4O3XB

Crystal structure of the vaccine antigen transferrin binding protein b (tbpb) mutant phe-171-ala from actinobacillus pleuropneumoniae h49
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
241
structure length
241
Chain Sequence
b'PALGYVVKVPVSSFENKKVDISDIEVITNGNLDDVPYKANSSKYNYPDIKTKDSSLQYVRSGYVIDGEHSGSNEKGYVYYKGNSPAKELPVNQLLTYTGSWDFTSNANLNNEEGRPNYLNDDYYTKAIGKRVGLVSGDAKPAKHKYTSQFEVDFATKKMTGKLSDKEKTIYTVNADIRGNRFTGAATASDKNKGKGESYNFFSADSQSLEGGFYGPKAEEMAGKFVANDKSLFAVFSAKHN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonbinding site-directed mutants of transferrin binding protein B exhibit enhanced immunogenicity and protective capabilities.
pubmed doi rcsb
molecule keywords Transferrin binding protein B
source organism Actinobacillus pleuropneumoniae
molecule tags Metal transport
total genus 64
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 4o3xB01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4o3xB02
3KVDD 3HOEA 3PQUA 5T5FA 2KDYA 4O49A 4AYNA 4O3WA 2W81C 1YS5A 2W80C 2YPVA 2KC0A 4O3YA 4QQ1A 4AYEC 4Z3TA 5EE2A 4O4UA 4O3ZA 4AYMC 4AYDC 3HOLA 3UAQA 3VE1A 3VE2A 3PQSA 3V8UA 4U9CA 2LFUA 4O4XA 2Y7SA 4O3XB 4AYID
chains in the Genus database with same CATH superfamily
1AVEA 4BGFA 2RD7C 3B2KA 3MBTA 5FVNA 2G7BA 7PRNA 1NP4A 3BU1A 2FGRA 1WBIA 2BT9A 4AFKA 2GTLN 2J4UP 1AVDA 3WZQA 1BJ7A 2AT3X 2RTBB 1D2UA 4RL9A 2IZAA 2I5VO 4EEJA 1VYFA 2WVPA 1PRNA 3U9PC 1E00A 4I3BA 2ACOA 2RTJA 4BX5A 2G79A 4B55A 2FS7A 1MM4A 2RTEB 1VWRB 3D4RA 2KTDA 4U9CA 3PH6A 4Y5DA 1QABE 1MK5A 1QFVA 2L5PA 2BC3A 4FBRA 4GE1A 5LJDA 1DF8A 2X55A 1MM5A 4OMWA 1SWNA 2G8CO 3G7XA 2UYWA 4IMOA 4IB9A 5HCDC 3F8AA 3AA1B 2X56A 1JJJA 1JV4A 1HXXA 4TNNA 5HZ5A 2F01A 3QRCA 2OY5O 2J1NA 2W80C 1BSOA 1E06A 2OFAA 5EPQA 5F6BA 4A60A 1YWAA 3EMNX 1KT5A 1SWOA 3NADA 2KZ7A 3WYQA 5IO7A 4ZHDA 2G5LA 3C5OA 1I06A 3NPOA 4U3QA 5LJHA 1PEEA 2DJGA 1CBQA 4BOEA 4UB6O 3WU2O 5B5GA 2ZAGA 2HZRA 1UYNX 3VG6A 1JYJA 4OS8A 1CBRA 3NJTA 4NNSA 3PECA 3PGRA 1LIFA 4KCAA 2A8GA 3HWBA 1SLFB 4EXZA 3VU1A 1GX9A 3RBYA 4AZOA 2OVSA 3AAEB 1ICMA 2CM9A 3Q34A 4QAEA 4O9SA 4JCHA 2X34A 1LCZA 3ZZVA 8PRNA 3CKFA 2IZIA 1IZNB 1VPRA 3WVMA 2MNHA 4MIRA 2L68A 1SWCA 1DV9A 5JDPA 3FENA 3HWFA 3O0EA 4MVEA 1IKEA 1RAVA 2Z4IA 4NNTA 1KZXA 3WJEA 1E5PA 2Y0KA 1YP6A 3G7GA 4OELA 3CBCA 3TGAA 3I17A 4BX7A 4C00A 1W4TA 3APXA 4QZUA 4RLBA 3RBHA 2Q4NA 2X8SA 4KC8A 3LK2B 3LV4A 1OBPA 4O3XB 5B3MO 4EDEA 3WYPA 3SYBA 4KR4A 2KC0A 2Y32A 2POAA 2RTQB 3S5VA 4HWMA 4LSEA 4YBPA 1X8PA 2LHFA 4GCQA 5GTIO 1BLRA 4KR8A 2FS6A 2MHLA 4N74A 2FHNX 4I3CA 3FELA 2FWVA 4IB6A 1N4JA 2MHDA 3BLGA 1VYOA 1KL4A 4ORWA 5ADXK 1T16A 1JJXA 5DL5A 1IIUA 1N9MA 3UPGA 3VHIA 3Q6LA 3KVNA 2P8GA 2Y0HA 4Y0QA 5IYUA 3S26A 1BM5A 3CBSA 1AVGI 4PR7A 1OSMA 3VHHA 4L1NA 1OPBA 3WZPA 3AKNA 6PRNA 5FQ8E 3D97A 3BSZE 2RCQA 4AYID 2OFMX 2GTFX 2FHLA 2OVEA 3MG5A 1SXWA 3PK2A 4ZFXA 3B2IA 1GFQA 3EBKA 3T6FA 1LIBA 4AYMC 3P6FA 