4O3XB

Crystal structure of the vaccine antigen transferrin binding protein b (tbpb) mutant phe-171-ala from actinobacillus pleuropneumoniae h49
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
241
structure length
241
Chain Sequence
PALGYVVKVPVSSFENKKVDISDIEVITNGNLDDVPYKANSSKYNYPDIKTKDSSLQYVRSGYVIDGEHSGSNEKGYVYYKGNSPAKELPVNQLLTYTGSWDFTSNANLNNEEGRPNYLNDDYYTKAIGKRVGLVSGDAKPAKHKYTSQFEVDFATKKMTGKLSDKEKTIYTVNADIRGNRFTGAATASDKNKGKGESYNFFSADSQSLEGGFYGPKAEEMAGKFVANDKSLFAVFSAKHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonbinding site-directed mutants of transferrin binding protein B exhibit enhanced immunogenicity and protective capabilities.
pubmed doi rcsb
source organism Actinobacillus pleuropneumoniae
molecule tags Metal transport
molecule keywords Transferrin binding protein B
total genus 64
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 4o3xB01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4o3xB02
3HOLA 4O3XB 4O4XA 3VE2A 4QQ1A 4AYID 2W81C 2LFUA 1YS5A 5T5FA 2Y7SA 3V8UA 2YPVA 4AYEC 3PQUA 4AYMC 4Z3TA 3UAQA 4O3ZA 4AYNA 4U9CA 4O4UA 4O3WA 3KVDD 4O49A 3HOEA 2KC0A 3PQSA 2W80C 2KDYA 4O3YA 5EE2A 3VE1A 4AYDC
chains in the Genus database with same CATH superfamily
1B56A 4YDAA 1WUBA 4AUIA 1KT7A 4OMXA 1GT3A 4AFKA 1KT6A 2W2BA 4NYRA 2PY1A 1TOWA 2X34A 1SWJA 1U0XA 4IAXA 4JHQA 3WXQA 2VDFA 4G76A 4ML7B 1AVDA 3BS0A 1DZMA 4IMNA 3HTYA 2A3FX 2QO5A 3KVNA 5EPQA 2R88A 4AW8A 3OD9A 1SWSA 1BM5A 4XMDA 3VG3A 4IAWA 2FT9A 2RTCB 3KFIA 4XMEA 1MVGA 2XE1A 5B2AO 4FSOA 2BT9A 1MUPA 3TGAA 1SWPA 4QYPA 2N2LA 2XTQA 1BLRA 1VWKB 2G8CO 3EMNX 1E00A 3F8AA 1GM6A 3FEKA 2F01A 5KAIO 1OBPA 3L4RA 2RTFB 4NV7A 2X9KA 3ZWEA 2IZHB 3SYSA 5T5FA 3POXA 3CKGA 2ANSA 4OKAA 2X8TA 4U8UO 2PRNA 2L68A 2GTFX 1KL4A 1LICA 2DJFA 5CHKA 1QJPA 3QRAA 5JD2A 3WJFA 3NPOA 3UEWA 1ICNA 3ZI8A 2BS6A 4Z3TA 1VWPB 3D97A 1KOIA 1IJ8A 1NQNA 3RDUA 1I78A 2A13A 3JCUO 3AAAA 5E79O 1EIIA 3LK3B 3VHHA 4GNYA 4ZHGA 1UREA 3FA9A 2OVSA 1X8OA 3PK2A 1LIFA 4Y0QA 1K24A 5HZQA 1FEMA 2G78A 5AEOA 2QO6A 5LJBA 4RLCA 4CDEA 4FQEA 5F58A 2XE3A 3EMMA 3APWA 1NP1A 4R0BA 1RSTB 1ZNKA 2LKKA 5B3MO 4IB9A 1O1VA 3SZIA 2Q2PA 2BSZA 3NSGA 3NBXX 2OF9A 5FQ6E 1X8QA 3VHIA 2HNXA 4XMHA 5ADXL 4I3CA 1CBRA 4O3YA 5EE2A 1AB0A 1LPJA 4AZNA 3JSQA 3FW4A 1YS5A 4QYNA 1GKAA 2F09A 1JJUA 3UAQA 1ORMA 2QM9A 2RCTA 4K3CA 4Z6JA 1X8UA 3BS2A 3BY0A 4O4OA 5HCEC 2KT4B 3STNA 1GFPA 2JU7A 1AVEA 2IWVA 4FSPA 5KHPA 4BX7A 4WHIA 4LZVA 1VWBB 3G7GA 2OL8O 2A5BA 1EQDA 1S2PA 1MX8A 3RDSA 3VPJE 1EXSA 1O1UA 3O2YA 3MX7A 4KR8A 1SWLA 4OEMA 4EEJA 3T20A 3NX2A 2YPVA 1LKEA 3N91A 1SXXA 4ODDA 2JN3A 1HQPA 3BSZE 2ODJA 1VWDB 4JGLA 1PBOA 4NP1A 1G74A 2FHLA 1LDOA 2KDYA 3MM0A 1Q9GA 4XNKA 2FTBA 1UZ2X 1Q9FA 3JQOA 1STSB 1RLBE 3PQUA 3ZQ3A 4HPAA 3T0SA 2A2UA 1KGLA 1I06A 4LKTA 3ZUOA 3BX7A 4AZMA 1TOUA 1X89A 4O4XA 2W2AA 5L8OA 2LHFA 2YG2A 5CE4A 3EW2A 1MEPA 2OFBA 3VZTX 5FFHA 2GJ5A 2YMSA 3O19A 2I5ZO 1SY1A 3WZNA 5H9LA 3WYPA 3DZMA 2AKQA 1Y9TA 1QABE 1LDQA 3P24A 3P6EA 2FR3A 3O0EA 4GD9A 3SOTA 4BJ8A 2N93A 5FAZA 3B2HA 1MM5A 3PGRA 1VYGA 2M06A 3WYQA 3WJDA 4A1HA 4NV8A 5B10O 4CPFA 1JQPA 2I5VO 2OFMX 3DSZA 2MO5A 5FVNA 3VG7A 4JFBA 1HMSA 1EW3A 3FLLA 5EDCA 3SZDA 1GFNA 1PHOA 2FKJA 4YCEA 1ZHXA 4N59A 2VFBA 1GFQA 1CJ5A 4IB6A 2P8GA 3WU2O 3DA3A 3UEUA 2N2MA 3ZW1A 4CPHB 4O49A 3POUA 1B8EA 1BXWA 4D6AA 1G90A 2BC3A 1I9HA 2IZJA 2IZEB 1MK5A 5D4AA 2X27X 3MBTA 5BVTA 4JO6A 4ZFXA 4ZH6A 1SWBA 4MVEA 4Z2OA 4DNEA 2OY8A 4JNJA 2R73A 2HLVA 3MG5A 4U8UN 1Y55X 1HXTA 3UU2A 4U46A 1VWLB 1VWRB 3VZUX 4I6SA 5GTHO 5IRWA 4GZVA 2QTKA 1UYNX 3T6LA 1VPRA 5DL6A 1Y53X 3HOLA 1GT1A 1BEBA 2WQAE 5PRNA 4ID2A 1VWIB 4I3BA 4ARHA 2OVAA 5DL8A 4CSBA 4GDZA 4CTDA 2CAMA 3FYXA 4I9RA 1IW2A 3T6FA 3T24A 2KXPB 5G39A 1HQQA 2NNQA 4IL6O 2QMIA 3APVA 1GGLA 2C1QA 5K67A 1Y9LA 3KFFA 4ORUA 1LIEA 1IKEA 3WZQA 1SRFA 4AZOA 4FZNA 3WJEA 3WZOA 4N7DA 3P6FA 1X8NA 2HZRA 2M07A 5IRUA 2JGSA 3FEPA 4GJSA 4TKHA 4CDFA 1N4JA 2MM3A 2XE2A 2L5PA 3BRNA 1N0SA 4CPEA 3EC5A 1NGLA 3ELXA 4GF4A 3B2LA 1SWUA 2WR6A 2WEXA 2IFBA 4U8UM 3AA6B 3E3CA 1XCAA 2Q39A 4INNA 3FDCA 2OL7A 3WI5A 3PF1A 1SLFB 2WSJA 4BOEA 3OJYC 1YUPA 3FENA 1SWQA 1L6MA 4LKPA 4I3DA 1NQMA 2XTRA 2ERVA 3RE5A 2G79A 5AJBA 4N58A 1VWMB 5AJCA 1RXJA 4FBOA 4WBKA 5HA1A 2PORA 1E2TA 3FA8A 5H9NA 2F1CX 1QQSA 1BJ7A 4YKOA 1JV4A 3GE2A 2IZKA 1PBYA 3DA4A 4GRJA 1W6FA 4E1TA 2Y32A 2RTMA 2JQYA 1VWCB 3BRYA 1KZXA 3PGUA 5B27A 1BSOA 5KIDA 1YP7A 8PRNA 4QGVA 3WVMA 1HBPA 2IWWA 3WOVA 3AAEB 3AKMA 4GKCA 5BVQA 2FWVA 3KFGA 4BX6A 5ADXK 3VG6A 1NDJA 4ES7A 1D2UA 3I17A 2WJRA 3LTWA 1BSQA 3RWXA 2KTDA 3FR2A 5IYUA 1AQBA 4GHBA 1QJ9A 4QGWA 2A5CA 2KZ7B 3PEDA 2IZCB 2OYBO 3P02A 2LB6A 3GAQA 2DM5A 4AZRA 1QJ8A 4ZHHA 4OS8A 4AYNA 1BSYA 2IZAA 4CDCA 3RDOA 2L9CA 2RQ0A 3RSWA 4XMCA 4F4BA 2MF6A 1A2DA 5K68A 4DQ4A 1VWFB 2XG6A 4JCHA 1VWAB 3ELZA 2IZIA 5D5DA 4FRXA 1AVGI 1DZPA 5FENA 2ACOA 1GXAA 1STRB 3AA7B 1SWEA 4IB8A 4OS3A 3STMX 2YNKA 1A3YA 3SLJA 3HWGA 4A8ZA 2IZDB 1DZJA 2FHNX 5HZ8A 1FE3A 1HMRA 5TISO 3CWKA 2AMMX 1BWYA 4HFOA 4GNWA 2LFUA 3PH5A 2RTHB 3RE6A 4GH7A 2X45A 4BGFA 1OPAA 2LBAA 1OSPO 2R74A 1H91A 4O4SA 4BX7B 6PRNA 2AT8X 5CYBA 3HWDA 1GX8A 1MOYA 3NQ9A 4YBPA 2Y2XA 3AA0A 1VWNB 2KW1A 4O3ZA 4FUVA 5H9AA 4KC7A 1JMXA 4C69X 5DG4A 4OS0A 4NW4A 3ZW1B 1LIBA 1ZNHA 1VWOB 3S60A 1OBQA 