4O3XB

Crystal structure of the vaccine antigen transferrin binding protein b (tbpb) mutant phe-171-ala from actinobacillus pleuropneumoniae h49
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
241
structure length
241
Chain Sequence
b'PALGYVVKVPVSSFENKKVDISDIEVITNGNLDDVPYKANSSKYNYPDIKTKDSSLQYVRSGYVIDGEHSGSNEKGYVYYKGNSPAKELPVNQLLTYTGSWDFTSNANLNNEEGRPNYLNDDYYTKAIGKRVGLVSGDAKPAKHKYTSQFEVDFATKKMTGKLSDKEKTIYTVNADIRGNRFTGAATASDKNKGKGESYNFFSADSQSLEGGFYGPKAEEMAGKFVANDKSLFAVFSAKHN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transferrin binding protein B
publication title Nonbinding site-directed mutants of transferrin binding protein B exhibit enhanced immunogenicity and protective capabilities.
pubmed doi rcsb
source organism Actinobacillus pleuropneumoniae
molecule tags Metal transport
total genus 64
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 4o3xB01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4o3xB02
4AYEC 4QQ1A 4O49A 4O3ZA 3KVDD 3HOEA 2YPVA 4U9CA 4Z3TA 1YS5A 4AYMC 4O3YA 4AYID 3V8UA 2W80C 4O4XA 2Y7SA 3UAQA 4O4UA 3VE1A 4O3WA 2W81C 5T5FA 2KDYA 5EE2A 4O3XB 3HOLA 2LFUA 4AYNA 3PQUA 2KC0A 3PQSA 4AYDC 3VE2A
chains in the Genus database with same CATH superfamily
1Y0GA 1HQQA 5G26A 4MEEA 2ACPX 2RTDB 1OBQA 2A3FX 3ZW1B 2OVAA 1GFOA 1GX8A 1DFVA 2OF8A 1HMRA 1EALA 4ORSA 4IBAA 4O4SA 1CBQA 4RJWA 2R8AA 3AA6A 2AMMX 2RTRB 2KD2A 4ML7B 3SY7A 4U8UN 3SAOA 2OMFA 1W4TA 1VWHB 5B10O 1GGLA 3KFGA 1VWFB 1SRJA 2FGSA 2R4LA 4OELA 2HKDA 4N7DA 4C4VA 2YNKA 3EW1A 2R73A 3PH5A 4JGLA 4I3BA 2QO4A 3RDUA 4I9RA 3FA7A 5B2AO 2X34A 4FBRA 2AKQA 4GJSA 3D96A 3DA4A 2WQ9A 4GGRA 3OE3A 4CPHB 4IMOA 3B2JA 5EZ2A 1OSPO 3VGWA 2R88A 4FQBB 5IO5A 5FFHA 3PGUA 2A2GA 2N2LA 2OL8O 3A0HO 1QQSA 4O3XB 3EBWA 2R4NA 4OKAA 3ZUIA 3AA7A 3V8UA 4I60A 3GE2A 1SMPI 2C1SA 2IZLB 1A3YA 3WJCA 1G7NA 2MM3A 1GKAA 3AAAA 2QMIA 2IWVA 5AFUK 1VWJB 3VE1A 2IZGB 4L3RA 3LK3B 3I0AA 2QM9A 3WVMA 3RBHA 4TNNA 4QZTA 4YH0A 2RQ0A 5D47A 2GTFX 4QQ1A 4TKHA 1SRHA 4ZHFA 1SWLA 1CBIA 2OY1O 1SY3A 1B0OA 4CK4A 3FW4A 4IB7A 3C5OA 4Z2OA 3GP6A 1G85A 4LSFA 2X9KA 2JU7A 5HBSA 1STPA 5HZQA 2X45A 3FMZA 1S5LO 1O1UA 1E02A 4YMYA 1GFNA 5IRWA 1A2DA 2O4VA 1HXZA 4FOZA 1MEPA 4KR4A 3WJBA 3TGCA 3PP6A 5H9KA 1P6PA 1VWQB 1VWAB 7PRNA 1PBYA 4FT6A 1TXLA 5H8TA 2N93A 2XMXA 1W6FA 4FBOA 2G7BA 4ZGUA 4TJZA 1QY0A 2A8GA 3POXA 1SWGA 2OVEA 2UZ2A 2XTRA 2XE3A 4KCAA 3RY2A 4LSEA 3KQ0A 4GD9A 2FHNX 1AB0A 3VHMA 2JU8A 1QFVA 4NLJA 4INNA 1MUPA 3D9WA 2IZEB 1AVDA 1ZHTA 1NGLA 5CE4A 4R0BA 2FLJA 1X71A 1DF3A 2PI3O 4HPCA 2HMBA 4NYRA 4EXZA 3JCUO 1KQWA 4BCSA 5L8NA 1JQPA 1O8VA 3LHNA 4XNLA 2GJ5A 3PPTA 1JMXA 1Q9GA 1OEKA 2FR3A 2I5ZO 4C4VB 5D8JA 2X46A 2R56A 2I5VO 1BSOA 1LF7A 5EPQA 1A57A 1IZNA 1LIEA 1TVQA 1XCAA 2Z4IA 4NNTA 4G76A 1RLBE 3VG3A 1QJPA 2OFMX 2ERVA 3QQ2A 3EM0A 3FR2A 1CJ5A 3D97A 5AJCA 3AA7B 1SWHA 4U8UM 4XMHA 2LFUA 5EEDA 1KQXA 5E79O 1N9YA 2GTLO 1ZHZA 5B5GA 4HPAA 1AELA 3FLLA 1SRGA 2X8FA 2VFBA 1SWBA 1E54A 1ICMA 1YWCA 4KRAA 1I05A 4JFBA 1GKAB 5BVTA 3AAAB 1G90A 1VWPB 2AT5X 2Y0HA 4HFOA 4BJ8A 1SWDA 1QABE 4Y0QA 1HXLA 3BY0A 1TW4A 2WWPA 3WJGA 1N7YA 4FBVA 3RDXA 2OY7A 2LBVA 3T2XA 2LHFA 4AZMA 4EFGA 3X00A 4O4UA 2IZBA 1Q9FA 4U3QA 2RN4A 2KT4B 2HZQA 1ZHXA 2HYSA 2Q2MA 4FSPA 5EDBA 1EQDA 4ORYA 4AZRA 3ELZA 4OMWA 2P8GA 1EW3A 3NP1A 5HTDA 1BBPA 1WUBA 1CRBA 1SLDB 2F73A 1EXSA 5D45A 1QG5A 1SWNA 3F9DA 1SWKA 5FQ8E 4A1YA 2ZSCA 4AKRB 2G8CO 2XE2A 1GT5A 2IWWA 3FYFA 4CPIA 4ZGFA 1VWEB 3U9PC 5T5FA 4IMNA 5L8IA 3WU2O 1SXXA 1EI5A 4O9SA 1HBPA 4RUNA 2HLVA 2ASNX 2W2FA 1ADLA 4GJVA 5F58A 3HOLA 1H91A 1JV4A 4TKJA 2KTDA 4YGGA 2RTEB 3PF1A 4CPFA 5HAEA 2Y32A 3KFIA 4KIIA 4A8ZA 2RCQA 3MBTA 2CBRA 3BS2A 3B2KA 3G7GA 3QRCA 2Q39A 1VWRB 4IB9A 2IZIA 4GH7A 5FENA 5GTHO 3FA6A 2DM5A 4ZHHA 2L5PA 1S2PA 2WR6A 2RTFB 2ANSA 1GT3A 4GGZA 1OEEA 1TOWA 1RXJA 1SY1A 3PGSA 2PRNA 2OYBO 2FWVA 2OFAA 2W81C 1SRFA 3F6ZB 1VWDB 4GHBA 2R89A 2ALLX 3P6HA 1VWCB 4RL9A 4CTDA 1SLEB 1HBQA 1VWKB 4EDEA 3PEDA 2LBAA 4WBKA 4IABA 3LK3A 4IB8A 5DL7A 3UEUA 4ORXA 1AVEA 3VU1A 1YWBA 2FR2A 4I9SA 2X27X 2L67A 3NSGA 1EUOA 1ZHYA 2K62A 3NQ3A 3SOTA 4NLIA 3WBGA 3UAQA 1KXOA 4UU2A 4D65A 2M4LA 2MHDA 3FIQA 5IO7A 1OSMA 4Y0SA 1E2TA 4XMGA 4AYNA 2QOSC 4UB6O 1SREA 4PJ0O 5B66O 3BX8A 3APVA 3PGRA 2FGRA 4K3BA 1FELA 2J4UP 2GTLN 2BLGA 4HPDA 1JYJA 2CAMA 1KL3A 2N2MA 2BC3A 4BOEA 2AH7X 1LPJA 4GUZA 4AZLA 3LV4A 1EPAA 1DZKA 4GRJA 3WYPA 1KFFA 1MPFA 5L8OA 3ZW2A 5LJKA 4NV8A 1YP6A 4ZHCA 3HW9A 4XMFA 1SWPA 1KGLA 2OL6O 3G7XA 2RTNB 3TF6A 4CDFA 1JBHA 1JYDA 1IIUA 1YIVA 1ICNA 4O49A 3VG6A 1YUPA 3HWFA 1HXXA 2K0LA 3JTYA 3PORA 4I3CA 3SYSA 3CWKA 1FTPA 4Y0RA 4EKVA 2KDYA 3EC5A 1ZHWA 4JCHA 5AJBA 4QYPA 4G75A 4LQZA 4LZVA 2R4OA 3BDRA 1VYOA 2RCTA 4YKMA 2JMMA 4BUMX 4B55A 5KICA 1BRQA 4K3CA 5HCEC 5HA1A 1ALBA 4GNWA 1L6MA 3SZDA 1LIBA 4N74A 5LKFA 2RD7C 2M06A 3POUA 2Q4NA 1ERXA 3ZZVA 1HMTA 1SRIA 1MDCA 3RDQA 3A0BO 5LJBA 3B2LA 1G5WA 1E00A 2A13A 1JIWI 2ZLDA 1KT5A 2G79A 1GX9A 4CV7A 4ZHGA 5D4AA 1I78A 1KZXA 4FZMA 5DL5A 4IL6O 3UPGA 4D6AA 1SY2A 4FUVA 5ADXK 4Z27A 3PECA 3SLTA 1LCZA 3LK2A 1K3BA 2QCBA 5IYUA 1X8QA 1RBPA 3NQKA 3TZGA 3CQRA 2ZAGA 4U46A 5K06A 4GCQA 3L4RA 4O3ZA 5B5EO 3NPOA 1E06A 3FYXA 2R4PA 5B29A 5H2FO 3P02A 4GZVA 1FJ1E 1PRNA 4Z2PA 1Y9LA 4PUXA 3VG2A 5B5FA 3AAEB 2RTQB 4FZLA 1B4MA 