4N75A 3FR2A 1PBOA 3EW1A 1IJ8A 5AFUK 2MM3A 2IZEB 5G3AA 4GJVA 3KVDD 3U0DA 1MX7A 3LTWA 2WUTA 3UEUA 3BRYA 1BSYA 1SWKA 1HMRA 4O4OA 1JZUA 4UU2A 1SWHA 2CZTA 3RY2A 1ZNHA 2GJ5A 1AQBA 1X8QA 4YDAA 1WUBA 2WQ9A 1KT7A 3HOEA 4KIIA 4K3BA 4COTA 4ZH9A 4YDBA 3HW9A 2X4MA 1JQPA 5HTDA 3IFBA 1GT4A 5K67A 2HNXA 2JU3A 3FEPA 5HZ9A 1HMSA 2R74A 1KT3A 4LZUA 3APUA 1ZHZA 1SMPI 2ASNX 4YVBA 4B61A 4AW8A 2KXPB 4Y0PA 3AA0A 5EDBA 3FR5A 4FMSA 1N43A 3N91A 5HBSA 3AA1A 2Y2XA 4CSBA 5KAIO 2RTIB 1A3YA 1KQWA 3B2JA 2A3FX 5L8IA 4YGGA 4G75A 1VWPB 1GT1A 2VFBA 2OY8A 4IMNA 3WI5A 3CKGA 4M6SA 4YH0A 3ZWEA 4WBKA 2BS6A 5H9KA 2L67A 1I4UA 2OZQA 1YUPA 3S5XA 4GDAA 2FRSA 1BRQA 4AKRB 3FW4A 4FGIB 4CDFA 4CDEA 4ALOA 3CQNA 1LCVA 1SWSA 1HXLA 4IBAA 4INNA 2M4LA 3DA3A 2M06A 1I04A 2F1CX 3F9DA 4OMXA 3PPTA 5HTEA 2YNKA 4PJ2A 3AAEA 3EC5A 1VYGA 4BQUA 1VWGB 5BYPA 5G26A 3KFIA 4TKBA 4BUMX 4GD9A 1ZHXA 4GRJA 3OD9A 1ZNKA 1IW2A 4FBOA 4GK9A 3O2YA 4N58A 3SLTA 4Z27A 1IZNA 4RJXA 2QOSC 5EDCA 1LIDA 2PI3O 4MEEA 5B10O 4NV7A 1E2TA 4AYEC 5G39A 3MX7A 5H8TA 3FLLA 2I5ZO 2CM4A 3STKA 4FZLA 1BEBA 1NDJA 4CPFA 3P6HA 2JQYA 3RWXA 2RCTA 3LK3B 3VZUX 1Y53X 2R56A 4DQ3A 2LKKA 2X8TA 2PORA 3WOVA 3STMX 3P02A 1VWEB 3SZIA 2LB6A 2Y3EA 4QQ1A 3BU9A 4O4UA 3LK2A 3FMZA 3ZW0B 3FA7A 5LKFA 1UZ2X 2AL0X 3EW2A 1QFTA 2LBVA 3FA8A 1T8VA 1SWUA 1DC9A 4I3DA 5LJKA 3NR3A 4FSPA 1RBPA 4O3ZA 2AMMX 1PTSA 1YWDA 4FQEA 4LKPA 2X45A 4ZCBA 4CV7A 3AAAB 4OEMA 3WJDA 1SWBA 2RTCB 4AKMA 2IZFB 2Z4HA 4U8UM 3POQA 2A5BA 2MJIA 1JBHA 3AUMO 4BBOA 5HAEA 4N7DA 1SREA 1GM6A 1QQSA 4YFQA 5IO6A 3B2LA 1QY1A 2AKQA 2IWVA 2ZAIA 2GTLO 1STSB 3FEKA 4LSIA 2Q2PA 3D96A 3A0HO 2RTRB 1Y9LA 5HWZA 3U03A 1ORMA 3RKGA 3HPEA 1YS5A 3VG5A 4QYNA 3EYCA 2ZFGA 3VY9X 1PHOA 4XNKA 4U8UN 4JNJA 3T20A 2F73A 1VWCB 3WJCA 4NYQA 1P4TA 1B0OA 5LJGA 1SXXA 2YMSA 3PP6A 1S5LO 3WXQA 4FT6A 1KZWA 2FT9A 3FIQA 3FYXA 5T5FA 2AT8X 1DZKA 3RE6A 1U0XA 1SY0A 1ERBA 2N2LA 3SLJA 1JYDA 2JGSA 1FEMA 1S2PA 4GGZA 3P24A 5LJBA 1UYOX 3PF1A 2DJFA 1SRIA 1I05A 2CBSA 3RDXA 1TOWA 4GH7A 5IRUA 2OF8A 4QNIA 1B56A 3LHNA 3EBWA 4IABA 5DPQA 2IZLB 1BXWA 3PH5A 3AA6B 3GP6A 4BCSA 5KICA 1DZJA 1YWBA 5L8NA 4HPCA 3RDSA 4C69X 2FTBA 2F1VA 2CBRA 3D9WA 4BVMA 4TKHA 1HMTA 3QRAA 4ON1A 1SA8A 4UB8O 4GJSA 4FRTA 4AYDC 1GFMA 4WHIA 5B27A 1SWFA 1KOIA 2GH7A 3SYSA 2KXPA 1LCWA 4ZHHA 1CBSA 1YP7A 1ZNDA 4AYHA 3VG3A 1FTPA 1VWDB 1KXOA 4I9RA 4MVLA 2AT0X 3OBLA 1KQXA 3HOLA 5D48A 4QGWA 3BRNA 2K0LA 1BT9A 1FELA 2BHVA 5AQ6A 4NYRA 3UEWA 1L6MA 4ES7A 3A0BO 3ZUIA 3NX1A 5HA1A 5F1EA 3OE3A 3UU2A 4JGLA 3DWOX 4DQ4A 4AZLA 2ANSA 1VWAB 1HXUA 2N2MA 4AKRA 2GC9A 2G78A 1E54A 3T24A 1VWOB 5EZ2A 3ZW1B 4LKTA 2XE2A 1QJ8A 1SWGA 2IZHB 4GGTA 4ZHGA 4ARHA 1O1VA 1I78A 2CZUA 3DSZA 4CPHB 1NQMA 2R8AA 4JHQA 2R73A 3O19A 1BSQA 1H91A 5IO5A 4HPAA 4WFUA 3H3IA 3FIDA 4HPDA 4YCEA 3FR4A 4PJ0O 2QM9A 2HZQA 5LKEA 4OS0A 2R4OA 2JW1A 5FENA 2ERVA 2OVDA 1LIEA 1GT3A 3HWGA 3AA7B 4D5UA 2RTMA 3EM0A 1TXLA 2A2GA 1GX3A 1QY2A 2LA7A 5LJEA 1CRBA 