4O3XB

Crystal structure of the vaccine antigen transferrin binding protein b (tbpb) mutant phe-171-ala from actinobacillus pleuropneumoniae h49
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
241
structure length
241
Chain Sequence
PALGYVVKVPVSSFENKKVDISDIEVITNGNLDDVPYKANSSKYNYPDIKTKDSSLQYVRSGYVIDGEHSGSNEKGYVYYKGNSPAKELPVNQLLTYTGSWDFTSNANLNNEEGRPNYLNDDYYTKAIGKRVGLVSGDAKPAKHKYTSQFEVDFATKKMTGKLSDKEKTIYTVNADIRGNRFTGAATASDKNKGKGESYNFFSADSQSLEGGFYGPKAEEMAGKFVANDKSLFAVFSAKHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonbinding site-directed mutants of transferrin binding protein B exhibit enhanced immunogenicity and protective capabilities.
pubmed doi rcsb
source organism Actinobacillus pleuropneumoniae
molecule tags Metal transport
molecule keywords Transferrin binding protein B
total genus 64
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 4o3xB01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4o3xB02
2W81C 4O3XB 2YPVA 4O3YA 3KVDD 4O4UA 3UAQA 1YS5A 2W80C 3VE1A 3VE2A 4AYMC 4AYDC 4AYNA 4QQ1A 4AYID 3PQUA 3HOLA 5EE2A 4Z3TA 4U9CA 2KDYA 3HOEA 4O3WA 3PQSA 4O4XA 2LFUA 2KC0A 5T5FA 3V8UA 4AYEC 4O3ZA 4O49A 2Y7SA
chains in the Genus database with same CATH superfamily
1W6FA 3GAQA 3TZSA 2UZ2A 1SWFA 4XMHA 4BVMA 2W80C 4KH8A 4BCSA 2RTJA 3SLTA 3PH5A 4IL6O 3PQUA 1X8PA 2L5PA 4CPEA 2RD7C 4GH7A 4ORWA 2Y3FA 3RDSA 1EPAA 1IFCA 2RTGB 1JQPA 5H9KA 3VG7A 5HCDC 1WBIA 1OEEA 5DL5A 4YKMA 4EDEA 1OBQA 4R0BA 1SWTA 1LICA 3ZUOA 2BSZA 4AYHA 1VWFB 5B5GA 1MOYA 4GZVA 2X45A 3EMNX 3D95A 4C5PA 3BS2A 4UB6O 4AKMA 4AYEC 2AT6X 1QFVA 4AKRB 5EZ2A 1ZRYA 3PK2A 5FFHA 2WEWA 1DC9A 1LCZA 1U17A 1NC9A 4GNYA 5DL7A 1KT6A 1JMXA 2DJFA 1HBPA 4I95A 1T0VA 5LJBA 3PEDA 1SY3A 4PUXA 5FQ8E 4UU3A 5IO6A 2QTKA 2IFBA 3B2JA 3TF6A 3FIQA 5TISO 1X89A 3CBSA 4NW4A 1WUBA 2LKKA 4M6SA 3NPOA 5HZ8A 5JR8A 1JMZA 4LZVA 4BX5B 1ADLA 4GCPA 4O4UA 1SWKA 1LIBA 4XMGA 4B61A 4RUNA 1VWKB 1KZWA 4CPHB 1S7DA 4I6SA 5JDPA 3EMMA 2Y2XA 3WVMA 2M4LA 1SWJA 1ZHXA 1BSQA 2Q9SA 2IZKA 5D5DA 3SZDA 3D96A 1NP1A 2GC9A 4K19A 2YNKA 4QQ1A 3VG6A 1VWEB 1YP6A 2AT3X 1BM5A 3FIDA 1VWQB 4GUZA 2X56A 4EFGA 3RBYA 6PRNA 3F9DA 1DZMA 1FENA 2C1SA 4MIRA 1MEPA 1AVDA 2R73A 2QOSC 3BU1A 1QABE 1RSTB 4D6BA 2R4LA 3CMPA 2X55A 3HOLA 2KXPB 2QMIA 4IRWA 1HMTA 2VFCA 4RLCA 1SLGB 2XE3A 4FRTA 5IRWA 1GXAA 4FGIB 1VWCB 3X00A 4TKJA 3MBTA 4YDAA 2X8SA 5GV0A 3O0EA 1E06A 4OS3A 1KZXA 3RBHA 3PORA 3KFFA 1N9MA 4O49A 3BDRA 2MNHA 3BU9A 3UEVA 3AA0B 2WQAE 3IA8A 2QO5A 2F09A 2F73A 1SA8A 4YGHA 5B27A 3WZOA 1O1UA 4U8UM 2FGSA 1KQXA 4JFBA 1YWAA 4KT5A 4NV8A 1X71A 3TGBA 5G26A 3PF1A 1RLBE 3B2LA 2I5ZO 1DZKA 1GKAA 4C4VA 3AKNA 3WBGA 3WYPA 2POAA 4GHBA 1BSOA 3FELA 5D47A 2XE2A 3ELZA 4A1YA 1BRQA 2O62A 1MM9A 3H3IA 5G39A 1QJPA 4N58A 5HAEA 2G8CO 1SWGA 2OVAA 2RTHB 5BYPA 2CZTA 3RKGA 4GGZA 2LA7A 2IZIA 1IKEA 3VZUX 3BRYA 2E4JA 3TZGA 1B56A 2ERVA 2F01A 3ZW0A 1DFVA 2IZJA 4NYQA 5HCCC 2MHLA 2FLJA 1Y9LA 3BX8A 1ZNKA 2IZDB 3HTYA 1VWGB 2NNQA 4FZLA 1BBPA 3AA6A 2X8TA 5HZQA 5BVQA 1G5WA 3WI4A 3FEPA 3I0AA 4F4BA 5F2BA 4K3CA 2RTNB 5DL8A 5B5FA 1SLEB 2Y0HA 4ZH9A 3NP1A 3ZUIA 4KR8A 4WBKA 1I06A 2ZSCA 1NDJA 5EE2A 5JD2A 2RTBB 4N75A 1VWHB 3AA7A 4MVIA 4BUMX 1RXKA 2IZLB 1VWRB 2VFBA 4KRAA 2HKDA 3D4RA 2OFAA 2G7BA 4G76A 3RE5A 5HCEC 4QZUA 2L9CA 4PSQA 2RCTA 1L6MA 3FR5A 4CDEA 1PM1X 5AFUK 4WHIA 3VGWA 1IJ8A 1LELA 3P02A 1NP4A 1VWJB 4Z28A 2HLVA 2ASNX 1EI5A 3KZIO 2WR6A 4ARHA 4L1NA 1SRJA 4GDZA 1AB0A 3VZTX 1PHOA 2AXTO 1GFOA 4ORSA 2J1NA 4HFOA 2R56A 5HBSA 2RTRB 1I04A 3T6LA 4FESA 2CBRA 3A0BO 2RTLA 3ZI8A 4I60A 3O19A 3ZW1B 2RTIB 1CBSA 2OL7A 3VG3A 1I05A 1SREA 1DZJA 2A2UA 4Y59A 1D3SA 5HA0A 4ORUA 1U18A 1NGLA 4Z2PA 4IMOA 3POXA 3TGAA 4RL9A 5AQ6A 1Y9TA 1KL4A 5D4AA 2OFRX 4FSPA 3CR6A 5B3MO 3QRCA 1BJ7A 3FR4A 2DJGA 4PR7A 3RDUA 4MVEA 5FAZA 4OMWA 1KT5A 1QWDA 3AA0A 1OPAA 2FHNX 3Q6LA 5FENA 1T16A 4GD9A 4IB6A 2M06A 4FMSA 3T6FA 1TOUA 2JMBA 2IZCB 5L8IA 3K19A 2GE4A 3SLOA 1G85A 2YPVA 1STPA 3GP6A 1SY2A 1G7NA 1IFBA 1HXTA 2ZAIA 5AJCA 3DZMA 4IABA 1LIEA 3KQ0A 1W5RA 2Y7SA 2Y0LA 2RTFB 2M07A 3T24A 1QY0A 4A8ZA 1H91A 2JU3A 3RZYA 1ZHZA 2WJRA 3STKA 4FBOA 1ZNHA 2IZBA 4EXZA 2ZAGA 1GM6A 4CPHA 2K0LA 3OE3A 5FQ7E 2RTAA 1SY1A 4LKPA 3UAQA 1KOIA 3CKGA 3JS1A 3SZVA 4TLJA 4JHQA 3E3CA 3QKGA 2RTKA 5HA1A 4D6AA 5DL6A 4YFRA 4C00A 1BH3A 3LHNA 4FZMA 2FHLA 1TXLA 4I3DA 2FS7A 1SMPI 1OPBA 4XMCA 5L3YA 4KR4A 3EW1A 1MK5A 5K67A 4KIIA 3P6CA 5H2FO 4MVLA 2WSJA 5EDBA 5GTIO 4YH0A 4QYPA 1YWDA 4QYNA 4TQ2A 4NP1A 1OEKA 4MISA 3F8AA 3SYBA 3HWDA 3FMZA 4U9CA 2AH7X 2FWVA 1KFFA 1U0XA 4BX5A 2XSTA 4GDAA 5CE4A 4LSEA 3EC5A 3B2IA 5IRAA 3T1DA 5K68A 2HZQA 5LJKA 1AVGI 4Y5DA 2LB6A 4YVBA 5KAIO 1SWAA 2F1VA 2FGQX 5EEEA 4N59A 3UEWA 1BEBA 5LKEA 2A5CA 1ML7A 4AZOA 1VYGA 1MDCA 1NQNA 1YP7A 1ORMA 3B2KA 1R0UA 4ZGFA 1P4TA 3KFIA 1ICNA 1LIFA 3P6FA 3WJDA 3F6ZB 4OEMA 2A5BA 1RBPA 3S60A 1VWDB 3WJCA 4JO6A 3T20A 3DWNA 5LJHA 3BY0A 5F58A 1SWLA 2ACPX 2W81C 4EQAC 1ALBA 4KCAA 1SXUA 3VG4A 5H9LA 2X9KA 1E54A 3D9WA 3A0HO 2MM3A 1T8VA 4AYMC 5C0NA 1UYOX 1UYNX 2WQ9A 3T2WA 4I9RA 3APWA 1N4JA 1KT4A 1FEMA 2WEXA 2OY1O 3WYQA 2MJIA 4Z2VA 2RTEB 3C76X 2UYWA 1TW4A 3NADA 1LDQA 5KICA 4AYID 1ZHWA 2OY5O 4LSHA 1CBIA 1H6S1 1GT1A 4NLIA 3NR3A 5HZ6A 2HMBA 1LFOA 4YCHA 3BX7A 1SXXA 1HMSA 4GNWA 2Y3EA 3BRNA 3HK1A 3HWGA 