3BS0A 2Y7SA 2XSTA 3N91A 5F6ZA 5HZ5A 1GX3A 3EBKA 3HWGA 3JQOA 4AKRA 3O22A 4GGTA 1X8OA 3UEVA 1A18A 3A2SX 3T6LA 5H9LA 3FA8A 1SWEA 2OY5O 3GAQA 3RWXA 3VG5A 4ZJ0A 1BWYA 2MJIA 1KT3A 1ERBA 3DSZA 2WQAE 2WVPA 1STRB 3VG4A 5H9NA 3P6CA 1IKJA 2J1NA 5HCDC 1SWRA 1SWUA 3UEWA 3RE5A 2OL7A 2A2UA 4AYMC 5FAZA 3CMPA 1LICA 3WZPA 5AQ6A 1BXWA 1UREA 4YFQA 2X56A 1SLGB 2RTCB 1KL4A 1UYNX 4MIRA 2XKLA 2K4TA 1HXUA 2L9CA 4Z6JA 3PDFA 4I3DA 3KFFA 3QKGA 2LKKA 1IKEA 1AQBA 4EQAC 4IRWA 5GV0A 5BYPA 3T0SA 4E1SA 1MVGA 1NP1A 4MVLA 4NNSA 1X8PA 4ORWA 1BSYA 1UYOX 4YGHA 5KAIO 4KC7A 1X8NA 3UEXA 3WI5A 3TZSA 2PY1A 3WXQA 4MISA 1P4TA 3S5VA 1HY2A 1T0VA 2G78A 2BHVA 2RTJA 1MM4A 2W80C 2WPUA 4BX6A 5LJEA 2R74A 4TKBA 3LK2B 3T24A 5LJCA 5LJHA 3LK41 4PR7A 4YFPA 2A5BA 4MVKA 3ZUOA 1MM9A 3WJFA 1R0UA 3FEKA 1X89A 3VG7A 3D95A 3T2WA 2X4MA 4L1NA 5KHPA 1IJ8A 4GF4A 1GM6A 4JO6A 2RTBB 3RDOA 3MM0A 4NV7A 2X8TA 3JSQA 1SWFA 3WOVA 4A1HA 3STKA 1RXKA 5HZ9A 1DZJA 4ZR2A 2FTBA 4AFKA 4ES7A 3HOEA 2LB6A 3TGBA 3P24A 5DL8A 4A60A 4CDEA 3WJEA 4M6SA 1H6S1 4QNIA 3DZMA 3I17A 1BM5A 1T1LA 1THQA 4Y5DA 4D5UA 2AT8X 1N43A 3WZNA 5HA0A 4AZOA 3APUA 1HMSA 4JNJA 3EMNX 1JJJA 2X8SA 3VE2A 1QJ8A 4FRXA 2IFBA 4HWMA 2IZCB 1NQMA 1WBIA 1GFPA 1PEEA 5EDCA 4TQ2A 2KW1A 2XE1A 1HN2A 3O2YA 4BBOA 4ORRA 3SZJA 5D48A 4QRLA 1PTSA 4O3WA 1GT1A 2WEWA 3NR3A 4AYEC 3AA1A 4GKCA 4YBPA 2CBSA 2BS6A 1D3SA 2OF9A 2Q2PA 3ZQ3A 4BX5A 4KT5A 3AKNA 3QRAA 1KL5A 2CZUA 6PRNA 4ARHA 1N9MA 4WHIA 3B2IA 3NJTA 2QTKA 3CBSA 4QAEA 2F09A 2YPVA 3FDCA 2IZKA 1KOIA 4O3YA 5HCCC 4MVEA 5FQ6E 4ALBA 5K68A 3S26A 4D64A 2BT9A 1LNMA 4CDDA 2C1QA 2GH7A 3IFBA 1ML7A 2Q9SA 5B27A 1VPRA 4OS3A 3HWEA 1ZNHA 4Z3TA 2YG2A 1SXYA 4O4OA 4XMCA 4FRTA 3JS1A 4ZH9A 2RTOB 1ZNGA 2OFBA 3APWA 1YWDA 1N0SA 3AA0B 4BX6B 2QOMA 4YFRA 3U03A 2AT6X 2BSZA 3AKMA 1I06A 1DV9A 1DZPA 2JN3A 4OS0A 3CQNA 1RSUB 3ZW0A 4E1TA 2ZFGA 4YDAA 3KFHA 3VZWX 3C78X 3AAEA 5F1EA 1SWTA 3EYCA 2RTLA 3D4RA 2CM9A 1KT4A 1BH3A 1BEBA 1B8EA 4KR8A 2KXPA 4QZUA 1NC9A 1PHOA 4FSOA 1UZ2X 4Y59A 1PBOA 4ZCBA 5AFUL 1Y53X 4C00A 1SWAA 2F1VA 1U0XA 3VHHA 3CKGA 3BU1A 2EU7X 2IZFB 1OPAA 1VWLB 1K24A 4YCEA 1OBPA 1U18A 2KZ7A 1T68X 4ZH6A 1EPBA 3OJYC 5IRUA 1VWMB 3B2HA 3STNA 1DC9A 1ZNDA 3U0DA 2NNDA 1LIFA 1Z24A 1LDOA 4EEJA 1Y52X 5DG4A 3RDSA 3F8AA 2AT3X 4N7CA 5IXGA 4AKMA 4CSBA 1LCWA 1IW2A 5LJGA 3AUMO 4AZQA 3P6FA 2BS5A 5FQ7E 3AA1B 3WYQA 5DL6A 4N75A 2XE5A 4N58A 3P6EA 4Z28A 3RSWA 3CKFA 3RBYA 2AL0X 5JR8A 2F1CX 3TGAA 5AEOA 5IO6A 1GXAA 4BX5B 4LSHA 2FS7A 3VZUX 2AF5A 4F4BA 1BJ7A 4QYNA 4GCPA 4GNYA 1LCVA 4O4XA 1O1VA 3HTYA 4XNKA 1JMZA 2FRSA 2Y3EA 2VFCA 4XMDA 3O19A 1T16A 4ALOA 2W2BA 3PH6A 4ZHDA 2X32A 1BRPA 5K67A 2QO6A 3P6DA 5G3AA 3VZTX 5CYBA 4M7MA 4GDAA 4OEMA 2MHLA 3HPEA 2FHLA 4OMXA 2AXTO 4WFVA 2JQYA 3FIDA 1OEJA 2G5LA 1E5PA 1B56A 5H9AA 1LFOA 3T20A 1QFTA 4AYID 1S7DA 4YDBA 2HZRA 4D6BA 5D5DA 5EE2A 1Y9TA 1I04A 2FS6A 4YBUA 5HWZA 3ZW0B 1QWDA 2UYWA 1ZNKA 3SY9A 5CSEA 1X8UA 3OD9A 4YGZA 3PRNA 3C77X 2POAA 2K23A 4FGIB 1NBXA 5F2BA 3Q34A 1MX8A 3BLGA 4JHQA 3H3IA 1Y55X 4AUIA 2WUTA 1I4UA 2KXPB 4N59A 5LJDA 4IAWA 1HXTA 4DQ4A 2Y0LA 1MX7A 4ON1A 4QGVA 2C4IA 2FKGA 2ZAIA 3NADA 3LTWA 1GFMA 4LZUA 5DPQA 1SXWA 1VWBB 2X55A 3RE6A 1RSTB 4AZNA 2IZAA 2M07A 2NP1A 1IFCA 4RLCA 2KZ7B 4QGWA 3NQ9A 1XKIA 5B11O 1FDQA 4CPEA 1MOYA 3DWNA 3VY8X 2OFRX 2W2AA 1ZRYA 3KZAA 5FVNA 2GTLM 3MG5A 1YS5A 1VWGB 1W5RA 3AA6B 5C0NA 3PK2A 4OS8A 2RTIB 3BX7A 4RLBA 2RTHB 4ORUA 3HK1A 4RJXA 4XMEA 3KVNA 5F6BA 1TOUA 3AEHA 1RXHA 3P6GA 2IZHB 2JMBA 5G39A 4PJ2A 8PRNA 2O62A 1QJ9A 1SWOA 1ZNLA 4B61A 1CBSA 3FENA 5LKEA 2KC0A 2Y3FA 4AW8A 4UU3A 4GE1A 3T1DA 1VWIB 4LKTA 2WJQA 5EEEA 3FA9A 3K3LA 3VPJE 2ODJA 2RTPB 4AYHA 1KZWA 3AA0A 5HTEA 4FQEA 3ZI8A 3KZIO 5KIDA 2HNXA 1LIDA 3CBCA 2OVDA 3RZYA 1NQNA 1LUQA 4KH8A 3SYBA 3WZOA 5HZ8A 1G74A 3SLOA 3MVFA 2WJRA 3LK42 2A0AA 1ACDA 4LSIA 4GK9A 5GTIO 1MK5A 1IFBA 4Y0PA 2JGSA 2NNEA 3EMMA 1SY0A 4IB6A 3EW2A 4BX7A 1JJUA 3BRZA 4BQUA 4FZNA 2MNHA 5L3YA 1HQPA 3DWOX 1PMPA 3UU2A 2LA7A 2CM4A 1NDJA 2QO5A 2FT9A 4WFUA 4PSQA 3VY9X 3NBXX 3BRYA 4U8UO 2RTAA 4YCHA 2MWHA 4NP1A 2L68A 4DQ3A 1SXUA 3ZWEA 1JJXA 4QGXA 4NYQA 1STSB 3RY1A 3NX1A 2MO5A 2E4JA 1VWOB 5BVSA 2JOZA 5TISO 1OPBA 2RTGB 3BSZE 1KT7A 1PM1X 1VYGA 5G38A 1SWSA 2GC9A 2Y2XA 3ZW1A 3FEPA 2JU3A 1GFQA 4Z2VA 2YMSA 2AVIA 2OZQA 2IZDB 5BVQA 4I95A 4FESA 1FE3A 1MM5A 3FW5A 5HZ6A 1SWQA 5KAFO 3Q6LA 1YP7A 2RA6A 3SZVA 4AZPA 3APXA 2FGQX 1T8VA 2OVSA 4KC8A 1U17A 4LKPA 4GU8A 4I6SA 2MF6A 1QY1A 1SA8A 1NP4A 1SLFB 3VHIA 4C69X 3S5XA 4ODDA 1OPFA 2WSJA 3HWBA 1KT6A 2AT0X 3RKGA 3MX7A 2FKJA 1YWAA 4U9CA 1RAVA 1BSQA 4CPHA 1ORMA 4GETA 4TLJA 3RDMA 1LKEA 1SWCA 2OY8A 2PORA 2DJGA 1S44A 5JDPA 4YVBA 4ZFXA 3S60A 3PQSA 1CBRA 2XG6A 1IZNB 3KVDD 3ELXA 4K19A 4CDCA 4COTA 2VDFA 2NNQA 1ZNEA 2Z4HA 2GE4A 5IRAA 4BGFA 4DNEA 2F1TA 3T6FA 4NW4A 5CHKA 1N4JA 1VYFA 3BRNA 4UB8O 3WI4A 3SZIA 3STMX 1BT9A 4ID2A 1BLRA 1SWJA 1D2UA 2ACOA 3SLJA 1EIIA 4BVMA 1QY2A 3FR4A 1I9HA 2F01A 2JW1A 4YKOA 3DA3A 4HPBA 3NX2A 5PRNA 1LDQA 3FELA 3E3CA 2RTMA 2DJFA 4FMSA 4RUUA 2LFOA 3O0EA 3K19A 3OBLA 1LELA 1GT4A 1DZMA 2CZTA 2WEXA 4BX7B 2Y0KA 2KTSA 2IZJA 4DCBA 1DF8A 3BU9A 3HWDA 3FR5A 1VWNB 1AVGI 3WZQA 3WJDA 2A5CA 2XTQA 4AYDC 4IAXA 5ADXL 5B3MO 3SZHA 3DTQA 1JZUA 1OBUA 3POQA 4GDZA 4MVIA 2RTKA 1FENA 1EIOA 3C76X 5JD2A 4C5PA 3IA8A 1FEMA 4GCSA 3CR6A 3PQUA 5F7GA
