4NYRA 4AZPA 4GCPA 4AUIA 3D95A 2OVDA 1QJ8A 1KQWA 2ANSA 4YCHA 5GTIO 2OF8A 5AQ6A 5CSEA 1O1UA 4FT6A 4BUMX 1RLBE 3FA8A 4GK9A 1PBOA 2FRSA 2XTRA 1UYOX 1MK5A 5H9NA 2OMFA 2K23A 4Z2OA 1DC9A 3OJYC 3LV4A 3VHHA 1IZNA 1H91A 1LF7A 1DZMA 1MM9A 2VDFA 3PQSA 3AAEA 4NYQA 4Y0RA 3TGBA 1ZNHA 1LCWA 4MEEA 3E3CA 4GDAA 2JN3A 1DZKA 2Y3FA 1KGLA 2R74A 3T2XA 1KT4A 4O3ZA 1YWAA 4YCEA 1WBIA 3EC5A 1HXZA 4KC7A 1FDQA 3FR4A 4ZJ0A 4DQ4A 3AA7B 4GKCA 1HMSA 4GE1A 1ZHTA 4YFQA 1LUQA 2HKDA 1RXKA 3BX8A 1I78A 1SWOA 2IZGB 2F1TA 1A2DA 1YUPA 3AKMA 1VWGB 2KDYA 4BBOA 1JMXA 4CDDA 2FTBA 3QQ2A 2BS6A 3TGAA 5IXGA 1G85A 2L9CA 1T68X 3KVNA 3SOTA 3H3IA 2UZ2A 3HW9A 3SYSA 1CBIA 3SZJA 2CZTA 5GV0A 5HA1A 2QCBA 4E1SA 3CQNA 4LSIA 1JJXA 3ZI8A 2R88A 2IWVA 2FS6A 3WZOA 4ZGUA 1SWLA 4OMWA 1KT5A 1ML7A 4HWMA 3PQUA 3WJBA 1VWEB 3CQRA 1ZNDA 3KFIA 5AFUK 3GE2A 3UEXA 1NBXA 1GT3A 1ZHZA 4TJZA 1QQSA 2QO6A 5AJBA 1DF3A 5L3YA 2BHVA 1E06A 2E4JA 1O8VA 1JIWI 3ELXA 3UEVA 3ZW1A 2X8TA 2RTLA 1CBQA 4BOEA 2MM3A 1Q9GA 2QO5A 4GJVA 2FHLA 1GKAA 2I5ZO 2ACOA 4AZOA 1GM6A 1SRGA 4GGZA 4GJSA 1GT5A 3EM0A 1SXYA 3SY7A 3VG5A 2AXTO 1EW3A 3WBGA 1OBUA 2WVPA 1KT3A 5IYUA 1BBPA 4A60A 4ZR2A 1NQNA 4GD9A 2BSZA 3JSQA 2OL7A 3SZVA 5HWZA 2Z4IA 3IFBA 2OFRX 5KHPA 4FOZA 1SXWA 4CV7A 3NJTA 1KFFA 2FR3A 5HCCC 1KL3A 2FKJA 4FZLA 3G7XA 2X27X 1LDQA 3FA6A 3FW5A 3NR3A 4XMDA 4CPEA 3KZIO 4FRXA 4MVIA 4D65A 3BU9A 4QZTA 5FFHA 4C00A 4CTDA 4RJXA 3GAQA 5ADXL 2AT8X 1GFOA 1OPAA 4GZVA 1HXTA 4YMYA 4GCSA 4CSBA 2FT9A 1WUBA 3KZAA 1OEEA 4OMXA 1Y9LA 3CWKA 1T0VA 2X8FA 3ZQ3A 4BJ8A 1SWKA 4Y0PA 8PRNA 2IZHB 4OS8A 4B61A 3AA6A 1I06A 2IZCB 1HXXA 4G75A 1ZRYA 1KT7A 4PJ0O 1LIFA 3SAOA 2KW1A 2Y3EA 2RTNB 1STRB 3G7GA 1X8NA 3POUA 3WYQA 5GTHO 3B2HA 4Y59A 1MPFA 2RTDB 2VFBA 3SYBA 4GHBA 5HTDA 5HCEC 1BXWA 3NQ9A 1EXSA 4I3DA 1ORMA 3T20A 1EPAA 2G8CO 3SLOA 2XMXA 1CRBA 3C5OA 1YIVA 2XE5A 3BLGA 3DWOX 4EXZA 4KIIA 3ZW0B 4KH8A 2R4OA 4BX6B 4GU8A 4ORYA 5EE2A 3FMZA 4N74A 3DZMA 3I17A 5HZQA 1MEPA 3HWEA 3APWA 2Y32A 1PBYA 3FR2A 1I4UA 5KAFO 3PK2A 1GX3A 1PEEA 2NP1A 2ZFGA 2RTMA 1SY3A 3P24A 1ACDA 2XKLA 2PY1A 1SWRA 5JDPA 1BH3A 3HWFA 4JHQA 2OVSA 5IRUA 4LZVA 3N91A 4YFRA 4KR8A 3C78X 3PEDA 4TLJA 1O1VA 5LJHA 3VU1A 1SWSA 1SLEB 1MX8A 1RSUB 1ZNGA 4WFUA 4BQUA 1AELA 2JGSA 5KIDA 3KQ0A 3CBSA 3A0HO 2HLVA 2F1CX 3WU2O 2HYSA 2X9KA 2M4LA 4DCBA 4FQEA 4I9SA 2CBRA 4BX7A 3S60A 5IRWA 3AAAB 4IB7A 2L5PA 3ZW0A 5F7GA 2FS7A 2OVEA 2W2FA 3PF1A 1W4TA 1A18A 3UAQA 3S5VA 1B56A 3SLTA 3EW1A 3B2KA 4O4OA 2IZKA 5KICA 3HOEA 1LIDA 2XG6A 1GX8A 4MVEA 4NW4A 1DZJA 1VWPB 1SWDA 4PJ2A 1KZXA 3PECA 5LJBA 4D64A 1B0OA 3EBKA 4O4UA 1SXXA 3FW4A 3WZPA 2N93A 2IZAA 5F58A 3WJDA 1XCAA 5IO5A 4AYDC 5HCDC 1SWGA 5AFUL 3B2IA 4U9CA 1TW4A 1DZPA 2QTKA 2GE4A 3OD9A 3HWDA 1I9HA 1PRNA 2FKGA 1T1LA 4WFVA 1LIBA 1KZWA 1UZ2X 2LA7A 3A0BO 3AAAA 3C77X 3PPTA 4D6BA 2MNHA 2RCQA 1SWEA 4XMCA 3WJEA 4LSHA 5LKFA 4NV8A 5EDBA 2CZUA 4GNWA 4ALOA 2X34A 4FZNA 4A1YA 1EIIA 1EIOA 2WEXA 1S7DA 3PP6A 1EALA 2PI3O 2X4MA 1HQQA 1G7NA 4KC8A 2WSJA 1VYOA 3ZW2A 2QOSC 2OFMX 4HPAA 3Q6LA 2YNKA 1UYNX 1JJJA 4IB6A 3HWGA 4E1TA 4FMSA 3MM0A 2W81C 4Y5DA 1VWAB 3VZTX 4FUVA 5FQ8E 3U9PC 5B29A 1A3YA 4Z2VA 1E00A 1SWQA 4N58A 2IZEB 4TKHA 2CBSA 3EMNX 1G74A 4N7DA 2FGQX 4A8ZA 5K68A 5D5DA 1AVDA 2YMSA 1X8UA 3CBCA 1VWOB 2ASNX 5FENA 1FJ1E 4IAWA 3HTYA 3D96A 5LJEA 2K0LA 1BSOA 5D47A 1BLRA 2KXPA 1P4TA 1EPBA 5EEDA 2GC9A 3C76X 3OE3A 3HWBA 1QABE 5B5GA 2PRNA 4O3WA 3VG3A 2I5VO 3JCUO 1PM1X 1IIUA 3ZUIA 4XMGA 4HFOA 4Z2PA 3U03A 2Y0LA 3ELZA 2Q4NA 2GTLN 1HXUA 4M7MA 3T1DA 1SWUA 3PORA 5D48A 2Q9SA 3JS1A 3SY9A 5CE4A 1JZUA 3AA1B 2RQ0A 3F8AA 1VWKB 4N75A 3SLJA 2RTRB 4QAEA 4ZHFA 4UU3A 1DFVA 3PDFA 4JGLA 3T24A 1I05A 1VWNB 3JQOA 4ZH9A 3NQKA 4FBRA 5PRNA 2G78A 1XKIA 3WJGA 3UEWA 3S5XA 2ZAGA 4ZHDA 4YBUA 3WVMA 4ZFXA 4OKAA 1VWCB 3AA7A 2RTGB 1KOIA 1TOUA 3WOVA 4D6AA 3RDQA 3RZYA 4I3BA 1N4JA 1JYJA 1LIEA 4OEMA 5DL5A 1GT1A 3EW2A 5FVNA 4Y0QA 1HBQA 3ZUOA 1LDOA 3BRNA 2A3FX 4ZCBA 2LHFA 4FBVA 3HOLA 2F1VA 3WXQA 2Z4HA 2GTLM 4FRTA 5BVQA 1NC9A 1QY1A 1BRPA 3FEPA 5LKEA 1UREA 4EKVA 1GFNA 2KZ7B 2F09A 2DM5A 1E2TA 1SRFA 4L1NA 5D8JA 4AYMC 1SREA 4ORUA 4XNLA 1OBPA 2RTCB 1X89A 5L8IA 3PRNA 3BRZA 2HZQA 1N9YA 2L67A 2A13A 2JMMA 3WI5A 5B2AO 1VWRB 2EU7X 4IMNA 2LFUA 1QY0A 2M07A 3K19A 3RKGA 4FGIB 5E79O 1T16A 4L3RA 2XE3A 2AT0X 2IZJA 5L8NA 4BGFA 5K06A 1RXHA 4TKBA 3MBTA 1VYFA 3NQ3A 4RUNA 4O4XA 4JO6A 5JR8A 2MO5A 4Y0SA 4ZHGA 1SWTA 1VWBB 1VWJB 1IFCA 2WQ9A 3T2WA 2P8GA 1MOYA 2JU8A 1A57A 2MHDA 1LCZA 3KFHA 3FENA 4EDEA 2C1SA 1EUOA 2AMMX 3RSWA 3WZQA 3BRYA 1NP1A 2KZ7A 3QRCA 4U8UM 2RCTA 3AEHA 5DL6A 1Y52X 2OY7A 1AB0A 4CDFA 2R8AA 3FEKA 1RSTB 1U17A 2A2UA 1SRHA 1CBRA 4BX5B 2X45A 3LTWA 3D9WA 3Q34A 1NQMA 3AKNA 1SWFA 3P02A 3P6FA 4ALBA 2OFBA 1RBPA 2AT6X 4Z27A 2OY8A 4RL9A 1B8EA 4Z6JA 2O62A 1ALBA 3RDSA 1GFQA 1Y55X 3RDOA 4N59A 3P6CA 1FEMA 1SLFB 3SZHA 1JYDA 4AKRB 2JU3A 4YBPA 1R0UA 1OEJA 2AH7X 2OZQA 2BC3A 1YP7A 1FELA 3U0DA 4I9RA 3HK1A 3FLLA 3A2SX 1VWFB 3LHNA 4I60A 4OELA 4AYNA 2WJQA 3APUA 2Q39A 2RTIB 2Y2XA 1OEKA 2DJFA 3D4RA 2J4UP 1LFOA 4CDEA 5EEEA 4ON1A 4GGRA 4UB8O 5G26A 3FR5A 3MG5A 3L4RA 2A5BA 3NX1A 2RTKA 2HMBA 4CK4A 