3DWOX 1SMPI 4LSHA 1G7NA 4Z2VA 3WI4A 2FS6A 3NADA 3QQ2A 1GFOA 5HZ5A 5D47A 4UB6O 3IFBA 3HOEA 2FGRA 4QZUA 5BVSA 3S5VA 3SLTA 4HPCA 2RTPB 2PI3O 5F6ZA 3O22A 1SLDB 4HPDA 3NR3A 3PP6A 2OFAA 2WVPA 3JS1A 1VWQB 3FR5A 1SA8A 4GCPA 1BRPA 1W4TA 3RKGA 4Y0SA 2K0LA 4YKMA 4TKJA 1HXZA 1ML7A 4Y0RA 4GE1A 4NYQA 2LA7A 4COTA 4QRLA 5CSEA 4GETA 3HWBA 3IA8A 1P4TA 3SYBA 4NLIA 1E54A 2CZTA 4U3QA 3VHMA 2KD2A 2AH7X 1X8PA 3ZW2A 4NNSA 4ZHFA 1BRQA 1A18A 1NP4A 3HW9A 4FRTA 1T0VA 2IZLB 3Q34A 4QNIA 3AAEA 2AT0X 3SAOA 3CKFA 1ERXA 5L8NA 2RTRB 3I0AA 4MVIA 1SXUA 2JOZA 5G38A 3LK2A 3RY2A 5LJEA 4FT6A 1HN2A 1Y52X 4UU3A 3CR6A 1SRJA 2RTAA 4RL9A 2RTLA 1LUQA 1JMZA 5HZ6A 4K3BA 3EM0A 1IZNA 3C78X 3CQRA 2OMFA 4GGRA 4FZLA 3V8UA 4RJXA 1UYOX 3TZSA 1SXWA 2OY7A 1S5LO 1OEKA 1RXKA 1VWHB 1BBPA 2FS7A 2VFCA 3ZW0B 3AA7A 2R4OA 2RCQA 2CM4A 1N9YA 1ZNLA 1T1LA 1ICMA 4YBUA 1I4UA 1ACDA 3EYCA 1OPBA 4KRAA 4ZHDA 1DV9A 2ALLX 3F6ZB 3B2JA 3QRCA 4YFRA 3WZPA 3LK3A 1DF8A 2OY5O 4LZUA 1QG5A 2W81C 2JU8A 3SZJA 2R89A 3VZWX 2RN4A 2FGSA 1GT5A 3KZAA 2DJGA 1IIUA 3D9WA 3VG5A 3A0HO 4GGTA 4BX6B 1E5PA 1GX3A 1THQA 1SWNA 3NQ3A 1TW4A 2X8FA 3S5XA 2MWHA 4TJZA 1DFVA 2RTIB 4N74A 4EXZA 1YWDA 3AKNA 2QOSC 3FIDA 4MISA 1SWOA 3FIQA 1HMTA 2WUTA 5L3YA 3FMZA 5B5FA 4KCAA 4A1YA 3P6DA 4L1NA 4YCHA 5DPQA 2RTOB 4FZMA 2ACPX 2Y3FA 1SWDA 3BRZA 1STPA 1JYJA 3VE1A 1DZKA 3RDXA 3PDFA 3TGBA 5B11O 1BT9A 5IO7A 2K62A 4ORYA 1SLGB 3SZVA 2ZAIA 3DWNA 1DF3A 3KQ0A 1CRBA 4YFPA 2HYSA 2Y3EA 4CDDA 2EU7X 2RTKA 1QWDA 1G5WA 1SY0A 2RTQB 1VYFA 2UZ2A 4M7MA 2MHLA 5JDPA 3FA6A 1KFFA 3HWEA 3DTQA 1AELA 4BX5B 1SWTA 1YP6A 2A0AA 3P6HA 1LCZA 3FW5A 4EKVA 3AA0B 1E06A 2JMMA 2L67A 3AAAB 2X8SA 1FTPA 4QQ1A 1TVQA 4AYMC 5G3AA 4BBOA 4G75A 1BH3A 2JU3A 2POAA 3C76X 1YWAA 1CBSA 3G7XA 4ZCBA 4TNNA 3PPTA 5HBSA 1VWJB 4OMWA 2AT6X 5F2BA 3VY9X 1T16A 1SLEB 5HWZA 1NC9A 2IZBA 4LQZA 3AA1A 3H3IA 4N7CA 1QFTA 1WBIA 4MVLA 4Z27A 2GTLO 2A8GA 4D64A 4L3RA 2CM9A 3PH6A 3RZYA 2Q2MA 2J4UP 4ORSA 1OEJA 4KIIA 1ZNDA 4ALBA 3U9PC 4E1SA 1JIWI 4D5UA 5IO5A 2XKLA 2R4NA 2RTNB 2OVDA 3K3LA 5EEEA 1KL5A 5KAFO 2R56A 5LJDA 2OY1O 1HXLA 4LSFA 2QCBA 1G85A 4BVMA 5AFUK 1KQWA 5HA0A 2E4JA 4KC8A 3B2IA 1T68X 4XMGA 2WPUA 5GTIO 1X71A 5FQ7E 3WJGA 1QY1A 4IBAA 5KICA 4NNTA 5AFUL 3OBLA 1XKIA 4TKBA 1SWRA 4IMOA 2AF5A 2Y0HA 5FQ8E 3RDMA 3VU1A 3Q6LA 4C4VB 4PJ2A 1QFVA 1MM4A 4YFQA 1OPFA 2QO4A 3HK1A 5IRAA 5LKFA 3PORA 1CBIA 5LJGA 2XE5A 3C5OA 2XSTA 5L8IA 2Q9SA 3ZW0A 4PR7A 2G7BA 4D6BA 4FBVA 1MPFA 1SREA 2GTLN 2R4PA 2JW1A 5B5GA 4O4UA 4YMYA 4ZGUA 1I04A 4BX5A 3NX1A 1JYDA 4YH0A 1H6S1 3B2KA 5H9KA 5EEDA 4AKRB 1N43A 3OE3A 1FENA 4ZJ0A 1ZHWA 1SWFA 2GTLM 2UYWA 3KVDD 2G5LA 2NP1A 2O4VA 4BQUA 3U03A 2LFOA 4GK9A 4AZQA 1R0UA 2WEWA 1CBQA 3CBCA 3BX8A 1KT4A 4B55A 2RTJA 4YGHA 4C4VA 4O3WA 2HZQA 2JMBA 4K19A 5F7GA 3JTYA 4ALOA 1GX9A 3RBYA 5HCDC 3A0BO 4C5PA 4AYDC 3T2WA 1LCWA 3UEXA 1E02A 2F1VA 1PMPA 1DC9A 3D95A 1NBXA 1LNMA 3BLGA 4UU2A 2QOMA 5IXGA 3C77X 4ON1A 2BLGA 3A2SX 2ZLDA 4I95A 3PRNA 3LK2B 1YWCA 3F9DA 5IO6A 1IFCA 3K19A 1LELA 4LSIA 4C00A 2W80C 1MDCA 1N7YA 4MVKA 4ZH9A 1LF7A 3LHNA 3QKGA 2KXPA 3U0DA 4ZR2A 4TLJA 4FGIB 4RUNA 2X32A 3EBKA 4YDBA 3LK41 2ZSCA 1OSMA 2Q4NA 4EQAC 3CMPA 2FR2A 1U18A 4GU8A 4EDEA 5LJKA 2OVEA 5D8JA 1VWEB 1S7DA 1SXYA 1ZNGA 1PRNA 4FMSA 2J1NA 4PUXA 2MHDA 1EI5A 3VG2A 4CV7A 1IFBA 1D3SA 4ZGFA 4WFVA 1FJ1E 4CPIA 3PECA 1EPBA 4Y5DA 4A60A 3AA6A 5H8TA 4ORXA 3EBWA 2K23A 4AZLA 3TGCA 1KT5A 4AYEC 1OBUA 1LIDA 2AT5X 1QY0A 1VYOA 4GGZA 4CPHA 1YIVA 2ZAGA 3AA1B 5LJHA 4ORRA 5K06A 4FOZA 2AVIA 3LK42 1ZHTA 4N75A 2XMXA 2Y0KA 4HWMA 1SWCA 4GDAA 3NJTA 1ALBA 3T2XA 3VGWA 5HCCC 1RAVA 4D65A 3PQSA 5HTEA 2X55A 5EZ2A 1SRIA 5DL5A 1QY2A 2CBSA 4GUZA 1P6PA 3KZIO 4PJ0O 1RXHA 3UEVA 2F1TA 1JZUA 2IZGB 1HXXA 2X56A 2WWPA 1VWGB 1O8VA 1Z24A 1PM1X 1SWGA 1PTSA 4KT5A 4KH8A 2RTDB 1SRGA 3EW1A 3CBSA 1TXLA 1SWKA 5HTDA 4RJWA 5C0NA 4I60A 2R4LA 3SZHA 3WJBA 4YGZA 4XMFA 4GJVA 3D4RA 5D45A 1ZHYA 3TF6A 4FBRA 4AYHA 2NNDA 1HBQA 2M4LA 1SY2A 4LSEA 2KZ7A 2FRSA 1I05A 1EUOA 1ADLA 1GKAB 2AL0X 2Z4IA 4QAEA 1GT4A 4RLBA 4RUUA 2C4IA 3KFHA 3CQNA 4GCQA 4ZHCA 3D96A 1W5RA 3VG4A 3BU9A 5B5EO 4AYID 2ZFGA 2BHVA 1HXUA 3FR4A 4HPBA 5HAEA 2FLJA 1OEEA 2NNEA 3STKA 3PGSA 1FELA 2GH7A 5F6BA 3APUA 2BS5A 3TZGA 4MEEA 2R8AA 4OELA 2RD7C 7PRNA 2C1SA 4BUMX 1B4MA 1SWAA 1T8VA 1Y0GA 1IKJA 3X00A 4IABA 4B61A 2RTBB 3APXA 2A2GA 3LV4A 4AKRA 2ASNX 1S44A 4IB7A 4I9SA 3HWFA 5F1EA 4FQBB 2GC9A 1HY2A 2HKDA 2HMBA 2W2FA 4Y59A 4IRWA 2LBVA 1EALA 1N9MA 1RSUB 4NLJA 2WJQA 1FDQA 2RTEB 2Y7SA 1KXOA 5LJCA 1MX7A 1SY3A 1YWBA 5G26A 4BCSA 1ZHZA 3WJCA 3SY7A 3P6GA 5H2FO 2IZFB 2MJIA 1PEEA 1EPAA 4FESA 2WQ9A 1U17A 3NP1A 2OZQA 4DQ3A 1GFMA 1SWHA 2AXTO 3BDRA 2F73A 4YGGA 1JJXA 4U9CA 1JJJA 3RBHA 4ORWA 2Z4HA 1EIOA 5AQ6A 4DCBA 1ZNEA 3GP6A 1ERBA 5D48A 3S26A 2FKGA 1KQXA 2RTGB 2OF8A 1KZWA 1MM9A 2AT3X 5B66O 3VE2A 2OFRX 3FA7A 2X4MA 1JBHA 4CK4A 1LFOA 5GV0A 2O62A 2CZUA 5LKEA 3NQKA 2KC0A 4KR4A 4O9SA 3UPGA 4WFUA 4PSQA 1B0OA 3WBGA 4TQ2A 4YVBA 3T1DA 5DL7A 4Z2PA 4AKMA 3P6CA 4M6SA 4Y0PA 4GCSA 3SLOA 4QGXA 1IZNB 3BU1A 3SY9A 5HZ9A 4QZTA 5EDBA 1SRHA 1ZRYA 1KT3A 5B29A 3AEHA 3ZUIA 3HPEA 4Z28A 3ZZVA 4XNLA 2K4TA 2KTSA 2Y0LA 2RA6A 2GE4A 2FGQX 3VY8X 2X46A 2OL6O 3MVFA 3FELA 1K3BA 3AUMO 1LCVA 1A57A 2CBRA 3POQA 2MNHA 4O3XB 5BYPA 5JR8A 3FYFA 1RBPA 4AZPA 3RDQA 4MIRA 1KL3A 3RY1A 4UB8O 4EFGA