chains in the Genus database with same CATH topology
4YGGA 5HAEA 5G26A 3KFIA 1ZNKA 3SY9A 1T0VA 4KIIA 4A8ZA 2RCQA 2G78A 3MBTA 2ACPX 1X8UA 2CBRA 3OD9A 3BS2A 4YGZA 3PRNA 2BHVA 3C77X 2POAA 1OBQA 2A3FX 3B2KA 3ZW1B 2K23A 4FGIB 1MM4A 3G7GA 3QRCA 2Q39A 2W80C 2OVAA 4IB9A 1GFOA 4GH7A 5FENA 1GX8A 5LJEA 1DFVA 1MX8A 2R74A 3BLGA 3H3IA 1HMRA 3FA6A 2DM5A 4AUIA 1EALA 4ZHHA 2L5PA 4TKBA 1S2PA 4ORSA 4IBAA 4O4SA 2WUTA 1CBQA 1I4UA 2WR6A 2KXPB 3LK2B 2ANSA 4N59A 4RJWA 5LJCA 3AA6A 2AMMX 3T24A 2KD2A 4ML7B 5LJDA 5LJHA 3LK41 3SY7A 4U8UN 4YFPA 1GT3A 4IAWA 4MVKA 1HXTA 1OEEA 1TOWA 3ZUOA 4DQ4A 3SAOA 1SY1A 1MX7A 2OMFA 2Y0LA 4ON1A 4QGVA 2PRNA 2FWVA 2ZAIA 1GGLA 3KFGA 3NADA 3WJFA 1R0UA 3FEKA 1X89A 3VG7A 3D95A 2W81C 1GFMA 4LZUA 5DPQA 3F6ZB 4GHBA 4L1NA 4N7DA 1SXWA 2ALLX 5KHPA 3P6HA 2YNKA 2R73A 3PH5A 4JGLA 4RL9A 4AZNA 4GF4A 4I3BA 2M07A 2QO4A 1HBQA 1GM6A 2NP1A 1IFCA 3PEDA 4I9RA 4EDEA 2KZ7B 4RLCA 3FA7A 2LBAA 4WBKA 4FBRA 2AKQA 3D96A 3DA4A 4IABA 2X8TA 4QGWA 3LK3A 3JSQA 4IB8A 5DL7A 2WQ9A 3NQ9A 1XKIA 3OE3A 1FDQA 4IMOA 3B2JA 5EZ2A 4MISA 3VY8X 3UEUA 2OFRX 4FQBB 5IO5A 5FFHA 3WOVA 4ORXA 2A2GA 2W2AA 1P4TA 2N2LA 1ZRYA 1QQSA 4A1HA 4O3XB 3KZAA 3EBWA 3STKA 5HZ9A 5FVNA 1DZJA 3VU1A 2GTLM 4ZR2A 1YWBA 2FTBA 2FR2A 4I9SA 2L67A 4ES7A 1EUOA 3HOEA 1ZHYA 2X27X 3NSGA 2LB6A 3TGBA 3P24A 1YS5A 2K62A 5DL8A 3NQ3A 4A60A 3AA6B 3WJEA 3ZUIA 5C0NA 4M6SA 1H6S1 3AA7A 3SOTA 4QNIA 3V8UA 4OS8A 4NLIA 3WBGA 3I17A 1BM5A 1THQA 3GE2A 1SMPI 2AT8X 4D5UA 3UAQA 5HA0A 1KXOA 3BX7A 4UU2A 4D65A 2M4LA 4RLBA 4AZOA 1A3YA 2MHDA 3APUA 3FIQA 4ORUA 5IO7A 3HK1A 1OSMA 1HMSA 4Y0SA 3WJCA 4XMGA 4AYNA 1G7NA 3EMNX 4RJXA 2QOSC 2X8SA 1JJJA 4XMEA 3VE2A 1QJ8A 4FRXA 2IFBA 3BX8A 3APVA 4HWMA 5F6BA 2FGRA 1GFPA 1PEEA 1TOUA 5EDCA 1FELA 4TQ2A 2J4UP 2MM3A 3P6GA 2GTLN 2KW1A 2BLGA 1GKAA 2JMBA 2XE1A 3AAAA 1HN2A 4HPDA 3O2YA 1JYJA 4PJ2A 2QMIA 8PRNA 2O62A 4ORRA 2N2MA 4BOEA 5AFUK 5D48A 2AH7X 1LPJA 3VE1A 4QRLA 4O3WA 1QJ9A 4AZLA 3LV4A 1EPAA 1DZKA 4GRJA 1GT1A 1ZNLA 2WEWA 4L3RA 3LK3B 4B61A 3I0AA 2QM9A 3WVMA 3NR3A 1CBSA 3FENA 4TNNA 4QZTA 4YH0A 5LKEA 2RQ0A 3RBHA 2KC0A 5D47A 4AW8A 2GTFX 4QQ1A 4TKHA 4AYEC 3AA1A 4GKCA 4UU3A 1MPFA 4YBPA 4GE1A 4ZHFA 5L8OA 1CBIA 3T1DA 2CBSA 3ZW2A 5HWZA 1SY3A 5LJKA 1YP6A 4LKTA 2BS6A 4ZHCA 3HW9A 5EEEA 1B0OA 1D3SA 4XMFA 4CK4A 2Q2PA 3FA9A 3K3LA 3ZQ3A 3VPJE 2ODJA 4AYHA 1KZWA 3FW4A 4IB7A 1KGLA 3AA0A 5HTEA 3C5OA 3G7XA 4KT5A 3AKNA 3GP6A 3TF6A 3ZI8A 3QRAA 1G85A 2CZUA 4LSFA 5KIDA 6PRNA 4ARHA 2HNXA 4WHIA 1LIDA 3B2IA 1JBHA 1JYDA 2QTKA 2JU7A 3CBCA 1IIUA 1YIVA 3CBSA 5HBSA 2OVDA 3RZYA 1ICNA 4QAEA 4O49A 2X45A 1YUPA 2F09A 3FMZA 4KH8A 5HZQA 3HWFA 3VG6A 2YPVA 5HZ8A 3SYBA 1G74A 3MVFA 3LK42 2A0AA 1HXXA 1ACDA 4LSIA 1KOIA 1O1UA 4O3YA 1E02A 4MVEA 5HCCC 2K0LA 5FQ6E 4YMYA 4GK9A 4ALBA 1GFNA 4I3CA 3JTYA 3PORA 3SYSA 1A2DA 3S26A 4D64A 2BT9A 2O4VA 1LNMA 3CWKA 1FTPA 1IFBA 4Y0PA 4Y0RA 2NNEA 2KDYA 3IFBA 3EMMA 1ML7A 1SY0A 1ZHWA 4FOZA 4IB6A 4JCHA 2Q9SA 3WJBA 4KR4A 5B27A 5AJBA 4QYPA 1VPRA 4OS3A 4G75A 4LQZA 4LZVA 3TGCA 3PP6A 3BDRA 5H9KA 3HWEA 1P6PA 4BQUA 1ZNHA 4FZNA 2MNHA 1HQPA 7PRNA 1PMPA 2RCTA 4Z3TA 4FT6A 2YG2A 1TXLA 4YKMA 5H8TA 3UU2A 2N93A 2JMMA 4BUMX 2XMXA 1SXYA 2LA7A 4O4OA 4FBOA 4XMCA 4FRTA 3JS1A 4ZH9A 2CM4A 2G7BA 4ZGUA 4TJZA 1ZNGA 2QO5A 2FT9A 5KICA 4WFUA 1QY0A 1BRQA 3APWA 4PSQA 1YWDA 3POXA 3VY9X 3NBXX 1N0SA 5HCEC 5HA1A 2OVEA 4U8UO 1ALBA 2XTRA 3AA0B 2XE3A 4KCAA 4YCHA 2MWHA 4YFRA 4GNWA 4NP1A 4LSEA 2L68A 4DQ3A 1L6MA 1SXUA 3U03A 3KQ0A 3ZWEA 2AT6X 1LIBA 3SZDA 1JJXA 4QGXA 1AB0A 3AKMA 2JU8A 5LKFA 2RD7C 1QFVA 1I06A 4NYQA 2M06A 1DV9A 3POUA 4NLJA 4INNA 1DZPA 2Q4NA 1MUPA 1ERXA 2JN3A 3ZZVA 1HMTA 4OS0A 1ZHTA 1NGLA 3CQNA 3NX1A 3ZW0A 4E1TA 2MO5A 5CE4A 1MDCA 4R0BA 2ZFGA 2E4JA 4YDAA 5BVSA 2FLJA 5LJBA 1X71A 1DF3A 2JOZA 3B2LA 1OPBA 4HPCA 2HMBA 3KFHA 3BSZE 3VZWX 1G5WA 4NYRA 1E00A 4EXZA 1KT7A 1PM1X 1VYGA 1KQWA 1JIWI 2A13A 2ZLDA 1KT5A 2G79A 2GC9A 3C78X 1GX9A 1O8VA 3LHNA 5L8NA 2Y2XA 3ZW1A 3AAEA 3FEPA 4CV7A 4ZHGA 5F1EA 4XNLA 2JU3A 2GJ5A 3EYCA 3PPTA 5D4AA 3D4RA 3ZW0B 1KZXA 1GFQA 1OEKA 1Q9GA 4FZMA 2FR3A 5DL5A 2YMSA 2CM9A 1KT4A 2OZQA 3UPGA 1BH3A 1BEBA 4D6AA 5D8JA 5BVQA 2X46A 1SY2A 2R56A 4I95A 4FUVA 5ADXK 4FESA 1FE3A 1B8EA 3PECA 1MM5A 3FW5A 5HZ6A 1BSOA 1LF7A 4KR8A 2KXPA 3LK2A 3Q6LA 1YP7A 4QZUA 2RA6A 3SZVA 5IYUA 1X8QA 4AZPA 1PHOA 3APXA 5EPQA 1A57A 1IZNA 1LIEA 1RBPA 1TVQA 2FGQX 4FSOA 1UZ2X 1XCAA 1T8VA 2OVSA 3NQKA 3TZGA 1PBOA 3CQRA 2Z4IA 2ZAGA 4KC8A 5K06A 4GCQA 3L4RA 4ZCBA 1U17A 5AFUL 4O3ZA 4NNTA 4G76A 4LKPA 4GU8A 1RLBE 4I6SA 3VG3A 1QJPA 2F1VA 1U0XA 2OFMX 3NPOA 1QY1A 1SA8A 2ERVA 1NP4A 3EM0A 1E06A 3FYXA 4C69X 3FR2A 1CJ5A 3S5XA 3BU1A 3D97A 2EU7X 4ODDA 1OPFA 5B29A 2WSJA 5AJCA 3HWBA 1OPAA 3P02A 3AA7B 1KT6A 4GZVA 4YCEA 1OBPA 2AT0X 1U18A 4U8UM 4XMHA 2LFUA 2KZ7A 1T68X 1KQXA 5EEDA 3RKGA 1PRNA 1ZHZA 2GTLO 3MX7A 4ZH6A 1YWAA 1EPBA 4HPAA 1Y9LA 4U9CA 4PUXA 1AELA 3VG2A 3OJYC 3FLLA 1BSQA 3AAEB 4FZLA 2X8FA 1B4MA 3B2HA 3STNA 1DC9A 1E54A 1ORMA 1ZNDA 4GETA 2NNDA 3U0DA 4TLJA 1LIFA 1ICMA 2Y7SA 2XSTA 1YWCA 1LKEA 1Z24A 4KRAA 1I05A 3N91A 5F6ZA 4JFBA 4EEJA 1GKAB 5BVTA 5HZ5A 3AAAB 1G90A 5DG4A 2PORA 3EBKA 1S44A 5JDPA 3F8AA 2AT5X 4ZFXA 2AT3X 3HWGA 4HFOA 2Y0HA 3S60A 3JQOA 3PQSA 4N7CA 4AKRA 1QABE 1CBRA 3O22A 4Y0QA 4AKMA 4CSBA 2XG6A 1IZNB 1X8OA 1TW4A 3BY0A 