1SLDB 4ORSA 1STPA 3PGSA 3X00A 3FYFA 4Z28A 3O2YA 3VY9X 2BLGA 3NADA 1AQBA 4WHIA 3VHMA 2C4IA 5LJDA 2OYBO 5B5EO 3STNA 1VWLB 4BX6A 5HA0A 2XTQA 3BX7A 2G79A 1KQXA 2POAA 3WI4A 3SZDA 2R4NA 1HMTA 1ERXA 3VG7A 5H9AA 1SA8A 5DL8A 3EMMA 3FA7A 2NNEA 2RTFB 4TNNA 1JQPA 4INNA 4QNIA 3VGWA 2XSTA 3PH6A 4I3CA 3PGUA 2A0AA 3TZSA 3STMX 2Q2PA 4QYPA 1E5PA 1HXLA 4LSFA 4DNEA 1GXAA 1SY2A 1OSMA 1SLGB 5H2FO 2FWVA 2WR6A 1GGLA 4O4SA 5HZ8A 2FHNX 1VWMB 1VPRA 4GETA 2OY5O 5G39A 4LKPA 1THQA 4AZRA 5AEOA 5ADXK 3QRAA 5LJKA 2O4VA 5EPQA 1U0XA 5F6ZA 2GJ5A 4MISA 5IRAA 1Y53X 2MWHA 2BT9A 2W2AA 2OVAA 2AT5X 1GT4A 4XMEA 2LFOA 2BS5A 4EQAC 5IO6A 3RY1A 2FR2A 4BCSA 2FLJA 2OF9A 4BVMA 2CM9A 1MX7A 3VPJE 2C1QA 1SRJA 4GNYA 3B2JA 5DG4A 2W80C 2FGSA 1IZNB 2JOZA 3HPEA 1AVGI 1BRQA 4QGXA 4YDBA 1HMRA 1N7YA 1X8PA 5DPQA 3VZWX 4QYNA 1VYGA 3WJCA 1ZHWA 2Y7SA 4PSQA 4FESA 2QO4A 5L8OA 1SWCA 3WYPA 2WEWA 4RLCA 4AZNA 4ES7A 5BVSA 1IKEA 1LPJA 3APXA 3WZNA 3STKA 4NNSA 2GTFX 1IJ8A 1ERBA 3NX2A 2ZLDA 2RTBB 5AJCA 1LELA 4MIRA 1W6FA 2DJGA 4Z3TA 4ID2A 2M06A 2OY1O 4AYEC 1ICMA 3RDXA 1D3SA 1SWJA 4LKTA 2IZDB 3NSGA 4IB8A 4AZMA 5BVTA 4C69X 1AVEA 3PGRA 3F9DA 2QMIA 3T6LA 2ODJA 1SWNA 5B11O 1OPFA 2IZBA 2LBVA 4YKMA 2JQYA 4PR7A 3LK42 2RA6A 4RUUA 3FDCA 4YGZA 1BWYA 2AL0X 3CMPA 3KFFA 1ZHYA 4A1HA 4AFKA 1ZNEA 1H6S1 4I6SA 1N0SA 5BYPA 5TISO 1JV4A 2N2LA 3DTQA 1PMPA 3JTYA 3KFGA 3RY2A 1GFPA 5FQ6E 4KT5A 1OSPO 3ZW1B 4GRJA 3AUMO 1TOWA 1GX9A 4GCQA 4R0BA 4NLIA 2ERVA 1GKAB 1FENA 2QM9A 1N43A 1MUPA 4K3BA 4ZH6A 2VFCA 4TKJA 3VHIA 1W5RA 1EQDA 2G7BA 1SWBA 1PTSA 2CAMA 3VG6A 2K4TA 3RBHA 1LKEA 1QG5A 5F1EA 4XMHA 1X8OA 1S44A 3SZIA 1K24A 2N2MA 1MVGA 3D97A 2KTDA 4IL6O 1S5LO 1BT9A 3O19A 3P6EA 1SWHA 5K67A 4NV7A 5G38A 3RWXA 1U18A 4ZHHA 1G5WA 4YGHA 5JD2A 4D5UA 5B5FA 5B27A 3FYXA 4G76A 4CPIA 4ZHCA 2RD7C 3P6DA 1YWDA 4AYID 4AYHA 5D4AA 1ZNLA 1D2UA 1FTPA 3AA1A 3RE5A 4U3QA 4ORXA 3VE1A 5EZ2A 5G3AA 2R56A 4U8UN 1HQPA 4IABA 1Q9FA 1YWBA 4YFPA 1OBQA 4AW8A 2X55A 4CPFA 4LSEA 2WJRA 2XE1A 4XNKA 3NPOA 2IFBA 2WUTA 3APVA 3AA6B 4TQ2A 3UPGA 2IZIA 5HZ6A 4NP1A 3CR6A 2R73A 1BEBA 3POXA 3TGCA 4O49A 2L68A 4LQZA 1TVQA 2K62A 5FQ7E 1E02A 3B2LA 4JCHA 4IBAA 3PH5A 4DQ3A 3UEUA 1HY2A 2G5LA 2R4PA 4EEJA 1LICA 5B3MO 2A8GA 2X46A 2HNXA 2CM4A 4QGVA 4UU2A 1E54A 3I0AA 4FQBB 3F6ZB 3RDMA 1BJ7A 3BSZE 1SRIA 3POQA 1YWCA 4EFGA 2X56A 4RJWA 1PHOA 1GFMA 1QFTA 4GUZA 4MVLA 4AZQA 5KAIO 2AF5A 4C4VB 3MX7A 1X71A 2ACPX 4QGWA 3KVDD 3BY0A 4MVKA 4FZMA 4GF4A 2LKKA 4K19A 1FE3A 1LCVA 1BSQA 1TXLA 4WBKA 1QWDA 2GTLO 2FGRA 3ZZVA 5HZ9A 5H9LA 1MDCA 3LK2B 1DV9A 4JNJA 5C0NA 4CDCA 2X32A 3P6GA 3VY8X 1CJ5A 3AA0B 1MM4A 4O3XB 4IMOA 4LZUA 4KR4A 3CKGA 4ARHA 2JMBA 2KTSA 5EDCA 1CBSA 3FIDA 2RTAA 4NLJA 1QFVA 1VWIB 2F01A 2R89A 2OL8O 1NGLA 2JU7A 2IZLB 4AKMA 1HN2A 3MVFA 4C5PA 2A2GA 4IAXA 2NNDA 2RTEB 1Y9TA 4ZGFA 4B55A 1ICNA 3FA9A 4QRLA 2AVIA 4C4VA 4N7CA 1X8QA 1IKJA 1K3BA 5D45A 3RE6A 5LJGA 1OPBA 2Q2MA 3VG2A 2MF6A 4BX7B 2JW1A 4QZUA 4NNTA 3S26A 2F73A 4GDZA 1ZHXA 5HAEA 1DF8A 4ODDA 3LK2A 1KT6A 4BX5A 2RTPB 4JFBA 1STSB 4FSOA 1QJPA 5LJCA 2ALLX 1P6PA 2WWPA 1I04A 4FSPA 2QOMA 2ZAIA 3AA0A 4FBOA 2X8SA 4U8UO 2ZSCA 3LK3B 1Z24A 2KC0A 2GH7A 1QY2A 5B66O 4O9SA 3T6FA 3P6HA 5F6BA 3VG4A 1MM5A 1SWAA 3VE2A 1RAVA 2A5CA 4AKRA 4ML7B 4PUXA 4XMFA 1JMZA 4I95A 3DA4A 2AKQA 4HPDA 4KRAA 4M6SA 1T8VA 4CPHB 2NNQA 5IO7A 4F4BA 4OS3A 5H9KA 3RBYA 2RTHB 3DA3A 3LK41 2UYWA 4YDAA 3VZUX 4KCAA 2J1NA 2RTOB 2KD2A 4GGTA 2LB6A 2RN4A 1BM5A 5HTEA 7PRNA 1NDJA 4GH7A 3FELA 2PORA 1B4MA 4YVBA 5DL7A 3UU2A 2Y0KA 2YPVA 6PRNA 1RXJA 3DWNA 2AT3X 3K3LA 2LBAA 3BS0A 1SY1A 2MHLA 1BSYA 1QJ9A 3WJFA 3RDUA 3LK3A 1N9MA 3EBWA 3FIQA 1Y0GA 5B10O 4IRWA 5CHKA 5H8TA 3EYCA 2KT4B 2MJIA 1VWQB 3TF6A 3V8UA 2WPUA 3NP1A 2Y0HA 1S2PA 5HBSA 2IZFB 1YP6A 2OL6O 4YKOA 2WQAE 4CPHA 1JBHA 4OS0A 5HZ5A 1L6MA 3TZGA 2XE2A 1IW2A 4HPCA 1SWPA 1NP4A 3OBLA 4U46A 2RTJA 4HPBA 3DSZA 3NBXX 1VWHB 3BU1A 3BDRA 1VWDB 3QKGA 3T0SA 3BS2A 2W2BA 3O0EA 1KXOA 4AZLA 1KL5A 2IWWA 1IFBA 5CYBA 3AAEB 5F2BA 4O3YA 2HZRA 1JJUA 4K3CA 1YS5A 1ADLA 1LNMA
chains in the Genus database with same CATH topology
2WQ9A 4YH0A 2G7BA 4YGGA 2P8GA 2JU8A 3VG6A 1A57A 1G90A 4IB9A 1MX8A 2K4TA 3GP6A 3ZWEA 3RBHA 1EI5A 1ZNGA 1LKEA 4WFUA 2MHDA 4BQUA 1AELA 2KXPB 5KIDA 3KFHA 3KQ0A 3CBSA 3FENA 1QG5A 2HLVA 5F1EA 4EDEA 2HYSA 4COTA 1EUOA 2AMMX 2YG2A 3O22A 4XMHA 3RSWA 5T5FA 1SMPI 2M4LA 1NP1A 2KZ7A 4RLBA 1X8OA 1S44A 3QRCA 1SY0A 4ORWA 4U8UM 4ORRA 4I9SA 4QQ1A 2RCTA 2CBRA 2N2MA 1ZNKA 1SXUA 3IA8A 5FAZA 5DL6A 1HBPA 3S60A 3AAAB 4NYRA 4IB7A 1MVGA 4AZPA 3D97A 2KTDA 2L5PA 3ZW0A 1BT9A 1AB0A 3O19A 3P6EA 4GCPA 3FEKA 4AUIA 3D95A 5F7GA 1U17A 2A2UA 2FS7A 2OVEA 2OVDA 1CBRA 2W2FA 3RWXA 1U18A 4ZHHA 1KQWA 1G5WA 1QJ8A 2ANSA 2X45A 4YGHA 4YCHA 4D5UA 1A18A 5AQ6A 5B27A 3FYXA 4G76A 3UAQA 4ZHCA 1O1UA 4FT6A 3AKNA 4BUMX 3P02A 2RD7C 1RLBE 3S5VA 3P6DA 1YWDA 3FA8A 1B56A 1PBOA 3P6FA 4GK9A 4ALBA 4AYHA 1RBPA 4AYID 2FRSA 5D4AA 2AT6X 3B2KA 4O4OA 5KICA 3HOEA 1ZNLA 1LIDA 1D2UA 2XTRA 1FTPA 5H9NA 2XG6A 3AA1A 2OMFA 1GX8A 4RL9A 1B8EA 4U3QA 2K23A 2O62A 1ALBA 1DC9A 4MVEA 4NW4A 3OJYC 1GFQA 1DZJA 3LV4A 4ORXA 3VE1A 4N59A 1IZNA 