1ALBA 4I9SA 4XNLA 3VPJE 1X8UA 4F4BA 5H2FO 3HTYA 1VWHB 2IZKA 5JD2A 3VHMA 2FLJA 5L3YA 2YPVA 5AJCA 5EEDA 4YFPA 3LK3A 4Z2VA 4IAWA 2RN4A 5KIDA 1G5WA 3WJGA 1ML7A 2HKDA 4G76A 1TVQA 3KQ0A 3ZW0A 1HBPA 4FOZA 4EFGA 2RTNB 1MEPA 3PDFA 4MVIA 1EALA 1SLGB 1SWLA 3V8UA 1KFFA 3CR6A 3WJFA 4GKCA 1AB0A 3BX8A 5KAFO 5IRWA 4XMFA 4FQBB 1ZHYA 5F7GA 2JN3A 3L4RA 2WJRA 4BX5B 4Z2PA 3QQ2A 1R0UA 3T2WA 3RDOA 2WEWA 1N9YA 3T2XA 5B29A 1TW4A 2OFRX 1ZNLA 4M7MA 1LICA 2AH7X 5FAZA 3GE2A 1X89A 1SWQA 1HBQA 5B11O 3WJBA 2DM5A 2K62A 1SLDB 1O8VA 2R89A 1A57A 1FE3A 2KTSA 4LQZA 4JFBA 3KZAA 4ORUA 5FQ7E 1Y52X 2QCBA 4QGXA 4FSOA 3DTQA 5LJCA 5JR8A 3SZJA 1Y9TA 1Y55X 4AZRA 3PGUA 4GCPA 2OMFA 3BX7A 1SWTA 4MVKA 5D45A 4YCHA 1OBUA 2WJQA 4ORYA 2E4JA 2JMMA 4FZNA 1AELA 1EW3A 5D47A 5BVSA 4IB7A 1K3BA 4R0BA 2C1SA 1PM1X 1FENA 3AA6A 3RDMA 2RTLA 2L9CA 3F6ZB 4EKVA 3WBGA 4NLIA 4CPEA 2JU7A 2WPUA 1Q9FA 2KW1A 1LNMA 2KT4B 1VWNB 3RDUA 1OEJA 2WR6A 5IRAA 2HYSA 3O22A 4PUXA 5D8JA 3SZHA 1QG5A 2WQAE 1W5RA 5DG4A 4AZQA 2MF6A 3AKMA 4ML7B 2MO5A 2EU7X 3KZIO 1IKJA 2R88A 2JOZA 4RUNA 1JIWI 4FESA 3CQRA 5HZ6A 3JQOA 1XCAA 1D3SA 1SRFA 1GFNA 5H9NA 4NW4A 1Z24A 3BRZA 5TISO 2NP1A 4TKJA 1G90A 1STRB 3HK1A 4K3CA 4RJWA 1MX8A 1QY0A 2PRNA 1CBIA 3C77X 1VWLB 2FGQX 5B5FA 2A2UA 4TQ2A 3ZW1A 1ADLA 1N7YA 4LSHA 2X9KA 5EE2A 3JS1A 2N93A 2Q9SA 1GFOA 2XG6A 3UAQA 4CPHA 1DZMA 2VFCA 4YKOA 1T0VA 4KH8A 2R4LA 2YG2A 3VG7A 2FR3A 4DCBA 4O4XA 3ZI8A 1SWJA 2Y7SA 5GV0A 1BBPA 1ZNEA 1MPFA 2Y0LA 3T6LA 3NQ3A 1Q9GA 4Z6JA 4XMEA 3PGSA 1HXZA 3OJYC 4YFRA 2Y3FA 1KT4A 1SY3A 1GKAB 2IZBA 1SLEB 5KHPA 3NSGA 2KDYA 2F1TA 4ORSA 2IZGB 4FZMA 1RSUB 4LZVA 4ORXA 1EI5A 1T68X 1STPA 4GGRA 4GNWA 3PORA 5HCEC 2UZ2A 4CTDA 3NQKA 3UEVA 3T1DA 1OPFA 4GUZA 4ZJ0A 3D95A 2K4TA 3NQ9A 2NNEA 4ID2A 5HZ8A 4ODDA 3QKGA 4DNEA 2OYBO 5BVQA 1JMZA 1LFOA 2Q2MA 3STNA 4HFOA 3APVA 1THQA 3JSQA 2Q39A 4O3YA 1X8NA 4U8UO 2QO5A 2RA6A 3TGBA 2WWPA 5G38A 5FFHA 5CHKA 3WZOA 1EQDA 1NP1A 1X71A 4NV8A 2QMIA 3P6GA 4I60A 1LDQA 5B66O 3GAQA 2AXTO 4D6BA 2AVIA 1RXJA 1RXKA 2RTFB 3IA8A 3C78X 2VDFA 3BDRA 2RTAA 4GZVA 1LF7A 1JMXA 4GU8A 4CDDA 3DA4A 1VWMB 1SXUA 3P6EA 3MVFA 1EPAA 4I6SA 1ZHTA 2F09A 3ZUOA 2OL7A 5DL7A 2IWWA 3VG2A 5D5DA 4IRWA 4ORRA 1FJ1E 1I9HA 2HLVA 3AA0B 5F2BA 5DL6A 3RDQA 3TZGA 4OKAA 1ERXA 1DF3A 3ELZA 2NNDA 1UREA 3ELXA 3TF6A 1KL5A 3HWDA 1PMPA 4OS3A 5PRNA 3POXA 5H9AA 4XMDA 4E1TA 3PRNA 1Y0GA 5HCCC 2W2AA 4JO6A 5AEOA 4E1SA 4BX6B 1P6PA 1W6FA 2ALLX 4D6AA 4YGHA 1S7DA 3FYFA 2K23A 5F6ZA 4O49A 3RY1A 3DWNA 4AZMA 3JTYA 4XMHA 4MISA 1EXSA 2A0AA 1OEEA 5D4AA 3PQSA 4GETA 4AZPA 2OVAA 2ODJA 1ACDA 3I0AA 3NBXX 5CSEA 5F58A 4A8ZA 3CWKA 2RQ0A 5IXGA 4AUIA 4Z3TA 3KFFA 2AT6X 2XKLA 1SRGA 2FR2A 1MDCA 4Y59A 2W2BA 2WEXA 4Z2OA 1RLBE 2FGSA 4U46A 1HN2A 4KC7A 4PSQA 4C4VB 2AF5A 1XKIA 2XTRA 4CPIA 2MWHA 4YGZA 2XE3A 4N59A 1IFCA 1GX8A 1K24A 3TZSA 4YMYA 1KGLA 5H9LA 5C0NA 1BWYA 1H6S1 3POUA 4HPBA 2IFBA 5K68A 2XMXA 1CJ5A 1HXTA 1NGLA 4NP1A 3SAOA 2XTQA 