3RE6A 2R4PA 1QG5A 3LK41 2OVDA 5F1EA 2IWVA 3EBKA 3WZQA 4CDCA 4WFUA 1FTPA 3OJYC 4DNEA 1KT3A 1YWCA 3FA7A 4HPAA 4L3RA 4O4SA 4EEJA 1VPRA 4GJVA 3AA6B 2ANSA 4Z27A 2PI3O 2RTPB 2N93A 1I4UA 2RTOB 4BX6A 5LJCA 5KHPA 3ZW1A 3APUA 1IW2A 2QO4A 1A2DA 2KD2A 3ZQ3A 1MPFA 2OF8A 1VWOB 3D97A 4BX7A 1YUPA 4YKOA 3P24A 1N0SA 1SRHA 2A8GA 4GU8A 2FGRA 1ZNEA 4JGLA 4UB8O 1LCWA 1GFMA 2IZAA 1GGLA 1S5LO 1AELA 3V8UA 1O8VA 1PEEA 1EUOA 3FYXA 1EW3A 1HY2A 4IB7A 5LJGA 2IZGB 2PORA 1ZHTA 4D64A 3GE2A 2FTBA 2OMFA 1DF3A 1OBUA 2F1TA 3IFBA 3P6DA 3LK2A 2N2LA 5AFUL 3ELXA 4BGFA 4QGWA 3DA3A 2Q39A 1ZNDA 1E00A 4ZHHA 5HZ5A 1Q9FA 2AT0X 3MX7A 2ZFGA 1JJJA 2A0AA 3APXA 3T2XA 4A1HA 2BS5A 1JIWI 4NNTA 1A57A 3DSZA 4HPDA 1HXXA 1W4TA 3VG2A 4YCEA 4Z2OA 5CSEA 2GJ5A 2QOMA 3STMX 3HWEA 3LK2B 5HZ9A 4ZGUA 1E2TA 1LPJA 4AZLA 4Y0RA 1IKJA 1TOWA 1VWLB 1SWEA 4GETA 3PP6A 2CM4A 4NV7A 5CHKA 4FBRA 1RXJA 1X8QA 2GTLM 3FA6A 3MVFA 4CDDA 1TVQA 4MEEA 3VG5A 3LV4A 4U3QA 3UPGA 3CQNA 3AAAA 1Y0GA 1QJ8A 3U03A 5GTHO 5H9AA 2O4VA 1GT3A 2N2MA 3UEUA 2WWPA 4WFVA 3UU2A 1RAVA 3NX2A 2HNXA 2XG6A 1IZNB 3POQA 2OZQA 4MVKA 3B2HA 4I9SA 4PJ0O 2LFUA 3OD9A 5DPQA 2AT5X 4ZHGA 2VDFA 3CWKA 4QGXA 1OSMA 1E5PA 3KFGA 3BS0A 1GKAB 3RWXA 2P8GA 1GT4A 1JZUA 3EBWA 3FA8A 1SWRA 4UU2A 3AAEB 2KTDA 4O3ZA 2OFBA 3PQSA 3VHIA 2LBVA 4G75A 4GCQA 2Y0KA 5ADXL 3MG5A 3RDQA 1I9HA 3I17A 3HWFA 1BRPA 4OS8A 4QNIA 5IXGA 4QGVA 2JOZA 1CJ5A 3VU1A 1GFQA 4IB8A 4IMNA 3SY7A 3PDFA 4N7DA 3WJBA 1PBYA 2XE5A 2QCBA 4CTDA 5E79O 1XKIA 4GE1A 2FS6A 2R8AA 3AKMA 5IO5A 4ZCBA 3AEHA 2FR2A 1N9YA 1LUQA 1PMPA 4IAWA 1SXYA 1HQPA 2ODJA 2AF5A 2X32A 2W2AA 4BX6B 2W2BA 1BXWA 3C78X 4BX7B 1I78A 2X34A 3HPEA 2F1CX 3SY9A 1OPFA 1YS5A 4Y0QA 1CBRA 2PRNA 3VE2A 1O1VA 4Y0SA 5B66O 4E1TA 1SRFA 2JGSA 1BT9A 3KFHA 1Y52X 1SWNA 1B8EA 1OEJA 5IRUA 1B4MA 5G38A 3RY1A 4OMXA 1T68X 4ZH6A 1VYFA 2G5LA 3RSWA 3FW5A 4ZHDA 2QM9A 4DCBA 4YBUA 3WJGA 1ACDA 1S44A 4Z3TA 4CPFA 2BC3A 1JBHA 3P6HA 1HMRA 3S26A 2PY1A 4O4OA 2OFMX 5PRNA 5HTEA 2R4OA 1MX7A 3FW4A 2R89A 2I5VO 1RSUB 3LK3A 1G90A 1QY1A 4ORYA 5L8OA 2X8FA 4AYDC 4NNSA 2ACOA 1FE3A 3VHHA 4INNA 1PTSA 2KTSA 4U8UN 3FLLA 3AA1B 4ZR2A 4U8UO 1LKEA 1DF8A 3EM0A 2C4IA 3VZWX 2NNDA 2L68A 1T1LA 4PJ2A 3LTWA 1AQBA 4CV7A 5FQ6E 2HYSA 4GCSA 2IZHB 2AVIA 1RXHA 1ZNGA 4FRXA 2KZ7B 4ALOA 3MM0A 1GFPA 2FT9A 1LDOA 1VWMB 1N43A 1VWNB 3TGCA 2GH7A 1LCVA 1BWYA 3G7GA 3LK42 5LJEA 3U0DA 3FDCA 4Y0PA 1JJUA 2KXPA 1EALA 1JYDA 2KW1A 2DM5A 4ID2A 5K06A 4HWMA 4YBPA 1SWUA 4CSBA 2XKLA 1SWBA 1Y55X 3CQRA 3PGUA 2AKQA 4XMDA 4BBOA 3VPJE 1XCAA 4O3YA 5BVTA 2XE1A 2WJQA 4K3BA 1K3BA 1HXLA 4I3CA 5HTDA 3AAEA 4EKVA 2Z4HA 3DA4A 3STNA 3SAOA 3SZHA 2KC0A 1KQWA 1OBPA 2BS6A 4BOEA 2ZLDA 4ON1A 5IYUA 2G79A 4DQ4A 4KC8A 1EPBA 2Q2PA 3JQOA 5AEOA 3ZWEA 4YDBA 1VWBB 2QO6A 3BLGA 3EW2A 4O3WA 2A13A 5EEDA 2Y32A 4FSOA 1KL3A 3FA9A 3WJEA 4A60A 3PECA 1FELA 2JW1A 5ADXK 3NBXX 1GT5A 1JYJA 3O22A 2YG2A 3S5VA 3LK3B 3S5XA 1SRGA 1QY2A 4GF4A 2BT9A 5B29A 3JCUO 2NP1A 5D45A 1HXUA 5H9NA 2GTLN 3T0SA 1SWQA 4ALBA 1D2UA 2L67A 2OVEA 3WJFA 4TJZA 1X8OA 4FZNA 4ORRA 1X8UA 1SWDA 3SZJA 3N91A 4TKBA 2JMMA 4AFKA 4TNNA 2NNEA 2RA6A 1ZHYA 4ZJ0A 4YMYA 3PH6A 5H8TA 4LZUA 5F7GA 4AZRA 1NBXA 4HPBA 2RCQA 1Q9GA 2K4TA 2R88A 3FEKA 3EYCA 2MF6A 2WPUA 4YFQA 4QRLA 2G78A 2K23A 5KIDA 2IZFB 1FJ1E 4FUVA 4LSIA 5LJDA 2X46A 1MUPA 3SZIA 4YFPA 2J4UP 1VYOA 2K62A 3BRZA 1MM5A 2LFOA 3DWOX 5F6ZA 1JJXA 4ML7B 4DQ3A 1HQQA 1QJ9A 3DTQA 5AJBA 2OF9A 2OL6O 4XNLA 2OVSA 2RN4A 4N74A 4RJXA 1SWOA 3FENA 3WXQA 3U9PC 2WUTA 5B11O 1B0OA 1QQSA 1SLDB 1P6PA 3RDOA 2XTQA 1A3YA 3WZPA 4GJSA 3WOVA 3PGRA 2A2GA 2OY8A 3G7XA 3FR2A 2OY7A 2LBAA 5B10O 2WVPA 5IO7A 4XNKA 2R4NA 4AZPA 3AAAB 1ZNLA 4C4VB 1Y53X 3HOEA 2RTCB 1UREA 4NYRA 2OYBO 5HWZA 1LF7A 1HBQA 4FQBB 5KAFO 2FKGA 1EIIA 3K3LA 4BJ8A 5BVSA 1JV4A 2JN3A 5D48A 4HPCA 2LHFA 1NQMA 2RQ0A 4D5UA 4IB9A 2IWWA 2CAMA 2YMSA 4N7CA 3VY8X 4ZFXA 4CPIA 2CZUA 1BLRA 4O3XB 4FBVA 3RDMA 1VWPB 4IBAA 4FT6A 2FR3A 3NX1A 5CYBA 1DV9A 4AYNA 4COTA 1E02A 1SLFB 2W2FA 5DG4A 3NJTA 4LSFA 2MO5A 1MVGA 2R74A 5G3AA 3HW9A 4ORXA 2Q4NA 4YGZA 1VWAB 1GFNA 3QQ2A 3JSQA 1PRNA 3KVDD 3SYSA 1MM4A 1BSYA 3Q34A 4NLJA 2RTQB 3WI5A 1LIDA 2A3FX 4RUUA 3BSZE 3WU2O 1GX3A 1KT7A 1STRB 4AZNA 1ERBA 3VHMA 3VY9X 1CRBA 1DZPA 4CK4A 2RTDB 1YWBA 2KT4B 3QRAA 5F6BA 3NQ3A 4ZHCA 5D8JA 3PPTA 3FYFA 4ZHFA 1OSPO 3ZW2A 1SRIA 2OL8O 4TKHA 1K24A 2EU7X 2GTLO 2C1QA 1IIUA 1MX8A 5L8NA 3CKFA 4OKAA 1QFTA 3ZZVA 1GX9A 3NQ9A 4XMEA 2CM9A 4GKCA 3AA7B 2XMXA 4B55A 3UEXA 4OELA 3NSGA 3RY2A 1VWIB 1N7YA 2MHDA 1UZ2X 3SOTA 1GX8A 1IZNA 3VE1A 4GGTA 4AKRA 3HWBA 1THQA 1EXSA 3P6EA 4FOZA 3POUA 5B2AO 4QZTA 4BQUA 3CBCA 2AT8X 1CBQA 1YIVA 4OS0A 3ZW0B 1STSB 1SWSA 3KVNA 4D65A 4CDFA 4ES7A 1SWCA 5B5EO 3SLJA 4LQZA 3APVA 3JTYA 4JNJA 4KC7A 2BHVA 4IAXA 2CBSA 5LKFA 3AUMO 2ALLX 4C69X 4GK9A 1EIOA 4AZMA 3O2YA 3AA1A 4ODDA 2GTFX 4E1SA 4O9SA 1EQDA 3L4RA 4M7MA 2KDYA 7PRNA 4QAEA 3C77X 2AL0X 2X4MA 1LNMA 1PBOA 5T5FA 1ERXA 2JU7A 2JU8A 3WZNA 4JCHA 2MWHA 5FVNA 1KGLA 3P6GA 5EDCA 8PRNA 2AMMX 1AVEA 1G74A 3C5OA 3RDXA 3A2SX 1Z24A 4AZQA 4O4XA 1ICMA 1X8NA 2HZRA 3OBLA 1A18A 2IZEB 4U46A 4AW8A 4I3BA 3PGSA 2FKJA 1SWPA 2Z4IA 4GRJA 4GGRA 1FDQA 1KL5A 2Q2MA 2RTMA 1HXZA 2KZ7A 4Z6JA 1S2PA 3KZAA 3PRNA 2FRSA 4YGGA 5EPQA 1SWHA 2JQYA 1SXWA 4FQEA 3NQKA 4AUIA 2BLGA 4XMFA 4RJWA 1SY0A 1HN2A 4LKTA 1KXOA 2X27X 2XTRA 4RLBA