1H91A 1LF7A 3P6CA 4PJ2A 1DZMA 5EZ2A 1KZXA 3PQSA 1FEMA 3PECA 5LJBA 3AAEA 4D64A 2R56A 4NYQA 4Y0RA 1B0OA 3EBKA 4O4UA 1JYDA 1ZNHA 2JU3A 4U8UN 1SXXA 1HQPA 3FW4A 3TGBA 4YBPA 4AKRB 3E3CA 2JN3A 4IABA 1R0UA 2N93A 1Q9FA 5F58A 1YWBA 4YFPA 3WJDA 1OBQA 4AW8A 1DZKA 1XCAA 5IO5A 4AYDC 5HCDC 1OEJA 2AH7X 5AFUL 2OZQA 1KGLA 4LSEA 3B2IA 4U9CA 2R74A 2XE1A 1KT4A 1YP7A 1FELA 4O3ZA 3U0DA 1YWAA 4XNKA 4I9RA 4YCEA 4KC7A 1TW4A 3HK1A 3NPOA 1FDQA 3FLLA 2IFBA 3FR4A 4ZJ0A 4DQ4A 2WUTA 1DZPA 3A2SX 3AA7B 3APVA 3AA6B 3LHNA 4GKCA 1HMSA 4TQ2A 4GE1A 3UPGA 2QTKA 5HZ6A 3OD9A 1ZHTA 2GE4A 4NP1A 4YFQA 3CR6A 2R73A 1BEBA 3HWDA 3POXA 4AYNA 3TGCA 1PRNA 3APUA 4O49A 2Q39A 4WFVA 1LIBA 2L68A 1KZWA 1UZ2X 4LQZA 1TVQA 2K62A 5FQ7E 3BX8A 2LA7A 1E02A 3B2LA 2Y2XA 3AAAA 1OEKA 4JCHA 4IBAA 2F1TA 1A2DA 3C77X 3PH5A 3UEUA 4DQ3A 3D4RA 3PPTA 4D6BA 1LFOA 2J4UP 2MNHA 4EEJA 1LICA 1YUPA 3AKMA 2KDYA 2X46A 2HNXA 2RCQA 5EEEA 4XMCA 4ON1A 3WJEA 4LSHA 5LKFA 2CM4A 2FTBA 4UU2A 5EDBA 4QGVA 2CZUA 4GNWA 4ALOA 5G26A 1E54A 4FZNA 3I0AA 2BS6A 3TGAA 3FR5A 4FQBB 3F6ZB 1BJ7A 3L4RA 4A1YA 1EIIA 3BSZE 1EIOA 2WEXA 3NX1A 1S7DA 1G85A 2L9CA 3POQA 1T68X 2HMBA 1YWCA 4CK4A 3SOTA 3H3IA 3PP6A 4EFGA 4RJWA 1PHOA 1EALA 4ORSA 1GFMA 1QFTA 4MVLA 4AZQA 3HW9A 3SYSA 1CBIA 2CZTA 3FYFA 5GV0A 5HA1A 4E1SA 1G7NA 1X71A 3MX7A 2ACPX 3CQNA 4KC8A 2WSJA 4QGWA 3KVDD 4LSIA 3BY0A 1JJXA 3O2YA 3ZW2A 3ZI8A 2QOSC 3VY9X 4MVKA 4FZMA 2BLGA 2FS6A 4ZGUA 4GF4A 2LKKA 3NADA 1FE3A 4K19A 2OFMX 1AQBA 4OMWA 1KT5A 1ML7A 4HWMA 3PQUA 4WHIA 4HPAA 1BSQA 3WJBA 3Q6LA 1TXLA 3CQRA 5LJDA 2YNKA 4WBKA 1QWDA 2GTLO 2FGRA 1JJJA 4IB6A 3ZZVA 3STNA 3HWGA 5HA0A 2XTQA 1ZNDA 2G79A 3BX7A 4E1TA 5HZ9A 3KFIA 5H9LA 5AFUK 3GE2A 4FMSA 1MDCA 2W81C 1KQXA 2POAA 3UEXA 3SZDA 3VZTX 3WI4A 3LK2B 1DV9A 4FUVA 1HMTA 1ERXA 1GT3A 5C0NA 1ZHZA 3VG7A 4TJZA 5H9AA 5FQ8E 3U9PC 1SA8A 5B29A 1A3YA 5DL8A 1E00A 3P6GA 1QQSA 2QO6A 5AJBA 1DF3A 3VY8X 3EMMA 4N58A 3FA7A 2BHVA 1CJ5A 2NNEA 1E06A 2E4JA 3AA0B 4TNNA 1MM4A 4QNIA 4INNA 1O8VA 4O3XB 4IMOA 4LZUA 4TKHA 2CBSA 2XSTA 3PH6A 3EMNX 4I3CA 4KR4A 1JIWI 3ELXA 1G74A 3UEVA 3ZW1A 2A0AA 3TZSA 2X8TA 4N7DA 3STMX 2Q2PA 4ARHA 1CBQA 2FGQX 4QYPA 4BOEA 2JMBA 2KTSA 1E5PA 4A8ZA 2MM3A 5EDCA 1CBSA 1Q9GA 5D5DA 2YMSA 4NLJA 1QFVA 2QO5A 1X8UA 1GKAA 3CBCA 4LSFA 2ACOA 1GXAA 1SY2A 1NGLA 2JU7A 4AZOA 1GM6A 4AKMA 1OSMA 1GT5A 1HN2A 2FWVA 3MVFA 2A2GA 4IAXA 3EM0A 1SXYA 3SY7A 3VG5A 2NNDA 2WR6A 2ASNX 5FENA 1EW3A 4IAWA 1Y9TA 3HTYA 3D96A 4ZGFA 5LJEA 1GGLA 1ICNA 2K0LA 4O4SA 3FA9A 5HZ8A 1BSOA 4QRLA 1OBUA 3WBGA 1KT3A 5D47A 5IYUA 1BLRA 1BBPA 4A60A 1VPRA 2KXPA 1P4TA 4N7CA 4ZR2A 1EPBA 1IKJA 1X8QA 4GETA 5EEDA 5D45A 3VG2A 5LJGA 1OPBA 2Q2MA 3JSQA 2GC9A 4LKPA 3C76X 1THQA 3SZVA 5HWZA 4AZRA 2JW1A 4QZUA 5AEOA 5ADXK 3OE3A 4NNTA 3HWBA 3QRAA 3S26A 1QABE 5LJKA 2PRNA 2Z4IA 4O3WA 2F73A 3IFBA 5EPQA 4GDZA 2O4VA 1U0XA 2OFRX 5F6ZA 3VG3A 1ZHXA 2GJ5A 4MISA 5KHPA 4FOZA 1SXWA 5HAEA 2MWHA 2BT9A 4CV7A 2W2AA 2OVAA 1PM1X 1IIUA 3ZUIA 4XMGA 4HFOA 3U03A 2Y0LA 2AT5X 3ELZA 1GT4A 2Q4NA 4ODDA 2GTLN 4XMEA 3LK2A 1HXUA 2FR3A 2LFOA 1KT6A 4M7MA 5HCCC 3T1DA 4FZLA 3G7XA 2X27X 4JFBA 3FA6A 3FW5A 4FSOA 1QJPA 2BS5A 3PORA 5LJCA 2ALLX 3NR3A 4XMDA 1P6PA 2WWPA 2Q9SA 5D48A 4EQAC 3JS1A 5IO6A 3SY9A 2FR2A 1I04A 2FLJA 4FSPA 5CE4A 4FRXA 4MVIA 2ZAIA 4D65A 1JZUA 3AA1B 4BVMA 3AA0A 2CM9A 2RQ0A 3BU9A 1MX7A 3F8AA 4FBOA 4QZTA 2X8SA 5FFHA 3VPJE 4GNYA 4U8UO 3B2JA 3LK3B 5DG4A 2W80C 1Z24A 2KC0A 1IZNB 2JOZA 4RJXA 4QAEA 1AVGI 1BRQA 4ZHFA 1QY2A 4UU3A 3GAQA 4O9SA 4QGXA 1DFVA 3P6HA 5F6BA 3VG4A 4YDBA 1MM5A 5ADXL 1HMRA 1X8PA 5DPQA 2AT8X 1GFOA 3VZWX 3VE2A 4QYNA 4JGLA 1OPAA 4GZVA 3T24A 1I05A 1HXTA 1VYGA 3JQOA 4ZH9A 3NQKA 3WJCA 4YMYA 1ZHWA 2Y7SA 4ML7B 4GCSA 4AKRA 4FBRA 4PUXA 4PSQA 4FESA 2QO4A 5L8OA 4CSBA 2FT9A 4XMFA 2G78A 1XKIA 4I95A 5PRNA 3KZAA 1OEEA 4OMXA 1Y9LA 3DA4A 2AKQA 3CWKA 4HPDA 3WJGA 4KRAA 1T0VA 4M6SA 2X8FA 1T8VA 3UEWA 2WEWA 4RLCA 4AZNA 2NNQA 4ES7A 3ZQ3A 5IO7A 4F4BA 5BVSA 4Y0PA 1IKEA 8PRNA 3S5XA 2ZAGA 4ZHDA 1LPJA 3APXA 4YBUA 4OS8A 3WVMA 4ZFXA 4OS3A 5H9KA 3STKA 4B61A 3RBYA 4NNSA 3AA7A 3AA6A 1I06A 3DA3A 1KOIA 3LK41 2GTFX 1TOUA 3WOVA 1ERBA 3NX2A 2ZLDA 4D6AA 4YDAA 1HXXA 3RZYA 3VZUX 5AJCA 4G75A 4I3BA 1JYJA 1LIEA 4KCAA 5DL5A 2J1NA 4MIRA 2KD2A 1GT1A 1ZRYA 1KT7A 5FVNA 4Z3TA 4ID2A 4Y0QA 2M06A 1LIFA 4AYEC 3SAOA 1HBQA 3ZUOA 2LB6A 2KW1A 2RN4A 1BM5A 1ICMA 5HTEA 7PRNA 4GH7A 3FELA 2PORA 1B4MA 1D3SA 4LKTA 3G7GA 5DL7A 3UU2A 3BRNA 2A3FX 1X8NA 2Y0KA 3NSGA 4IB8A 2YPVA 3POUA 4ZCBA 2LHFA 4FBVA 3HOLA 4AZMA 5BVTA 6PRNA 2F1VA 4C69X 3WXQA 2Z4HA 3B2HA 2GTLM 1MPFA 4FRTA 5BVQA 3SYBA 4GHBA 3F9DA 2AT3X 3K3LA 5HTDA 2QMIA 5HCEC 1BXWA 2LBAA 3NQ9A 2ODJA 1SY1A 1EXSA 4I3DA 1ORMA 2MHLA 1QY1A 1OPFA 1BSYA 1QJ9A 3T20A 1EPAA 3WJFA 2LBVA 1BRPA 4YKMA 3FEPA 5LKEA 3LK3A 1UREA 3EBWA 1GFNA 3FIQA 3LK42 2RA6A 4RUUA 4YGZA 2KZ7B 1CRBA 2XMXA 3C5OA 2F09A 1YIVA 2DM5A 1BWYA 4L1NA 3BLGA 5D8JA 2XE5A 5H8TA 2AL0X 3EYCA 4AYMC 4ORUA 3CMPA 4EXZA 4XNLA 2KT4B 4KIIA 3KFFA 1ZHYA 1OBPA 2MJIA 1X89A 5L8IA 4A1HA 3PRNA 4AFKA 2HZQA 3TF6A 3ZW0B 4KH8A 3V8UA 2Y0HA 3NP1A 4GU8A 2L67A 4ORYA 1S2PA 1ZNEA 2A13A 5HBSA 2JMMA 1YP6A 3WI5A 5EE2A 