2AT5X 1VWKB 4A1YA 4L3RA 1U17A 1HQQA 1LPJA 3SZDA 3FA9A 1RSTB 1PBYA 4GCSA 2GE4A 4KRAA 1ICNA 3FA6A 3VGWA 5AJBA 4Z28A 4N7CA 1T1LA 1SWEA 3SZVA 4I95A 1GKAA 3SLOA 4KT5A 1OPAA 3PEDA 2PY1A 1VWBB 5B5EO 1QJ9A 3B2HA 2R4PA 2X46A 2LBAA 3RE5A 3AAAA 5K06A 3JCUO 1ZRYA 3A2SX 4BJ8A 1MOYA 2LFOA 3VZTX 1HQPA 2ACPX 3KFHA 3K3LA 1BRPA 1NBXA 2JU8A 3PQUA 5ADXL 1SRHA 3ZW2A 1LDOA 1EIIA 4D64A 1GXAA 2A5CA 4YKMA 1BH3A 2X8FA 2QTKA 2XSTA 4ZGUA 3K19A 2OY1O 3C76X 2BS5A 5EEEA 1G85A 2QO6A 3RSWA 1VWFB 2WSJA 3DZMA 1U18A 1SRJA 1G74A 2X32A 3KFGA 1QJPA 4FBVA 2QOMA 3UEXA 3AEHA 4IAXA 1ZHWA 4RUUA 1SXYA 3NP1A 1S44A 4FUVA 2LFUA 1G7NA 2IZDB 3BS2A 2KZ7B 2O4VA 1IFBA 4FRXA 1VWJB 4AYNA 4O3WA 2OY7A 2IZCB 5BVTA 1EIOA 2W81C 5AFUL 1MM9A 1DFVA 2FKJA 3SY9A 1A18A 1MVGA 4XMGA 4CK4A 3APWA 1ZNGA 3VG4A 2A13A 2C4IA 1LKEA 2RTKA 2RTHB 2QO4A 3WI4A 1SY2A 3VE1A 5HA0A 3VE2A 4XMCA 1MUPA 3LK41 4GNYA 4GF4A 2OL8O 4O4SA 1X8OA 1VWQB 4Y0RA 1QWDA 5E79O 2JMBA 3CMPA 4ZR2A 4ZGFA 3ZQ3A 5HZQA 1RXHA 2W2FA 2CAMA 4A1HA 5DL8A 1NQNA 1GGLA 1EUOA 2FKGA 3FW5A 4QRLA 2IZJA 4IL6O 4BX6A 4AZNA 1N0SA 4LSFA 2M07A 4C5PA 4D65A 4RLCA 3BY0A 3E3CA 5L8OA 4ZH6A 3MM0A 1B4MA 1LUQA 4EQAC 4Y0SA 4BX7B 2RTGB 2OF9A 4NLJA 3X00A 2ZSCA 3LK42 1YWCA 2C1QA 1HY2A 2O62A 1KT6A 1GT5A 2RTPB 4CDCA 3HWEA 1YIVA 1E02A 2HMBA 2RTDB 1OSPO 4UU3A 1OBQA 1NC9A 1A2DA 4ALBA 4K19A 2BSZA 1SWAA 1SY1A 4C4VA 4QZTA 3EMMA 4TJZA 3SY7A 3RZYA 1OEKA 3AA7A 1GFPA 1FDQA 3T0SA 1SWPA 2KD2A 1EPBA 4TLJA 5CYBA 2OFBA 3WZNA 1SWRA 5CE4A 1JJUA 2ZLDA 5GTHO 2BLGA 4QYPA 1DZPA 2OL6O 2RTOB 2XE5A 1O1UA 4ZHCA 5B2AO 3P6CA 2NNQA 3VZWX 4GDZA 4WFVA 3SOTA 1TOUA 4QGVA 3FDCA 2GTLM 3TGCA 3S60A 4YBUA 4ZHFA 3BS0A 1SWDA 2X27X 3P6DA 4IB8A 1B8EA 1LELA 3NX2A 1KL3A 5FQ6E 1VWIB 2R4NA 2XE1A 4GHBA 3VY8X
chains in the Genus database with same CATH topology
4GKCA 1AB0A 3FYFA 2K23A 5F6ZA 2RD7C 3BX8A 3B2KA 4O49A 3CQNA 3MBTA 5FVNA 2G7BA 7PRNA 1NP4A 3BU1A 4AZMA 2FGRA 3JTYA 4XMHA 4XMFA 4IBAA 4INNA 2M4LA 4MISA 1EXSA 2A0AA 4FQBB 1ZHYA 3DA3A 2M06A 1OEEA 5D4AA 5F7GA 2BT9A 3PQSA 1I04A 2JN3A 3L4RA 4AFKA 2GTLN 3F9DA 4OMXA 3PPTA 5HTEA 2J4UP 2YNKA 1BJ7A 2AT3X 4GETA 4PJ2A 4AZPA 1D2UA 2OVAA 1R0UA 2ODJA 3AAEA 4RL9A 1ACDA 3I0AA 1VYGA 3NBXX 5F58A 4EEJA 4A8ZA 4BQUA 5BYPA 1VYFA 2RQ0A 3CWKA 5G26A 2WEWA 3KFIA 4TKBA 4BUMX 5B29A 1PRNA 1TW4A 1ZHXA 2OFRX 4GRJA 3U9PC 4AUIA 3OD9A 1ZNLA 4M7MA 1ZNKA 1E00A 1IW2A 4FBOA 4GK9A 2ACOA 4I3BA 4Z3TA 1LICA 3O2YA 3KFFA 2AH7X 4N58A 2AT6X 1IZNA 2G79A 2XKLA 5FAZA 3GE2A 1X89A 4RJXA 2FS7A 1MM4A 2FR2A 2QOSC 1MDCA 1HBQA 2W2BA 2WEXA 3D4RA 2KTDA 4U9CA 3PH6A 3WJBA 1RLBE 1QABE 1QFVA 2L5PA 2DM5A 5EDCA 2K62A 4FBRA 4GE1A 5LJDA 1O8VA 1HN2A 4KC7A 4PSQA 1MM5A 1LIDA 1A57A 1FE3A 1XKIA 2KTSA 4LQZA 4OMWA 2XTRA 4JFBA 3KZAA 4ORUA 4AYEC 3G7XA 2MWHA 5FQ7E 4YGZA 2XE3A 4IMOA 3MX7A 4IB9A 5H8TA 4N59A 3FLLA 1IFCA 1GX8A 4QGXA 5HCDC 2CM4A 3STKA 4FSOA 4FZLA 3DTQA 1BEBA 3TZSA 3F8AA 4YMYA 5LJCA 5JR8A 1KGLA 3AA1B 1Y9TA 3P6HA 