chains in the Genus database with same CATH topology
3QRCA 2NP1A 2GJ5A 3GAQA 5D45A 3TZSA 1HXUA 1BJ7A 3STMX 3HWEA 2GTLN 5H9NA 3LK2B 4XMHA 3T0SA 3FR4A 4ALBA 5HZ9A 4BVMA 1D2UA 2W80C 4KH8A 2L67A 2OVEA 3WJFA 4TJZA 4ZGUA 1X8OA 3PH5A 4MVEA 5FAZA 1LPJA 4OMWA 1KT5A 3PQUA 4FZNA 4ORRA 1QWDA 1X8PA 1X8UA 1OPAA 2L5PA 3AA0A 4AZLA 4Y0RA 3Q6LA 3N91A 4TKBA 1IKJA 2RD7C 2JMMA 4AFKA 4TNNA 5FENA 4GH7A 4ORWA 2NNEA 2RA6A 4IB6A 1TOWA 1ZHYA 1EPAA 1IFCA 4ZJ0A 5H9KA 3VG7A 4YMYA 5HCDC 4GETA 2M06A 3PH6A 3PP6A 4FMSA 1OEEA 2CM4A 5H8TA 5DL5A 1TOUA 2JMBA 4LZUA 4YKMA 5F7GA 4EDEA 1OBQA 4R0BA 5L8IA 3K19A 4FBRA 2GE4A 3GP6A 1G85A 1LICA 2YPVA 3ZUOA 4AZRA 1SY2A 1G7NA 4AYHA 1IFBA 1HXTA 4HPBA 4GZVA 2X45A 3EMNX 2RCQA 3D95A 1Q9GA 1X8QA 2ZAIA 2K4TA 5AJCA 3FEKA 3EYCA 2GTLM 3BS2A 4IABA 1LIEA 3FA6A 3MVFA 4YFQA 4QRLA 2G78A 2K23A 3KQ0A 1TVQA 4AKMA 3VG5A 2AT6X 3LV4A 5KIDA 2Y7SA 1QFVA 4U3QA 4AYEC 4AKRB 4FUVA 5EZ2A 1ZRYA 3UPGA 3CQNA 5FFHA 2WEWA 2Y0LA 3AAAA 1DC9A 1QJ8A 3U03A 4LSIA 2M07A 5LJDA 3T24A 2X46A 1MUPA 5H9AA 1U17A 4GNYA 1QY0A 2O4VA 1GT3A 4YFPA 2N2MA 5DL7A 1KT6A 2J4UP 3UEUA 4A8ZA 2K62A 1H91A 2WWPA 4WFVA 3UU2A 1MM5A 2LFOA 1HBPA 4I95A 3NX2A 2HNXA 5F6ZA 1JJXA 1T0VA 5LJBA 3PEDA 4ML7B 1SY3A 4DQ3A 2XG6A 2JU3A 3RZYA 5FQ8E 1IZNB 3POQA 4PUXA 4AYMC 2OZQA 4UU3A 3DTQA 5IO6A 1QJ9A 5AJBA 2QTKA 4MVKA 1ZHZA 3B2HA 2IFBA 3B2JA 4I9SA 3STKA 4XNLA 4FBOA 2OVSA 3TF6A 2RN4A 3FIQA 1ZNHA 2LFUA 4RJXA 4EXZA 3FENA 3OD9A 2ZAGA 5DPQA 1GM6A 1X89A 3WXQA 2K0LA 3CBSA 3OE3A 4NW4A 3U9PC 2LKKA 4M6SA 3NPOA 5HZ8A 5JR8A 2AT5X 4ZHGA 4LZVA 5FQ7E 1ADLA 1SY1A 2WUTA 3CWKA 4GCPA 4LKPA 4O4UA 3UAQA 4QGXA 1KOIA 3JS1A 1OSMA 1E5PA 1LIBA 3KFGA 4XMGA 3SZVA 1B0OA 4RUNA 4B61A 1GKAB 4TLJA 1QQSA 3RWXA 3E3CA 1KZWA 3QKGA 2P8GA 1GT4A 5HA1A 1S7DA 4D6AA 1P6PA 4I6SA 1JZUA 5JDPA 5DL6A 2XTQA 3EBWA 3FA8A 3EMMA 1A3YA 3WOVA 2Y2XA 3WVMA 4YFRA 2A2GA 2M4LA 4UU2A 1BH3A 1ZHXA 3LHNA 3G7XA 2KTDA 1BSQA 2Q9SA 3FR2A 3PQSA 4O3ZA 1MM4A 4FZMA 5D5DA 1TXLA 2LBVA 2LBAA 4I3DA 3SZDA 4G75A 3D96A 2FS7A 5IO7A 1SMPI 4GCQA 1OPBA 1NP1A 4XNKA 2GC9A 4K19A 4AZPA 2Y0KA 2YNKA 5ADXL 4QQ1A 4XMCA 3AAAB 3VG6A 3I17A 1YP6A 1ZNLA 1BRPA 2AT3X 3HWFA 4OS8A 1BM5A 4KR4A 4QNIA 3HOEA 4KIIA 3P6CA 1UREA 4NYRA 4EFGA 3RBYA 4QGVA 6PRNA 5HWZA 3F9DA 1DZMA 2JOZA 4MVLA 1CJ5A 1FENA 2WSJA 5EDBA 1LF7A 3VU1A 4YH0A 1GFQA 4QYPA 4IB8A 1YWDA 4MIRA 4QYNA 1HBQA 2R73A 4TQ2A 2QOSC 4NP1A 4FQBB 1OEKA 4IMNA 4MISA 3SY7A 3BU1A 1EIIA 1QABE 3F8AA 3K3LA 4N7DA 5BVSA 3WJBA 4D6BA 3CMPA 3SYBA 2XE5A 1JV4A 2JN3A 3HWDA 4HPCA 5D48A 2LHFA 3FMZA 3HOLA 2KXPB 2QMIA 4U9CA 2AH7X 2FWVA 2RQ0A 4D5UA 1XKIA 1HMTA 1U0XA 4GE1A 4IB9A 2FS6A 2XSTA 2YMSA 4RLCA 3AKMA 4N7CA 4ZFXA 5CE4A 3VY8X 2XE3A 4LSEA 5IO5A 4ZCBA 4FRTA 1GXAA 4FGIB 2CZUA 2FR2A 1BLRA 4O3XB 4TKJA 1PMPA 3MBTA 3B2IA 4YDAA 4FBVA 3T1DA 2HZQA 5LJKA 4IAWA 1AVGI 4IBAA 1SXYA 2X8SA 5GV0A 2LB6A 4FT6A 2FR3A 3NX1A 1E06A 4OS3A 3O0EA 1HQPA 5CYBA 1DV9A 2ODJA 4AYNA 4COTA 2F1VA 1E02A 2FGQX 2W2FA 5EEEA 5DG4A 1KZXA 4LSFA 3RBHA 2MO5A 2W2AA 3PORA 4N59A 3UEWA 1MVGA 2R74A 2W2BA 1BEBA 5LKEA 1BXWA 1ML7A 3C78X 4AZOA 3HW9A 1VYGA 3KFFA 1MDCA 4ORXA 2Q4NA 4YGZA 4O49A 3BDRA 2MNHA 1YP7A 1ORMA 1GFNA 3B2KA 3BU9A 3JSQA 1R0UA 4ZGFA 1PRNA 5ADXK 3SY9A 3UEVA 3AA0B 2WQAE 3IA8A 1OPFA 1P4TA 3KVDD 3KFIA 2QO5A 1YS5A 3SYSA 2F09A 2F73A 1ICNA 1LIFA 1SA8A 3P6FA 4Y0QA 1CBRA 1BSYA 1O1UA 3F6ZB 4U8UM 4YGHA 4NLJA 5B27A 3VE2A 1O1VA 2PRNA 3WI5A 1KQXA 4JFBA 1RBPA 1LIDA 4Y0SA 2A3FX 4RUUA 4E1TA 3S60A 1YWAA 4KT5A 3BSZE 3WJCA 1KT7A 1X71A 3TGBA 1BT9A 5G26A 1RLBE 4AZNA 3T20A 5LJHA 1ERBA 3BY0A 3B2LA 3KFHA 5F58A 1DZKA 3VY9X 1GKAA 2ACPX 1B8EA 1OEJA 1CRBA 1DZPA 3AKNA 3WBGA 4CK4A 1B4MA 2W81C 4EQAC 1ALBA 2POAA 4OMXA 1YWBA 4KCAA 1SXUA 2KT4B 3VG4A 3QRAA 5H9LA 1T68X 5F6BA 1E54A 4ZH6A 1BSOA 3NQ3A 4ZHCA 4GHBA 3FELA 1VYFA 2MM3A 1T8VA 3FW5A 5D8JA 3PPTA 3RSWA 4ZHDA 2QM9A 3FYFA 5C0NA 5D47A 2XE2A 4YBUA 3WJGA 1ACDA 4ZHFA 2WQ9A 3ELZA 1S44A 4Z3TA 4I9RA 3APWA 1BRQA 3ZW2A 4A1YA 2O62A 1JBHA 3P6HA 1HMRA 3H3IA 1KT4A 4TKHA 1FEMA 2EU7X 2GTLO 1QJPA 4N58A 2WEXA 3S26A 5HAEA 1IIUA 1MX8A 5L8NA 2PY1A 4O4OA 2OFMX 2OVAA 5PRNA 1QFTA 5BYPA 2MJIA 5HTEA 2CZTA 3RKGA 3ZZVA 1GX9A 1MX7A 3FW4A 2LA7A 3NQ9A 4XMEA 3C76X 3LK3A 1G90A 1QY1A 2CM9A 1IKEA 1TW4A 3NADA 4GKCA 4ORYA 3AA7B 2XMXA 5L8OA 2X8FA 3UEXA 3VZUX 4AYDC 4NNSA 2ACOA 1FE3A 5KICA 2E4JA 4AYID 1ZHWA 4INNA 4LSHA 1CBIA 1H6S1 3TZGA 1GT1A 4NLIA 3NSGA 3NR3A 1B56A 2ERVA 5HZ6A 2HMBA 3ZW0A 2KTSA 1DFVA 4U8UN 3FLLA 3AA1B 4ZR2A 4NYQA 5HCCC 4U8UO 2MHLA 2FLJA 1LKEA 1LFOA 4YCHA 1Y9LA 3BX8A 3BX7A 1ZNKA 1SXXA 2MHDA 1UZ2X 3EM0A 3SOTA 1GX8A 1HMSA 1IZNA 3HTYA 2NNQA 4FZLA 4GNWA 3VZWX 3VE1A 1BBPA 3BRNA 3HK1A 3AA6A 2NNDA 2L68A 3HWGA 4PJ2A 2X8TA 5HZQA 5BVQA 1AQBA 4CV7A 1G5WA 4AKRA 3HWBA 1QG5A 5FQ6E 3LK41 2HYSA 1THQA 2OVDA 1EXSA 3WI4A 3FEPA 3P6EA 5F1EA 4FOZA 3EBKA 3I0AA 4F4BA 4GCSA 4WFUA 3POUA 1FTPA 3OJYC 4QZTA 4BQUA 1ZNGA 3CBCA 4FRXA 2AT8X 5DL8A 2Y0HA 1CBQA 4ZH9A 1YIVA 3NP1A 3ZUIA 4ALOA 1GFPA 2KZ7B 1KT3A 2FT9A 1YWCA 4KR8A 4WBKA 4OS0A 3ZW0B 3FA7A 1I06A 4HPAA 5EE2A 4D65A 4L3RA 4ES7A 4O4SA 4EEJA 3TGCA 1VPRA 3G7GA 4LQZA 1BWYA 3LK42 3AA6B 3APVA 2ANSA 5LJEA 3U0DA 3JTYA 4KC7A 3AA7A 2BHVA 4IAXA 4MVIA 4Y0PA 2CBSA 5LKFA 4BUMX 2N93A 1I4UA 2ALLX 2KXPA 4C69X 1EALA 1JYDA 2KW1A 2DM5A 4ID2A 4GK9A 1EIOA 