3FMZA 2WQAE 4YKOA 1JBHA 1H6S1 4OS0A 4I6SA 1N0SA 5BYPA 3I17A 2EU7X 1JV4A 5HZQA 5HZ5A 3DTQA 1PMPA 4IMNA 2N2LA 2LFUA 1L6MA 3TZGA 3HWEA 1QY0A 3JTYA 3APWA 3KFGA 2M07A 3K19A 3RKGA 2XE2A 1GFPA 1IW2A 4FGIB 4HPCA 1IFCA 1NP4A 4L3RA 3OBLA 5FQ6E 3FR2A 4KT5A 2XE3A 1I4UA 2AT0X 3DSZA 3NBXX 4HPBA 3BU1A 5L8NA 1PEEA 3BDRA 2NP1A 5K06A 2ZFGA 1SY3A 3ZW1B 3QKGA 4GRJA 3T0SA 3BS2A 1ACDA 3P24A 1TOWA 2XKLA 1GX9A 2PY1A 2W2BA 4R0BA 3O0EA 1KXOA 4GCQA 4AZLA 5JDPA 4NLIA 1BH3A 3HWFA 4TKBA 1IFBA 2ERVA 3MBTA 1GKAB 1FENA 1VYFA 2OVSA 5CYBA 3AAEB 2QM9A 3NQ3A 4O3YA 4RUNA 4LZVA 4O4XA 2HZRA 1MUPA 3N91A 5JR8A 2MO5A 4Y0SA 4ZHGA 4ZH6A 4YFRA 4KR8A 3C78X 3PEDA 4TKJA 1O1VA 4TLJA 1YS5A 1EQDA 1ADLA 1LNMA 5LJHA 3VU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYD C;  4Z3T A;  3V8U A;  4AYE C;  3HOE A;  4O3X B;  4U9C A;  4O3Z A;  5EE2 A;  2W80 C;  2KC0 A;  2KDY A;  2W81 C;  3VE1 A;  3KVD D;  2YPV A;  5T5F A;  4O3Y A;  3HOL A;  3PQS A;  2LFU A;  4O4X A;  4AYN A;  3VE2 A;  3UAQ A;  4AYM C;  4O4U A;  4O49 A;  3PQU A;  4QQ1 A;  1YS5 A;  2Y7S A;  4AYI D;  4O3W A; 
#chains in the Genus database with same CATH topology
 4YH0 A;  4YGG A;  1G90 A;  4IB9 A;  3GP6 A;  3ZWE A;  1EI5 A;  2R4L A;  2OFA A;  2KXP B;  4COT A;  3CKF A;  2YG2 A;  3O22 A;  5T5F A;  1KL4 A;  1SMP I;  4RLB A;  2RTQ B;  1SY0 A;  4UB6 O;  4ORW A;  4ORR A;  4QQ1 A;  1ZNK A;  1SXU A;  3IA8 A;  5FAZ A;  1HBP A;  4NYR A;  4AZP A;  4GCP A;  4AUI A;  3D95 A;  2OVD A;  1QJ8 A;  1KQW A;  2ANS A;  4YCH A;  5GTI O;  2OF8 A;  5AQ6 A;  5CSE A;  1O1U A;  4FT6 A;  4BUM X;  1RLB E;  3FA8 A;  4GK9 A;  1PBO A;  2FRS A;  2XTR A;  1UYO X;  1MK5 A;  5H9N A;  2OMF A;  2K23 A;  4Z2O A;  1DC9 A;  3OJY C;  3LV4 A;  3VHH A;  1IZN A;  1H91 A;  1LF7 A;  1DZM A;  1MM9 A;  2VDF A;  3PQS A;  3AAE A;  4NYQ A;  4Y0R A;  3TGB A;  1ZNH A;  1LCW A;  4MEE A;  3E3C A;  4GDA A;  2JN3 A;  1DZK A;  2Y3F A;  1KGL A;  2R74 A;  3T2X A;  1KT4 A;  4O3Z A;  1YWA A;  4YCE A;  1WBI A;  3EC5 A;  1HXZ A;  4KC7 A;  1FDQ A;  3FR4 A;  4ZJ0 A;  4DQ4 A;  3AA7 B;  4GKC A;  1HMS A;  4GE1 A;  1ZHT A;  4YFQ A;  1LUQ A;  2HKD A;  1RXK A;  3BX8 A;  1I78 A;  1SWO A;  2IZG B;  2F1T A;  1A2D A;  1YUP A;  3AKM A;  1VWG B;  2KDY A;  4BBO A;  1JMX A;  4CDD A;  2FTB A;  3QQ2 A;  2BS6 A;  3TGA A;  5IXG A;  1G85 A;  2L9C A;  1T68 X;  3KVN A;  3SOT A;  3H3I A;  2UZ2 A;  3HW9 A;  3SYS A;  1CBI A;  3SZJ A;  2CZT A;  5GV0 A;  5HA1 A;  2QCB A;  4E1S A;  3CQN A;  4LSI A;  1JJX A;  3ZI8 A;  2R88 A;  2IWV A;  2FS6 A;  3WZO A;  4ZGU A;  1SWL A;  4OMW A;  1KT5 A;  1ML7 A;  4HWM A;  3PQU A;  3WJB A;  1VWE B;  3CQR A;  1ZND A;  3KFI A;  5AFU K;  3GE2 A;  3UEX A;  1NBX A;  1GT3 A;  1ZHZ A;  4TJZ A;  1QQS A;  2QO6 A;  5AJB A;  1DF3 A;  5L3Y A;  2BHV A;  1E06 A;  2E4J A;  1O8V A;  1JIW I;  3ELX A;  3UEV A;  3ZW1 A;  2X8T A;  2RTL A;  1CBQ A;  4BOE A;  2MM3 A;  1Q9G A;  2QO5 A;  4GJV A;  2FHL A;  1GKA A;  2I5Z O;  2ACO A;  4AZO A;  1GM6 A;  1SRG A;  4GGZ A;  4GJS A;  1GT5 A;  3EM0 A;  1SXY A;  3SY7 A;  3VG5 A;  2AXT O;  1EW3 A;  3WBG A;  1OBU A;  2WVP A;  1KT3 A;  5IYU A;  1BBP A;  4A60 A;  4ZR2 A;  1NQN A;  4GD9 A;  2BSZ A;  3JSQ A;  2OL7 A;  3SZV A;  5HWZ A;  2Z4I A;  3IFB A;  2OFR X;  5KHP A;  4FOZ A;  1SXW A;  4CV7 A;  3NJT A;  1KFF A;  2FR3 A;  5HCC C;  1KL3 A;  2FKJ A;  4FZL A;  3G7X A;  2X27 X;  1LDQ A;  3FA6 A;  3FW5 A;  3NR3 A;  4XMD A;  4CPE A;  3KZI O;  4FRX A;  4MVI A;  4D65 A;  3BU9 A;  4QZT A;  5FFH A;  4C00 A;  4CTD A;  4RJX A;  3GAQ A;  5ADX L;  2AT8 X;  1GFO A;  1OPA A;  4GZV A;  1HXT A;  4YMY A;  4GCS A;  4CSB A;  2FT9 A;  1WUB A;  3KZA A;  1OEE A;  4OMX A;  1Y9L A;  3CWK A;  1T0V A;  2X8F A;  3ZQ3 A;  4BJ8 A;  1SWK A;  4Y0P A;  8PRN A;  2IZH B;  4OS8 A;  4B61 A;  3AA6 A;  1I06 A;  2IZC B;  1HXX A;  4G75 A;  1ZRY A;  1KT7 A;  4PJ0 O;  1LIF A;  3SAO A;  2KW1 A;  2Y3E A;  2RTN B;  1STR B;  3G7G A;  1X8N A;  3POU A;  3WYQ A;  5GTH O;  3B2H A;  4Y59 A;  1MPF A;  2RTD B;  2VFB A;  3SYB A;  4GHB A;  5HTD A;  5HCE C;  1BXW A;  3NQ9 A;  1EXS A;  4I3D A;  1ORM A;  3T20 A;  1EPA A;  2G8C O;  3SLO A;  2XMX A;  1CRB A;  3C5O A;  1YIV A;  2XE5 A;  3BLG A;  3DWO X;  4EXZ A;  4KII A;  3ZW0 B;  4KH8 A;  2R4O A;  4BX6 B;  4GU8 A;  4ORY A;  5EE2 A;  3FMZ A;  4N74 A;  3DZM A;  3I17 A;  5HZQ A;  1MEP A;  3HWE A;  3APW A;  2Y32 A;  1PBY A;  3FR2 A;  1I4U A;  5KAF O;  3PK2 A;  1GX3 A;  1PEE A;  2NP1 A;  2ZFG A;  2RTM A;  1SY3 A;  3P24 A;  1ACD A;  2XKL A;  2PY1 A;  1SWR A;  5JDP A;  1BH3 A;  3HWF A;  4JHQ A;  2OVS A;  5IRU A;  4LZV A;  3N91 A;  4YFR A;  4KR8 A;  3C78 X;  3PED A;  4TLJ A;  1O1V A;  5LJH A;  3VU1 A;  1SWS A;  1SLE B;  1MX8 A;  1RSU B;  1ZNG A;  4WFU A;  4BQU A;  1AEL A;  2JGS A;  5KID A;  3KQ0 A;  3CBS A;  3A0H O;  2HLV A;  2F1C X;  3WU2 O;  2HYS A;  2X9K A;  2M4L A;  4DCB A;  4FQE A;  4I9S A;  2CBR A;  4BX7 A;  3S60 A;  5IRW A;  3AAA B;  4IB7 A;  2L5P A;  3ZW0 A;  5F7G A;  2FS7 A;  2OVE A;  2W2F A;  3PF1 A;  1W4T A;  1A18 A;  3UAQ A;  3S5V A;  1B56 A;  3SLT