3KVDD 3UEVA 3ELXA 2WWPA 1IW2A 3WJGA 4K19A 1A18A 5LJGA 4AZQA 3A2SX 3P6FA 5H9LA 2BS5A 3FA8A 4FBVA 4COTA 5FQ7E 2NNQA 3AA1B 5DL6A 2LBVA 3GAQA 3RWXA 2LHFA 2XE5A 4N58A 3VG5A 4AZMA 1ZNEA 4ZJ0A 4EFGA 2Z4HA 1BWYA 2MJIA 1KT3A 3P6EA 4O4UA 2GE4A 1Q9FA 1ERBA 4U3QA 3RSWA 2RN4A 3DSZA 2WQAE 2AL0X 3RBYA 5JR8A 3VG4A 2F1TA 4NW4A 3TGAA 5AEOA 1GXAA 5IO6A 4LSHA 2FS7A 5H9NA 3VZUX 3P6CA 4F4BA 1IKJA 2KT4B 1VYFA 1BJ7A 5HCDC 2J1NA 3BRNA 3WI4A 3UEWA 2HZQA 3STMX 1BT9A 4QYNA 1ZHXA 4ID2A 4GCPA 2HYSA 1BLRA 1D2UA 2ACOA 2A2UA 1EIIA 2Q2MA 4AYMC 4BVMA 5FAZA 1QY2A 4FSPA 5EDBA 1EQDA 3CMPA 1LICA 3FR4A 4GNYA 4ORYA 4O4XA 4YKOA 1O1VA 2JW1A 3HTYA 4XNKA 3DA3A 4HPBA 2FRSA 3NX2A 4AZRA 3ELZA 4OMWA 2P8GA 4XMDA 5PRNA 1EW3A 3FELA 1UREA 4YFQA 5AQ6A 1BXWA 3NP1A 5HTDA 3E3CA 1BBPA 4MIRA 2XKLA 1CRBA 3O19A 2K4TA 1HXUA 2L9CA 4ALOA 2F73A 1EXSA 2W2BA 5D45A 1QG5A 3F9DA 5FQ8E 4A1YA 4FMSA 4RUUA 2LFOA 4AKRB 3PH6A 3O0EA 2XE2A 3K19A 4ZHDA 3OBLA 1GT5A 1GT4A 1DZMA 2CZTA 2WEXA 1BRPA 2Y0KA 4I3DA 3FYFA 3KFFA 2KTSA 2QO6A 3QKGA 3P6DA 4ZGFA 3BU9A 3HWDA 3VZTX 5CYBA 3FR5A 3U9PC 4M7MA 5T5FA 4AFKA 1AVGI 2LKKA 1IKEA 3WJDA 4IMNA 2MHLA 5L8IA 2XTQA 1SXXA 1AQBA 4AYDC 4IAXA 4OMXA 4EQAC 5ADXL 4WFVA 5GV0A 1EI5A 1OEJA 5BYPA 3T0SA 4E1SA 1E5PA 1B56A 1MVGA 4O9SA 1NP1A 4MVLA 3DTQA 1HBPA 1JZUA 4NNSA 1X8PA 5H9AA 4ORWA 1LFOA 1OBUA 1QFTA 4AYID 3T20A 1BSYA 4RUNA 3POQA 1S7DA 2HLVA 2ASNX 2W2FA 1ADLA 4GDZA 4MVIA 4YDBA 2HZRA 4YGHA 4D6BA 4KC7A 1FENA 1X8NA 5F58A 1EIOA 3UEXA 5D5DA 3WI5A 5EE2A 1Y9TA 1H91A 3C76X 3HOLA 3TZSA 1I04A 3IA8A 1FEMA 2FS6A 4GCSA 2PY1A 3CR6A 3PQUA 4YBUA 1JV4A 1QWDA 5F7GA 4TKJA 3S5VA 3WXQA 2KTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYE C;  4QQ1 A;  4O49 A;  4O3Z A;  3KVD D;  3HOE A;  2YPV A;  4U9C A;  4Z3T A;  1YS5 A;  4AYM C;  4O3Y A;  4AYI D;  3V8U A;  2W80 C;  4O4X A;  2Y7S A;  3UAQ A;  4O4U A;  3VE1 A;  4O3W A;  2W81 C;  5T5F A;  2KDY A;  5EE2 A;  4O3X B;  3HOL A;  2LFU A;  4AYN A;  3PQU A;  2KC0 A;  3PQS A;  4AYD C;  3VE2 A; 
#chains in the Genus database with same CATH topology
 1Y0G A;  1HQQ A;  5G26 A;  4MEE A;  2ACP X;  2RTD B;  1OBQ A;  2A3F X;  3ZW1 B;  2OVA A;  1GFO A;  1GX8 A;  1DFV A;  2OF8 A;  1HMR A;  1EAL A;  4ORS A;  4IBA A;  4O4S A;  1CBQ A;  4RJW A;  2R8A A;  3AA6 A;  2AMM X;  2RTR B;  2KD2 A;  4ML7 B;  3SY7 A;  4U8U N;  3SAO A;  2OMF A;  1W4T A;  1VWH B;  5B10 O;  1GGL A;  3KFG A;  1VWF B;  1SRJ A;  2FGS A;  2R4L A;  4OEL A;  2HKD A;  4N7D A;  4C4V A;  2YNK A;  3EW1 A;  2R73 A;  3PH5 A;  4JGL A;  4I3B A;  2QO4 A;  3RDU A;  4I9R A;  3FA7 A;  5B2A O;  2X34 A;  4FBR A;  2AKQ A;  4GJS A;  3D96 A;  3DA4 A;  2WQ9 A;  4GGR A;  3OE3 A;  4CPH B;  4IMO A;  3B2J A;  5EZ2 A;  1OSP O;  3VGW A;  2R88 A;  4FQB B;  5IO5 A;  5FFH A;  3PGU A;  2A2G A;  2N2L A;  2OL8 O;  3A0H O;  1QQS A;  4O3X B;  3EBW A;  2R4N A;  4OKA A;  3ZUI A;  3AA7 A;  3V8U A;  4I60 A;  3GE2 A;  1SMP I;  2C1S A;  2IZL B;  1A3Y A;  3WJC A;  1G7N A;  2MM3 A;  1GKA A;  3AAA A;  2QMI A;  2IWV A;  5AFU K;  1VWJ B;  3VE1 A;  2IZG B;  4L3R A;  3LK3 B;  3I0A A;  2QM9 A;  3WVM A;  3RBH A;  4TNN A;  4QZT A;  4YH0 A;  2RQ0 A;  5D47 A;  2GTF X;  4QQ1 A;  4TKH A;  1SRH A;  4ZHF A;  1SWL A;  1CBI A;  2OY1 O;  1SY3 A;  1B0O A;  4CK4 A;  3FW4 A;  4IB7 A;  3C5O A;  4Z2O A;  3GP6 A;  1G85 A;  4LSF A;  2X9K A;  2JU7 A;  5HBS A;  1STP A;  5HZQ A;  2X45 A;  3FMZ A;  1S5L O;  1O1U A;  1E02 A;  4YMY A;  1GFN A;  5IRW A;  1A2D A;  2O4V A;  1HXZ A;  4FOZ A;  1MEP A;  4KR4 A;  3WJB A;  3TGC A;  3PP6 A;  5H9K A;  1P6P A;  1VWQ B;  1VWA B;  7PRN A;  1PBY A;  4FT6 A;  1TXL A;  5H8T A;  2N93 A;  2XMX A;  1W6F A;  4FBO A;  2G7B A;  4ZGU A;  4TJZ A;  1QY0 A;  2A8G A;  3POX A;  1SWG A;  2OVE A;  2UZ2 A;  2XTR A;  2XE3 A;  4KCA A;  3RY2 A;  4LSE A;  3KQ0 A;  4GD9 A;  2FHN X;  1AB0 A;  3VHM A;  2JU8 A;  1QFV A;  4NLJ A;  4INN A;  1MUP A;  3D9W A;  2IZE B;  1AVD A;  1ZHT A;  1NGL A;  5CE4 A;  4R0B A;  2FLJ A;  1X71 A;  1DF3 A;  2PI3 O;  4HPC A;  2HMB A;  4NYR A;  4EXZ A;  3JCU O;  1KQW A;  4BCS A;  5L8N A;  1JQP A;  1O8V A;  3LHN A;  4XNL A;  2GJ5 A;  3PPT A;  1JMX A;  1Q9G A;  1OEK A;  2FR3 A;  2I5Z O;  4C4V B;  5D8J A;  2X46 A;  2R56 A;  2I5V O;  1BSO A;  1LF7 A;  5EPQ A;  1A57 A;  1IZN A;  1LIE A;  1TVQ A;  1XCA A;  2Z4I A;  4NNT A;  4G76 A;  1RLB E;  3VG3 A;  1QJP A;  2OFM X;  2ERV A;  3QQ2 A;  3EM0 A;  3FR2 A;  1CJ5 A;  3D97 A;  5AJC A;  3AA7 B;  1SWH A;  4U8U M;  4XMH A;  2LFU A;  5EED A;  1KQX A;  5E79 O;  1N9Y A;  2GTL O;  1ZHZ A;  5B5G A;  4HPA A;  1AEL A;  3FLL A;  1SRG A;  2X8F A;  2VFB A;  1SWB A;  1E54 A;  1ICM A;  1YWC A;  4KRA A;  1I05 A;  4JFB A;  1GKA B;  5BVT A;  3AAA B;  1G90 A;  1VWP B;  2AT5 X;  2Y0H A;  4HFO A;  4BJ8 A;  1SWD A;  1QAB E;  4Y0Q A;  1HXL A;  3BY0 A;  1TW4 A;  2WWP A;  3WJG A;  1N7Y A;  4FBV A;  3RDX A;  2OY7 A;  2LBV A;  3T2X A;  2LHF A;  4AZM A;  4EFG A;  3X00 A;  4O4U A;  2IZB A;  1Q9F A;  4U3Q A;  2RN4 A;  2KT4 B;  2HZQ A;  1ZHX A;  2HYS A;  2Q2M A;  4FSP A;  5EDB A;  1EQD A;  4ORY A;  4AZR A;  3ELZ A;  4OMW A;  2P8G A;  1EW3 A;  3NP1 A;  5HTD A;  1BBP A;  1WUB A;  1CRB A;  1SLD B;  2F73 A;  1EXS A;  5D45 A;  1QG5 A;  1SWN A;  3F9D A;  1SWK A;  5FQ8 E;  4A1Y A;  