5H9LA 5C0NA 1BWYA 1JJJA 1H6S1 3RWXA 1JV4A 3POUA 4HPBA 2RCTA 3LK3B 2IFBA 2XMXA 3VZUX 2R56A 1HXXA 4AZRA 4DQ3A 2LKKA 1CJ5A 2X8TA 4TNNA 5HZ5A 4GCPA 2OMFA 3BX7A 2PORA 3WOVA 3STMX 3QRCA 3P02A 1HXTA 2J1NA 2W80C 2LB6A 1BSOA 1E06A 4MVKA 4QQ1A 5D45A 5EPQA 1NGLA 4YCHA 5F6BA 4NP1A 4A60A 1YWAA 1OBUA 3BU9A 4O4UA 4ORYA 3SAOA 2XTQA 3LK2A 2E4JA 3EMNX 1KT5A 3FMZA 2AT5X 2JMMA 4A1YA 4FZNA 3NADA 4L3RA 1U17A 3ZW0B 1LPJA 3SZDA 3FA7A 2KZ7A 1AELA 1EW3A 5D47A 5LKFA 4ZHDA 5IO7A 5BVSA 3FA9A 1UZ2X 1I06A 2AL0X 4IB7A 3C5OA 3NPOA 4R0BA 4U3QA 5LJHA 1QFTA 1PM1X 4GCSA 2LBVA 3FA8A 1PEEA 2GE4A 4KRAA 1FENA 1ICNA 3AA6A 1T8VA 3FA6A 1DC9A 2L9CA 3F6ZB 1CBQA 4BOEA 4I3DA 5LJKA 5AJBA 3WBGA 4N7CA 2ZAGA 2HZRA 3NR3A 2JU7A 4NLIA 4FSPA 1RBPA 4O3ZA 1Q9FA 2KW1A 3VG6A 2AMMX 3SZVA 1JYJA 4I95A 1GKAA 1YWDA 4OS8A 4KT5A 4LKPA 2X45A 1OPAA 4ZCBA 1CBRA 4CV7A 1LNMA 4NNSA 3AAAB 2KT4B 3PECA 3WJDA 3PEDA 1LIFA 1OEJA 2WR6A 4KCAA 4AKMA 2PY1A 2HYSA 3O22A 4PUXA 5D8JA 3HWBA 4EXZA 1QG5A 3VU1A 2Z4HA 4U8UM 2WQAE 3B2HA 1QJ9A 1GX9A 3RBYA 3POQA 2MJIA 1JBHA 5DG4A 4AZQA 2OVSA 4AZOA 3AAEB 5HAEA 1ICMA 2X46A 4N7DA 2CM9A 2LBAA 3AKMA 4ML7B 3AAAA 1GM6A 5K06A 1QQSA 2MO5A 4QAEA 4YFQA 5IO6A 2EU7X 1QY1A 2AKQA 3B2LA 1IKJA 4O9SA 2ZAIA 2GTLO 1ZRYA 3A2SX 4JCHA 3FEKA 2JOZA 4RUNA 4LSIA 1JIWI 3ZZVA 2LFOA 4FESA 2Q2PA 3D96A 3CQRA 5HZ6A 8PRNA 3VZTX 1HQPA 2ACPX 3JQOA 3KFHA 1IZNB 1VPRA 1Y9LA 1BRPA 3K3LA 5HWZA 1XCAA 2JU8A 1D3SA 3WVMA 2MNHA 3PQUA 5ADXL 3ZW2A 4MIRA 3U03A 1ORMA 2L68A 1EIIA 1GFNA 3RKGA 1DV9A 1YS5A 4D64A 3VG5A 4QYNA 5H9NA 4NW4A 1GXAA 1Z24A 3EYCA 4YKMA 2ZFGA 5JDPA 3VY9X 3FENA 1BH3A 1PHOA 4XNKA 2NP1A 4U8UN 3HWFA 2X8FA 2QTKA 2XSTA 3T20A 2F73A 4TKJA 4ZGUA 3WJCA 4NYQA 3K19A 1G90A 3O0EA 1P4TA 1B0OA 5LJGA 3HK1A 1SXXA 3C76X 2YMSA 4RJWA 2BS5A 5EEEA 1MX8A 3PP6A 1QY0A 2PRNA 4MVEA 1G85A 1IKEA 3WXQA 1CBIA 1KZWA 2FT9A 2QO6A 3C77X 3FIQA 3RSWA 4FT6A 2FGQX 2Z4IA 3FYXA 5T5FA 2AT8X 4NNTA 1KZXA 3WJEA 1E5PA 1DZKA 2A2UA 2WSJA 2Y0KA 1U18A 1YP6A 4TQ2A 3ZW1A 1ADLA 3G7GA 1G74A 1SY0A 1U0XA 4LSHA 3KFGA 3CBCA 3TGAA 1QJPA 5EE2A 1ERBA 3JS1A 4FBVA 2N93A 3I17A 2Q9SA 3UEXA 1GFOA 2N2LA 2XG6A 1JYDA 4IAXA 3UAQA 1FEMA 1DZMA 4YKOA 1S2PA 1ZHWA 1T0VA 3APXA 4KH8A 4QZUA 1SXYA 3NP1A 4RUUA 4RLBA 1S44A 3P24A 3RBHA 2Q4NA 2X8SA 2YG2A 3VG7A 2FR3A 4KC8A 3LK2B 4FUVA 3LV4A 5LJBA 2LFUA 4O4XA 3ZI8A 2Y7SA 1OBPA 4O3XB 1G7NA 5GV0A 1I05A 2CBSA 1BBPA 1ZNEA 3BS2A 2KZ7B 2O4VA 1IFBA 4EDEA 4FRXA 1MPFA 1TOWA 4AYNA 4GH7A 4O3WA 3SYBA 4QNIA 5BVTA 1EIOA 1B56A 3LHNA 2W81C 3EBWA 4IABA 1DFVA 4KR4A 5AFUL 2KC0A 5DPQA 2Y0LA 4D65A 3NQ3A 1Q9GA 2POAA 3SY9A 1A18A 1BXWA 3PH5A 4XMEA 3AA6B 3GP6A 3S5VA 1MVGA 5KICA 1DZJA 3OJYC 1YWBA 5L8NA 4YFRA 4HWMA 4HPCA 4LSEA 4YBPA 4XMGA 1KT4A 4CK4A 3APWA 1ZNGA 3VG4A 4C69X 1X8PA 2FTBA 1SY3A 1GKAB 2F1VA 2LHFA 4GCQA 2CBRA 5KHPA 2A13A 3NSGA 1BLRA 4KR8A 2KDYA 2FS6A 2F1TA 2MHLA 4ORSA 1LKEA 4BVMA 4I3CA 4TKHA 3FELA 2FWVA 1HMTA 3QRAA 4ON1A 4FZMA 4IB6A 1SA8A 