A;  3EW1 A;  3B2K A;  4O4O A;  2IZK A;  5KIC A;  3HOE A;  1LID A;  2XG6 A;  1GX8 A;  4MVE A;  4NW4 A;  1DZJ A;  1VWP B;  1SWD A;  4PJ2 A;  1KZX A;  3PEC A;  5LJB A;  4D64 A;  1B0O A;  3EBK A;  4O4U A;  1SXX A;  3FW4 A;  3WZP A;  2N93 A;  2IZA A;  5F58 A;  3WJD A;  1XCA A;  5IO5 A;  4AYD C;  5HCD C;  1SWG A;  5AFU L;  3B2I A;  4U9C A;  1TW4 A;  1DZP A;  2QTK A;  2GE4 A;  3OD9 A;  3HWD A;  1I9H A;  1PRN A;  2FKG A;  1T1L A;  4WFV A;  1LIB A;  1KZW A;  1UZ2 X;  2LA7 A;  3A0B O;  3AAA A;  3C77 X;  3PPT A;  4D6B A;  2MNH A;  2RCQ A;  1SWE A;  4XMC A;  3WJE A;  4LSH A;  5LKF A;  4NV8 A;  5EDB A;  2CZU A;  4GNW A;  4ALO A;  2X34 A;  4FZN A;  4A1Y A;  1EII A;  1EIO A;  2WEX A;  1S7D A;  3PP6 A;  1EAL A;  2PI3 O;  2X4M A;  1HQQ A;  1G7N A;  4KC8 A;  2WSJ A;  1VYO A;  3ZW2 A;  2QOS C;  2OFM X;  4HPA A;  3Q6L A;  2YNK A;  1UYN X;  1JJJ A;  4IB6 A;  3HWG A;  4E1T A;  4FMS A;  3MM0 A;  2W81 C;  4Y5D A;  1VWA B;  3VZT X;  4FUV A;  5FQ8 E;  3U9P C;  5B29 A;  1A3Y A;  4Z2V A;  1E00 A;  1SWQ A;  4N58 A;  2IZE B;  4TKH A;  2CBS A;  3EMN X;  1G74 A;  4N7D A;  2FGQ X;  4A8Z A;  5K68 A;  5D5D A;  1AVD A;  2YMS A;  1X8U A;  3CBC A;  1VWO B;  2ASN X;  5FEN A;  1FJ1 E;  4IAW A;  3HTY A;  3D96 A;  5LJE A;  2K0L A;  1BSO A;  5D47 A;  1BLR A;  2KXP A;  1P4T A;  1EPB A;  5EED A;  2GC9 A;  3C76 X;  3OE3 A;  3HWB A;  1QAB E;  5B5G A;  2PRN A;  4O3W A;  3VG3 A;  2I5V O;  3JCU O;  1PM1 X;  1IIU A;  3ZUI A;  4XMG A;  4HFO A;  4Z2P A;  3U03 A;  2Y0L A;  3ELZ A;  2Q4N A;  2GTL N;  1HXU A;  4M7M A;  3T1D A;  1SWU A;  3POR A;  5D48 A;  2Q9S A;  3JS1 A;  3SY9 A;  5CE4 A;  1JZU A;  3AA1 B;  2RQ0 A;  3F8A A;  1VWK B;  4N75 A;  3SLJ A;  2RTR B;  4QAE A;  4ZHF A;  4UU3 A;  1DFV A;  3PDF A;  4JGL A;  3T24 A;  1I05 A;  1VWN B;  3JQO A;  4ZH9 A;  3NQK A;  4FBR A;  5PRN A;  2G78 A;  1XKI A;  3WJG A;  3UEW A;  3S5X A;  2ZAG A;  4ZHD A;  4YBU A;  3WVM A;  4ZFX A;  4OKA A;  1VWC B;  3AA7 A;  2RTG B;  1KOI A;  1TOU A;  3WOV A;  4D6A A;  3RDQ A;  3RZY A;  4I3B A;  1N4J A;  1JYJ A;  1LIE A;  4OEM A;  5DL5 A;  1GT1 A;  3EW2 A;  5FVN A;  4Y0Q A;  1HBQ A;  3ZUO A;  1LDO A;  3BRN A;  2A3F X;  4ZCB A;  2LHF A;  4FBV A;  3HOL A;  2F1V A;  3WXQ A;  2Z4H A;  2GTL M;  4FRT A;  5BVQ A;  1NC9 A;  1QY1 A;  1BRP A;  3FEP A;  5LKE A;  1URE A;  4EKV A;  1GFN A;  2KZ7 B;  2F09 A;  2DM5 A;  1E2T A;  1SRF A;  4L1N A;  5D8J A;  4AYM C;  1SRE A;  4ORU A;  4XNL A;  1OBP A;  2RTC B;  1X89 A;  5L8I A;  3PRN A;  3BRZ A;  2HZQ A;  1N9Y A;  2L67 A;  2A13 A;  2JMM A;  3WI5 A;  5B2A O;  1VWR B;  2EU7 X;  4IMN A;  2LFU A;  1QY0 A;  2M07 A;  3K19 A;  3RKG A;  4FGI B;  5E79 O;  1T16 A;  4L3R A;  2XE3 A;  2AT0 X;  2IZJ A;  5L8N A;  4BGF A;  5K06 A;  1RXH A;  4TKB A;  3MBT A;  1VYF A;  3NQ3 A;  4RUN A;  4O4X A;  4JO6 A;  5JR8 A;  2MO5 A;  4Y0S A;  4ZHG A;  1SWT A;  1VWB B;  1VWJ B;  1IFC A;  2WQ9 A;  3T2W A;  2P8G A;  1MOY A;  2JU8 A;  1A57 A;  2MHD A;  1LCZ A;  3KFH A;  3FEN A;  4EDE A;  2C1S A;  1EUO A;  2AMM X;  3RSW A;  3WZQ A;  3BRY A;  1NP1 A;  2KZ7 A;  3QRC A;  4U8U M;  2RCT A;  3AEH A;  5DL6 A;  1Y52 X;  2OY7 A;  1AB0 A;  4CDF A;  2R8A A;  3FEK A;  1RST B;  1U17 A;  2A2U A;  1SRH A;  1CBR A;  4BX5 B;  2X45 A;  3LTW A;  3D9W A;  3Q34 A;  1NQM A;  3AKN A;  1SWF A;  3P02 A;  3P6F A;  4ALB A;  2OFB A;  1RBP A;  2AT6 X;  4Z27 A;  2OY8 A;  4RL9 A;  1B8E A;  4Z6J A;  2O62 A;  1ALB A;  3RDS A;  1GFQ A;  1Y55 X;  3RDO A;  4N59 A;  3P6C A;  1FEM A;  1SLF B;  3SZH A;  1JYD A;  4AKR B;  2JU3 A;  4YBP A;  1R0U A;  1OEJ A;  2AH7 X;  2OZQ A;  2BC3 A;  1YP7 A;  1FEL A;  3U0D A;  4I9R A;  3HK1 A;  3FLL A;  3A2S X;  1VWF B;  3LHN A;  4I60 A;  4OEL A;  4AYN A;  2WJQ A;  3APU A;  2Q39 A;  2RTI B;  2Y2X A;  1OEK A;  2DJF A;  3D4R A;  2J4U P;  1LFO A;  4CDE A;  5EEE A;  4ON1 A;  4GGR A;  4UB8 O;  5G26 A;  3FR5 A;  3MG5 A;  3L4R A;  2A5B A;  3NX1 A;  2RTK A;  2HMB A;  4CK4 A;  1SLD B;  4ORS A;  1STP A;  3PGS A;  3X00 A;  3FYF A;  4Z28 A;  3O2Y A;  3VY9 X;  2BLG A;  3NAD A;  1AQB A;  4WHI A;  3VHM A;  2C4I A;  5LJD A;  2OYB O;  5B5E O;  3STN A;  1VWL B;  4BX6 A;  5HA0 A;  2XTQ A;  3BX7 A;  2G79 A;  1KQX A;  2POA A;  3WI4 A;  3SZD A;  2R4N A;  1HMT A;  1ERX A;  3VG7 A;  5H9A A;  1SA8 A;  5DL8 A;  3EMM A;  3FA7 A;  2NNE A;  2RTF B;  4TNN A;  1JQP A;  4INN A;  4QNI A;  3VGW A;  2XST A;  3PH6 A;  4I3C A;  3PGU A;  2A0A A;  3TZS A;  3STM X;  2Q2P A;  4QYP A;  1E5P A;  1HXL A;  4LSF A;  4DNE A;  1GXA A;  1SY2 A;  1OSM A;  1SLG B;  5H2F O;  2FWV A;  2WR6 A;  1GGL A;  4O4S A;  5HZ8 A;  2FHN X;  1VWM B;  1VPR A;  4GET A;  2OY5 O;  5G39 A;  4LKP A;  1THQ A;  4AZR A;  5AEO A;  5ADX K;  3QRA A;  5LJK A;  2O4V A;  5EPQ A;  1U0X A;  5F6Z A;  2GJ5 A;  4MIS A;  5IRA A;  1Y53 X;  2MWH A;  2BT9 A;  2W2A A;  2OVA A;  2AT5 X;  1GT4 A;  4XME A;  2LFO A;  2BS5 A;  4EQA C;  5IO6 A;  3RY1 A;  2FR2 A;  4BCS A;  2FLJ A;  2OF9 A;  4BVM A;  2CM9 A;  1MX7 A;  3VPJ E;  2C1Q A;  1SRJ A;  4GNY A;  3B2J A;  5DG4 A;  2W80 C;  2FGS A;  1IZN