chains in the Genus database with same CATH topology
1Y9LA 1B56A 4YDAA 4AUIA 4LZUA 3KFFA 1KT7A 4OMXA 1QG5A 4ORUA 2W81C 2JU8A 1GT3A 1LIEA 4MVKA 1IKEA 4AZOA 3VZWX 4AFKA 2RN4A 1KT6A 4ZH9A 2W2BA 4NYRA 4FZNA 2PY1A 1LF7A 1TOWA 3LHNA 3WJEA 3SYBA 3QKGA 2KXPA 1U0XA 1GT5A 4IAXA 3KZAA 4N7DA 4ZR2A 3P6FA 3WXQA 4TLJA 3U0DA 4FGIB 1IIUA 4RUNA 1X8NA 3EBKA 4YDBA 4G76A 3LK41 3VG5A 1OSMA 2HZRA 4ML7B 2Q4NA 1DZMA 4EQAC 3CMPA 2FR2A 4IMNA 1E5PA 3HTYA 2M07A 1U18A 4GU8A 4EDEA 5LJKA 1THQA 2OVEA 2A3FX 2QO5A 5D8JA 1S7DA 3NQ3A 1TW4A 2X8FA 5EPQA 3FEPA 3S5XA 4AW8A 1SXYA 4TKHA 1ZNGA 3OD9A 2MWHA 1PRNA 4FMSA 2J1NA 4TJZA 1DFVA 4PUXA 2MHDA 1BM5A 4XMDA 3VG3A 4EXZA 1EI5A 1YWDA 3VG2A 2MM3A 4CV7A 2XE2A 3AKNA 2QOSC 2L5PA 4IAWA 3BRNA 2FT9A 1IFBA 1D3SA 4MISA 4ZGFA 1N0SA 3KFIA 1NGLA 3ELXA 4WFVA 4XMEA 4GF4A 3FIQA 3B2LA 3PECA 1HMTA 1EPBA 2WUTA 4A60A 1MVGA 3AA6A 2WR6A 2XE1A 2WEXA 2IFBA 4U8UM 3AA6B 3FMZA 5H8TA 4FSOA 2BT9A 3E3CA 1MUPA 4ORXA 3EBWA 3TGAA 1XCAA 4QYPA 2K23A 2Q39A 4INNA 2N2LA 2XTQA 4AZLA 1BLRA 4KCAA 3TGCA 3EMNX 1E00A 1KT5A 3F8AA 4A1YA 1GM6A 3P6DA 4AYEC 4L1NA 3FEKA 3WI5A 4YCHA 1OBUA 5DPQA 1LIDA 2AT5X 1QY0A 2WSJA 4BOEA 3OJYC 4FZMA 1YUPA 1OBPA 3FENA 2ACPX 1YIVA 2ZAGA 3L4RA 1L6MA 3AA1B 5LJHA 4ORRA 5K06A 1JYJA 4LKPA 4I3DA 4FOZA 2XTRA 2ERVA 3VE1A 1DZKA 1PHOA 3LK42 3TGBA 1ZHTA 2G79A 5AJBA 3ZWEA 1BT9A 4N58A 5IO7A 2K62A 5AJCA 4ORYA 3SYSA 5T5FA 3POXA 2XMXA 2Y0KA 4FBOA 4HWMA 4WBKA 5HA1A 2PORA 3SZVA 2ANSA 2ZAIA 3FA8A 2X8TA 4U8UO 1DF3A 1ALBA 3KQ0A 5H9NA 5HCCC 1CRBA 1QQSA 2PRNA 2L68A 1BJ7A 2GTFX 4D65A 4YFPA 2HYSA 3PQSA 1LICA 4YKOA 5HTEA 1JV4A 3GE2A 1QJPA 3QRAA 2EU7X 3WJFA 5EZ2A 1QWDA 3NPOA 3UEWA 1ICNA 3DA4A 1G5WA 5DL5A 1QY2A 2CBSA 3ZI8A 1SY0A 1P6PA 4GRJA 4E1TA 1VYFA 2BS6A 4M7MA 4Z3TA 2MHLA 5JDPA 3FA6A 3UEVA 3D97A 1KOIA 2F1TA 3HWEA 3DTQA 1AELA 1JZUA 2A0AA 1YP6A 3P6HA 3FW5A 1KZXA 1HXXA 3AA0B 5B27A 2WWPA 1BSOA 5KIDA 1E06A 2A13A 2JMMA 1YP7A 2L67A 3AAAB 2X8SA 1O8VA 8PRNA 1FTPA 4QGVA 3AAAA 1Z24A 3WVMA 1PM1X 1EIIA 1HBPA 3LK3B 4GNYA 4QQ1A 3WOVA 4ZHGA 1UREA 4KT5A 1TVQA 3FA9A 4KH8A 2OVSA 1X8OA 3AAEB 3AKMA 1LIFA 3CBSA 4GKCA 1TXLA 4Y0QA 2FWVA 3KFGA 5BVQA 5HTDA 4RJWA 4AYMC 5C0NA 5ADXK 3VG6A 5HZQA 4G75A 1FEMA 2G78A 1BH3A 3WJBA 4YGZA 1D2UA 4ES7A 2JU3A 2POAA 5AEOA 2QO6A 3I17A 5LJBA 4RLCA 4XMFA 1BSQA 3C76X 1YWAA 3RWXA 3D4RA 2KTDA 5D45A 1CBSA 3G7XA 4ZCBA 4TNNA 1ZHYA 3PPTA 3TF6A 5HBSA 4OMWA 3FR2A 2AT6X 5F58A 4FBRA 2XE3A 5IYUA 3EMMA 3APWA 1NP1A 3VY9X 1AQBA 4R0BA 4AYHA 4GHBA 2NNDA 1HBQA 4QGWA 2LKKA 1ZNKA 1QJ9A 3PEDA 2M4LA 2KZ7B 1SY2A 4LSEA 5HWZA 4IB9A 2KZ7A 1O1VA 3P02A 2LB6A 3GAQA 2FRSA 4LQZA 2DM5A 4AZRA 1QJ8A 2Q2PA 3AA1A 3H3IA 4N7CA 1I05A 1QFTA 3NBXX 1EUOA 4MVLA 4ZHHA 3NSGA 4OS8A 4AYNA 1BSYA 2GTLO 1ADLA 5FQ6E 1X8QA 1GKAB 2AL0X 2L9CA 2Z4IA 1GT4A 4QAEA 2RQ0A 4D64A 2HNXA 4XMHA 3RSWA 4RLBA 4XMCA 4I3CA 4F4BA 5ADXL 1CBRA 4RUUA 1A2DA 3KFHA 3CQNA 4L3RA 4DQ4A 4ZHCA 4GCQA 3D96A 4O3YA 2XG6A 4JCHA 5EE2A 2CM9A 3ELZA 1AB0A 3PH6A 3VG4A 3RZYA 1LPJA 2Q2MA 3BU9A 4AZNA 2J4UP 3JSQA 4AYID 3FW4A 5D5DA 4ORSA 1OEJA 1YS5A 4QYNA 1GKAA 4KIIA 2BHVA 2ZFGA 1HXUA 4FRXA 1AVGI 2F09A 3FR4A 1DZPA 1ZNDA 2FLJA 4HPBA 3U9PC 4ALBA 5FENA 5HAEA 2ACOA 1GXAA 1OEEA 2NNEA 3UAQA 3STKA 1ORMA 4E1SA 1JIWI 4D5UA 2QM9A 3AA7B 4IB8A 5IO5A 4OS3A 2XKLA 3STMX 2YNKA 1FELA 2RCTA 2OVDA 1A3YA 3K3LA 5F6BA 3HWGA 5EEEA 4A8ZA 1DZJA 1X8UA 2BS5A 3APUA 3BS2A 5HZ8A 3TZGA 3BY0A 1FE3A 4O4OA 1HMRA 5HCEC 2KT4B 2R56A 3CWKA 3STNA 2AMMX 1GFPA 2JU7A 5LJDA 1BWYA 2RD7C 4HFOA 4GNWA 7PRNA 4BUMX 1B4MA 2LFUA 4FSPA 5KHPA 3PH5A 1T8VA 4LSFA 1G85A 1IKJA 4BVMA 4GH7A 1KQWA 2X45A 5DL7A 5AFUK 4WHIA 4IABA 4B61A 5HA0A 4LZVA 3APXA 2A2GA 2E4JA 3G7GA 3LV4A 4AKRA 2ASNX 1S44A 1EQDA 1OPAA 1S2PA 1MX8A 3B2IA 2LBAA 4KC8A 3VPJE 1T68X 2R74A 1EXSA 4XMGA 1O1UA 1H91A 4O4SA 4IB7A 3O2YA 4I9SA 3HWFA 5F1EA 3MX7A 2AT8X 5CYBA 6PRNA 4KR8A 3HWDA 1GX8A 4FQBB 2GC9A 3NQ9A 4EEJA 4YBPA 2Y2XA 3AA0A 3NX2A 3T20A 2KW1A 2YPVA 1LKEA 3N91A 1X71A 2HMBA 1SXXA 5FQ7E 3WJGA 2W2FA 1QY1A 4O3ZA 4FUVA 4ODDA 2JN3A 5H9AA 4IBAA 4KC7A 1HQPA 5KICA 4NNTA 4C69X 5DG4A 3BSZE 4OS0A 2LBVA 1EALA 2ODJA 5AFUL 4JGLA 1PBOA 4NP1A 1G74A 4NW4A 3OBLA 2KDYA 1XKIA 3ZW1B 1Q9GA 4TKBA 1LIBA 4IMOA 4NLJA 4XNKA 1ZNHA 2FTBA 1FDQA 3S60A 1UZ2X 1OBQA 1Q9FA 1SMPI 3JQOA 4LSHA 2Y0HA 5FQ8E 1G7NA 2Y7SA 3VU1A 1RLBE 3PQUA 3ZQ3A 1KXOA 5LJCA 3WI4A 3Q6LA 2FS6A 3NADA 4PJ2A 1GFOA 1QFVA 1MX7A 5HZ5A 4HPAA 5D47A 1MM4A 3T0SA 1SY3A 1YWBA 2A2UA 4YFQA 5G26A 1ZHZA 1OPFA 2QO4A 1KGLA 3HK1A 3WJCA 3SY7A 3P6GA 1I06A 4LKTA 3IFBA 3HOEA 3BX7A 3ZUOA 5LKFA 2MJIA 4AZMA 1PEEA 2FGRA 3PORA 4QZUA 1CBIA 1EPAA 5BVSA 5LJGA 3S5VA 2XE5A 1TOUA 3C5OA 4FESA 2XSTA 1X89A 5L8IA 4O4XA 2Q9SA 2WQ9A 4HPCA 3ZW0A 1U17A 2G7BA 3NP1A 2W2AA 2OZQA 4D6BA 4DQ3A 1GFMA 5L8OA 4FBVA 2LHFA 1MPFA 2YG2A 5F6ZA 5CE4A 2GTLN 3VZTX 5FFHA 2GJ5A 2YMSA 3O19A 3BDRA 2JW1A 2F73A 3O22A 4U9CA 4YGGA 1JJXA 4HPDA 4O4UA 3NR3A 4YMYA 3PP6A 1JJJA 4ORWA 2Z4HA 3JS1A 3RBHA 1SY1A 3FR5A 5H9LA 1SA8A 5AQ6A 1EIOA 4GCPA 1BRPA 3RKGA 1ZNEA 1ERBA 2AKQA 5D48A 1Y9TA 1I04A 1QABE 4Y0SA 3S26A 4ZGUA 3GP6A 1KQXA 2K0LA 3P24A 3P6EA 4YKMA 2FR3A 1KZWA 3NX1A 3O0EA 1JYDA 3SOTA 2AT3X 4TKJA 4YH0A 1H6S1 1ML7A 4Y0RA 2N93A 5FAZA 4GE1A 3VE2A 4NYQA 3B2HA 2LA7A 2OFRX 1MM5A 3B2KA 1VYGA 3FA7A 5H9KA 4COTA 5EEDA 2M06A 3WJDA 