2ZSC A;  4AKR B;  2G8C O;  2XE2 A;  1GT5 A;  2IWW A;  3FYF A;  4CPI A;  4ZGF A;  1VWE B;  3U9P C;  5T5F A;  4IMN A;  5L8I A;  3WU2 O;  1SXX A;  1EI5 A;  4O9S A;  1HBP A;  4RUN A;  2HLV A;  2ASN X;  2W2F A;  1ADL A;  4GJV A;  5F58 A;  3HOL A;  1H91 A;  1JV4 A;  4TKJ A;  2KTD A;  4YGG A;  2RTE B;  3PF1 A;  4CPF A;  5HAE A;  2Y32 A;  3KFI A;  4KII A;  4A8Z A;  2RCQ A;  3MBT A;  2CBR A;  3BS2 A;  3B2K A;  3G7G A;  3QRC A;  2Q39 A;  1VWR B;  4IB9 A;  2IZI A;  4GH7 A;  5FEN A;  5GTH O;  3FA6 A;  2DM5 A;  4ZHH A;  2L5P A;  1S2P A;  2WR6 A;  2RTF B;  2ANS A;  1GT3 A;  4GGZ A;  1OEE A;  1TOW A;  1RXJ A;  1SY1 A;  3PGS A;  2PRN A;  2OYB O;  2FWV A;  2OFA A;  2W81 C;  1SRF A;  3F6Z B;  1VWD B;  4GHB A;  2R89 A;  2ALL X;  3P6H A;  1VWC B;  4RL9 A;  4CTD A;  1SLE B;  1HBQ A;  1VWK B;  4EDE A;  3PED A;  2LBA A;  4WBK A;  4IAB A;  3LK3 A;  4IB8 A;  5DL7 A;  3UEU A;  4ORX A;  1AVE A;  3VU1 A;  1YWB A;  2FR2 A;  4I9S A;  2X27 X;  2L67 A;  3NSG A;  1EUO A;  1ZHY A;  2K62 A;  3NQ3 A;  3SOT A;  4NLI A;  3WBG A;  3UAQ A;  1KXO A;  4UU2 A;  4D65 A;  2M4L A;  2MHD A;  3FIQ A;  5IO7 A;  1OSM A;  4Y0S A;  1E2T A;  4XMG A;  4AYN A;  2QOS C;  4UB6 O;  1SRE A;  4PJ0 O;  5B66 O;  3BX8 A;  3APV A;  3PGR A;  2FGR A;  4K3B A;  1FEL A;  2J4U P;  2GTL N;  2BLG A;  4HPD A;  1JYJ A;  2CAM A;  1KL3 A;  2N2M A;  2BC3 A;  4BOE A;  2AH7 X;  1LPJ A;  4GUZ A;  4AZL A;  3LV4 A;  1EPA A;  1DZK A;  4GRJ A;  3WYP A;  1KFF A;  1MPF A;  5L8O A;  3ZW2 A;  5LJK A;  4NV8 A;  1YP6 A;  4ZHC A;  3HW9 A;  4XMF A;  1SWP A;  1KGL A;  2OL6 O;  3G7X A;  2RTN B;  3TF6 A;  4CDF A;  1JBH A;  1JYD A;  1IIU A;  1YIV A;  1ICN A;  4O49 A;  3VG6 A;  1YUP A;  3HWF A;  1HXX A;  2K0L A;  3JTY A;  3POR A;  4I3C A;  3SYS A;  3CWK A;  1FTP A;  4Y0R A;  4EKV A;  2KDY A;  3EC5 A;  1ZHW A;  4JCH A;  5AJB A;  4QYP A;  4G75 A;  4LQZ A;  4LZV A;  2R4O A;  3BDR A;  1VYO A;  2RCT A;  4YKM A;  2JMM A;  4BUM X;  4B55 A;  5KIC A;  1BRQ A;  4K3C A;  5HCE C;  5HA1 A;  1ALB A;  4GNW A;  1L6M A;  3SZD A;  1LIB A;  4N74 A;  5LKF A;  2RD7 C;  2M06 A;  3POU A;  2Q4N A;  1ERX A;  3ZZV A;  1HMT A;  1SRI A;  1MDC A;  3RDQ A;  3A0B O;  5LJB A;  3B2L A;  1G5W A;  1E00 A;  2A13 A;  1JIW I;  2ZLD A;  1KT5 A;  2G79 A;  1GX9 A;  4CV7 A;  4ZHG A;  5D4A A;  1I78 A;  1KZX A;  4FZM A;  5DL5 A;  4IL6 O;  3UPG A;  4D6A A;  1SY2 A;  4FUV A;  5ADX K;  4Z27 A;  3PEC A;  3SLT A;  1LCZ A;  3LK2 A;  1K3B A;  2QCB A;  5IYU A;  1X8Q A;  1RBP A;  3NQK A;  3TZG A;  3CQR A;  2ZAG A;  4U46 A;  5K06 A;  4GCQ A;  3L4R A;  4O3Z A;  5B5E O;  3NPO A;  1E06 A;  3FYX A;  2R4P A;  5B29 A;  5H2F O;  3P02 A;  4GZV A;  1FJ1 E;  1PRN A;  4Z2P A;  1Y9L A;  4PUX A;  3VG2 A;  5B5F A;  3AAE B;  2RTQ B;  4FZL A;  1B4M A;  3BS0 A;  2Y7S A;  2XST A;  3N91 A;  5F6Z A;  5HZ5 A;  1GX3 A;  3EBK A;  3HWG A;  3JQO A;  4AKR A;  3O22 A;  4GGT A;  1X8O A;  3UEV A;  1A18 A;  3A2S X;  3T6L A;  5H9L A;  3FA8 A;  1SWE A;  2OY5 O;  3GAQ A;  3RWX A;  3VG5 A;  4ZJ0 A;  1BWY A;  2MJI A;  1KT3 A;  1ERB A;  3DSZ A;  2WQA E;  2WVP A;  1STR B;  3VG4 A;  5H9N A;  3P6C A;  1IKJ A;  2J1N A;  5HCD C;  1SWR A;  1SWU A;  3UEW A;  3RE5 A;  2OL7 A;  2A2U A;  4AYM C;  5FAZ A;  3CMP A;  1LIC A;  3WZP A;  5AQ6 A;  1BXW A;  1URE A;  4YFQ A;  2X56 A;  1SLG B;  2RTC B;  1KL4 A;  1UYN X;  4MIR A;  2XKL A;  2K4T A;  1HXU A;  2L9C A;  4Z6J A;  3PDF A;  4I3D A;  3KFF A;  3QKG A;  2LKK A;  1IKE A;  1AQB A;  4EQA C;  4IRW A;  5GV0 A;  5BYP A;  3T0S A;  4E1S A;  1MVG A;  1NP1 A;  4MVL A;  4NNS A;  1X8P A;  4ORW A;  1BSY A;  1UYO X;  4YGH A;  5KAI O;  4KC7 A;  1X8N A;  3UEX A;  3WI5 A;  3TZS A;  2PY1 A;  3WXQ A;  4MIS A;  1P4T A;  3S5V A;  1HY2 A;  1T0V A;  2G78 A;  2BHV A;  2RTJ A;  1MM4 A;  2W80 C;  2WPU A;  4BX6 A;  5LJE A;  2R74 A;  4TKB A;  3LK2 B;  3T24 A;  5LJC A;  5LJH A;  3LK4 1;  4PR7 A;  4YFP A;  2A5B A;  4MVK A;  3ZUO A;  1MM9 A;  3WJF A;  1R0U A;  3FEK A;  1X89 A;  3VG7 A;  3D95 A;  3T2W A;  2X4M A;  4L1N A;  5KHP A;  1IJ8 A;  4GF4 A;  1GM6 A;  4JO6 A;  2RTB B;  3RDO A;  3MM0 A;  4NV7 A;  2X8T A;  3JSQ A;  1SWF A;  3WOV A;  4A1H A;  3STK A;  1RXK A;  5HZ9 A;  1DZJ A;  4ZR2 A;  2FTB A;  4AFK A;  4ES7 A;  3HOE A;  2LB6 A;  3TGB A;  3P24 A;  5DL8 A;  4A60 A;  4CDE A;  3WJE A;  4M6S A;  1H6S 1;  4QNI A;  3DZM A;  3I17 A;  1BM5 A;  1T1L A;  1THQ A;  4Y5D A;  4D5U A;  2AT8 X;  1N43 A;  3WZN A;  5HA0 A;  4AZO A;  3APU A;  1HMS A;  4JNJ A;  3EMN X;  1JJJ A;  2X8S A;  3VE2 A;  1QJ8 A;  4FRX A;  2IFB A;  4HWM A;  2IZC B;  1NQM A;  1WBI A;  1GFP A;  1PEE A;  5EDC A;  4TQ2 A;  2KW1 A;  2XE1 A;  1HN2 A;  3O2Y A;  4BBO A;  4ORR A;  3SZJ A;  5D48 A;  4QRL A;  1PTS A;  4O3W A;  1GT1 A;  2WEW A;  3NR3 A;  4AYE C;  3AA1 A;  4GKC A;  4YBP A;  2CBS A;  2BS6 A;  1D3S A;  2OF9 A;  2Q2P A;  3ZQ3 A;  4BX5 A;  4KT5 A;  3AKN A;  3QRA A;  1KL5 A;  2CZU A;  6PRN A;  4ARH A;  1N9M A;  4WHI A;  3B2I A;  3NJT A;  2QTK A;  3CBS A;  4QAE A;  2F09 A;  2YPV A;  3FDC A;  2IZK A;  1KOI A;  4O3Y A;  5HCC C;  4MVE A;  5FQ6 E;  4ALB A;  5K68 A;  3S26 A;  4D64 A;  2BT9 A;  1LNM A;  4CDD A;  2C1Q A;  2GH7 A;  3IFB A;  1ML7 A;  2Q9S A;  5B27 A;  1VPR A;  4OS3 A;  3HWE A;  1ZNH A;  