4AZMA 3O2YA 5LJCA 5K06A 4ODDA 4HWMA 4YBPA 3D4RA 5KHPA 3AA1A 4KRAA 3ZW1A 4CSBA 2G7BA 2XKLA 3APUA 4G76A 5HCEC 2GTFX 4E1SA 4O9SA 1EQDA 3CQRA 1IW2A 3L4RA 4M7MA 2L9CA 4PSQA 4QZUA 2KDYA 2RCTA 7PRNA 1L6MA 4QAEA 3C77X 2QO4A 3FR5A 1A2DA 2AL0X 2KD2A 3ZQ3A 1LNMA 1PBOA 2AKQA 5T5FA 1PM1X 4XMDA 1ERXA 5AFUK 3VPJE 1MPFA 2JU7A 2JU8A 1XCAA 4JCHA 4WHIA 3WJDA 4O3YA 3D97A 3P02A 2MWHA 5BVTA 2XE1A 1NP4A 1YUPA 4YKOA 5FVNA 1KGLA 3P6GA 2HLVA 5EDCA 8PRNA 4I3CA 3P24A 2ASNX 5HTDA 1EI5A 3AAEA 2Z4HA 1N0SA 3DA4A 4GU8A 3STNA 2FGRA 3SAOA 2AMMX 2WR6A 4ARHA 1ZNEA 4JGLA 1G74A 4L1NA 1GFMA 3C5OA 4GDZA 3A2SX 1Z24A 1GGLA 4AZQA 4O4XA 1ICMA 1AELA 2KC0A 1KQWA 3V8UA 1O8VA 1AB0A 1OBPA 1X8NA 2HZRA 3OBLA 1PEEA 2BS6A 1PHOA 1EUOA 3VZTX 3FYXA 1EW3A 1A18A 4BOEA 1GFOA 4ORSA 4IB7A 2ZLDA 5LJGA 4ON1A 4AW8A 4HFOA 2J1NA 2R56A 1ZHTA 2PORA 5HBSA 5IYUA 2G79A 4D64A 4DQ4A 4I3BA 3GE2A 4KC8A 1I04A 1EPBA 2FTBA 2Q2PA 3JQOA 2OMFA 2Z4IA 1DF3A 4FESA 5AEOA 2CBRA 3ZWEA 3AAEB 4GRJA 1OBUA 4YDBA 2F1TA 3IFBA 3P6DA 3ZI8A 2QO6A 3LK2A 1FDQA 3BLGA 2N2LA 5AFUL 3O19A 4O3WA 2Q2MA 3ELXA 3ZW1B 2KZ7A 4QGWA 1CBSA 2A13A 3VG3A 5EEDA 1I05A 1S2PA 3KZAA 1DZJA 2A2UA 3DA3A 2Q39A 4FSOA 1ZNDA 3PRNA 3FA9A 1E00A 1D3SA 2FRSA 4YGGA 5EPQA 5HA0A 3WJEA 4ZHHA 5HZ5A 4ORUA 1Q9FA 2AT0X 1U18A 1SXWA 3MX7A 4A60A 3NQKA 3PECA 1NGLA 4AUIA 2BLGA 2ZFGA 4IMOA 3POXA 1JJJA 2A0AA 4XMFA 3TGAA 1FELA 2JW1A 4RL9A 3APXA 4A1HA 5AQ6A 2BS5A 4RJWA 3NBXX 1JIWI 1GT5A 1JYJA 1Y9TA 2YG2A 1SY0A 3O22A 4NNTA 3S5VA 3S5XA 3LK3B 1HN2A 1A57A 4LKTA 1QY2A 4GF4A 3DSZA 1KXOA 2X27X 2BT9A 5D4AA 5B29A 2XTRA 4RLBA 2OFRX 4HPDA 1HXXA 4FSPA 3CR6A 3VG2A 4YCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W81 C;  4O3X B;  2YPV A;  4O3Y A;  3KVD D;  4O4U A;  3UAQ A;  1YS5 A;  2W80 C;  3VE1 A;  3VE2 A;  4AYM C;  4AYD C;  4AYN A;  4QQ1 A;  4AYI D;  3PQU A;  3HOL A;  5EE2 A;  4Z3T A;  4U9C A;  2KDY A;  3HOE A;  4O3W A;  3PQS A;  4O4X A;  2LFU A;  2KC0 A;  5T5F A;  3V8U A;  4AYE C;  4O3Z A;  4O49 A;  2Y7S A; 
#chains in the Genus database with same CATH topology
 1W6F A;  3GAQ A;  3TZS A;  2UZ2 A;  1SWF A;  4XMH A;  4BVM A;  2W80 C;  4KH8 A;  4BCS A;  2RTJ A;  3SLT A;  3PH5 A;  4IL6 O;  3PQU A;  1X8P A;  2L5P A;  4CPE A;  2RD7 C;  4GH7 A;  4ORW A;  2Y3F A;  3RDS A;  1EPA A;  1IFC A;  2RTG B;  1JQP A;  5H9K A;  3VG7 A;  5HCD C;  1WBI A;  1OEE A;  5DL5 A;  4YKM A;  4EDE A;  1OBQ A;  4R0B A;  1SWT A;  1LIC A;  3ZUO A;  2BSZ A;  4AYH A;  1VWF B;  5B5G A;  1MOY A;  4GZV A;  2X45 A;  3EMN X;  3D95 A;  4C5P A;  3BS2 A;  4UB6 O;  4AKM A;  4AYE C;  2AT6 X;  1QFV A;  4AKR B;  5EZ2 A;  1ZRY A;  3PK2 A;  5FFH A;  2WEW A;  1DC9 A;  1LCZ A;  1U17 A;  1NC9 A;  4GNY A;  5DL7 A;  1KT6 A;  1JMX A;  2DJF A;  1HBP A;  4I95 A;  1T0V A;  5LJB A;  3PED A;  1SY3 A;  4PUX A;  5FQ8 E;  4UU3 A;  5IO6 A;  2QTK A;  2IFB A;  3B2J A;  3TF6 A;  3FIQ A;  5TIS O;  1X89 A;  3CBS A;  4NW4 A;  1WUB A;  2LKK A;  4M6S A;  3NPO A;  5HZ8 A;  5JR8 A;  1JMZ A;  4LZV A;  4BX5 B;  1ADL A;  4GCP A;  4O4U A;  1SWK A;  1LIB A;  4XMG A;  4B61 A;  4RUN A;  1VWK B;  1KZW A;  4CPH B;  1S7D A;  4I6S A;  5JDP A;  3EMM A;  2Y2X A;  3WVM A;  2M4L A;  1SWJ A;  1ZHX A;  1BSQ A;  2Q9S A;  2IZK A;  5D5D A;  3SZD A;  3D96 A;  1NP1 A;  2GC9 A;  4K19 A;  2YNK A;  4QQ1 A;  3VG6 A;  1VWE B;  1YP6 A;  2AT3 X;  1BM5 A;  3FID A;  1VWQ B;  4GUZ A;  2X56 A;  4EFG A;  3RBY A;  6PRN A;  3F9D A;  1DZM A;  1FEN A;  2C1S A;  4MIR A;  1MEP A;  1AVD A;  2R73 A;  2QOS C;  3BU1 A;  1QAB E;  1RST B;  4D6B A;  2R4L A;  3CMP A;  2X55 A;  3HOL A;  2KXP B;  2QMI A;  4IRW A;  1HMT A;  2VFC A;  4RLC A;  1SLG B;  2XE3 A;  4FRT A;  5IRW A;  1GXA A;  4FGI B;  1VWC B;  3X00 A;  4TKJ A;  3MBT A;  4YDA A;  2X8S A;  5GV0 A;  3O0E A;  1E06 A;  4OS3 A;  1KZX A;  3RBH A;  3POR A;  3KFF A;  1N9M A;  4O49 A;  3BDR A;  2MNH A;  3BU9 A;  3UEV A;  3AA0 B;  2WQA E;  3IA8 A;  2QO5 A;  2F09 A;  2F73 A;  1SA8 A;  4YGH A;  5B27 A;  3WZO A;  1O1U A;  4U8U M;  2FGS A;  1KQX A;  4JFB A;  1YWA A;  4KT5 A;  4NV8 A;  1X71 A;  3TGB A;  5G26 A;  3PF1 A;  1RLB E;  3B2L A;  2I5Z O;  1DZK A;  1GKA A;  4C4V A;  3AKN A;  3WBG A;  3WYP A;  2POA A;  4GHB A;  1BSO A;  3FEL A;  5D47 A;  2XE2 A;  3ELZ A;  4A1Y A;  1BRQ A;  2O62 A;  1MM9 A;  3H3I A;  5G39 A;  1QJP A;  4N58 A;  5HAE A;  2G8C O;  1SWG A;  2OVA A;  2RTH B;  5BYP A;  2CZT A;  3RKG A;  4GGZ A;  2LA7 A;  2IZI A;  1IKE A;  3VZU X;  3BRY A;  2E4J A;  3TZG A;  1B56 A;  2ERV A;  2F01 A;  3ZW0 A;  1DFV A;  2IZJ A;  4NYQ A;  5HCC C;  2MHL A;  2FLJ A;  1Y9L A;  3BX8 A;  1ZNK A;  2IZD B;  3HTY A;  1VWG B;  2NNQ A;  4FZL A;  1BBP A;  3AA6 A;  2X8T A;  5HZQ A;  5BVQ A;  1G5W A;  3WI4 A;  3FEP A;  3I0A A;  4F4B A;  5F2B A;  4K3C A;  2RTN B;  5DL8 A;  5B5F A;  1SLE B;  2Y0H A;  4ZH9 A;  3NP1 A;  3ZUI A;  4KR8 A;  4WBK A;  1I06 A;  2ZSC A;  1NDJ A;  5EE2 A;  5JD2 A;  2RTB B;  4N75 A;  1VWH B;  3AA7 A;  4MVI A;  4BUM X;  1RXK A;  2IZL B;  1VWR B;  2VFB A;  4KRA A;  2HKD A;  3D4R A;  2OFA A;  2G7B A;  4G76 A;  3RE5 A;  5HCE C;  4QZU A;  2L9C A;  4PSQ A;  2RCT A;  1L6M A;  3FR5 A;  4CDE A;  1PM1 X;  5AFU K;  4WHI A;  3VGW A;  1IJ8 A;  1LEL A;  3P02 A;  1NP4 A;  1VWJ B;  4Z28 A;  2HLV A;  2ASN X;  1EI5 