B;  2JOZ A;  3HPE A;  1AVG I;  1BRQ A;  4QGX A;  4YDB A;  1HMR A;  1N7Y A;  1X8P A;  5DPQ A;  3VZW X;  4QYN A;  1VYG A;  3WJC A;  1ZHW A;  2Y7S A;  4PSQ A;  4FES A;  2QO4 A;  5L8O A;  1SWC A;  3WYP A;  2WEW A;  4RLC A;  4AZN A;  4ES7 A;  5BVS A;  1IKE A;  1LPJ A;  3APX A;  3WZN A;  3STK A;  4NNS A;  2GTF X;  1IJ8 A;  1ERB A;  3NX2 A;  2ZLD A;  2RTB B;  5AJC A;  1LEL A;  4MIR A;  1W6F A;  2DJG A;  4Z3T A;  4ID2 A;  2M06 A;  2OY1 O;  4AYE C;  1ICM A;  3RDX A;  1D3S A;  1SWJ A;  4LKT A;  2IZD B;  3NSG A;  4IB8 A;  4AZM A;  5BVT A;  4C69 X;  1AVE A;  3PGR A;  3F9D A;  2QMI A;  3T6L A;  2ODJ A;  1SWN A;  5B11 O;  1OPF A;  2IZB A;  2LBV A;  4YKM A;  2JQY A;  4PR7 A;  3LK4 2;  2RA6 A;  4RUU A;  3FDC A;  4YGZ A;  1BWY A;  2AL0 X;  3CMP A;  3KFF A;  1ZHY A;  4A1H A;  4AFK A;  1ZNE A;  1H6S 1;  4I6S A;  1N0S A;  5BYP A;  5TIS O;  1JV4 A;  2N2L A;  3DTQ A;  1PMP A;  3JTY A;  3KFG A;  3RY2 A;  1GFP A;  5FQ6 E;  4KT5 A;  1OSP O;  3ZW1 B;  4GRJ A;  3AUM O;  1TOW A;  1GX9 A;  4GCQ A;  4R0B A;  4NLI A;  2ERV A;  1GKA B;  1FEN A;  2QM9 A;  1N43 A;  1MUP A;  4K3B A;  4ZH6 A;  2VFC A;  4TKJ A;  3VHI A;  1W5R A;  1EQD A;  2G7B A;  1SWB A;  1PTS A;  2CAM A;  3VG6 A;  2K4T A;  3RBH A;  1LKE A;  1QG5 A;  5F1E A;  4XMH A;  1X8O A;  1S44 A;  3SZI A;  1K24 A;  2N2M A;  1MVG A;  3D97 A;  2KTD A;  4IL6 O;  1S5L O;  1BT9 A;  3O19 A;  3P6E A;  1SWH A;  5K67 A;  4NV7 A;  5G38 A;  3RWX A;  1U18 A;  4ZHH A;  1G5W A;  4YGH A;  5JD2 A;  4D5U A;  5B5F A;  5B27 A;  3FYX A;  4G76 A;  4CPI A;  4ZHC A;  2RD7 C;  3P6D A;  1YWD A;  4AYI D;  4AYH A;  5D4A A;  1ZNL A;  1D2U A;  1FTP A;  3AA1 A;  3RE5 A;  4U3Q A;  4ORX A;  3VE1 A;  5EZ2 A;  5G3A A;  2R56 A;  4U8U N;  1HQP A;  4IAB A;  1Q9F A;  1YWB A;  4YFP A;  1OBQ A;  4AW8 A;  2X55 A;  4CPF A;  4LSE A;  2WJR A;  2XE1 A;  4XNK A;  3NPO A;  2IFB A;  2WUT A;  3APV A;  3AA6 B;  4TQ2 A;  3UPG A;  2IZI A;  5HZ6 A;  4NP1 A;  3CR6 A;  2R73 A;  1BEB A;  3POX A;  3TGC A;  4O49 A;  2L68 A;  4LQZ A;  1TVQ A;  2K62 A;  5FQ7 E;  1E02 A;  3B2L A;  4JCH A;  4IBA A;  3PH5 A;  4DQ3 A;  3UEU A;  1HY2 A;  2G5L A;  2R4P A;  4EEJ A;  1LIC A;  5B3M O;  2A8G A;  2X46 A;  2HNX A;  2CM4 A;  4QGV A;  4UU2 A;  1E54 A;  3I0A A;  4FQB B;  3F6Z B;  3RDM A;  1BJ7 A;  3BSZ E;  1SRI A;  3POQ A;  1YWC A;  4EFG A;  2X56 A;  4RJW A;  1PHO A;  1GFM A;  1QFT A;  4GUZ A;  4MVL A;  4AZQ A;  5KAI O;  2AF5 A;  4C4V B;  3MX7 A;  1X71 A;  2ACP X;  4QGW A;  3KVD D;  3BY0 A;  4MVK A;  4FZM A;  4GF4 A;  2LKK A;  4K19 A;  1FE3 A;  1LCV A;  1BSQ A;  1TXL A;  4WBK A;  1QWD A;  2GTL O;  2FGR A;  3ZZV A;  5HZ9 A;  5H9L A;  1MDC A;  3LK2 B;  1DV9 A;  4JNJ A;  5C0N A;  4CDC A;  2X32 A;  3P6G A;  3VY8 X;  1CJ5 A;  3AA0 B;  1MM4 A;  4O3X B;  4IMO A;  4LZU A;  4KR4 A;  3CKG A;  4ARH A;  2JMB A;  2KTS A;  5EDC A;  1CBS A;  3FID A;  2RTA A;  4NLJ A;  1QFV A;  1VWI B;  2F01 A;  2R89 A;  2OL8 O;  1NGL A;  2JU7 A;  2IZL B;  4AKM A;  1HN2 A;  3MVF A;  4C5P A;  2A2G A;  4IAX A;  2NND A;  2RTE B;  1Y9T A;  4ZGF A;  4B55 A;  1ICN A;  3FA9 A;  4QRL A;  2AVI A;  4C4V A;  4N7C A;  1X8Q A;  1IKJ A;  1K3B A;  5D45 A;  3RE6 A;  5LJG A;  1OPB A;  2Q2M A;  3VG2 A;  2MF6 A;  4BX7 B;  2JW1 A;  4QZU A;  4NNT A;  3S26 A;  2F73 A;  4GDZ A;  1ZHX A;  5HAE A;  1DF8 A;  4ODD A;  3LK2 A;  1KT6 A;  4BX5 A;  2RTP B;  4JFB A;  1STS B;  4FSO A;  1QJP A;  5LJC A;  2ALL X;  1P6P A;  2WWP A;  1I04 A;  4FSP A;  2QOM A;  2ZAI A;  3AA0 A;  4FBO A;  2X8S A;  4U8U O;  2ZSC A;  3LK3 B;  1Z24 A;  2KC0 A;  2GH7 A;  1QY2 A;  5B66 O;  4O9S A;  3T6F A;  3P6H A;  5F6B A;  3VG4 A;  1MM5 A;  1SWA A;  3VE2 A;  1RAV A;  2A5C A;  4AKR A;  4ML7 B;  4PUX A;  4XMF A;  1JMZ A;  4I95 A;  3DA4 A;  2AKQ A;  4HPD A;  4KRA A;  4M6S A;  1T8V A;  4CPH B;  2NNQ A;  5IO7 A;  4F4B A;  4OS3 A;  5H9K A;  3RBY A;  2RTH B;  3DA3 A;  3LK4 1;  2UYW A;  4YDA A;  3VZU X;  4KCA A;  2J1N A;  2RTO B;  2KD2 A;  4GGT A;  2LB6 A;  2RN4 A;  1BM5 A;  5HTE A;  7PRN A;  1NDJ A;  4GH7 A;  3FEL A;  2POR A;  1B4M A;  4YVB A;  5DL7 A;  3UU2 A;  2Y0K A;  2YPV A;  6PRN A;  1RXJ A;  3DWN A;  2AT3 X;  3K3L A;  2LBA A;  3BS0 A;  1SY1 A;  2MHL A;  1BSY A;  1QJ9 A;  3WJF A;  3RDU A;  3LK3 A;  1N9M A;  3EBW A;  3FIQ A;  1Y0G A;  5B10 O;  4IRW A;  5CHK A;  5H8T A;  3EYC A;  2KT4 B;  2MJI A;  1VWQ B;  3TF6 A;  3V8U A;  2WPU A;  3NP1 A;  2Y0H A;  1S2P A;  5HBS A;  2IZF B;  1YP6 A;  2OL6 O;  4YKO A;  2WQA E;  4CPH A;  1JBH A;  4OS0 A;  5HZ5 A;  1L6M A;  3TZG A;  2XE2 A;  1IW2 A;  4HPC A;  1SWP A;  1NP4 A;  3OBL A;  4U46 A;  2RTJ A;  4HPB A;  3DSZ A;  3NBX X;  1VWH B;  3BU1 A;  3BDR A;  1VWD B;  3QKG A;  3T0S A;  3BS2 A;  2W2B A;  3O0E A;  1KXO A;  4AZL A;  1KL5 A;  2IWW A;  1IFB A;  5CYB A;  3AAE B;  5F2B A;  4O3Y A;  2HZR A;  1JJU A;  4K3C A;  1YS5 A;  1ADL A;  1LNM A; 
#chains in the Genus database with same CATH homology