4FRTA 2QO4A 2MHDA 4LZVA 3BLGA 4ORXA 1EI5A 1T68X 3WI4A 4ORWA 4AYDC 1GFMA 4WHIA 5ADXK 1SY2A 5B27A 3VE1A 5HA0A 3VE2A 4GNWA 4XMCA 1JJXA 1KOIA 3PORA 5HCEC 1MUPA 3SYSA 3LK41 5DL5A 1IIUA 2KXPA 4GNYA 3UPGA 3NQKA 4ZHHA 1CBSA 4GF4A 3UEVA 1YP7A 3Q6LA 1ZNDA 3T1DA 4AYHA 2P8GA 4O4SA 3VG3A 1FTPA 1OPFA 2Y0HA 1X8OA 1KXOA 4Y0QA 5IYUA 4I9RA 4MVLA 3S26A 1BM5A 2AT0X 3OBLA 4ZJ0A 3D95A 3CBSA 1AVGI 4Y0RA 1QWDA 1KQXA 1OSMA 2K4TA 2JMBA 3CMPA 3HOLA 4ZR2A 3NQ9A 2NNEA 4ZGFA 5D48A 3ZQ3A 4QGWA 3BRNA 4ID2A 5HZQA 2W2FA 1OPBA 4L1NA 4A1HA 1BT9A 1FELA 2K0LA 3AKNA 1GGLA 5HZ8A 2BHVA 4ODDA 3QKGA 4NYRA 5AQ6A 3D97A 5FQ8E 1L6MA 3UEWA 1EUOA 6PRNA 4ES7A 3BSZE 3ZUIA 2RCQA 5BVQA 3FW5A 4AYID 3NX1A 4QRLA 5HA1A 5F1EA 3OE3A 3UU2A 2OFMX 2GTFX 4JGLA 2OVEA 4DQ4A 4AZLA 2ANSA 1LFOA 1N0SA 2Q2MA 4AZNA 3STNA 1SXWA 4LSFA 2M07A 4HFOA 1HXUA 3APVA 2N2MA 1THQA 3JSQA 4AKRA 2GC9A 2G78A 2Q39A 3B2IA 1X8NA 4O3YA 4ZFXA 1E54A 3EBKA 1GFQA 4RLCA 3BY0A 5DL8A 1LIBA 4U8UO 3T24A 4AYMC 2QO5A 3E3CA 5L8OA 3P6FA 4ZH6A 2RA6A 3TGBA 5EZ2A 3FR2A 1PBOA 3ZW1B 2WWPA 4LKTA 1B4MA 2XE2A 5AFUK 5FFHA 1QJ8A 4EQAC 4Y0SA 2MM3A 4ZHGA 4ARHA 1O1VA 3DSZA 2CZUA 1EQDA 3KVDD 3U0DA 1MX7A 4NLJA 1NP1A 1X71A 2R73A 3O19A 2QMIA 2WUTA 3UEUA 1BSQA 3LK42 1BSYA 3P6GA 1YWCA 1HMRA 4O4OA 1JZUA 1H91A 3GAQA 4UU2A 5IO5A 4HPAA 4WFUA 2CZTA 3H3IA 1ZNHA 2GJ5A 2O62A 4D6BA 1AQBA 1KT6A 4HPDA 1GT5A 1X8QA 4YCEA 3IA8A 3C78X 3BDRA 3FR4A 4YDAA 3HWEA 4GZVA 2QM9A 1LF7A 1YIVA 1E02A 2HZQA 5LKEA 2WQ9A 4GU8A 1KT7A 3DA4A 3P6EA 1SXUA 4OS0A 3MVFA 3HOEA 1EPAA 4KIIA 2HMBA 4COTA 4I6SA 1ZHTA 4ZH9A 2JW1A 5FENA 2F09A 3ZUOA 2ERVA 2OVDA 1LIEA 4YDBA 1GT3A 5DL7A 3VG2A 3HWGA 4UU3A 3AA7B 5D5DA 1OBQA 4D5UA 3HW9A 5HTDA 3EM0A 4ORRA 1TXLA 2A2GA 3IFBA 1GT4A 1A2DA 4ALBA 2HNXA 2JU3A 3FEPA 5HZ9A 1HMSA 4K19A 2HLVA 1QY2A 2R74A 1KT3A 2LA7A 3AA0B 4LZUA 5LJEA 5DL6A 1SY1A 1CRBA 1ALBA 4I9SA 3APUA 4XNLA 3VPJE 1X8UA 4QZTA 3EMMA 4TJZA 3SY7A 1ZHZA 4F4BA 3RZYA 3TZGA 1SMPI 3HTYA 1OEKA 2ASNX 3AA7A 4B61A 1GFPA 1ERXA 1FDQA 1DF3A 3T0SA 3ELZA 2NNDA 2KD2A 1EPBA 4AW8A 4TLJA 2KXPB 5CYBA 2FLJA 2YPVA 1UREA 3ELXA 5CE4A 3TF6A 2ZLDA 2BLGA 4Y0PA 4QYPA 5AJCA 3FR5A 5EDBA 3AA0A 1DZPA 4FMSA 3HWDA 3N91A 5EEDA 4YFPA 5HBSA 3AA1A 2XE5A 1O1UA 2Y2XA 4CSBA 4ZHCA 1A3YA 3LK3A 1KQWA 3B2JA 2A3FX 5L8IA 1PMPA 4IAWA 4OS3A 2RN4A 5KIDA 4YGGA 5PRNA 4G75A 3P6CA 2NNQA 3POXA 5H9AA 1G5WA 3VZWX 3WJGA 1ML7A 4XMDA 4GDZA 4WFVA 4E1TA 3SOTA 1GT1A 1TOUA 4G76A 3PRNA 4QGVA 1TVQA 5HCCC 3KQ0A 4IMNA 3WI5A 2W2AA 4M6SA 4YH0A 3ZWEA 2GTLM 2BS6A 4WBKA 3ZW0A 5AEOA 3TGCA 4E1SA 1HBPA 4YBUA 3S60A 4ZHFA 4FOZA 5H9KA 2L67A 2X27X 3P6DA 4EFGA 4IB8A 1B8EA 1I4UA 2OZQA 1YUPA 3S5XA 1P6PA 2FRSA 4MVIA 1BRQA 3NX2A 1EALA 5FQ6E 4AKRB 2ALLX 3FW4A 4FGIB 4D6AA 3V8UA 2XE1A 4GHBA 3VY8X 4YGHA 1S7DA 3CR6A 3WJFA 4ALOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KVD D;  3HOE A;  3PQU A;  5T5F A;  2KDY A;  4O49 A;  4AYN A;  4O3W A;  2W81 C;  1YS5 A;  2W80 C;  2YPV A;  2KC0 A;  4O3Y A;  4QQ1 A;  4AYE C;  4Z3T A;  5EE2 A;  4O4U A;  4O3Z A;  4AYM C;  4AYD C;  3HOL A;  3UAQ A;  3VE1 A;  3VE2 A;  3PQS A;  3V8U A;  4U9C A;  2LFU A;  4O4X A;  2Y7S A;  4O3X B;  4AYI D; 