A;  3KZI O;  2WR6 A;  4ARH A;  4L1N A;  1SRJ A;  4GDZ A;  1AB0 A;  3VZT X;  1PHO A;  2AXT O;  1GFO A;  4ORS A;  2J1N A;  4HFO A;  2R56 A;  5HBS A;  2RTR B;  1I04 A;  3T6L A;  4FES A;  2CBR A;  3A0B O;  2RTL A;  3ZI8 A;  4I60 A;  3O19 A;  3ZW1 B;  2RTI B;  1CBS A;  2OL7 A;  3VG3 A;  1I05 A;  1SRE A;  1DZJ A;  2A2U A;  4Y59 A;  1D3S A;  5HA0 A;  4ORU A;  1U18 A;  1NGL A;  4Z2P A;  4IMO A;  3POX A;  3TGA A;  4RL9 A;  5AQ6 A;  1Y9T A;  1KL4 A;  5D4A A;  2OFR X;  4FSP A;  3CR6 A;  5B3M O;  3QRC A;  1BJ7 A;  3FR4 A;  2DJG A;  4PR7 A;  3RDU A;  4MVE A;  5FAZ A;  4OMW A;  1KT5 A;  1QWD A;  3AA0 A;  1OPA A;  2FHN X;  3Q6L A;  5FEN A;  1T16 A;  4GD9 A;  4IB6 A;  2M06 A;  4FMS A;  3T6F A;  1TOU A;  2JMB A;  2IZC B;  5L8I A;  3K19 A;  2GE4 A;  3SLO A;  1G85 A;  2YPV A;  1STP A;  3GP6 A;  1SY2 A;  1G7N A;  1IFB A;  1HXT A;  2ZAI A;  5AJC A;  3DZM A;  4IAB A;  1LIE A;  3KQ0 A;  1W5R A;  2Y7S A;  2Y0L A;  2RTF B;  2M07 A;  3T24 A;  1QY0 A;  4A8Z A;  1H91 A;  2JU3 A;  3RZY A;  1ZHZ A;  2WJR A;  3STK A;  4FBO A;  1ZNH A;  2IZB A;  4EXZ A;  2ZAG A;  1GM6 A;  4CPH A;  2K0L A;  3OE3 A;  5FQ7 E;  2RTA A;  1SY1 A;  4LKP A;  3UAQ A;  1KOI A;  3CKG A;  3JS1 A;  3SZV A;  4TLJ A;  4JHQ A;  3E3C A;  3QKG A;  2RTK A;  5HA1 A;  4D6A A;  5DL6 A;  4YFR A;  4C00 A;  1BH3 A;  3LHN A;  4FZM A;  2FHL A;  1TXL A;  4I3D A;  2FS7 A;  1SMP I;  1OPB A;  4XMC A;  5L3Y A;  4KR4 A;  3EW1 A;  1MK5 A;  5K67 A;  4KII A;  3P6C A;  5H2F O;  4MVL A;  2WSJ A;  5EDB A;  5GTI O;  4YH0 A;  4QYP A;  1YWD A;  4QYN A;  4TQ2 A;  4NP1 A;  1OEK A;  4MIS A;  3F8A A;  3SYB A;  3HWD A;  3FMZ A;  4U9C A;  2AH7 X;  2FWV A;  1KFF A;  1U0X A;  4BX5 A;  2XST A;  4GDA A;  5CE4 A;  4LSE A;  3EC5 A;  3B2I A;  5IRA A;  3T1D A;  5K68 A;  2HZQ A;  5LJK A;  1AVG I;  4Y5D A;  2LB6 A;  4YVB A;  5KAI O;  1SWA A;  2F1V A;  2FGQ X;  5EEE A;  4N59 A;  3UEW A;  1BEB A;  5LKE A;  2A5C A;  1ML7 A;  4AZO A;  1VYG A;  1MDC A;  1NQN A;  1YP7 A;  1ORM A;  3B2K A;  1R0U A;  4ZGF A;  1P4T A;  3KFI A;  1ICN A;  1LIF A;  3P6F A;  3WJD A;  3F6Z B;  4OEM A;  2A5B A;  1RBP A;  3S60 A;  1VWD B;  3WJC A;  4JO6 A;  3T20 A;  3DWN A;  5LJH A;  3BY0 A;  5F58 A;  1SWL A;  2ACP X;  2W81 C;  4EQA C;  1ALB A;  4KCA A;  1SXU A;  3VG4 A;  5H9L A;  2X9K A;  1E54 A;  3D9W A;  3A0H O;  2MM3 A;  1T8V A;  4AYM C;  5C0N A;  1UYO X;  1UYN X;  2WQ9 A;  3T2W A;  4I9R A;  3APW A;  1N4J A;  1KT4 A;  1FEM A;  2WEX A;  2OY1 O;  3WYQ A;  2MJI A;  4Z2V A;  2RTE B;  3C76 X;  2UYW A;  1TW4 A;  3NAD A;  1LDQ A;  5KIC A;  4AYI D;  1ZHW A;  2OY5 O;  4LSH A;  1CBI A;  1H6S 1;  1GT1 A;  4NLI A;  3NR3 A;  5HZ6 A;  2HMB A;  1LFO A;  4YCH A;  3BX7 A;  1SXX A;  1HMS A;  4GNW A;  2Y3E A;  3BRN A;  3HK1 A;  3HWG A;  3RE6 A;  2R4P A;  1QG5 A;  3LK4 1;  2OVD A;  5F1E A;  2IWV A;  3EBK A;  3WZQ A;  4CDC A;  4WFU A;  1FTP A;  3OJY C;  4DNE A;  1KT3 A;  1YWC A;  3FA7 A;  4HPA A;  4L3R A;  4O4S A;  4EEJ A;  1VPR A;  4GJV A;  3AA6 B;  2ANS A;  4Z27 A;  2PI3 O;  2RTP B;  2N93 A;  1I4U A;  2RTO B;  4BX6 A;  5LJC A;  5KHP A;  3ZW1 A;  3APU A;  1IW2 A;  2QO4 A;  1A2D A;  2KD2 A;  3ZQ3 A;  1MPF A;  2OF8 A;  1VWO B;  3D97 A;  4BX7 A;  1YUP A;  4YKO A;  3P24 A;  1N0S A;  1SRH A;  2A8G A;  4GU8 A;  2FGR A;  1ZNE A;  4JGL A;  4UB8 O;  1LCW A;  1GFM A;  2IZA A;  1GGL A;  1S5L O;  1AEL A;  3V8U A;  1O8V A;  1PEE A;  1EUO A;  3FYX A;  1EW3 A;  1HY2 A;  4IB7 A;  5LJG A;  2IZG B;  2POR A;  1ZHT A;  4D64 A;  3GE2 A;  2FTB A;  2OMF A;  1DF3 A;  1OBU A;  2F1T A;  3IFB A;  3P6D A;  3LK2 A;  2N2L A;  5AFU L;  3ELX A;  4BGF A;  4QGW A;  3DA3 A;  2Q39 A;  1ZND A;  1E00 A;  4ZHH A;  5HZ5 A;  1Q9F A;  2AT0 X;  3MX7 A;  2ZFG A;  1JJJ A;  2A0A A;  3APX A;  3T2X A;  4A1H A;  2BS5 A;  1JIW I;  4NNT A;  1A57 A;  3DSZ A;  4HPD A;  1HXX A;  1W4T A;  3VG2 A;  4YCE A;  4Z2O A;  5CSE A;  2GJ5 A;  2QOM A;  3STM X;  3HWE A;  3LK2 B;  5HZ9 A;  4ZGU A;  1E2T A;  1LPJ A;  4AZL A;  4Y0R A;  1IKJ A;  1TOW A;  1VWL B;  1SWE A;  4GET A;  3PP6 A;  2CM4 A;  4NV7 A;  5CHK A;  4FBR A;  1RXJ A;  1X8Q A;  2GTL M;  3FA6 A;  3MVF A;  4CDD A;  1TVQ A;  4MEE A;  3VG5 A;  3LV4 A;  4U3Q A;  3UPG A;  3CQN A;  3AAA A;  1Y0G A;  1QJ8 A;  3U03 A;  5GTH O;  5H9A A;  2O4V A;  1GT3 A;  2N2M A;  3UEU A;  2WWP A;  4WFV A;  3UU2 A;  1RAV A;  3NX2 A;  2HNX A;  2XG6 A;  1IZN B;  3POQ A;  2OZQ A;  4MVK A;  3B2H A;  4I9S A;  4PJ0 O;  2LFU A;  3OD9 A;  5DPQ A;  2AT5 X;  4ZHG A;  2VDF A;  3CWK A;  4QGX A;  1OSM A;  1E5P A;  3KFG A;  3BS0 A;  1GKA B;  3RWX A;  2P8G A;  1GT4 A;  1JZU A;  3EBW A;  3FA8 A;  1SWR A;  4UU2 A;  3AAE B;  2KTD A;  4O3Z A;  2OFB A;  3PQS A;  3VHI A;  2LBV A;  4G75 A;  4GCQ A;  2Y0K A;  5ADX L;  3MG5 A;  3RDQ A;  1I9H A;  3I17 A;  3HWF A;  1BRP A;  4OS8 A;  4QNI A;  5IXG A;  4QGV A;  2JOZ A;  1CJ5 A;  3VU1 A;  1GFQ A;  4IB8 A;  4IMN A;  3SY7 A;  3PDF A;  4N7D A;  3WJB A;  1PBY A;  2XE5 A;  2QCB A;  4CTD A;  5E79 O;  1XKI A;  4GE1 A;  2FS6 A;  2R8A A;  3AKM A;  5IO5 A;  4ZCB A;  3AEH A;  2FR2 A;  1N9Y A;  1LUQ A;  1PMP A;  4IAW A;  1SXY A;  1HQP A;  2ODJ A;  2AF5 A;  2X32 A;  2W2A A;  4BX6 B;  2W2B A;  1BXW A;  3C78 X;  4BX7 B;  1I78 A;  2X34 A;  3HPE A;  