4AKRB 4QRLA 4A1HA 4GETA 1JBHA 3OE3A 4CK4A 1FENA 4ZJ0A 3HWBA 1ZHWA 2OFMX 1LFOA 2GTLM 5GV0A 2O62A 2MO5A 3DSZA 5FVNA 3VG7A 4JFBA 1HMSA 2CZUA 3KVDD 3IA8A 2NP1A 1EW3A 3FLLA 1P4TA 4NLIA 4BQUA 5LKEA 3NQKA 2KC0A 1E54A 2O4VA 4KR4A 4O9SA 3U03A 2CZTA 4U3QA 3UPGA 4WFUA 2LFOA 4GK9A 5EDCA 4AZQA 3SZDA 4PSQA 1B0OA 3WBGA 4TQ2A 1GFNA 1R0UA 2KD2A 2WEWA 1X8PA 1CBQA 4NNSA 2AH7X 3T1DA 3ZW2A 1BRQA 3CBCA 4ZHFA 1A18A 1NP4A 4YCEA 4AKMA 3BX8A 3P6CA 3HW9A 1KT4A 1T0VA 4FRTA 1ZHXA 4QNIA 3AAEA 2AT0X 4M6SA 4YGHA 3SAOA 1GFQA 4Y0PA 4GCSA 1ERXA 4N59A 4QGXA 4IB6A 5L8NA 2P8GA 3I0AA 4MVIA 1CJ5A 3UEUA 1SXUA 1IZNB 3DA3A 2JOZA 3BU1A 4O3WA 2N2MA 3SY9A 2HZQA 2JMBA 4K19A 3ZW1A 4QZTA 5HZ9A 5F7GA 5EDBA 5LJEA 3JTYA 4ALOA 4FT6A 1HN2A 1ZRYA 1GX9A 1KT3A 4O49A 3RBYA 1B8EA 3POUA 4UU3A 5HCDC 4D6AA 1BXWA 5B29A 3ZUIA 1G90A 3CR6A 3ZZVA 5D4AA 4XNLA 2X27X 2K4TA 3MBTA 4AYDC 2KTSA 4RL9A 5BVTA 2Y0LA 4ZFXA 2RA6A 4ZH6A 4MVEA 3UEXA 2GE4A 1E02A 5HZ6A 2F1VA 1PMPA 2FGQX 2R73A 2HLVA 3EM0A 1IZNA 3C78X 3VY8X 3CQRA 1DC9A 4U8UN 1HXTA 2OMFA 3UU2A 3D95A 2X46A 3V8UA 1LNMA 3BLGA 4UU2A 4FZLA 4RJXA 3TZSA 1SXWA 3MVFA 3LK2A 3VZUX 3C77X 3FELA 4ON1A 2BLGA 1OEKA 4I6SA 2ZLDA 3A2SX 1BBPA 2FS7A 3ZW0B 4GZVA 3AA7A 4I95A 3PRNA 2QTKA 2RCQA 1A57A 1VPRA 5DL6A 2CM4A 3LK2B 2CBRA 3POQA 2MNHA 3HOLA 1GT1A 1BEBA 2WQAE 4O3XB 1ZNLA 5PRNA 4ID2A 1YWCA 3F9DA 5BYPA 5JR8A 3FYFA 1RBPA 4I3BA 1ICMA 4YBUA 4ARHA 2OVAA 5IO6A 1IFCA 4AZPA 5DL8A 4CSBA 4GDZA 3K19A 1I4UA 1ACDA 4MIRA 3EYCA 3FYXA 1OPBA 4I9RA 1IW2A 3T24A 2KXPB 4KRAA 4ZHDA 1DV9A 4LSIA 2ALLX 2NNQA 4EFGA 3F6ZB 3B2JA 3QRCA 2QMIA 2W80C 4YFRA 1MDCA 3APVA 3LK3A 1GGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOL A;  4O3X B;  4O4X A;  3VE2 A;  4QQ1 A;  4AYI D;  2W81 C;  2LFU A;  1YS5 A;  5T5F A;  2Y7S A;  3V8U A;  2YPV A;  4AYE C;  3PQU A;  4AYM C;  4Z3T A;  3UAQ A;  4O3Z A;  4AYN A;  4U9C A;  4O4U A;  4O3W A;  3KVD D;  4O49 A;  3HOE A;  2KC0 A;  3PQS A;  2W80 C;  2KDY A;  4O3Y A;  5EE2 A;  3VE1 A;  4AYD C; 
#chains in the Genus database with same CATH topology
 1B56 A;  4YDA A;  1WUB A;  4AUI A;  1KT7 A;  4OMX A;  1GT3 A;  4AFK A;  1KT6 A;  2W2B A;  4NYR A;  2PY1 A;  1TOW A;  2X34 A;  1SWJ A;  1U0X A;  4IAX A;  4JHQ A;  3WXQ A;  2VDF A;  4G76 A;  4ML7 B;  1AVD A;  3BS0 A;  1DZM A;  4IMN A;  3HTY A;  2A3F X;  2QO5 A;  3KVN A;  5EPQ A;  2R88 A;  4AW8 A;  3OD9 A;  1SWS A;  1BM5 A;  4XMD A;  3VG3 A;  4IAW A;  2FT9 A;  2RTC B;  3KFI A;  4XME A;  1MVG A;  2XE1 A;  5B2A O;  4FSO A;  2BT9 A;  1MUP A;  3TGA A;  1SWP A;  4QYP A;  2N2L A;  2XTQ A;  1BLR A;  1VWK B;  2G8C O;  3EMN X;  1E00 A;  3F8A A;  1GM6 A;  3FEK A;  2F01 A;  5KAI O;  1OBP A;  3L4R A;  2RTF B;  4NV7 A;  2X9K A;  3ZWE A;  2IZH B;  3SYS A;  5T5F A;  3POX A;  3CKG A;  2ANS A;  4OKA A;  2X8T A;  4U8U O;  2PRN A;  2L68 A;  2GTF X;  1KL4 A;  1LIC A;  2DJF A;  5CHK A;  1QJP A;  3QRA A;  5JD2 A;  3WJF A;  3NPO A;  3UEW A;  1ICN A;  3ZI8 A;  2BS6 A;  4Z3T A;  1VWP B;  3D97 A;  1KOI A;  1IJ8 A;  1NQN A;  3RDU A;  1I78 A;  2A13 A;  3JCU O;  3AAA A;  5E79 O;  1EII A;  3LK3 B;  3VHH A;  4GNY A;  4ZHG A;  1URE A;  3FA9 A;  2OVS A;  1X8O A;  3PK2 A;  1LIF A;  4Y0Q A;  1K24 A;  5HZQ A;  1FEM A;  2G78 A;  5AEO A;  2QO6 A;  5LJB A;  4RLC A;  4CDE A;  4FQE A;  5F58 A;  2XE3 A;  3EMM A;  3APW A;  1NP1 A;  4R0B A;  1RST B;  1ZNK A;  2LKK A;  5B3M O;  4IB9 A;  1O1V A;  3SZI A;  2Q2P A;  2BSZ A;  3NSG A;  3NBX X;  2OF9 A;  5FQ6 E;  1X8Q A;  3VHI A;  2HNX A;  4XMH A;  5ADX L;  4I3C A;  1CBR A;  4O3Y A;  5EE2 A;  1AB0 A;  1LPJ A;  4AZN A;  3JSQ A;  3FW4 A;  1YS5 A;  4QYN A;  1GKA A;  2F09 A;  1JJU A;  3UAQ A;  1ORM A;  2QM9 A;  2RCT A;  4K3C A;  4Z6J A;  1X8U A;  3BS2 A;  3BY0 A;  4O4O A;  5HCE C;  2KT4 B;  3STN A;  1GFP A;  2JU7 A;  1AVE A;  2IWV A;  4FSP A;  5KHP A;  4BX7 A;  4WHI A;  4LZV A;  1VWB B;  3G7G A;  2OL8 O;  2A5B A;  1EQD A;  1S2P A;  1MX8 A;  3RDS A;  3VPJ E;  1EXS A;  1O1U A;  3O2Y A;  3MX7 A;  4KR8 A;  1SWL A;  4OEM A;  4EEJ A;  3T20 A;  3NX2 A;  2YPV A;  1LKE A;  3N91 A;  1SXX A;  4ODD A;  2JN3 A;  1HQP A;  3BSZ E;  2ODJ A;  1VWD B;  4JGL A;  1PBO A;  4NP1 A;  1G74 A;  2FHL A;  1LDO A;  2KDY A;  3MM0 A;  1Q9G A;  4XNK A;  2FTB A;  1UZ2 X;  1Q9F A;  3JQO A;  1STS B;  1RLB E;  3PQU A;  3ZQ3 A;  4HPA A;  3T0S A;  2A2U A;  1KGL A;  1I06 A;  4LKT A;  3ZUO A;  3BX7 A;  4AZM A;  1TOU A;  1X89 A;  4O4X A;  2W2A A;  5L8O A;  2LHF A;  2YG2 A;  5CE4 A;  3EW2 A;  1MEP A;  2OFB A;  3VZT X;  5FFH A;  2GJ5 A;  2YMS A;  3O19 A;  2I5Z O;  1SY1 A;  3WZN A;  5H9L A;  3WYP A;  3DZM A;  2AKQ A;  1Y9T A;  1QAB E;  1LDQ A;  3P24 A;  3P6E A;  2FR3 A;  3O0E A;  4GD9 A;  3SOT A;  4BJ8 A;  2N93 A;  5FAZ A;  3B2H A;  1MM5 A;  3PGR A;  1VYG A;  2M06 A;  3WYQ A;  3WJD A;  4A1H A;  4NV8 A;  5B10 O;  4CPF A;  1JQP A;  2I5V O;  2OFM X;  3DSZ A;  2MO5 A;  5FVN A;  3VG7 A;  4JFB A;  1HMS A;  1EW3 A;  3FLL A;  5EDC A;  3SZD A;  1GFN A;  1PHO A;  2FKJ A;  4YCE A;  1ZHX A;  4N59 A;  2VFB A;  1GFQ A;  1CJ5 A;  4IB6 A;  2P8G A;  3WU2 O;  3DA3 A;  3UEU A;  2N2M A;  3ZW1 A;  4CPH B;  4O49 A;  3POU A;  1B8E A;  1BXW A;  4D6A A;  1G90 A;  2BC3 A;  1I9H A;  2IZJ A;  2IZE B;  1MK5 A;  5D4A A;  2X27 X;  3MBT A;  5BVT