#chains in the Genus database with same CATH topology
 1AVE A;  4BGF A;  2RD7 C;  3B2K A;  3MBT A;  5FVN A;  2G7B A;  7PRN A;  1NP4 A;  3BU1 A;  2FGR A;  1WBI A;  2BT9 A;  4AFK A;  2GTL N;  2J4U P;  1AVD A;  3WZQ A;  1BJ7 A;  2AT3 X;  2RTB B;  1D2U A;  4RL9 A;  2IZA A;  2I5V O;  4EEJ A;  1VYF A;  2WVP A;  1PRN A;  3U9P C;  1E00 A;  4I3B A;  2ACO A;  2RTJ A;  4BX5 A;  2G79 A;  4B55 A;  2FS7 A;  1MM4 A;  2RTE B;  1VWR B;  3D4R A;  2KTD A;  4U9C A;  3PH6 A;  4Y5D A;  1QAB E;  1MK5 A;  1QFV A;  2L5P A;  2BC3 A;  4FBR A;  4GE1 A;  5LJD A;  1DF8 A;  2X55 A;  1MM5 A;  4OMW A;  1SWN A;  2G8C O;  3G7X A;  2UYW A;  4IMO A;  4IB9 A;  5HCD C;  3F8A A;  3AA1 B;  2X56 A;  1JJJ A;  1JV4 A;  1HXX A;  4TNN A;  5HZ5 A;  2F01 A;  3QRC A;  2OY5 O;  2J1N A;  2W80 C;  1BSO A;  1E06 A;  2OFA A;  5EPQ A;  5F6B A;  4A60 A;  1YWA A;  3EMN X;  1KT5 A;  1SWO A;  3NAD A;  2KZ7 A;  3WYQ A;  5IO7 A;  4ZHD A;  2G5L A;  3C5O A;  1I06 A;  3NPO A;  4U3Q A;  5LJH A;  1PEE A;  2DJG A;  1CBQ A;  4BOE A;  4UB6 O;  3WU2 O;  5B5G A;  2ZAG A;  2HZR A;  1UYN X;  3VG6 A;  1JYJ A;  4OS8 A;  1CBR A;  3NJT A;  4NNS A;  3PEC A;  3PGR A;  1LIF A;  4KCA A;  2A8G A;  3HWB A;  1SLF B;  4EXZ A;  3VU1 A;  1GX9 A;  3RBY A;  4AZO A;  2OVS A;  3AAE B;  1ICM A;  2CM9 A;  3Q34 A;  4QAE A;  4O9S A;  4JCH A;  2X34 A;  1LCZ A;  3ZZV A;  8PRN A;  3CKF A;  2IZI A;  1IZN B;  1VPR A;  3WVM A;  2MNH A;  4MIR A;  2L68 A;  1SWC A;  1DV9 A;  5JDP A;  3FEN A;  3HWF A;  3O0E A;  4MVE A;  1IKE A;  1RAV A;  2Z4I A;  4NNT A;  1KZX A;  3WJE A;  1E5P A;  2Y0K A;  1YP6 A;  3G7G A;  4OEL A;  3CBC A;  3TGA A;  3I17 A;  4BX7 A;  4C00 A;  1W4T A;  3APX A;  4QZU A;  4RLB A;  3RBH A;  2Q4N A;  2X8S A;  4KC8 A;  3LK2 B;  3LV4 A;  1OBP A;  4O3X B;  5B3M O;  4EDE A;  3WYP A;  3SYB A;  4KR4 A;  2KC0 A;  2Y32 A;  2POA A;  2RTQ B;  3S5V A;  4HWM A;  4LSE A;  4YBP A;  1X8P A;  2LHF A;  4GCQ A;  5GTI O;  1BLR A;  4KR8 A;  2FS6 A;  2MHL A;  4N74 A;  2FHN X;  4I3C A;  3FEL A;  2FWV A;  4IB6 A;  1N4J A;  2MHD A;  3BLG A;  1VYO A;  1KL4 A;  4ORW A;  5ADX K;  1T16 A;  1JJX A;  5DL5 A;  1IIU A;  1N9M A;  3UPG A;  3VHI A;  3Q6L A;  3KVN A;  2P8G A;  2Y0H A;  4Y0Q A;  5IYU A;  3S26 A;  1BM5 A;  3CBS A;  1AVG I;  4PR7 A;  1OSM A;  3VHH A;  4L1N A;  1OPB A;  3WZP A;  3AKN A;  6PRN A;  5FQ8 E;  3D97 A;  3BSZ E;  2RCQ A;  4AYI D;  2OFM X;  2GTF X;  2FHL A;  2OVE A;  3MG5 A;  1SXW A;  3PK2 A;  4ZFX A;  3B2I A;  1GFQ A;  3EBK A;  3T6F A;  1LIB A;  4AYM C;  3P6F A;  4N75 A;  3FR2 A;  1PBO A;  3EW1 A;  1IJ8 A;  5AFU K;  2MM3 A;  2IZE B;  5G3A A;  4GJV A;  3KVD D;  3U0D A;  1MX7 A;  3LTW A;  2WUT A;  3UEU A;  3BRY A;  