2F1C X;  3SY9 A;  1OPF A;  1YS5 A;  4Y0Q A;  1CBR A;  2PRN A;  3VE2 A;  1O1V A;  4Y0S A;  5B66 O;  4E1T A;  1SRF A;  2JGS A;  1BT9 A;  3KFH A;  1Y52 X;  1SWN A;  1B8E A;  1OEJ A;  5IRU A;  1B4M A;  5G38 A;  3RY1 A;  4OMX A;  1T68 X;  4ZH6 A;  1VYF A;  2G5L A;  3RSW A;  3FW5 A;  4ZHD A;  2QM9 A;  4DCB A;  4YBU A;  3WJG A;  1ACD A;  1S44 A;  4Z3T A;  4CPF A;  2BC3 A;  1JBH A;  3P6H A;  1HMR A;  3S26 A;  2PY1 A;  4O4O A;  2OFM X;  5PRN A;  5HTE A;  2R4O A;  1MX7 A;  3FW4 A;  2R89 A;  2I5V O;  1RSU B;  3LK3 A;  1G90 A;  1QY1 A;  4ORY A;  5L8O A;  2X8F A;  4AYD C;  4NNS A;  2ACO A;  1FE3 A;  3VHH A;  4INN A;  1PTS A;  2KTS A;  4U8U N;  3FLL A;  3AA1 B;  4ZR2 A;  4U8U O;  1LKE A;  1DF8 A;  3EM0 A;  2C4I A;  3VZW X;  2NND A;  2L68 A;  1T1L A;  4PJ2 A;  3LTW A;  1AQB A;  4CV7 A;  5FQ6 E;  2HYS A;  4GCS A;  2IZH B;  2AVI A;  1RXH A;  1ZNG A;  4FRX A;  2KZ7 B;  4ALO A;  3MM0 A;  1GFP A;  2FT9 A;  1LDO A;  1VWM B;  1N43 A;  1VWN B;  3TGC A;  2GH7 A;  1LCV A;  1BWY A;  3G7G A;  3LK4 2;  5LJE A;  3U0D A;  3FDC A;  4Y0P A;  1JJU A;  2KXP A;  1EAL A;  1JYD A;  2KW1 A;  2DM5 A;  4ID2 A;  5K06 A;  4HWM A;  4YBP A;  1SWU A;  4CSB A;  2XKL A;  1SWB A;  1Y55 X;  3CQR A;  3PGU A;  2AKQ A;  4XMD A;  4BBO A;  3VPJ E;  1XCA A;  4O3Y A;  5BVT A;  2XE1 A;  2WJQ A;  4K3B A;  1K3B A;  1HXL A;  4I3C A;  5HTD A;  3AAE A;  4EKV A;  2Z4H A;  3DA4 A;  3STN A;  3SAO A;  3SZH A;  2KC0 A;  1KQW A;  1OBP A;  2BS6 A;  4BOE A;  2ZLD A;  4ON1 A;  5IYU A;  2G79 A;  4DQ4 A;  4KC8 A;  1EPB A;  2Q2P A;  3JQO A;  5AEO A;  3ZWE A;  4YDB A;  1VWB B;  2QO6 A;  3BLG A;  3EW2 A;  4O3W A;  2A13 A;  5EED A;  2Y32 A;  4FSO A;  1KL3 A;  3FA9 A;  3WJE A;  4A60 A;  3PEC A;  1FEL A;  2JW1 A;  5ADX K;  3NBX X;  1GT5 A;  1JYJ A;  3O22 A;  2YG2 A;  3S5V A;  3LK3 B;  3S5X A;  1SRG A;  1QY2 A;  4GF4 A;  2BT9 A;  5B29 A;  3JCU O;  2NP1 A;  5D45 A;  1HXU A;  5H9N A;  2GTL N;  3T0S A;  1SWQ A;  4ALB A;  1D2U A;  2L67 A;  2OVE A;  3WJF A;  4TJZ A;  1X8O A;  4FZN A;  4ORR A;  1X8U A;  1SWD A;  3SZJ A;  3N91 A;  4TKB A;  2JMM A;  4AFK A;  4TNN A;  2NNE A;  2RA6 A;  1ZHY A;  4ZJ0 A;  4YMY A;  3PH6 A;  5H8T A;  4LZU A;  5F7G A;  4AZR A;  1NBX A;  4HPB A;  2RCQ A;  1Q9G A;  2K4T A;  2R88 A;  3FEK A;  3EYC A;  2MF6 A;  2WPU A;  4YFQ A;  4QRL A;  2G78 A;  2K23 A;  5KID A;  2IZF B;  1FJ1 E;  4FUV A;  4LSI A;  5LJD A;  2X46 A;  1MUP A;  3SZI A;  4YFP A;  2J4U P;  1VYO A;  2K62 A;  3BRZ A;  1MM5 A;  2LFO A;  3DWO X;  5F6Z A;  1JJX A;  4ML7 B;  4DQ3 A;  1HQQ A;  1QJ9 A;  3DTQ A;  5AJB A;  2OF9 A;  2OL6 O;  4XNL A;  2OVS A;  2RN4 A;  4N74 A;  4RJX A;  1SWO A;  3FEN A;  3WXQ A;  3U9P C;  2WUT A;  5B11 O;  1B0O A;  1QQS A;  1SLD B;  1P6P A;  3RDO A;  2XTQ A;  1A3Y A;  3WZP A;  4GJS A;  3WOV A;  3PGR A;  2A2G A;  2OY8 A;  3G7X A;  3FR2 A;  2OY7 A;  2LBA A;  5B10 O;  2WVP A;  5IO7 A;  4XNK A;  2R4N A;  4AZP A;  3AAA B;  1ZNL A;  4C4V B;  1Y53 X;  3HOE A;  2RTC B;  1URE A;  4NYR A;  2OYB O;  5HWZ A;  1LF7 A;  1HBQ A;  4FQB B;  5KAF O;  2FKG A;  1EII A;  3K3L A;  4BJ8 A;  5BVS A;  1JV4 A;  2JN3 A;  5D48 A;  4HPC A;  2LHF A;  1NQM A;  2RQ0 A;  4D5U A;  4IB9 A;  2IWW A;  2CAM A;  2YMS A;  4N7C A;  3VY8 X;  4ZFX A;  4CPI A;  2CZU A;  1BLR A;  4O3X B;  4FBV A;  3RDM A;  1VWP B;  4IBA A;  4FT6 A;  2FR3 A;  3NX1 A;  5CYB A;  1DV9 A;  4AYN A;  4COT A;  1E02 A;  1SLF B;  2W2F A;  5DG4 A;  3NJT A;  4LSF A;  2MO5 A;  1MVG A;  2R74 A;  5G3A A;  3HW9 A;  4ORX A;  2Q4N A;  4YGZ A;  1VWA B;  1GFN A;  3QQ2 A;  3JSQ A;  1PRN A;  3KVD D;  3SYS A;  1MM4 A;  1BSY A;  3Q34 A;  4NLJ A;  2RTQ B;  3WI5 A;  1LID A;  2A3F X;  4RUU A;  3BSZ E;  3WU2 O;  1GX3 A;  1KT7 A;  1STR B;  4AZN A;  1ERB A;  3VHM A;  3VY9 X;  1CRB A;  1DZP A;  4CK4 A;  2RTD B;  1YWB A;  2KT4 B;  3QRA A;  5F6B A;  3NQ3 A;  4ZHC A;  5D8J A;  3PPT A;  3FYF A;  4ZHF A;  1OSP O;  3ZW2 A;  1SRI A;  2OL8 O;  4TKH A;  1K24 A;  2EU7 X;  2GTL O;  2C1Q A;  1IIU A;  1MX8 A;  5L8N A;  3CKF A;  4OKA A;  1QFT A;  3ZZV A;  1GX9 A;  3NQ9 A;  4XME A;  2CM9 A;  4GKC A;  3AA7 B;  2XMX A;  4B55 A;  3UEX A;  4OEL A;  3NSG A;  3RY2 A;  1VWI B;  1N7Y A;  2MHD A;  1UZ2 X;  3SOT A;  1GX8 A;  1IZN A;  3VE1 A;  4GGT A;  4AKR A;  3HWB A;  1THQ A;  1EXS A;  3P6E A;  4FOZ A;  3POU A;  5B2A O;  4QZT A;  4BQU A;  3CBC A;  2AT8 X;  1CBQ A;  1YIV A;  4OS0 A;  3ZW0 B;  1STS B;  1SWS A;  3KVN A;  4D65 A;  4CDF A;  4ES7 A;  1SWC A;  5B5E O;  3SLJ A;  4LQZ A;  3APV A;  3JTY A;  4JNJ A;  4KC7 A;  2BHV A;  4IAX A;  2CBS A;  5LKF A;  3AUM O;  2ALL X;  4C69 X;  4GK9 A;  1EIO A;  4AZM A;  3O2Y A;  3AA1 A;  4ODD A;  2GTF X;  4E1S A;  4O9S A;  1EQD A;  3L4R A;  4M7M A;  2KDY A;  7PRN A;  4QAE A;  3C77 X;  2AL0 X;  2X4M A;  1LNM A;  1PBO A;  5T5F A;  1ERX A;  2JU7 A;  2JU8 A;  3WZN A;  4JCH A;  2MWH A;  5FVN A;  1KGL A;  3P6G A;  5EDC A;  8PRN A;  2AMM X;  1AVE A;  1G74 A;  3C5O A;  3RDX A;  3A2S X;  1Z24 A;  4AZQ A;  4O4X A;  1ICM A;  1X8N A;  2HZR A;  3OBL A;  1A18 A;  2IZE B;  4U46 A;  4AW8 A;  4I3B A;  3PGS A;  2FKJ A;  1SWP A;  2Z4I A;  4GRJ A;  4GGR A;  1FDQ A;  1KL5 A;  2Q2M A;  2RTM A;  1HXZ A;  2KZ7 A;  4Z6J A;  1S2P A;  3KZA A;  3PRN A;  2FRS A;  4YGG A;  5EPQ A;  1SWH A;  2JQY A;  1SXW A;  4FQE A;  3NQK A;  4AUI A;  2BLG A;  4XMF A;  4RJW A;  1SY0 A;  1HN2 A;  4LKT A;  1KXO A;  2X27 X;  2XTR A;  4RLB A; 