A;  4JO6 A;  4ZFX A;  4ZH6 A;  1SWB A;  4MVE A;  4Z2O A;  4DNE A;  2OY8 A;  4JNJ A;  2R73 A;  2HLV A;  3MG5 A;  4U8U N;  1Y55 X;  1HXT A;  3UU2 A;  4U46 A;  1VWL B;  1VWR B;  3VZU X;  4I6S A;  5GTH O;  5IRW A;  4GZV A;  2QTK A;  1UYN X;  3T6L A;  1VPR A;  5DL6 A;  1Y53 X;  3HOL A;  1GT1 A;  1BEB A;  2WQA E;  5PRN A;  4ID2 A;  1VWI B;  4I3B A;  4ARH A;  2OVA A;  5DL8 A;  4CSB A;  4GDZ A;  4CTD A;  2CAM A;  3FYX A;  4I9R A;  1IW2 A;  3T6F A;  3T24 A;  2KXP B;  5G39 A;  1HQQ A;  2NNQ A;  4IL6 O;  2QMI A;  3APV A;  1GGL A;  2C1Q A;  5K67 A;  1Y9L A;  3KFF A;  4ORU A;  1LIE A;  1IKE A;  3WZQ A;  1SRF A;  4AZO A;  4FZN A;  3WJE A;  3WZO A;  4N7D A;  3P6F A;  1X8N A;  2HZR A;  2M07 A;  5IRU A;  2JGS A;  3FEP A;  4GJS A;  4TKH A;  4CDF A;  1N4J A;  2MM3 A;  2XE2 A;  2L5P A;  3BRN A;  1N0S A;  4CPE A;  3EC5 A;  1NGL A;  3ELX A;  4GF4 A;  3B2L A;  1SWU A;  2WR6 A;  2WEX A;  2IFB A;  4U8U M;  3AA6 B;  3E3C A;  1XCA A;  2Q39 A;  4INN A;  3FDC A;  2OL7 A;  3WI5 A;  3PF1 A;  1SLF B;  2WSJ A;  4BOE A;  3OJY C;  1YUP A;  3FEN A;  1SWQ A;  1L6M A;  4LKP A;  4I3D A;  1NQM A;  2XTR A;  2ERV A;  3RE5 A;  2G79 A;  5AJB A;  4N58 A;  1VWM B;  5AJC A;  1RXJ A;  4FBO A;  4WBK A;  5HA1 A;  2POR A;  1E2T A;  3FA8 A;  5H9N A;  2F1C X;  1QQS A;  1BJ7 A;  4YKO A;  1JV4 A;  3GE2 A;  2IZK A;  1PBY A;  3DA4 A;  4GRJ A;  1W6F A;  4E1T A;  2Y32 A;  2RTM A;  2JQY A;  1VWC B;  3BRY A;  1KZX A;  3PGU A;  5B27 A;  1BSO A;  5KID A;  1YP7 A;  8PRN A;  4QGV A;  3WVM A;  1HBP A;  2IWW A;  3WOV A;  3AAE B;  3AKM A;  4GKC A;  5BVQ A;  2FWV A;  3KFG A;  4BX6 A;  5ADX K;  3VG6 A;  1NDJ A;  4ES7 A;  1D2U A;  3I17 A;  2WJR A;  3LTW A;  1BSQ A;  3RWX A;  2KTD A;  3FR2 A;  5IYU A;  1AQB A;  4GHB A;  1QJ9 A;  4QGW A;  2A5C A;  2KZ7 B;  3PED A;  2IZC B;  2OYB O;  3P02 A;  2LB6 A;  3GAQ A;  2DM5 A;  4AZR A;  1QJ8 A;  4ZHH A;  4OS8 A;  4AYN A;  1BSY A;  2IZA A;  4CDC A;  3RDO A;  2L9C A;  2RQ0 A;  3RSW A;  4XMC A;  4F4B A;  2MF6 A;  1A2D A;  5K68 A;  4DQ4 A;  1VWF B;  2XG6 A;  4JCH A;  1VWA B;  3ELZ A;  2IZI A;  5D5D A;  4FRX A;  1AVG I;  1DZP A;  5FEN A;  2ACO A;  1GXA A;  1STR B;  3AA7 B;  1SWE A;  4IB8 A;  4OS3 A;  3STM X;  2YNK A;  1A3Y A;  3SLJ A;  3HWG A;  4A8Z A;  2IZD B;  1DZJ A;  2FHN X;  5HZ8 A;  1FE3 A;  1HMR A;  5TIS O;  3CWK A;  2AMM X;  1BWY A;  4HFO A;  4GNW A;  2LFU A;  3PH5 A;  2RTH B;  3RE6 A;  4GH7 A;  2X45 A;  4BGF A;  1OPA A;  2LBA A;  1OSP O;  2R74 A;  1H91 A;  4O4S A;  4BX7 B;  6PRN A;  2AT8 X;  5CYB A;  3HWD A;  1GX8 A;  1MOY A;  3NQ9 A;  4YBP A;  2Y2X A;  3AA0 A;  1VWN B;  2KW1 A;  4O3Z A;  4FUV A;  5H9A A;  4KC7 A;  1JMX A;  4C69 X;  5DG4 A;  4OS0 A;  4NW4 A;  3ZW1 B;  1LIB A;  1ZNH A;  1VWO B;  3S60 A;  1OBQ A;  3DWO X;  1SMP I;  4LSH A;  1G7N A;  4Z2V A;  3WI4 A;  2FS6 A;  3NAD A;  3QQ2 A;  1GFO A;  5HZ5 A;  5D47 A;  4UB6 O;  3IFB A;  3HOE A;  2FGR A;  4QZU A;  5BVS A;  3S5V A;  3SLT A;  4HPC A;  2RTP B;  2PI3 O;  5F6Z A;  3O22 A;  1SLD B;  4HPD A;  3NR3 A;  3PP6 A;  2OFA A;  2WVP A;  3JS1 A;  1VWQ B;  3FR5 A;  1SA8 A;  4GCP A;  1BRP A;  1W4T A;  3RKG A;  4Y0S A;  2K0L A;  4YKM A;  4TKJ A;  1HXZ A;  1ML7 A;  4Y0R A;  4GE1 A;  4NYQ A;  2LA7 A;  4COT A;  4QRL A;  5CSE A;  4GET A;  3HWB A;  3IA8 A;  1P4T A;  3SYB A;  4NLI A;  1E54 A;  2CZT A;  4U3Q A;  3VHM A;  2KD2 A;  2AH7 X;  1X8P A;  3ZW2 A;  4NNS A;  4ZHF A;  1BRQ A;  1A18 A;  1NP4 A;  3HW9 A;  4FRT A;  1T0V A;  2IZL B;  3Q34 A;  4QNI A;  3AAE A;  2AT0 X;  3SAO A;  3CKF A;  1ERX A;  5L8N A;  2RTR B;  3I0A A;  4MVI A;  1SXU A;  2JOZ A;  5G38 A;  3LK2 A;  3RY2 A;  5LJE A;  4FT6 A;  1HN2 A;  1Y52 X;  4UU3 A;  3CR6 A;  1SRJ A;  2RTA A;  4RL9 A;  2RTL A;  1LUQ A;  1JMZ A;  5HZ6 A;  4K3B A;  3EM0 A;  1IZN A;  3C78 X;  3CQR A;  2OMF A;  4GGR A;  4FZL A;  3V8U A;  4RJX A;  1UYO X;  3TZS A;  1SXW A;  2OY7 A;  1S5L O;  1OEK A;  1RXK A;  1VWH B;  1BBP A;  2FS7 A;  2VFC A;  3ZW0 B;  3AA7 A;  2R4O A;  2RCQ A;  2CM4 A;  1N9Y A;  1ZNL A;  1T1L A;  1ICM A;  4YBU A;  1I4U A;  1ACD A;  3EYC A;  1OPB A;  4KRA A;  4ZHD A;  1DV9 A;  2ALL X;  3F6Z B;  3B2J A;  3QRC A;  4YFR A;  3WZP A;  3LK3 A;  1DF8 A;  2OY5 O;  4LZU A;  1QG5 A;  2W81 C;  2JU8 A;  3SZJ A;  2R89 A;  3VZW X;  2RN4 A;  2FGS A;  1GT5 A;  3KZA A;  2DJG A;  1IIU A;  3D9W A;  3VG5 A;  3A0H O;  4GGT A;  4BX6 B;  1E5P A;  1GX3 A;  1THQ A;  1SWN A;  3NQ3 A;  1TW4 A;  2X8F A;  3S5X A;  2MWH A;  4TJZ A;  1DFV A;  2RTI B;  4N74 A;  4EXZ A;  1YWD A;  3AKN A;  2QOS C;  3FID A;  4MIS A;  1SWO A;  3FIQ A;  1HMT A;  2WUT A;  5L3Y A;  3FMZ A;  5B5F A;  4KCA A;  4A1Y A;  3P6D A;  4L1N A;  4YCH A;  5DPQ A;  2RTO B;  4FZM A;  2ACP X;  2Y3F A;  1SWD A;  3BRZ A;  1STP A;  1JYJ A;  3VE1 A;  1DZK A;  3RDX A;  3PDF A;  3TGB A;  5B11 O;  1BT9 A;  5IO7 A;  2K62 A;  4ORY A;  1SLG B;  3SZV A;  2ZAI A;  3DWN A;  1DF3 A;  3KQ0 A;  1CRB A;  4YFP A;  2HYS A;  2Y3E A;  4CDD A;  2EU7 X;  2RTK A;  1QWD A;  1G5W A;  1SY0 A;  2RTQ B;  1VYF A;  2UZ2 A;  4M7M A;  2MHL A;  5JDP A;  3FA6 A;  1KFF A;  3HWE A;  3DTQ A;  1AEL A;  4BX5 B;  1SWT A;  1YP6 A;  2A0A A;  3P6H A;  1LCZ A;  3FW5 A;  4EKV A;  3AA0 B;  1E06 A;  2JMM A;  2L67 A;  3AAA B;  2X8S