 2WQ9 A;  4YH0 A;  2G7B A;  4YGG A;  2P8G A;  2JU8 A;  3VG6 A;  1A57 A;  1G90 A;  4IB9 A;  1MX8 A;  2K4T A;  3GP6 A;  3ZWE A;  3RBH A;  1EI5 A;  1ZNG A;  1LKE A;  4WFU A;  2MHD A;  4BQU A;  1AEL A;  2KXP B;  5KID A;  3KFH A;  3KQ0 A;  3CBS A;  3FEN A;  1QG5 A;  2HLV A;  5F1E A;  4EDE A;  2HYS A;  4COT A;  1EUO A;  2AMM X;  2YG2 A;  3O22 A;  4XMH A;  3RSW A;  5T5F A;  1SMP I;  2M4L A;  1NP1 A;  2KZ7 A;  4RLB A;  1X8O A;  1S44 A;  3QRC A;  1SY0 A;  4ORW A;  4U8U M;  4ORR A;  4I9S A;  4QQ1 A;  2RCT A;  2CBR A;  2N2M A;  1ZNK A;  1SXU A;  3IA8 A;  5FAZ A;  5DL6 A;  1HBP A;  3S60 A;  3AAA B;  4NYR A;  4IB7 A;  1MVG A;  4AZP A;  3D97 A;  2KTD A;  2L5P A;  3ZW0 A;  1BT9 A;  1AB0 A;  3O19 A;  3P6E A;  4GCP A;  3FEK A;  4AUI A;  3D95 A;  5F7G A;  1U17 A;  2A2U A;  2FS7 A;  2OVE A;  2OVD A;  1CBR A;  2W2F A;  3RWX A;  1U18 A;  4ZHH A;  1KQW A;  1G5W A;  1QJ8 A;  2ANS A;  2X45 A;  4YGH A;  4YCH A;  4D5U A;  1A18 A;  5AQ6 A;  5B27 A;  3FYX A;  4G76 A;  3UAQ A;  4ZHC A;  1O1U A;  4FT6 A;  3AKN A;  4BUM X;  3P02 A;  2RD7 C;  1RLB E;  3S5V A;  3P6D A;  1YWD A;  3FA8 A;  1B56 A;  1PBO A;  3P6F A;  4GK9 A;  4ALB A;  4AYH A;  1RBP A;  4AYI D;  2FRS A;  5D4A A;  2AT6 X;  3B2K A;  4O4O A;  5KIC A;  3HOE A;  1ZNL A;  1LID A;  1D2U A;  2XTR A;  1FTP A;  5H9N A;  2XG6 A;  3AA1 A;  2OMF A;  1GX8 A;  4RL9 A;  1B8E A;  4U3Q A;  2K23 A;  2O62 A;  1ALB A;  1DC9 A;  4MVE A;  4NW4 A;  3OJY C;  1GFQ A;  1DZJ A;  3LV4 A;  4ORX A;  3VE1 A;  4N59 A;  1IZN A;  1H91 A;  1LF7 A;  3P6C A;  4PJ2 A;  1DZM A;  5EZ2 A;  1KZX A;  3PQS A;  1FEM A;  3PEC A;  5LJB A;  3AAE A;  4D64 A;  2R56 A;  4NYQ A;  4Y0R A;  1B0O A;  3EBK A;  4O4U A;  1JYD A;  1ZNH A;  2JU3 A;  4U8U N;  1SXX A;  1HQP A;  3FW4 A;  3TGB A;  4YBP A;  4AKR B;  3E3C A;  2JN3 A;  4IAB A;  1R0U A;  2N93 A;  1Q9F A;  5F58 A;  1YWB A;  4YFP A;  3WJD A;  1OBQ A;  4AW8 A;  1DZK A;  1XCA A;  5IO5 A;  4AYD C;  5HCD C;  1OEJ A;  2AH7 X;  5AFU L;  2OZQ A;  1KGL A;  4LSE A;  3B2I A;  4U9C A;  2R74 A;  2XE1 A;  1KT4 A;  1YP7 A;  1FEL A;  4O3Z A;  3U0D A;  1YWA A;  4XNK A;  4I9R A;  4YCE A;  4KC7 A;  1TW4 A;  3HK1 A;  3NPO A;  1FDQ A;  3FLL A;  2IFB A;  3FR4 A;  4ZJ0 A;  4DQ4 A;  2WUT A;  1DZP A;  3A2S X;  3AA7 B;  3APV A;  3AA6 B;  3LHN A;  4GKC A;  1HMS A;  4TQ2 A;  4GE1 A;  3UPG A;  2QTK A;  5HZ6 A;  3OD9 A;  1ZHT A;  2GE4 A;  4NP1 A;  4YFQ A;  3CR6 A;  2R73 A;  1BEB A;  3HWD A;  3POX A;  4AYN A;  3TGC A;  1PRN A;  3APU A;  4O49 A;  2Q39 A;  4WFV A;  1LIB A;  2L68 A;  1KZW A;  1UZ2 X;  4LQZ A;  1TVQ A;  2K62 A;  5FQ7 E;  3BX8 A;  2LA7 A;  1E02 A;  3B2L A;  2Y2X A;  3AAA A;  1OEK A;  4JCH A;  4IBA A;  2F1T A;  1A2D A;  3C77 X;  3PH5 A;  3UEU A;  4DQ3 A;  3D4R A;  3PPT A;  4D6B A;  1LFO A;  2J4U P;  2MNH A;  4EEJ A;  1LIC A;  1YUP A;  3AKM A;  2KDY A;  2X46 A;  2HNX A;  2RCQ A;  5EEE A;  4XMC A;  4ON1 A;  3WJE A;  4LSH A;  5LKF A;  2CM4 A;  2FTB A;  4UU2 A;  5EDB A;  4QGV A;  2CZU A;  4GNW A;  4ALO A;  5G26 A;  1E54 A;  4FZN A;  3I0A A;  2BS6 A;  3TGA A;  3FR5 A;  4FQB B;  3F6Z B;  1BJ7 A;  3L4R A;  4A1Y A;  1EII A;  3BSZ E;  1EIO A;  2WEX A;  3NX1 A;  1S7D A;  1G85 A;  2L9C A;  3POQ A;  1T68 X;  2HMB A;  1YWC A;  4CK4 A;  3SOT A;  3H3I A;  3PP6 A;  4EFG A;  4RJW A;  1PHO A;  1EAL A;  4ORS A;  1GFM A;  1QFT A;  4MVL A;  4AZQ A;  3HW9 A;  3SYS A;  1CBI A;  2CZT A;  3FYF A;  5GV0 A;  5HA1 A;  4E1S A;  1G7N A;  1X71 A;  3MX7 A;  2ACP X;  3CQN A;  4KC8 A;  2WSJ A;  4QGW A;  3KVD D;  4LSI A;  3BY0 A;  1JJX A;  3O2Y A;  3ZW2 A;  3ZI8 A;  2QOS C;  3VY9 X;  4MVK A;  4FZM A;  2BLG A;  2FS6 A;  4ZGU A;  4GF4 A;  2LKK A;  3NAD A;  1FE3 A;  4K19 A;  2OFM X;  1AQB A;  4OMW A;  1KT5 A;  1ML7 A;  4HWM A;  3PQU A;  4WHI A;  4HPA A;  1BSQ A;  3WJB A;  3Q6L A;  1TXL A;  3CQR A;  5LJD A;  2YNK A;  4WBK A;  1QWD A;  2GTL O;  2FGR A;  1JJJ A;  4IB6 A;  3ZZV A;  3STN A;  3HWG A;  5HA0 A;  2XTQ A;  1ZND A;  2G79 A;  3BX7 A;  4E1T A;  5HZ9 A;  3KFI A;  5H9L A;  5AFU K;  3GE2 A;  4FMS A;  1MDC A;  2W81 C;  1KQX A;  2POA A;  3UEX A;  3SZD A;  3VZT X;  3WI4 A;  3LK2 B;  1DV9 A;  4FUV A;  1HMT A;  1ERX A;  1GT3 A;  5C0N A;  1ZHZ A;  3VG7 A;  4TJZ A;  5H9A A;  5FQ8 E;  3U9P C;  1SA8 A;  5B29 A;  1A3Y A;  5DL8 A;  1E00 A;  3P6G A;  1QQS A;  2QO6 A;  5AJB A;  1DF3 A;  3VY8 X;  3EMM A;  4N58 A;  3FA7 A;  2BHV A;  1CJ5 A;  2NNE A;  1E06 A;  2E4J A;  3AA0 B;  4TNN A;  1MM4 A;  4QNI A;  4INN A;  1O8V A;  4O3X B;  4IMO A;  4LZU A;  4TKH A;  2CBS A;  2XST A;  3PH6 A;  3EMN X;  4I3C A;  4KR4 A;  1JIW I;  3ELX A;  1G74 A;  3UEV A;  3ZW1 A;  2A0A A;  3TZS A;  2X8T A;  4N7D A;  3STM X;  2Q2P A;  4ARH A;  1CBQ A;  2FGQ X;  4QYP A;  4BOE A;  2JMB A;  2KTS A;  1E5P A;  4A8Z A;  2MM3 A;  5EDC A;  1CBS A;  1Q9G A;  5D5D A;  2YMS A;  4NLJ A;  1QFV A;  2QO5 A;  1X8U A;  1GKA A;  3CBC A;  4LSF A;  2ACO A;  1GXA A;  1SY2 A;  1NGL A;  2JU7 A;  4AZO A;  1GM6 A;  4AKM A;  1OSM A;  1GT5 A;  1HN2 A;  2FWV A;  3MVF A;  2A2G A;  4IAX A;  3EM0 A;  1SXY A;  3SY7 A;  3VG5 A;  2NND A;  2WR6 A;  2ASN X;  5FEN A;  1EW3 A;  4IAW A;  1Y9T A;  3HTY A;  3D96 A;  4ZGF A;  5LJE A;  1GGL A;  