4Z3T A;  2YG2 A;  1SXY A;  4O4O A;  4XMC A;  4FRT A;  3JS1 A;  4ZH9 A;  2RTO B;  1ZNG A;  2OFB A;  3APW A;  1YWD A;  1N0S A;  3AA0 B;  4BX6 B;  2QOM A;  4YFR A;  3U03 A;  2AT6 X;  2BSZ A;  3AKM A;  1I06 A;  1DV9 A;  1DZP A;  2JN3 A;  4OS0 A;  3CQN A;  1RSU B;  3ZW0 A;  4E1T A;  2ZFG A;  4YDA A;  3KFH A;  3VZW X;  3C78 X;  3AAE A;  5F1E A;  1SWT A;  3EYC A;  2RTL A;  3D4R A;  2CM9 A;  1KT4 A;  1BH3 A;  1BEB A;  1B8E A;  4KR8 A;  2KXP A;  4QZU A;  1NC9 A;  1PHO A;  4FSO A;  1UZ2 X;  4Y59 A;  1PBO A;  4ZCB A;  5AFU L;  1Y53 X;  4C00 A;  1SWA A;  2F1V A;  1U0X A;  3VHH A;  3CKG A;  3BU1 A;  2EU7 X;  2IZF B;  1OPA A;  1VWL B;  1K24 A;  4YCE A;  1OBP A;  1U18 A;  2KZ7 A;  1T68 X;  4ZH6 A;  1EPB A;  3OJY C;  5IRU A;  1VWM B;  3B2H A;  3STN A;  1DC9 A;  1ZND A;  3U0D A;  2NND A;  1LIF A;  1Z24 A;  1LDO A;  4EEJ A;  1Y52 X;  5DG4 A;  3RDS A;  3F8A A;  2AT3 X;  4N7C A;  5IXG A;  4AKM A;  4CSB A;  1LCW A;  1IW2 A;  5LJG A;  3AUM O;  4AZQ A;  3P6F A;  2BS5 A;  5FQ7 E;  3AA1 B;  3WYQ A;  5DL6 A;  4N75 A;  2XE5 A;  4N58 A;  3P6E A;  4Z28 A;  3RSW A;  3CKF A;  3RBY A;  2AL0 X;  5JR8 A;  2F1C X;  3TGA A;  5AEO A;  5IO6 A;  1GXA A;  4BX5 B;  4LSH A;  2FS7 A;  3VZU X;  2AF5 A;  4F4B A;  1BJ7 A;  4QYN A;  4GCP A;  4GNY A;  1LCV A;  4O4X A;  1O1V A;  3HTY A;  4XNK A;  1JMZ A;  2FRS A;  2Y3E A;  2VFC A;  4XMD A;  3O19 A;  1T16 A;  4ALO A;  2W2B A;  3PH6 A;  4ZHD A;  2X32 A;  1BRP A;  5K67 A;  2QO6 A;  3P6D A;  5G3A A;  3VZT X;  5CYB A;  4M7M A;  4GDA A;  4OEM A;  2MHL A;  3HPE A;  2FHL A;  4OMX A;  2AXT O;  4WFV A;  2JQY A;  3FID A;  1OEJ A;  2G5L A;  1E5P A;  1B56 A;  5H9A A;  1LFO A;  3T20 A;  1QFT A;  4AYI D;  1S7D A;  4YDB A;  2HZR A;  4D6B A;  5D5D A;  5EE2 A;  1Y9T A;  1I04 A;  2FS6 A;  4YBU A;  5HWZ A;  3ZW0 B;  1QWD A;  2UYW A;  1ZNK A;  3SY9 A;  5CSE A;  1X8U A;  3OD9 A;  4YGZ A;  3PRN A;  3C77 X;  2POA A;  2K23 A;  4FGI B;  1NBX A;  5F2B A;  3Q34 A;  1MX8 A;  3BLG A;  4JHQ A;  3H3I A;  1Y55 X;  4AUI A;  2WUT A;  1I4U A;  2KXP B;  4N59 A;  5LJD A;  4IAW A;  1HXT A;  4DQ4 A;  2Y0L A;  1MX7 A;  4ON1 A;  4QGV A;  2C4I A;  2FKG A;  2ZAI A;  3NAD A;  3LTW A;  1GFM A;  4LZU A;  5DPQ A;  1SXW A;  1VWB B;  2X55 A;  3RE6 A;  1RST B;  4AZN A;  2IZA A;  2M07 A;  2NP1 A;  1IFC A;  4RLC A;  2KZ7 B;  4QGW A;  3NQ9 A;  1XKI A;  5B11 O;  1FDQ A;  4CPE A;  1MOY A;  3DWN A;  3VY8 X;  2OFR X;  2W2A A;  1ZRY A;  3KZA A;  5FVN A;  2GTL M;  3MG5 A;  1YS5 A;  1VWG B;  1W5R A;  3AA6 B;  5C0N A;  3PK2 A;  4OS8 A;  2RTI B;  3BX7 A;  4RLB A;  2RTH B;  4ORU A;  3HK1 A;  4RJX A;  4XME A;  3KVN A;  5F6B A;  1TOU A;  3AEH A;  1RXH A;  3P6G A;  2IZH B;  2JMB A;  5G39 A;  4PJ2 A;  8PRN A;  2O62 A;  1QJ9 A;  1SWO A;  1ZNL A;  4B61 A;  1CBS A;  3FEN A;  5LKE A;  2KC0 A;  2Y3F A;  4AW8 A;  4UU3 A;  4GE1 A;  3T1D A;  1VWI B;  4LKT A;  2WJQ A;  5EEE A;  3FA9 A;  3K3L A;  3VPJ E;  2ODJ A;  2RTP B;  4AYH A;  1KZW A;  3AA0 A;  5HTE A;  4FQE A;  3ZI8 A;  3KZI O;  5KID A;  2HNX A;  1LID A;  3CBC A;  2OVD A;  3RZY A;  1NQN A;  1LUQ A;  4KH8 A;  3SYB A;  3WZO A;  5HZ8 A;  1G74 A;  3SLO A;  3MVF A;  2WJR A;  3LK4 2;  2A0A A;  1ACD A;  4LSI A;  4GK9 A;  5GTI O;  1MK5 A;  1IFB A;  4Y0P A;  2JGS A;  2NNE A;  3EMM A;  1SY0 A;  4IB6 A;  3EW2 A;  4BX7 A;  1JJU A;  3BRZ A;  4BQU A;  4FZN A;  2MNH A;  5L3Y A;  1HQP A;  3DWO X;  1PMP A;  3UU2 A;  2LA7 A;  2CM4 A;  1NDJ A;  2QO5 A;  2FT9 A;  4WFU A;  4PSQ A;  3VY9 X;  3NBX X;  3BRY A;  4U8U O;  2RTA A;  4YCH A;  2MWH A;  4NP1 A;  2L68 A;  4DQ3 A;  1SXU A;  3ZWE A;  1JJX A;  4QGX A;  4NYQ A;  1STS B;  3RY1 A;  3NX1 A;  2MO5 A;  2E4J A;  1VWO B;  5BVS A;  2JOZ A;  5TIS O;  1OPB A;  2RTG B;  3BSZ E;  1KT7 A;  1PM1 X;  1VYG A;  5G38 A;  1SWS A;  2GC9 A;  2Y2X A;  3ZW1 A;  3FEP A;  2JU3 A;  1GFQ A;  4Z2V A;  2YMS A;  2AVI A;  2OZQ A;  2IZD B;  5BVQ A;  4I95 A;  4FES A;  1FE3 A;  1MM5 A;  3FW5 A;  5HZ6 A;  1SWQ A;  5KAF O;  3Q6L A;  1YP7 A;  2RA6 A;  3SZV A;  4AZP A;  3APX A;  2FGQ X;  1T8V A;  2OVS A;  4KC8 A;  1U17 A;  4LKP A;  4GU8 A;  4I6S A;  2MF6 A;  1QY1 A;  1SA8 A;  1NP4 A;  1SLF B;  3VHI A;  4C69 X;  3S5X A;  4ODD A;  1OPF A;  2WSJ A;  3HWB A;  1KT6 A;  2AT0 X;  3RKG A;  3MX7 A;  2FKJ A;  1YWA A;  4U9C A;  1RAV A;  1BSQ A;  4CPH A;  1ORM A;  4GET A;  4TLJ A;  3RDM A;  1LKE A;  1SWC A;  2OY8 A;  2POR A;  2DJG A;  1S44 A;  5JDP A;  4YVB A;  4ZFX A;  3S60 A;  3PQS A;  1CBR A;  2XG6 A;  1IZN B;  3KVD D;  3ELX A;  4K19 A;  4CDC A;  4COT A;  2VDF A;  2NNQ A;  1ZNE A;  2Z4H A;  2GE4 A;  5IRA A;  4BGF A;  4DNE A;  2F1T A;  3T6F A;  4NW4 A;  5CHK A;  1N4J A;  1VYF A;  3BRN A;  4UB8 O;  3WI4 A;  3SZI A;  3STM X;  1BT9 A;  4ID2 A;  1BLR A;  1SWJ A;  1D2U A;  2ACO A;  3SLJ A;  1EII A;  4BVM A;  1QY2 A;  3FR4 A;  1I9H A;  2F01 A;  2JW1 A;  4YKO A;  3DA3 A;  4HPB A;  3NX2 A;  5PRN A;  1LDQ A;  3FEL A;  3E3C A;  2RTM A;  2DJF A;  4FMS A;  4RUU A;  2LFO A;  3O0E A;  3K19 A;  3OBL A;  1LEL A;  1GT4 A;  1DZM A;  2CZT A;  2WEX A;  4BX7 B;  2Y0K A;  2KTS A;  2IZJ A;  4DCB A;  1DF8 A;  3BU9 A;  3HWD A;  3FR5 A;  1VWN B;  1AVG I;  3WZQ A;  3WJD A;  2A5C A;  2XTQ A;  4AYD C;  4IAX A;  5ADX L;  5B3M O;  3SZH A;  3DTQ A;  1JZU A;  1OBU A;  3POQ A;  4GDZ A;  4MVI A;  2RTK A;  1FEN A;  1EIO A;  3C76 X;  5JD2 A;  4C5P A;  3IA8 A;  1FEM A;  4GCS A;  3CR6 A;  3PQU A;  5F7G A; 