A;  1FTP A;  4QQ1 A;  1TVQ A;  4AYM C;  5G3A A;  4BBO A;  4G75 A;  1BH3 A;  2JU3 A;  2POA A;  3C76 X;  1YWA A;  1CBS A;  3G7X A;  4ZCB A;  4TNN A;  3PPT A;  5HBS A;  1VWJ B;  4OMW A;  2AT6 X;  5F2B A;  3VY9 X;  1T16 A;  1SLE B;  5HWZ A;  1NC9 A;  2IZB A;  4LQZ A;  3AA1 A;  3H3I A;  4N7C A;  1QFT A;  1WBI A;  4MVL A;  4Z27 A;  2GTL O;  2A8G A;  4D64 A;  4L3R A;  2CM9 A;  3PH6 A;  3RZY A;  2Q2M A;  2J4U P;  4ORS A;  1OEJ A;  4KII A;  1ZND A;  4ALB A;  3U9P C;  4E1S A;  1JIW I;  4D5U A;  5IO5 A;  2XKL A;  2R4N A;  2RTN B;  2OVD A;  3K3L A;  5EEE A;  1KL5 A;  5KAF O;  2R56 A;  5LJD A;  2OY1 O;  1HXL A;  4LSF A;  2QCB A;  1G85 A;  4BVM A;  5AFU K;  1KQW A;  5HA0 A;  2E4J A;  4KC8 A;  3B2I A;  1T68 X;  4XMG A;  2WPU A;  5GTI O;  1X71 A;  5FQ7 E;  3WJG A;  1QY1 A;  4IBA A;  5KIC A;  4NNT A;  5AFU L;  3OBL A;  1XKI A;  4TKB A;  1SWR A;  4IMO A;  2AF5 A;  2Y0H A;  5FQ8 E;  3RDM A;  3VU1 A;  3Q6L A;  4C4V B;  4PJ2 A;  1QFV A;  1MM4 A;  4YFQ A;  1OPF A;  2QO4 A;  3HK1 A;  5IRA A;  5LKF A;  3POR A;  1CBI A;  5LJG A;  2XE5 A;  3C5O A;  2XST A;  5L8I A;  2Q9S A;  3ZW0 A;  4PR7 A;  2G7B A;  4D6B A;  4FBV A;  1MPF A;  1SRE A;  2GTL N;  2R4P A;  2JW1 A;  5B5G A;  4O4U A;  4YMY A;  4ZGU A;  1I04 A;  4BX5 A;  3NX1 A;  1JYD A;  4YH0 A;  1H6S 1;  3B2K A;  5H9K A;  5EED A;  4AKR B;  1N43 A;  3OE3 A;  1FEN A;  4ZJ0 A;  1ZHW A;  1SWF A;  2GTL M;  2UYW A;  3KVD D;  2G5L A;  2NP1 A;  2O4V A;  4BQU A;  3U03 A;  2LFO A;  4GK9 A;  4AZQ A;  1R0U A;  2WEW A;  1CBQ A;  3CBC A;  3BX8 A;  1KT4 A;  4B55 A;  2RTJ A;  4YGH A;  4C4V A;  4O3W A;  2HZQ A;  2JMB A;  4K19 A;  5F7G A;  3JTY A;  4ALO A;  1GX9 A;  3RBY A;  5HCD C;  3A0B O;  4C5P A;  4AYD C;  3T2W A;  1LCW A;  3UEX A;  1E02 A;  2F1V A;  1PMP A;  1DC9 A;  3D95 A;  1NBX A;  1LNM A;  3BLG A;  4UU2 A;  2QOM A;  5IXG A;  3C77 X;  4ON1 A;  2BLG A;  3A2S X;  2ZLD A;  4I95 A;  3PRN A;  3LK2 B;  1YWC A;  3F9D A;  5IO6 A;  1IFC A;  3K19 A;  1LEL A;  4LSI A;  4C00 A;  2W80 C;  1MDC A;  1N7Y A;  4MVK A;  4ZH9 A;  1LF7 A;  3LHN A;  3QKG A;  2KXP A;  3U0D A;  4ZR2 A;  4TLJ A;  4FGI B;  4RUN A;  2X32 A;  3EBK A;  4YDB A;  3LK4 1;  2ZSC A;  1OSM A;  2Q4N A;  4EQA C;  3CMP A;  2FR2 A;  1U18 A;  4GU8 A;  4EDE A;  5LJK A;  2OVE A;  5D8J A;  1VWE B;  1S7D A;  1SXY A;  1ZNG A;  1PRN A;  4FMS A;  2J1N A;  4PUX A;  2MHD A;  1EI5 A;  3VG2 A;  4CV7 A;  1IFB A;  1D3S A;  4ZGF A;  4WFV A;  1FJ1 E;  4CPI A;  3PEC A;  1EPB A;  4Y5D A;  4A60 A;  3AA6 A;  5H8T A;  4ORX A;  3EBW A;  2K23 A;  4AZL A;  3TGC A;  1KT5 A;  4AYE C;  1OBU A;  1LID A;  2AT5 X;  1QY0 A;  1VYO A;  4GGZ A;  4CPH A;  1YIV A;  2ZAG A;  3AA1 B;  5LJH A;  4ORR A;  5K06 A;  4FOZ A;  2AVI A;  3LK4 2;  1ZHT A;  4N75 A;  2XMX A;  2Y0K A;  4HWM A;  1SWC A;  4GDA A;  3NJT A;  1ALB A;  3T2X A;  3VGW A;  5HCC C;  1RAV A;  4D65 A;  3PQS A;  5HTE A;  2X55 A;  5EZ2 A;  1SRI A;  5DL5 A;  1QY2 A;  2CBS A;  4GUZ A;  1P6P A;  3KZI O;  4PJ0 O;  1RXH A;  3UEV A;  2F1T A;  1JZU A;  2IZG B;  1HXX A;  2X56 A;  2WWP A;  1VWG B;  1O8V A;  1Z24 A;  1PM1 X;  1SWG A;  1PTS A;  4KT5 A;  4KH8 A;  2RTD B;  1SRG A;  3EW1 A;  3CBS A;  1TXL A;  1SWK A;  5HTD A;  4RJW A;  5C0N A;  4I60 A;  2R4L A;  3SZH A;  3WJB A;  4YGZ A;  4XMF A;  4GJV A;  3D4R A;  5D45 A;  1ZHY A;  3TF6 A;  4FBR A;  4AYH A;  2NND A;  1HBQ A;  2M4L A;  1SY2 A;  4LSE A;  2KZ7 A;  2FRS A;  1I05 A;  1EUO A;  1ADL A;  1GKA B;  2AL0 X;  2Z4I A;  4QAE A;  1GT4 A;  4RLB A;  4RUU A;  2C4I A;  3KFH A;  3CQN A;  4GCQ A;  4ZHC A;  3D96 A;  1W5R A;  3VG4 A;  3BU9 A;  5B5E O;  4AYI D;  2ZFG A;  2BHV A;  1HXU A;  3FR4 A;  4HPB A;  5HAE A;  2FLJ A;  1OEE A;  2NNE A;  3STK A;  3PGS A;  1FEL A;  2GH7 A;  5F6B A;  3APU A;  2BS5 A;  3TZG A;  4MEE A;  2R8A A;  4OEL A;  2RD7 C;  7PRN A;  2C1S A;  4BUM X;  1B4M A;  1SWA A;  1T8V A;  1Y0G A;  1IKJ A;  3X00 A;  4IAB A;  4B61 A;  2RTB B;  3APX A;  2A2G A;  3LV4 A;  4AKR A;  2ASN X;  1S44 A;  4IB7 A;  4I9S A;  3HWF A;  5F1E A;  4FQB B;  2GC9 A;  1HY2 A;  2HKD A;  2HMB A;  2W2F A;  4Y59 A;  4IRW A;  2LBV A;  1EAL A;  1N9M A;  1RSU B;  4NLJ A;  2WJQ A;  1FDQ A;  2RTE B;  2Y7S A;  1KXO A;  5LJC A;  1MX7 A;  1SY3 A;  1YWB A;  5G26 A;  4BCS A;  1ZHZ A;  3WJC A;  3SY7 A;  3P6G A;  5H2F O;  2IZF B;  2MJI A;  1PEE A;  1EPA A;  4FES A;  2WQ9 A;  1U17 A;  3NP1 A;  2OZQ A;  4DQ3 A;  1GFM A;  1SWH A;  2AXT O;  3BDR A;  2F73 A;  4YGG A;  1JJX A;  4U9C A;  1JJJ A;  3RBH A;  4ORW A;  2Z4H A;  1EIO A;  5AQ6 A;  4DCB A;  1ZNE A;  3GP6 A;  1ERB A;  5D48 A;  3S26 A;  2FKG A;  1KQX A;  2RTG B;  2OF8 A;  1KZW A;  1MM9 A;  2AT3 X;  5B66 O;  3VE2 A;  2OFR X;  3FA7 A;  2X4M A;  1JBH A;  4CK4 A;  1LFO A;  5GV0 A;  2O62 A;  2CZU A;  5LKE A;  3NQK A;  2KC0 A;  4KR4 A;  4O9S A;  3UPG A;  4WFU A;  4PSQ A;  1B0O A;  3WBG A;  4TQ2 A;  4YVB A;  3T1D A;  5DL7 A;  4Z2P A;  4AKM A;  3P6C A;  4M6S A;  4Y0P A;  4GCS A;  3SLO A;  4QGX A;  1IZN B;  3BU1 A;  3SY9 A;  5HZ9 A;  4QZT A;  5EDB A;  1SRH A;  1ZRY A;  1KT3 A;  5B29 A;  3AEH A;  3ZUI A;  3HPE A;  4Z28 A;  3ZZV A;  4XNL A;  2K4T A;  2KTS A;  2Y0L A;  2RA6 A;  2GE4 A;  2FGQ X;  3VY8 X;  2X46 A;  2OL6 O;  3MVF A;  3FEL A;  1K3B A;  3AUM O;  1LCV A;  1A57 A;  2CBR A;  3POQ A;  2MNH A;  4O3X B;  5BYP A;  5JR8 A;  3FYF A;  1RBP A;  4AZP A;  3RDQ A;  4MIR A;  1KL3 A;  3RY1 A;  4UB8 O;  4EFG A; 