#chains in the Genus database with same CATH homology
 3QRC A;  2NP1 A;  2GJ5 A;  3GAQ A;  5D45 A;  3TZS A;  1HXU A;  1BJ7 A;  3STM X;  3HWE A;  2GTL N;  5H9N A;  3LK2 B;  4XMH A;  3T0S A;  3FR4 A;  4ALB A;  5HZ9 A;  4BVM A;  1D2U A;  2W80 C;  4KH8 A;  2L67 A;  2OVE A;  3WJF A;  4TJZ A;  4ZGU A;  1X8O A;  3PH5 A;  4MVE A;  5FAZ A;  1LPJ A;  4OMW A;  1KT5 A;  3PQU A;  4FZN A;  4ORR A;  1QWD A;  1X8P A;  1X8U A;  1OPA A;  2L5P A;  3AA0 A;  4AZL A;  4Y0R A;  3Q6L A;  3N91 A;  4TKB A;  1IKJ A;  2RD7 C;  2JMM A;  4AFK A;  4TNN A;  5FEN A;  4GH7 A;  4ORW A;  2NNE A;  2RA6 A;  4IB6 A;  1TOW A;  1ZHY A;  1EPA A;  1IFC A;  4ZJ0 A;  5H9K A;  3VG7 A;  4YMY A;  5HCD C;  4GET A;  2M06 A;  3PH6 A;  3PP6 A;  4FMS A;  1OEE A;  2CM4 A;  5H8T A;  5DL5 A;  1TOU A;  2JMB A;  4LZU A;  4YKM A;  5F7G A;  4EDE A;  1OBQ A;  4R0B A;  5L8I A;  3K19 A;  4FBR A;  2GE4 A;  3GP6 A;  1G85 A;  1LIC A;  2YPV A;  3ZUO A;  4AZR A;  1SY2 A;  1G7N A;  4AYH A;  1IFB A;  1HXT A;  4HPB A;  4GZV A;  2X45 A;  3EMN X;  2RCQ A;  3D95 A;  1Q9G A;  1X8Q A;  2ZAI A;  2K4T A;  5AJC A;  3FEK A;  3EYC A;  2GTL M;  3BS2 A;  4IAB A;  1LIE A;  3FA6 A;  3MVF A;  4YFQ A;  4QRL A;  2G78 A;  2K23 A;  3KQ0 A;  1TVQ A;  4AKM A;  3VG5 A;  2AT6 X;  3LV4 A;  5KID A;  2Y7S A;  1QFV A;  4U3Q A;  4AYE C;  4AKR B;  4FUV A;  5EZ2 A;  1ZRY A;  3UPG A;  3CQN A;  5FFH A;  2WEW A;  2Y0L A;  3AAA A;  1DC9 A;  1QJ8 A;  3U03 A;  4LSI A;  2M07 A;  5LJD A;  3T24 A;  2X46 A;  1MUP A;  5H9A A;  1U17 A;  4GNY A;  1QY0 A;  2O4V A;  1GT3 A;  4YFP A;  2N2M A;  5DL7 A;  1KT6 A;  2J4U P;  3UEU A;  4A8Z A;  2K62 A;  1H91 A;  2WWP A;  4WFV A;  3UU2 A;  1MM5 A;  2LFO A;  1HBP A;  4I95 A;  3NX2 A;  2HNX A;  5F6Z A;  1JJX A;  1T0V A;  5LJB A;  3PED A;  4ML7 B;  1SY3 A;  4DQ3 A;  2XG6 A;  2JU3 A;  3RZY A;  5FQ8 E;  1IZN B;  3POQ A;  4PUX A;  4AYM C;  2OZQ A;  4UU3 A;  3DTQ A;  5IO6 A;  1QJ9 A;  5AJB A;  2QTK A;  4MVK A;  1ZHZ A;  3B2H A;  2IFB A;  3B2J A;  4I9S A;  3STK A;  4XNL A;  4FBO A;  2OVS A;  3TF6 A;  2RN4 A;  3FIQ A;  1ZNH A;  2LFU A;  4RJX A;  4EXZ A;  3FEN A;  3OD9 A;  2ZAG A;  5DPQ A;  1GM6 A;  1X89 A;  3WXQ A;  2K0L A;  3CBS A;  3OE3 A;  4NW4 A;  3U9P C;  2LKK A;  4M6S A;  3NPO A;  5HZ8 A;  5JR8 A;  2AT5 X;  4ZHG A;  4LZV A;  5FQ7 E;  1ADL A;  1SY1 A;  2WUT A;  3CWK A;  4GCP A;  4LKP A;  4O4U A;  3UAQ A;  4QGX A;  1KOI A;  3JS1 A;  1OSM A;  1E5P A;  1LIB A;  3KFG A;  4XMG A;  3SZV A;  1B0O A;  4RUN A;  4B61 A;  1GKA B;  4TLJ A;  1QQS A;  3RWX A;  3E3C A;  1KZW A;  3QKG A;  2P8G A;  1GT4 A;  5HA1 A;  1S7D A;  4D6A A;  1P6P A;  4I6S A;  1JZU A;  5JDP A;  5DL6 A;  2XTQ A;  3EBW A;  3FA8 A;  3EMM A;  1A3Y A;  3WOV A;  2Y2X A;  3WVM A;  4YFR A;  2A2G A;  2M4L A;  4UU2 A;  1BH3 A;  1ZHX A;  3LHN A;  3G7X A;  2KTD A;  1BSQ A;  2Q9S A;  3FR2 A;  3PQS A;  4O3Z A;  1MM4 A;  4FZM A;  5D5D A;  1TXL A;  2LBV A;  2LBA A;  4I3D A;  3SZD A;  4G75 A;  3D96 A;  2FS7 A;  5IO7 A;  1SMP I;  4GCQ A;  1OPB A;  1NP1 A;  4XNK A;  2GC9 A;  4K19 A;  4AZP A;  2Y0K A;  2YNK A;  5ADX L;  4QQ1 A;  4XMC A;  3AAA B;  3VG6 A;  3I17 A;  1YP6 A;  1ZNL A;  1BRP A;  2AT3 X;  3HWF A;  4OS8 A;  1BM5 A;  4KR4 A;  4QNI A;  3HOE A;  4KII A;  3P6C A;  1URE A;  4NYR A;  4EFG A;  3RBY A;  4QGV A;  6PRN A;  5HWZ A;  3F9D A;  1DZM A;  2JOZ A;  4MVL A;  1CJ5 A;  1FEN A;  2WSJ A;  5EDB A;  1LF7 A;  3VU1 A;  4YH0 A;  1GFQ A;  4QYP A;  4IB8 A;  1YWD A;  4MIR A;  4QYN A;  1HBQ A;  2R73 A;  4TQ2 A;  2QOS C;  4NP1 A;  4FQB B;  1OEK A;  4IMN A;  4MIS A;  3SY7 A;  3BU1 A;  1EII A;  1QAB E;  3F8A A;  3K3L A;  4N7D A;  5BVS A;  3WJB A;  4D6B A;  3CMP A;  3SYB A;  2XE5 A;  1JV4 A;  2JN3 A;  3HWD A;  4HPC A;  5D48 A;  2LHF A;  3FMZ A;  3HOL A;  2KXP B;  2QMI A;  4U9C A;  2AH7 X;  2FWV A;  2RQ0 A;  4D5U A;  1XKI A;  1HMT A;  1U0X A;  4GE1 A;  4IB9 A;  2FS6 A;  2XST A;  2YMS A;  4RLC A;  3AKM A;  4N7C A;  4ZFX A;  5CE4 A;  3VY8 X;  2XE3 A;  4LSE A;  5IO5 A;  4ZCB A;  4FRT A;  1GXA A;  4FGI B;  2CZU A;  2FR2 A;  1BLR A;  4O3X B;  4TKJ A;  1PMP A;  3MBT A;  3B2I A;  4YDA A;  4FBV A;  3T1D A;  2HZQ A;  5LJK A;  4IAW A;  1AVG I;  4IBA A;  1SXY A;  2X8S A;  5GV0 A;  2LB6 A;  4FT6 A;  2FR3 A;  3NX1 A;  1E06 A;  4OS3 A;  3O0E A;  1HQP A;  5CYB A;  1DV9 A;  2ODJ A;  4AYN A;  4COT A;  2F1V A;  1E02 A;  2FGQ X;  2W2F A;  5EEE A;  5DG4 A;  1KZX A;  4LSF A;  3RBH A;  2MO5 A;  2W2A A;  3POR A;  4N59 A;  3UEW A;  1MVG A;  2R74 A;  2W2B A;  1BEB A;  5LKE A;  1BXW A;  1ML7 A;  3C78 X;  4AZO A;  3HW9 A;  1VYG A;  3KFF A;  1MDC A;  4ORX A;  2Q4N A;  4YGZ A;  4O49 A;  3BDR A;  2MNH A;  1YP7 A;  1ORM A;  1GFN A;  3B2K A;  3BU9 A;  3JSQ A;  1R0U A;  4ZGF A;  1PRN A;  5ADX K;  3SY9 A;  3UEV A;  3AA0 B;  2WQA E;  3IA8 A;  1OPF A;  1P4T A;  3KVD D;  3KFI A;  2QO5 A;  1YS5 A;  3SYS A;  2F09 A;  2F73 A;  1ICN A;  1LIF A;  1SA8 A;  3P6F A;  4Y0Q A;  1CBR A;  1BSY A;  1O1U A;  3F6Z B;  4U8U M;  4YGH A;  4NLJ A;  5B27 A;  3VE2 A;  1O1V A;  2PRN A;  3WI5 A;  1KQX A;  4JFB A;  1RBP