#chains in the Genus database with same CATH homology
 4YGG A;  5HAE A;  5G26 A;  3KFI A;  1ZNK A;  3SY9 A;  1T0V A;  4KII A;  4A8Z A;  2RCQ A;  2G78 A;  3MBT A;  2ACP X;  1X8U A;  2CBR A;  3OD9 A;  3BS2 A;  4YGZ A;  3PRN A;  2BHV A;  3C77 X;  2POA A;  1OBQ A;  2A3F X;  3B2K A;  3ZW1 B;  2K23 A;  4FGI B;  1MM4 A;  3G7G A;  3QRC A;  2Q39 A;  2W80 C;  2OVA A;  4IB9 A;  1GFO A;  4GH7 A;  5FEN A;  1GX8 A;  5LJE A;  1DFV A;  1MX8 A;  2R74 A;  3BLG A;  3H3I A;  1HMR A;  3FA6 A;  2DM5 A;  4AUI A;  1EAL A;  4ZHH A;  2L5P A;  4TKB A;  1S2P A;  4ORS A;  4IBA A;  4O4S A;  2WUT A;  1CBQ A;  1I4U A;  2WR6 A;  2KXP B;  3LK2 B;  2ANS A;  4N59 A;  4RJW A;  5LJC A;  3AA6 A;  2AMM X;  3T24 A;  2KD2 A;  4ML7 B;  5LJD A;  5LJH A;  3LK4 1;  3SY7 A;  4U8U N;  4YFP A;  1GT3 A;  4IAW A;  4MVK A;  1HXT A;  1OEE A;  1TOW A;  3ZUO A;  4DQ4 A;  3SAO A;  1SY1 A;  1MX7 A;  2OMF A;  2Y0L A;  4ON1 A;  4QGV A;  2PRN A;  2FWV A;  2ZAI A;  1GGL A;  3KFG A;  3NAD A;  3WJF A;  1R0U A;  3FEK A;  1X89 A;  3VG7 A;  3D95 A;  2W81 C;  1GFM A;  4LZU A;  5DPQ A;  3F6Z B;  4GHB A;  4L1N A;  4N7D A;  1SXW A;  2ALL X;  5KHP A;  3P6H A;  2YNK A;  2R73 A;  3PH5 A;  4JGL A;  4RL9 A;  4AZN A;  4GF4 A;  4I3B A;  2M07 A;  2QO4 A;  1HBQ A;  1GM6 A;  2NP1 A;  1IFC A;  3PED A;  4I9R A;  4EDE A;  2KZ7 B;  4RLC A;  3FA7 A;  2LBA A;  4WBK A;  4FBR A;  2AKQ A;  3D96 A;  3DA4 A;  4IAB A;  2X8T A;  4QGW A;  3LK3 A;  3JSQ A;  4IB8 A;  5DL7 A;  2WQ9 A;  3NQ9 A;  1XKI A;  3OE3 A;  1FDQ A;  4IMO A;  3B2J A;  5EZ2 A;  4MIS A;  3VY8 X;  3UEU A;  2OFR X;  4FQB B;  5IO5 A;  5FFH A;  3WOV A;  4ORX A;  2A2G A;  2W2A A;  1P4T A;  2N2L A;  1ZRY A;  1QQS A;  4A1H A;  4O3X B;  3KZA A;  3EBW A;  3STK A;  5HZ9 A;  5FVN A;  1DZJ A;  3VU1 A;  2GTL M;  4ZR2 A;  1YWB A;  2FTB A;  2FR2 A;  4I9S A;  2L67 A;  4ES7 A;  1EUO A;  3HOE A;  1ZHY A;  2X27 X;  3NSG A;  2LB6 A;  3TGB A;  3P24 A;  1YS5 A;  2K62 A;  5DL8 A;  3NQ3 A;  4A60 A;  3AA6 B;  3WJE A;  3ZUI A;  5C0N A;  4M6S A;  1H6S 1;  3AA7 A;  3SOT A;  4QNI A;  3V8U A;  4OS8 A;  4NLI A;  3WBG A;  3I17 A;  1BM5 A;  1THQ A;  3GE2 A;  1SMP I;  2AT8 X;  4D5U A;  3UAQ A;  5HA0 A;  1KXO A;  3BX7 A;  4UU2 A;  4D65 A;  2M4L A;  4RLB A;  4AZO A;  1A3Y A;  2MHD A;  3APU A;  3FIQ A;  4ORU A;  5IO7 A;  3HK1 A;  1OSM A;  1HMS A;  4Y0S A;  3WJC A;  4XMG A;  4AYN A;  1G7N A;  3EMN X;  4RJX A;  2QOS C;  2X8S A;  1JJJ A;  4XME A;  3VE2 A;  1QJ8 A;  4FRX A;  2IFB A;  3BX8 A;  3APV A;  4HWM A;  5F6B A;  2FGR A;  1GFP A;  1PEE A;  1TOU A;  5EDC A;  1FEL A;  4TQ2 A;  2J4U P;  2MM3 A;  3P6G A;  2GTL N;  2KW1 A;  2BLG A;  1GKA A;  2JMB A;  2XE1 A;  3AAA A;  1HN2 A;  4HPD A;  3O2Y A;  1JYJ A;  4PJ2 A;  2QMI A;  8PRN A;  2O62 A;  4ORR A;  2N2M A;  4BOE A;  5AFU K;  5D48 A;  2AH7 X;  1LPJ A;  3VE1 A;  4QRL A;  4O3W A;  1QJ9 A;  4AZL A;  3LV4 A;  1EPA A;  1DZK A;  4GRJ A;  1GT1 A;  1ZNL A;  2WEW A;  4L3R A;  3LK3 B;  4B61 A;  3I0A A;  2QM9 A;  3WVM A;  3NR3 A;  1CBS A;  3FEN A;  4TNN A;  4QZT A;  4YH0 A;  5LKE A;  2RQ0 A;  3RBH A;  2KC0 A;  5D47 A;  4AW8 A;  2GTF X;  4QQ1 A;  4TKH A;  4AYE C;  3AA1 A;  4GKC A;  4UU3 A;  1MPF A;  4YBP A;  4GE1 A;  4ZHF A;  5L8O A;  1CBI A;  3T1D A;  2CBS A;  3ZW2 A;  5HWZ A;  1SY3 A;  5LJK A;  1YP6 A;  4LKT A;  2BS6 A;  4ZHC A;  3HW9 A;  5EEE A;  1B0O A;  1D3S A;  4XMF A;  4CK4 A;  2Q2P A;  3FA9 A;  3K3L A;  3ZQ3 A;  3VPJ E;  2ODJ A;  4AYH A;  1KZW A;  3FW4 A;  4IB7 A;  1KGL A;  3AA0 A;  5HTE A;  3C5O A;  3G7X A;  4KT5 A;  3AKN A;  3GP6 A;  3TF6 A;  3ZI8 A;  3QRA A;  1G85 A;  2CZU A;  4LSF A;  5KID A;  6PRN A;  4ARH A;  2HNX A;  4WHI A;  1LID A;  3B2I A;  1JBH A;  1JYD A;  2QTK A;  2JU7 A;  3CBC A;  1IIU A;  1YIV A;  3CBS A;  5HBS A;  2OVD A;  3RZY A;  1ICN A;  4QAE A;  4O49 A;  2X45 A;  1YUP A;  2F09 A;  3FMZ A;  4KH8 A;  5HZQ A;  3HWF A;  3VG6 A;  2YPV A;  5HZ8 A;  3SYB A;  1G74 A;  3MVF A;  3LK4 2;  2A0A A;  1HXX A;  1ACD A;  4LSI A;  1KOI A;  1O1U A;  4O3Y A;  1E02 A;  4MVE A;  5HCC C;  2K0L A;  5FQ6 E;  4YMY A;  4GK9 A;  4ALB A;  1GFN A;  4I3C A;  3JTY A;  3POR A;  3SYS A;  1A2D A;  3S26 A;  4D64 A;  2BT9 A;  2O4V A;  1LNM A;  3CWK A;  1FTP A;  1IFB A;  4Y0P A;  4Y0R A;  2NNE A;  2KDY A;  3IFB A;  3EMM A;  1ML7 A;  1SY0 A;  1ZHW A;  4FOZ A;  4IB6 A;  4JCH A;  2Q9S A;  3WJB A;  4KR4 A;  5B27 A;  5AJB A;  4QYP A;  1VPR A;  4OS3 A;  4G75 A;  4LQZ A;  4LZV A;  3TGC A;  3PP6 A;  3BDR A;  5H9K A;  3HWE A;  1P6P A;  4BQU A;  1ZNH A;  4FZN A;  2MNH A;  1HQP A;  7PRN A;  1PMP A;  2RCT A;  4Z3T A;  4FT6 A;  2YG2 A;  1TXL A;  4YKM A;  5H8T A;  3UU2 A;  2N93 A;  2JMM A;  4BUM X;  2XMX A;  1SXY A;  2LA7 A;  4O4O A;  4FBO A;  4XMC A;  4FRT A;  3JS1 A;  4ZH9 A;  2CM4 A;  2G7B A;  4ZGU A;  4TJZ A;  1ZNG A;  2QO5 A;  2FT9 A;  5KIC A;  4WFU A;  1QY0 A;  1BRQ A;  3APW A;  4PSQ A;  1YWD A;  3POX A;  3VY9 X;  3NBX X;  1N0S A;  5HCE C;  5HA1 A;  2OVE A;  4U8U O;  1ALB A;  2XTR A;  3AA0 B;  2XE3 A;  4KCA A;  4YCH A;  2MWH A;  4YFR A;  4GNW A;  4NP1 A;  4LSE