#chains in the Genus database with same CATH homology
 1Y9L A;  1B56 A;  4YDA A;  4AUI A;  4LZU A;  3KFF A;  1KT7 A;  4OMX A;  1QG5 A;  4ORU A;  2W81 C;  2JU8 A;  1GT3 A;  1LIE A;  4MVK A;  1IKE A;  4AZO A;  3VZW X;  4AFK A;  2RN4 A;  1KT6 A;  4ZH9 A;  2W2B A;  4NYR A;  4FZN A;  2PY1 A;  1LF7 A;  1TOW A;  3LHN A;  3WJE A;  3SYB A;  3QKG A;  2KXP A;  1U0X A;  1GT5 A;  4IAX A;  3KZA A;  4N7D A;  4ZR2 A;  3P6F A;  3WXQ A;  4TLJ A;  3U0D A;  4FGI B;  1IIU A;  4RUN A;  1X8N A;  3EBK A;  4YDB A;  4G76 A;  3LK4 1;  3VG5 A;  1OSM A;  2HZR A;  4ML7 B;  2Q4N A;  1DZM A;  4EQA C;  3CMP A;  2FR2 A;  4IMN A;  1E5P A;  3HTY A;  2M07 A;  1U18 A;  4GU8 A;  4EDE A;  5LJK A;  1THQ A;  2OVE A;  2A3F X;  2QO5 A;  5D8J A;  1S7D A;  3NQ3 A;  1TW4 A;  2X8F A;  5EPQ A;  3FEP A;  3S5X A;  4AW8 A;  1SXY A;  4TKH A;  1ZNG A;  3OD9 A;  2MWH A;  1PRN A;  4FMS A;  2J1N A;  4TJZ A;  1DFV A;  4PUX A;  2MHD A;  1BM5 A;  4XMD A;  3VG3 A;  4EXZ A;  1EI5 A;  1YWD A;  3VG2 A;  2MM3 A;  4CV7 A;  2XE2 A;  3AKN A;  2QOS C;  2L5P A;  4IAW A;  3BRN A;  2FT9 A;  1IFB A;  1D3S A;  4MIS A;  4ZGF A;  1N0S A;  3KFI A;  1NGL A;  3ELX A;  4WFV A;  4XME A;  4GF4 A;  3FIQ A;  3B2L A;  3PEC A;  1HMT A;  1EPB A;  2WUT A;  4A60 A;  1MVG A;  3AA6 A;  2WR6 A;  2XE1 A;  2WEX A;  2IFB A;  4U8U M;  3AA6 B;  3FMZ A;  5H8T A;  4FSO A;  2BT9 A;  3E3C A;  1MUP A;  4ORX A;  3EBW A;  3TGA A;  1XCA A;  4QYP A;  2K23 A;  2Q39 A;  4INN A;  2N2L A;  2XTQ A;  4AZL A;  1BLR A;  4KCA A;  3TGC A;  3EMN X;  1E00 A;  1KT5 A;  3F8A A;  4A1Y A;  1GM6 A;  3P6D A;  4AYE C;  4L1N A;  3FEK A;  3WI5 A;  4YCH A;  1OBU A;  5DPQ A;  1LID A;  2AT5 X;  1QY0 A;  2WSJ A;  4BOE A;  3OJY C;  4FZM A;  1YUP A;  1OBP A;  3FEN A;  2ACP X;  1YIV A;  2ZAG A;  3L4R A;  1L6M A;  3AA1 B;  5LJH A;  4ORR A;  5K06 A;  1JYJ A;  4LKP A;  4I3D A;  4FOZ A;  2XTR A;  2ERV A;  3VE1 A;  1DZK A;  1PHO A;  3LK4 2;  3TGB A;  1ZHT A;  2G79 A;  5AJB A;  3ZWE A;  1BT9 A;  4N58 A;  5IO7 A;  2K62 A;  5AJC A;  4ORY A;  3SYS A;  5T5F A;  3POX A;  2XMX A;  2Y0K A;  4FBO A;  4HWM A;  4WBK A;  5HA1 A;  2POR A;  3SZV A;  2ANS A;  2ZAI A;  3FA8 A;  2X8T A;  4U8U O;  1DF3 A;  1ALB A;  3KQ0 A;  5H9N A;  5HCC C;  1CRB A;  1QQS A;  2PRN A;  2L68 A;  1BJ7 A;  2GTF X;  4D65 A;  4YFP A;  2HYS A;  3PQS A;  1LIC A;  4YKO A;  5HTE A;  1JV4 A;  3GE2 A;  1QJP A;  3QRA A;  2EU7 X;  3WJF A;  5EZ2 A;  1QWD A;  3NPO A;  3UEW A;  1ICN A;  3DA4 A;  1G5W A;  5DL5 A;  1QY2 A;  2CBS A;  3ZI8 A;  1SY0 A;  1P6P A;  4GRJ A;  4E1T A;  1VYF A;  2BS6 A;  4M7M A;  4Z3T A;  2MHL A;  5JDP A;  3FA6 A;  3UEV A;  3D97 A;  1KOI A;  2F1T A;  3HWE A;  3DTQ A;  1AEL A;  1JZU A;  2A0A A;  1YP6 A;  3P6H A;  3FW5 A;  1KZX A;  1HXX A;  3AA0 B;  5B27 A;  2WWP A;  1BSO A;  5KID A;  1E06 A;  2A13 A;  2JMM A;  1YP7 A;  2L67 A;  3AAA B;  2X8S A;  1O8V A;  8PRN A;  1FTP A;  4QGV A;  3AAA A;  1Z24 A;  3WVM A;  1PM1 X;  1EII A;  1HBP A;  3LK3 B;  4GNY A;  4QQ1 A;  3WOV A;  4ZHG A;  1URE A;  4KT5 A;  1TVQ A;  3FA9 A;  4KH8 A;  2OVS A;  1X8O A;  3AAE B;  3AKM A;  1LIF A;  3CBS A;  4GKC A;  1TXL A;  4Y0Q A;  2FWV A;  3KFG A;  5BVQ A;  5HTD A;  4RJW A;  4AYM C;  5C0N A;  5ADX K;  3VG6 A;  5HZQ A;  4G75 A;  1FEM A;  2G78 A;  1BH3 A;  3WJB A;  4YGZ A;  1D2U A;  4ES7 A;  2JU3 A;  2POA A;  5AEO A;  2QO6 A;  3I17 A;  5LJB A;  4RLC A;  4XMF A;  1BSQ A;  3C76 X;  1YWA A;  3RWX A;  3D4R A;  2KTD A;  5D45 A;  1CBS A;  3G7X A;  4ZCB A;  4TNN A;  1ZHY A;  3PPT A;  3TF6 A;  5HBS A;  4OMW A;  3FR2 A;  2AT6 X;  5F58 A;  4FBR A;  2XE3 A;  5IYU A;  3EMM A;  3APW A;  1NP1 A;  3VY9 X;  1AQB A;  4R0B A;  4AYH A;  4GHB A;  2NND A;  1HBQ A;  4QGW A;  2LKK A;  1ZNK A;  1QJ9 A;  3PED A;  2M4L A;  2KZ7 B;  1SY2 A;  4LSE A;  5HWZ A;  4IB9 A;  2KZ7 A;  1O1V A;  3P02 A;  2LB6 A;  3GAQ A;  2FRS A;  4LQZ A;  2DM5 A;  4AZR A;  1QJ8 A;  2Q2P A;  3AA1 A;  3H3I A;  4N7C A;  1I05 A;  1QFT A;  3NBX X;  1EUO A;  4MVL A;  4ZHH A;  3NSG A;  4OS8 A;  4AYN A;  1BSY A;  2GTL O;  1ADL A;  5FQ6 E;  1X8Q A;  1GKA B;  2AL0 X;  2L9C A;  2Z4I A;  1GT4 A;  4QAE A;  2RQ0 A;  4D64 A;  2HNX A;  4XMH A;  3RSW A;  4RLB A;  4XMC A;  4I3C A;  4F4B A;  5ADX L;  1CBR A;  4RUU A;  1A2D A;  3KFH A;  3CQN A;  4L3R A;  4DQ4 A;  4ZHC A;  4GCQ A;  3D96 A;  4O3Y A;  2XG6 A;  4JCH A;  5EE2 A;  2CM9 A;  3ELZ A;  1AB0 A;  3PH6 A;  3VG4 A;  3RZY A;  1LPJ A;  2Q2M A;  3BU9 A;  4AZN A;  2J4U P;  3JSQ A;  4AYI D;  3FW4 A;  5D5D A;  4ORS A;  1OEJ A;  1YS5 A;  4QYN A;  1GKA A;  4KII A;  2BHV A;  2ZFG A;  1HXU A;  4FRX A;  1AVG I;  2F09 A;  3FR4 A;  1DZP A;  1ZND A;  2FLJ A;  4HPB A;  3U9P C;  4ALB A;  5FEN A;  5HAE A;  2ACO A;  1GXA A;  1OEE A;  2NNE A;  3UAQ A;  3STK A;  1ORM A;  4E1S A;  1JIW I;  4D5U A;  2QM9 A;  3AA7 B;  4IB8 A;  5IO5 A;  4OS3 A;  2XKL A;  3STM X;  2YNK A;  1FEL A;  2RCT A;  2OVD A;  1A3Y A;  3K3L A;  5F6B A;  3HWG A;  5EEE A;  4A8Z A;  1DZJ A;  1X8U A;  2BS5 A;  3APU A;  3BS2 A;  5HZ8 A;  3TZG A;  3BY0 A;  1FE3 A;  4O4O A;  1HMR A;  5HCE