A;  1LID A;  4Y0S A;  2A3F X;  4RUU A;  4E1T A;  3S60 A;  1YWA A;  4KT5 A;  3BSZ E;  3WJC A;  1KT7 A;  1X71 A;  3TGB A;  1BT9 A;  5G26 A;  1RLB E;  4AZN A;  3T20 A;  5LJH A;  1ERB A;  3BY0 A;  3B2L A;  3KFH A;  5F58 A;  1DZK A;  3VY9 X;  1GKA A;  2ACP X;  1B8E A;  1OEJ A;  1CRB A;  1DZP A;  3AKN A;  3WBG A;  4CK4 A;  1B4M A;  2W81 C;  4EQA C;  1ALB A;  2POA A;  4OMX A;  1YWB A;  4KCA A;  1SXU A;  2KT4 B;  3VG4 A;  3QRA A;  5H9L A;  1T68 X;  5F6B A;  1E54 A;  4ZH6 A;  1BSO A;  3NQ3 A;  4ZHC A;  4GHB A;  3FEL A;  1VYF A;  2MM3 A;  1T8V A;  3FW5 A;  5D8J A;  3PPT A;  3RSW A;  4ZHD A;  2QM9 A;  3FYF A;  5C0N A;  5D47 A;  2XE2 A;  4YBU A;  3WJG A;  1ACD A;  4ZHF A;  2WQ9 A;  3ELZ A;  1S44 A;  4Z3T A;  4I9R A;  3APW A;  1BRQ A;  3ZW2 A;  4A1Y A;  2O62 A;  1JBH A;  3P6H A;  1HMR A;  3H3I A;  1KT4 A;  4TKH A;  1FEM A;  2EU7 X;  2GTL O;  1QJP A;  4N58 A;  2WEX A;  3S26 A;  5HAE A;  1IIU A;  1MX8 A;  5L8N A;  2PY1 A;  4O4O A;  2OFM X;  2OVA A;  5PRN A;  1QFT A;  5BYP A;  2MJI A;  5HTE A;  2CZT A;  3RKG A;  3ZZV A;  1GX9 A;  1MX7 A;  3FW4 A;  2LA7 A;  3NQ9 A;  4XME A;  3C76 X;  3LK3 A;  1G90 A;  1QY1 A;  2CM9 A;  1IKE A;  1TW4 A;  3NAD A;  4GKC A;  4ORY A;  3AA7 B;  2XMX A;  5L8O A;  2X8F A;  3UEX A;  3VZU X;  4AYD C;  4NNS A;  2ACO A;  1FE3 A;  5KIC A;  2E4J A;  4AYI D;  1ZHW A;  4INN A;  4LSH A;  1CBI A;  1H6S 1;  3TZG A;  1GT1 A;  4NLI A;  3NSG A;  3NR3 A;  1B56 A;  2ERV A;  5HZ6 A;  2HMB A;  3ZW0 A;  2KTS A;  1DFV A;  4U8U N;  3FLL A;  3AA1 B;  4ZR2 A;  4NYQ A;  5HCC C;  4U8U O;  2MHL A;  2FLJ A;  1LKE A;  1LFO A;  4YCH A;  1Y9L A;  3BX8 A;  3BX7 A;  1ZNK A;  1SXX A;  2MHD A;  1UZ2 X;  3EM0 A;  3SOT A;  1GX8 A;  1HMS A;  1IZN A;  3HTY A;  2NNQ A;  4FZL A;  4GNW A;  3VZW X;  3VE1 A;  1BBP A;  3BRN A;  3HK1 A;  3AA6 A;  2NND A;  2L68 A;  3HWG A;  4PJ2 A;  2X8T A;  5HZQ A;  5BVQ A;  1AQB A;  4CV7 A;  1G5W A;  4AKR A;  3HWB A;  1QG5 A;  5FQ6 E;  3LK4 1;  2HYS A;  1THQ A;  2OVD A;  1EXS A;  3WI4 A;  3FEP A;  3P6E A;  5F1E A;  4FOZ A;  3EBK A;  3I0A A;  4F4B A;  4GCS A;  4WFU A;  3POU A;  1FTP A;  3OJY C;  4QZT A;  4BQU A;  1ZNG A;  3CBC A;  4FRX A;  2AT8 X;  5DL8 A;  2Y0H A;  1CBQ A;  4ZH9 A;  1YIV A;  3NP1 A;  3ZUI A;  4ALO A;  1GFP A;  2KZ7 B;  1KT3 A;  2FT9 A;  1YWC A;  4KR8 A;  4WBK A;  4OS0 A;  3ZW0 B;  3FA7 A;  1I06 A;  4HPA A;  5EE2 A;  4D65 A;  4L3R A;  4ES7 A;  4O4S A;  4EEJ A;  3TGC A;  1VPR A;  3G7G A;  4LQZ A;  1BWY A;  3LK4 2;  3AA6 B;  3APV A;  2ANS A;  5LJE A;  3U0D A;  3JTY A;  4KC7 A;  3AA7 A;  2BHV A;  4IAX A;  4MVI A;  4Y0P A;  2CBS A;  5LKF A;  4BUM X;  2N93 A;  1I4U A;  2ALL X;  2KXP A;  4C69 X;  1EAL A;  1JYD A;  2KW1 A;  2DM5 A;  4ID2 A;  4GK9 A;  1EIO A;  4AZM A;  3O2Y A;  5LJC A;  5K06 A;  4ODD A;  4HWM A;  4YBP A;  3D4R A;  5KHP A;  3AA1 A;  4KRA A;  3ZW1 A;  4CSB A;  2G7B A;  2XKL A;  3APU A;  4G76 A;  5HCE C;  2GTF X;  4E1S A;  4O9S A;  1EQD A;  3CQR A;  1IW2 A;  3L4R A;  4M7M A;  2L9C A;  4PSQ A;  4QZU A;  2KDY A;  2RCT A;  7PRN A;  1L6M A;  4QAE A;  3C77 X;  2QO4 A;  3FR5 A;  1A2D A;  2AL0 X;  2KD2 A;  3ZQ3 A;  1LNM A;  1PBO A;  2AKQ A;  5T5F A;  1PM1 X;  4XMD A;  1ERX A;  5AFU K;  3VPJ E;  1MPF A;  2JU7 A;  2JU8 A;  1XCA A;  4JCH A;  4WHI A;  3WJD A;  4O3Y A;  3D97 A;  3P02 A;  2MWH A;  5BVT A;  2XE1 A;  1NP4 A;  1YUP A;  4YKO A;  5FVN A;  1KGL A;  3P6G A;  2HLV A;  5EDC A;  8PRN A;  4I3C A;  3P24 A;  2ASN X;  5HTD A;  1EI5 A;  3AAE A;  2Z4H A;  1N0S A;  3DA4 A;  4GU8 A;  3STN A;  2FGR A;  3SAO A;  2AMM X;  2WR6 A;  4ARH A;  1ZNE A;  4JGL A;  1G74 A;  4L1N A;  1GFM A;  3C5O A;  4GDZ A;  3A2S X;  1Z24 A;  1GGL A;  4AZQ A;  4O4X A;  1ICM A;  1AEL A;  2KC0 A;  1KQW A;  3V8U A;  1O8V A;  1AB0 A;  1OBP A;  1X8N A;  2HZR A;  3OBL A;  1PEE A;  2BS6 A;  1PHO A;  1EUO A;  3VZT X;  3FYX A;  1EW3 A;  1A18 A;  4BOE A;  1GFO A;  4ORS A;  4IB7 A;  2ZLD A;  5LJG A;  4ON1 A;  4AW8 A;  4HFO A;  2J1N A;  2R56 A;  1ZHT A;  2POR A;  5HBS A;  5IYU A;  2G79 A;  4D64 A;  4DQ4 A;  4I3B A;  3GE2 A;  4KC8 A;  1I04 A;  1EPB A;  2FTB A;  2Q2P A;  3JQO A;  2OMF A;  2Z4I A;  1DF3 A;  4FES A;  5AEO A;  2CBR A;  3ZWE A;  3AAE B;  4GRJ A;  1OBU A;  4YDB A;  2F1T A;  3IFB A;  3P6D A;  3ZI8 A;  2QO6 A;  3LK2 A;  1FDQ A;  3BLG A;  2N2L A;  5AFU L;  3O19 A;  4O3W A;  2Q2M A;  3ELX A;  3ZW1 B;  2KZ7 A;  4QGW A;  1CBS A;  2A13 A;  3VG3 A;  5EED A;  1I05 A;  1S2P A;  3KZA A;  1DZJ A;  2A2U A;  3DA3 A;  2Q39 A;  4FSO A;  1ZND A;  3PRN A;  3FA9 A;  1E00 A;  1D3S A;  2FRS A;  4YGG A;  5EPQ A;  5HA0 A;  3WJE A;  4ZHH A;  5HZ5 A;  4ORU A;  1Q9F A;  2AT0 X;  1U18 A;  1SXW A;  3MX7 A;  4A60 A;  3NQK A;  3PEC A;  1NGL A;  4AUI A;  2BLG A;  2ZFG A;  4IMO A;  3POX A;  1JJJ A;  2A0A A;  4XMF A;  3TGA A;  1FEL A;  2JW1 A;  4RL9 A;  3APX A;  4A1H A;  5AQ6 A;  2BS5 A;  4RJW A;  3NBX X;  1JIW I;  1GT5 A;  1JYJ A;  1Y9T A;  2YG2 A;  1SY0 A;  3O22 A;  4NNT A;  3S5V A;  3S5X A;  3LK3 B;  1HN2 A;  1A57 A;  4LKT A;  1QY2 A;  4GF4 A;  3DSZ A;  1KXO A;  2X27 X;  2BT9 A;  5D4A A;  5B29 A;  2XTR A;  4RLB A;  2OFR X;  4HPD A;  1HXX A;  4FSP A;  3CR6 A;  3VG2 A;  4YCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...