1ICN A;  2K0L A;  4O4S A;  3FA9 A;  5HZ8 A;  1BSO A;  4QRL A;  1OBU A;  3WBG A;  1KT3 A;  5D47 A;  5IYU A;  1BLR A;  1BBP A;  4A60 A;  1VPR A;  2KXP A;  1P4T A;  4N7C A;  4ZR2 A;  1EPB A;  1IKJ A;  1X8Q A;  4GET A;  5EED A;  5D45 A;  3VG2 A;  5LJG A;  1OPB A;  2Q2M A;  3JSQ A;  2GC9 A;  4LKP A;  3C76 X;  1THQ A;  3SZV A;  5HWZ A;  4AZR A;  2JW1 A;  4QZU A;  5AEO A;  5ADX K;  3OE3 A;  4NNT A;  3HWB A;  3QRA A;  3S26 A;  1QAB E;  5LJK A;  2PRN A;  2Z4I A;  4O3W A;  2F73 A;  3IFB A;  5EPQ A;  4GDZ A;  2O4V A;  1U0X A;  2OFR X;  5F6Z A;  3VG3 A;  1ZHX A;  2GJ5 A;  4MIS A;  5KHP A;  4FOZ A;  1SXW A;  5HAE A;  2MWH A;  2BT9 A;  4CV7 A;  2W2A A;  2OVA A;  1PM1 X;  1IIU A;  3ZUI A;  4XMG A;  4HFO A;  3U03 A;  2Y0L A;  2AT5 X;  3ELZ A;  1GT4 A;  2Q4N A;  4ODD A;  2GTL N;  4XME A;  3LK2 A;  1HXU A;  2FR3 A;  2LFO A;  1KT6 A;  4M7M A;  5HCC C;  3T1D A;  4FZL A;  3G7X A;  2X27 X;  4JFB A;  3FA6 A;  3FW5 A;  4FSO A;  1QJP A;  2BS5 A;  3POR A;  5LJC A;  2ALL X;  3NR3 A;  4XMD A;  1P6P A;  2WWP A;  2Q9S A;  5D48 A;  4EQA C;  3JS1 A;  5IO6 A;  3SY9 A;  2FR2 A;  1I04 A;  2FLJ A;  4FSP A;  5CE4 A;  4FRX A;  4MVI A;  2ZAI A;  4D65 A;  1JZU A;  3AA1 B;  4BVM A;  3AA0 A;  2CM9 A;  2RQ0 A;  3BU9 A;  1MX7 A;  3F8A A;  4FBO A;  4QZT A;  2X8S A;  5FFH A;  3VPJ E;  4GNY A;  4U8U O;  3B2J A;  3LK3 B;  5DG4 A;  2W80 C;  1Z24 A;  2KC0 A;  1IZN B;  2JOZ A;  4RJX A;  4QAE A;  1AVG I;  1BRQ A;  4ZHF A;  1QY2 A;  4UU3 A;  3GAQ A;  4O9S A;  4QGX A;  1DFV A;  3P6H A;  5F6B A;  3VG4 A;  4YDB A;  1MM5 A;  5ADX L;  1HMR A;  1X8P A;  5DPQ A;  2AT8 X;  1GFO A;  3VZW X;  3VE2 A;  4QYN A;  4JGL A;  1OPA A;  4GZV A;  3T24 A;  1I05 A;  1HXT A;  1VYG A;  3JQO A;  4ZH9 A;  3NQK A;  3WJC A;  4YMY A;  1ZHW A;  2Y7S A;  4ML7 B;  4GCS A;  4AKR A;  4FBR A;  4PUX A;  4PSQ A;  4FES A;  2QO4 A;  5L8O A;  4CSB A;  2FT9 A;  4XMF A;  2G78 A;  1XKI A;  4I95 A;  5PRN A;  3KZA A;  1OEE A;  4OMX A;  1Y9L A;  3DA4 A;  2AKQ A;  3CWK A;  4HPD A;  3WJG A;  4KRA A;  1T0V A;  4M6S A;  2X8F A;  1T8V A;  3UEW A;  2WEW A;  4RLC A;  4AZN A;  2NNQ A;  4ES7 A;  3ZQ3 A;  5IO7 A;  4F4B A;  5BVS A;  4Y0P A;  1IKE A;  8PRN A;  3S5X A;  2ZAG A;  4ZHD A;  1LPJ A;  3APX A;  4YBU A;  4OS8 A;  3WVM A;  4ZFX A;  4OS3 A;  5H9K A;  3STK A;  4B61 A;  3RBY A;  4NNS A;  3AA7 A;  3AA6 A;  1I06 A;  3DA3 A;  1KOI A;  3LK4 1;  2GTF X;  1TOU A;  3WOV A;  1ERB A;  3NX2 A;  2ZLD A;  4D6A A;  4YDA A;  1HXX A;  3RZY A;  3VZU X;  5AJC A;  4G75 A;  4I3B A;  1JYJ A;  1LIE A;  4KCA A;  5DL5 A;  2J1N A;  4MIR A;  2KD2 A;  1GT1 A;  1ZRY A;  1KT7 A;  5FVN A;  4Z3T A;  4ID2 A;  4Y0Q A;  2M06 A;  1LIF A;  4AYE C;  3SAO A;  1HBQ A;  3ZUO A;  2LB6 A;  2KW1 A;  2RN4 A;  1BM5 A;  1ICM A;  5HTE A;  7PRN A;  4GH7 A;  3FEL A;  2POR A;  1B4M A;  1D3S A;  4LKT A;  3G7G A;  5DL7 A;  3UU2 A;  3BRN A;  2A3F X;  1X8N A;  2Y0K A;  3NSG A;  4IB8 A;  2YPV A;  3POU A;  4ZCB A;  2LHF A;  4FBV A;  3HOL A;  4AZM A;  5BVT A;  6PRN A;  2F1V A;  4C69 X;  3WXQ A;  2Z4H A;  3B2H A;  2GTL M;  1MPF A;  4FRT A;  5BVQ A;  3SYB A;  4GHB A;  3F9D A;  2AT3 X;  3K3L A;  5HTD A;  2QMI A;  5HCE C;  1BXW A;  2LBA A;  3NQ9 A;  2ODJ A;  1SY1 A;  1EXS A;  4I3D A;  1ORM A;  2MHL A;  1QY1 A;  1OPF A;  1BSY A;  1QJ9 A;  3T20 A;  1EPA A;  3WJF A;  2LBV A;  1BRP A;  4YKM A;  3FEP A;  5LKE A;  3LK3 A;  1URE A;  3EBW A;  1GFN A;  3FIQ A;  3LK4 2;  2RA6 A;  4RUU A;  4YGZ A;  2KZ7 B;  1CRB A;  2XMX A;  3C5O A;  2F09 A;  1YIV A;  2DM5 A;  1BWY A;  4L1N A;  3BLG A;  5D8J A;  2XE5 A;  5H8T A;  2AL0 X;  3EYC A;  4AYM C;  4ORU A;  3CMP A;  4EXZ A;  4XNL A;  2KT4 B;  4KII A;  3KFF A;  1ZHY A;  1OBP A;  2MJI A;  1X89 A;  5L8I A;  4A1H A;  3PRN A;  4AFK A;  2HZQ A;  3TF6 A;  3ZW0 B;  4KH8 A;  3V8U A;  2Y0H A;  3NP1 A;  4GU8 A;  2L67 A;  4ORY A;  1S2P A;  1ZNE A;  2A13 A;  5HBS A;  2JMM A;  1YP6 A;  3WI5 A;  5EE2 A;  3FMZ A;  2WQA E;  4YKO A;  1JBH A;  1H6S 1;  4OS0 A;  4I6S A;  1N0S A;  5BYP A;  3I17 A;  2EU7 X;  1JV4 A;  5HZQ A;  5HZ5 A;  3DTQ A;  1PMP A;  4IMN A;  2N2L A;  2LFU A;  1L6M A;  3TZG A;  3HWE A;  1QY0 A;  3JTY A;  3APW A;  3KFG A;  2M07 A;  3K19 A;  3RKG A;  2XE2 A;  1GFP A;  1IW2 A;  4FGI B;  4HPC A;  1IFC A;  1NP4 A;  4L3R A;  3OBL A;  5FQ6 E;  3FR2 A;  4KT5 A;  2XE3 A;  1I4U A;  2AT0 X;  3DSZ A;  3NBX X;  4HPB A;  3BU1 A;  5L8N A;  1PEE A;  3BDR A;  2NP1 A;  5K06 A;  2ZFG A;  1SY3 A;  3ZW1 B;  3QKG A;  4GRJ A;  3T0S A;  3BS2 A;  1ACD A;  3P24 A;  1TOW A;  2XKL A;  1GX9 A;  2PY1 A;  2W2B A;  4R0B A;  3O0E A;  1KXO A;  4GCQ A;  4AZL A;  5JDP A;  4NLI A;  1BH3 A;  3HWF A;  4TKB A;  1IFB A;  2ERV A;  3MBT A;  1GKA B;  1FEN A;  1VYF A;  2OVS A;  5CYB A;  3AAE B;  2QM9 A;  3NQ3 A;  4O3Y A;  4RUN A;  4LZV A;  4O4X A;  2HZR A;  1MUP A;  3N91 A;  5JR8 A;  2MO5 A;  4Y0S A;  4ZHG A;  4ZH6 A;  4YFR A;  4KR8 A;  3C78 X;  3PED A;  4TKJ A;  1O1V A;  4TLJ A;  1YS5 A;  1EQD A;  1ADL A;  1LNM A;  5LJH A;  3VU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...