C;  2KT4 B;  2R56 A;  3CWK A;  3STN A;  2AMM X;  1GFP A;  2JU7 A;  5LJD A;  1BWY A;  2RD7 C;  4HFO A;  4GNW A;  7PRN A;  4BUM X;  1B4M A;  2LFU A;  4FSP A;  5KHP A;  3PH5 A;  1T8V A;  4LSF A;  1G85 A;  1IKJ A;  4BVM A;  4GH7 A;  1KQW A;  2X45 A;  5DL7 A;  5AFU K;  4WHI A;  4IAB A;  4B61 A;  5HA0 A;  4LZV A;  3APX A;  2A2G A;  2E4J A;  3G7G A;  3LV4 A;  4AKR A;  2ASN X;  1S44 A;  1EQD A;  1OPA A;  1S2P A;  1MX8 A;  3B2I A;  2LBA A;  4KC8 A;  3VPJ E;  1T68 X;  2R74 A;  1EXS A;  4XMG A;  1O1U A;  1H91 A;  4O4S A;  4IB7 A;  3O2Y A;  4I9S A;  3HWF A;  5F1E A;  3MX7 A;  2AT8 X;  5CYB A;  6PRN A;  4KR8 A;  3HWD A;  1GX8 A;  4FQB B;  2GC9 A;  3NQ9 A;  4EEJ A;  4YBP A;  2Y2X A;  3AA0 A;  3NX2 A;  3T20 A;  2KW1 A;  2YPV A;  1LKE A;  3N91 A;  1X71 A;  2HMB A;  1SXX A;  5FQ7 E;  3WJG A;  2W2F A;  1QY1 A;  4O3Z A;  4FUV A;  4ODD A;  2JN3 A;  5H9A A;  4IBA A;  4KC7 A;  1HQP A;  5KIC A;  4NNT A;  4C69 X;  5DG4 A;  3BSZ E;  4OS0 A;  2LBV A;  1EAL A;  2ODJ A;  5AFU L;  4JGL A;  1PBO A;  4NP1 A;  1G74 A;  4NW4 A;  3OBL A;  2KDY A;  1XKI A;  3ZW1 B;  1Q9G A;  4TKB A;  1LIB A;  4IMO A;  4NLJ A;  4XNK A;  1ZNH A;  2FTB A;  1FDQ A;  3S60 A;  1UZ2 X;  1OBQ A;  1Q9F A;  1SMP I;  3JQO A;  4LSH A;  2Y0H A;  5FQ8 E;  1G7N A;  2Y7S A;  3VU1 A;  1RLB E;  3PQU A;  3ZQ3 A;  1KXO A;  5LJC A;  3WI4 A;  3Q6L A;  2FS6 A;  3NAD A;  4PJ2 A;  1GFO A;  1QFV A;  1MX7 A;  5HZ5 A;  4HPA A;  5D47 A;  1MM4 A;  3T0S A;  1SY3 A;  1YWB A;  2A2U A;  4YFQ A;  5G26 A;  1ZHZ A;  1OPF A;  2QO4 A;  1KGL A;  3HK1 A;  3WJC A;  3SY7 A;  3P6G A;  1I06 A;  4LKT A;  3IFB A;  3HOE A;  3BX7 A;  3ZUO A;  5LKF A;  2MJI A;  4AZM A;  1PEE A;  2FGR A;  3POR A;  4QZU A;  1CBI A;  1EPA A;  5BVS A;  5LJG A;  3S5V A;  2XE5 A;  1TOU A;  3C5O A;  4FES A;  2XST A;  1X89 A;  5L8I A;  4O4X A;  2Q9S A;  2WQ9 A;  4HPC A;  3ZW0 A;  1U17 A;  2G7B A;  3NP1 A;  2W2A A;  2OZQ A;  4D6B A;  4DQ3 A;  1GFM A;  5L8O A;  4FBV A;  2LHF A;  1MPF A;  2YG2 A;  5F6Z A;  5CE4 A;  2GTL N;  3VZT X;  5FFH A;  2GJ5 A;  2YMS A;  3O19 A;  3BDR A;  2JW1 A;  2F73 A;  3O22 A;  4U9C A;  4YGG A;  1JJX A;  4HPD A;  4O4U A;  3NR3 A;  4YMY A;  3PP6 A;  1JJJ A;  4ORW A;  2Z4H A;  3JS1 A;  3RBH A;  1SY1 A;  3FR5 A;  5H9L A;  1SA8 A;  5AQ6 A;  1EIO A;  4GCP A;  1BRP A;  3RKG A;  1ZNE A;  1ERB A;  2AKQ A;  5D48 A;  1Y9T A;  1I04 A;  1QAB E;  4Y0S A;  3S26 A;  4ZGU A;  3GP6 A;  1KQX A;  2K0L A;  3P24 A;  3P6E A;  4YKM A;  2FR3 A;  1KZW A;  3NX1 A;  3O0E A;  1JYD A;  3SOT A;  2AT3 X;  4TKJ A;  4YH0 A;  1H6S 1;  1ML7 A;  4Y0R A;  2N93 A;  5FAZ A;  4GE1 A;  3VE2 A;  4NYQ A;  3B2H A;  2LA7 A;  2OFR X;  1MM5 A;  3B2K A;  1VYG A;  3FA7 A;  5H9K A;  4COT A;  5EED A;  2M06 A;  3WJD A;  4AKR B;  4QRL A;  4A1H A;  4GET A;  1JBH A;  3OE3 A;  4CK4 A;  1FEN A;  4ZJ0 A;  3HWB A;  1ZHW A;  2OFM X;  1LFO A;  2GTL M;  5GV0 A;  2O62 A;  2MO5 A;  3DSZ A;  5FVN A;  3VG7 A;  4JFB A;  1HMS A;  2CZU A;  3KVD D;  3IA8 A;  2NP1 A;  1EW3 A;  3FLL A;  1P4T A;  4NLI A;  4BQU A;  5LKE A;  3NQK A;  2KC0 A;  1E54 A;  2O4V A;  4KR4 A;  4O9S A;  3U03 A;  2CZT A;  4U3Q A;  3UPG A;  4WFU A;  2LFO A;  4GK9 A;  5EDC A;  4AZQ A;  3SZD A;  4PSQ A;  1B0O A;  3WBG A;  4TQ2 A;  1GFN A;  1R0U A;  2KD2 A;  2WEW A;  1X8P A;  1CBQ A;  4NNS A;  2AH7 X;  3T1D A;  3ZW2 A;  1BRQ A;  3CBC A;  4ZHF A;  1A18 A;  1NP4 A;  4YCE A;  4AKM A;  3BX8 A;  3P6C A;  3HW9 A;  1KT4 A;  1T0V A;  4FRT A;  1ZHX A;  4QNI A;  3AAE A;  2AT0 X;  4M6S A;  4YGH A;  3SAO A;  1GFQ A;  4Y0P A;  4GCS A;  1ERX A;  4N59 A;  4QGX A;  4IB6 A;  5L8N A;  2P8G A;  3I0A A;  4MVI A;  1CJ5 A;  3UEU A;  1SXU A;  1IZN B;  3DA3 A;  2JOZ A;  3BU1 A;  4O3W A;  2N2M A;  3SY9 A;  2HZQ A;  2JMB A;  4K19 A;  3ZW1 A;  4QZT A;  5HZ9 A;  5F7G A;  5EDB A;  5LJE A;  3JTY A;  4ALO A;  4FT6 A;  1HN2 A;  1ZRY A;  1GX9 A;  1KT3 A;  4O49 A;  3RBY A;  1B8E A;  3POU A;  4UU3 A;  5HCD C;  4D6A A;  1BXW A;  5B29 A;  3ZUI A;  1G90 A;  3CR6 A;  3ZZV A;  5D4A A;  4XNL A;  2X27 X;  2K4T A;  3MBT A;  4AYD C;  2KTS A;  4RL9 A;  5BVT A;  2Y0L A;  4ZFX A;  2RA6 A;  4ZH6 A;  4MVE A;  3UEX A;  2GE4 A;  1E02 A;  5HZ6 A;  2F1V A;  1PMP A;  2FGQ X;  2R73 A;  2HLV A;  3EM0 A;  1IZN A;  3C78 X;  3VY8 X;  3CQR A;  1DC9 A;  4U8U N;  1HXT A;  2OMF A;  3UU2 A;  3D95 A;  2X46 A;  3V8U A;  1LNM A;  3BLG A;  4UU2 A;  4FZL A;  4RJX A;  3TZS A;  1SXW A;  3MVF A;  3LK2 A;  3VZU X;  3C77 X;  3FEL A;  4ON1 A;  2BLG A;  1OEK A;  4I6S A;  2ZLD A;  3A2S X;  1BBP A;  2FS7 A;  3ZW0 B;  4GZV A;  3AA7 A;  4I95 A;  3PRN A;  2QTK A;  2RCQ A;  1A57 A;  1VPR A;  5DL6 A;  2CM4 A;  3LK2 B;  2CBR A;  3POQ A;  2MNH A;  3HOL A;  1GT1 A;  1BEB A;  2WQA E;  4O3X B;  1ZNL A;  5PRN A;  4ID2 A;  1YWC A;  3F9D A;  5BYP A;  5JR8 A;  3FYF A;  1RBP A;  4I3B A;  1ICM A;  4YBU A;  4ARH A;  2OVA A;  5IO6 A;  1IFC A;  4AZP A;  5DL8 A;  4CSB A;  4GDZ A;  3K19 A;  1I4U A;  1ACD A;  4MIR A;  3EYC A;  3FYX A;  1OPB A;  4I9R A;  1IW2 A;  3T24 A;  2KXP B;  4KRA A;  4ZHD A;  1DV9 A;  4LSI A;  2ALL X;  2NNQ A;  4EFG A;  3F6Z B;  3B2J A;  3QRC A;  2QMI A;  2W80 C;  4YFR A;  1MDC A;  3APV A;  3LK3 A;  1GGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...