A;  2L68 A;  4DQ3 A;  1L6M A;  1SXU A;  3U03 A;  3KQ0 A;  3ZWE A;  2AT6 X;  1LIB A;  3SZD A;  1JJX A;  4QGX A;  1AB0 A;  3AKM A;  2JU8 A;  5LKF A;  2RD7 C;  1QFV A;  1I06 A;  4NYQ A;  2M06 A;  1DV9 A;  3POU A;  4NLJ A;  4INN A;  1DZP A;  2Q4N A;  1MUP A;  1ERX A;  2JN3 A;  3ZZV A;  1HMT A;  4OS0 A;  1ZHT A;  1NGL A;  3CQN A;  3NX1 A;  3ZW0 A;  4E1T A;  2MO5 A;  5CE4 A;  1MDC A;  4R0B A;  2ZFG A;  2E4J A;  4YDA A;  5BVS A;  2FLJ A;  5LJB A;  1X71 A;  1DF3 A;  2JOZ A;  3B2L A;  1OPB A;  4HPC A;  2HMB A;  3KFH A;  3BSZ E;  3VZW X;  1G5W A;  4NYR A;  1E00 A;  4EXZ A;  1KT7 A;  1PM1 X;  1VYG A;  1KQW A;  1JIW I;  2A13 A;  2ZLD A;  1KT5 A;  2G79 A;  2GC9 A;  3C78 X;  1GX9 A;  1O8V A;  3LHN A;  5L8N A;  2Y2X A;  3ZW1 A;  3AAE A;  3FEP A;  4CV7 A;  4ZHG A;  5F1E A;  4XNL A;  2JU3 A;  2GJ5 A;  3EYC A;  3PPT A;  5D4A A;  3D4R A;  3ZW0 B;  1KZX A;  1GFQ A;  1OEK A;  1Q9G A;  4FZM A;  2FR3 A;  5DL5 A;  2YMS A;  2CM9 A;  1KT4 A;  2OZQ A;  3UPG A;  1BH3 A;  1BEB A;  4D6A A;  5D8J A;  5BVQ A;  2X46 A;  1SY2 A;  2R56 A;  4I95 A;  4FUV A;  5ADX K;  4FES A;  1FE3 A;  1B8E A;  3PEC A;  1MM5 A;  3FW5 A;  5HZ6 A;  1BSO A;  1LF7 A;  4KR8 A;  2KXP A;  3LK2 A;  3Q6L A;  1YP7 A;  4QZU A;  2RA6 A;  3SZV A;  5IYU A;  1X8Q A;  4AZP A;  1PHO A;  3APX A;  5EPQ A;  1A57 A;  1IZN A;  1LIE A;  1RBP A;  1TVQ A;  2FGQ X;  4FSO A;  1UZ2 X;  1XCA A;  1T8V A;  2OVS A;  3NQK A;  3TZG A;  1PBO A;  3CQR A;  2Z4I A;  2ZAG A;  4KC8 A;  5K06 A;  4GCQ A;  3L4R A;  4ZCB A;  1U17 A;  5AFU L;  4O3Z A;  4NNT A;  4G76 A;  4LKP A;  4GU8 A;  1RLB E;  4I6S A;  3VG3 A;  1QJP A;  2F1V A;  1U0X A;  2OFM X;  3NPO A;  1QY1 A;  1SA8 A;  2ERV A;  1NP4 A;  3EM0 A;  1E06 A;  3FYX A;  4C69 X;  3FR2 A;  1CJ5 A;  3S5X A;  3BU1 A;  3D97 A;  2EU7 X;  4ODD A;  1OPF A;  5B29 A;  2WSJ A;  5AJC A;  3HWB A;  1OPA A;  3P02 A;  3AA7 B;  1KT6 A;  4GZV A;  4YCE A;  1OBP A;  2AT0 X;  1U18 A;  4U8U M;  4XMH A;  2LFU A;  2KZ7 A;  1T68 X;  1KQX A;  5EED A;  3RKG A;  1PRN A;  1ZHZ A;  2GTL O;  3MX7 A;  4ZH6 A;  1YWA A;  1EPB A;  4HPA A;  1Y9L A;  4U9C A;  4PUX A;  1AEL A;  3VG2 A;  3OJY C;  3FLL A;  1BSQ A;  3AAE B;  4FZL A;  2X8F A;  1B4M A;  3B2H A;  3STN A;  1DC9 A;  1E54 A;  1ORM A;  1ZND A;  4GET A;  2NND A;  3U0D A;  4TLJ A;  1LIF A;  1ICM A;  2Y7S A;  2XST A;  1YWC A;  1LKE A;  1Z24 A;  4KRA A;  1I05 A;  3N91 A;  5F6Z A;  4JFB A;  4EEJ A;  1GKA B;  5BVT A;  5HZ5 A;  3AAA B;  1G90 A;  5DG4 A;  2POR A;  3EBK A;  1S44 A;  5JDP A;  3F8A A;  2AT5 X;  4ZFX A;  2AT3 X;  3HWG A;  4HFO A;  2Y0H A;  3S60 A;  3JQO A;  3PQS A;  4N7C A;  4AKR A;  1QAB E;  1CBR A;  3O22 A;  4Y0Q A;  4AKM A;  4CSB A;  2XG6 A;  1IZN B;  1X8O A;  1TW4 A;  3BY0 A;  3KVD D;  3UEV A;  3ELX A;  2WWP A;  1IW2 A;  3WJG A;  4K19 A;  1A18 A;  5LJG A;  4AZQ A;  3A2S X;  3P6F A;  5H9L A;  2BS5 A;  3FA8 A;  4FBV A;  4COT A;  5FQ7 E;  2NNQ A;  3AA1 B;  5DL6 A;  2LBV A;  3GAQ A;  3RWX A;  2LHF A;  2XE5 A;  4N58 A;  3VG5 A;  4AZM A;  1ZNE A;  4ZJ0 A;  4EFG A;  2Z4H A;  1BWY A;  2MJI A;  1KT3 A;  3P6E A;  4O4U A;  2GE4 A;  1Q9F A;  1ERB A;  4U3Q A;  3RSW A;  2RN4 A;  3DSZ A;  2WQA E;  2AL0 X;  3RBY A;  5JR8 A;  3VG4 A;  2F1T A;  4NW4 A;  3TGA A;  5AEO A;  1GXA A;  5IO6 A;  4LSH A;  2FS7 A;  5H9N A;  3VZU X;  3P6C A;  4F4B A;  1IKJ A;  2KT4 B;  1VYF A;  1BJ7 A;  5HCD C;  2J1N A;  3BRN A;  3WI4 A;  3UEW A;  2HZQ A;  3STM X;  1BT9 A;  4QYN A;  1ZHX A;  4ID2 A;  4GCP A;  2HYS A;  1BLR A;  1D2U A;  2ACO A;  2A2U A;  1EII A;  2Q2M A;  4AYM C;  4BVM A;  5FAZ A;  1QY2 A;  4FSP A;  5EDB A;  1EQD A;  3CMP A;  1LIC A;  3FR4 A;  4GNY A;  4ORY A;  4O4X A;  4YKO A;  1O1V A;  2JW1 A;  3HTY A;  4XNK A;  3DA3 A;  4HPB A;  2FRS A;  3NX2 A;  4AZR A;  3ELZ A;  4OMW A;  2P8G A;  4XMD A;  5PRN A;  1EW3 A;  3FEL A;  1URE A;  4YFQ A;  5AQ6 A;  1BXW A;  3NP1 A;  5HTD A;  3E3C A;  1BBP A;  4MIR A;  2XKL A;  1CRB A;  3O19 A;  2K4T A;  1HXU A;  2L9C A;  4ALO A;  2F73 A;  1EXS A;  2W2B A;  5D45 A;  1QG5 A;  3F9D A;  5FQ8 E;  4A1Y A;  4FMS A;  4RUU A;  2LFO A;  4AKR B;  3PH6 A;  3O0E A;  2XE2 A;  3K19 A;  4ZHD A;  3OBL A;  1GT5 A;  1GT4 A;  1DZM A;  2CZT A;  2WEX A;  1BRP A;  2Y0K A;  4I3D A;  3FYF A;  3KFF A;  2KTS A;  2QO6 A;  3QKG A;  3P6D A;  4ZGF A;  3BU9 A;  3HWD A;  3VZT X;  5CYB A;  3FR5 A;  3U9P C;  4M7M A;  5T5F A;  4AFK A;  1AVG I;  2LKK A;  1IKE A;  3WJD A;  4IMN A;  2MHL A;  5L8I A;  2XTQ A;  1SXX A;  1AQB A;  4AYD C;  4IAX A;  4OMX A;  4EQA C;  5ADX L;  4WFV A;  5GV0 A;  1EI5 A;  1OEJ A;  5BYP A;  3T0S A;  4E1S A;  1E5P A;  1B56 A;  1MVG A;  4O9S A;  1NP1 A;  4MVL A;  3DTQ A;  1HBP A;  1JZU A;  4NNS A;  1X8P A;  5H9A A;  4ORW A;  1LFO A;  1OBU A;  1QFT A;  4AYI D;  3T20 A;  1BSY A;  4RUN A;  3POQ A;  1S7D A;  2HLV A;  2ASN X;  2W2F A;  1ADL A;  4GDZ A;  4MVI A;  4YDB A;  2HZR A;  4YGH A;  4D6B A;  4KC7 A;  1FEN A;  1X8N A;  5F58 A;  1EIO A;  3UEX A;  5D5D A;  3WI5 A;  5EE2 A;  1Y9T A;  1H91 A;  3C76 X;  3HOL A;  3TZS A;  1I04 A;  3IA8 A;  1FEM A;  2FS6 A;  4GCS A;  2PY1 A;  3CR6 A;  3PQU A;  4YBU A;  1JV4 A;  1QWD A;  5F7G A;  4TKJ A;  3S5V A;  3WXQ A;  2KTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...