1BSY A;  1SWK A;  1HMR A;  4O4O A;  1JZU A;  4UU2 A;  1SWH A;  2CZT A;  3RY2 A;  1ZNH A;  2GJ5 A;  1AQB A;  1X8Q A;  4YDA A;  1WUB A;  2WQ9 A;  1KT7 A;  3HOE A;  4KII A;  4K3B A;  4COT A;  4ZH9 A;  4YDB A;  3HW9 A;  2X4M A;  1JQP A;  5HTD A;  3IFB A;  1GT4 A;  5K67 A;  2HNX A;  2JU3 A;  3FEP A;  5HZ9 A;  1HMS A;  2R74 A;  1KT3 A;  4LZU A;  3APU A;  1ZHZ A;  1SMP I;  2ASN X;  4YVB A;  4B61 A;  4AW8 A;  2KXP B;  4Y0P A;  3AA0 A;  5EDB A;  3FR5 A;  4FMS A;  1N43 A;  3N91 A;  5HBS A;  3AA1 A;  2Y2X A;  4CSB A;  5KAI O;  2RTI B;  1A3Y A;  1KQW A;  3B2J A;  2A3F X;  5L8I A;  4YGG A;  4G75 A;  1VWP B;  1GT1 A;  2VFB A;  2OY8 A;  4IMN A;  3WI5 A;  3CKG A;  4M6S A;  4YH0 A;  3ZWE A;  4WBK A;  2BS6 A;  5H9K A;  2L67 A;  1I4U A;  2OZQ A;  1YUP A;  3S5X A;  4GDA A;  2FRS A;  1BRQ A;  4AKR B;  3FW4 A;  4FGI B;  4CDF A;  4CDE A;  4ALO A;  3CQN A;  1LCV A;  1SWS A;  1HXL A;  4IBA A;  4INN A;  2M4L A;  3DA3 A;  2M06 A;  1I04 A;  2F1C X;  3F9D A;  4OMX A;  3PPT A;  5HTE A;  2YNK A;  4PJ2 A;  3AAE A;  3EC5 A;  1VYG A;  4BQU A;  1VWG B;  5BYP A;  5G26 A;  3KFI A;  4TKB A;  4BUM X;  4GD9 A;  1ZHX A;  4GRJ A;  3OD9 A;  1ZNK A;  1IW2 A;  4FBO A;  4GK9 A;  3O2Y A;  4N58 A;  3SLT A;  4Z27 A;  1IZN A;  4RJX A;  2QOS C;  5EDC A;  1LID A;  2PI3 O;  4MEE A;  5B10 O;  4NV7 A;  1E2T A;  4AYE C;  5G39 A;  3MX7 A;  5H8T A;  3FLL A;  2I5Z O;  2CM4 A;  3STK A;  4FZL A;  1BEB A;  1NDJ A;  4CPF A;  3P6H A;  2JQY A;  3RWX A;  2RCT A;  3LK3 B;  3VZU X;  1Y53 X;  2R56 A;  4DQ3 A;  2LKK A;  2X8T A;  2POR A;  3WOV A;  3STM X;  3P02 A;  1VWE B;  3SZI A;  2LB6 A;  2Y3E A;  4QQ1 A;  3BU9 A;  4O4U A;  3LK2 A;  3FMZ A;  3ZW0 B;  3FA7 A;  5LKF A;  1UZ2 X;  2AL0 X;  3EW2 A;  1QFT A;  2LBV A;  3FA8 A;  1T8V A;  1SWU A;  1DC9 A;  4I3D A;  5LJK A;  3NR3 A;  4FSP A;  1RBP A;  4O3Z A;  2AMM X;  1PTS A;  1YWD A;  4FQE A;  4LKP A;  2X45 A;  4ZCB A;  4CV7 A;  3AAA B;  4OEM A;  3WJD A;  1SWB A;  2RTC B;  4AKM A;  2IZF B;  2Z4H A;  4U8U M;  3POQ A;  2A5B A;  2MJI A;  1JBH A;  3AUM O;  4BBO A;  5HAE A;  4N7D A;  1SRE A;  1GM6 A;  1QQS A;  4YFQ A;  5IO6 A;  3B2L A;  1QY1 A;  2AKQ A;  2IWV A;  2ZAI A;  2GTL O;  1STS B;  3FEK A;  4LSI A;  2Q2P A;  3D96 A;  3A0H O;  2RTR B;  1Y9L A;  5HWZ A;  3U03 A;  1ORM A;  3RKG A;  3HPE A;  1YS5 A;  3VG5 A;  4QYN A;  3EYC A;  2ZFG A;  3VY9 X;  1PHO A;  4XNK A;  4U8U N;  4JNJ A;  3T20 A;  2F73 A;  1VWC B;  3WJC A;  4NYQ A;  1P4T A;  1B0O A;  5LJG A;  1SXX A;  2YMS A;  3PP6 A;  1S5L O;  3WXQ A;  4FT6 A;  1KZW A;  2FT9 A;  3FIQ A;  3FYX A;  5T5F A;  2AT8 X;  1DZK A;  3RE6 A;  1U0X A;  1SY0 A;  1ERB A;  2N2L A;  3SLJ A;  1JYD A;  2JGS A;  1FEM A;  1S2P A;  4GGZ A;  3P24 A;  5LJB A;  1UYO X;  3PF1 A;  2DJF A;  1SRI A;  1I05 A;  2CBS A;  3RDX A;  1TOW A;  4GH7 A;  5IRU A;  2OF8 A;  4QNI A;  1B56 A;  3LHN A;  3EBW A;  4IAB A;  5DPQ A;  2IZL B;  1BXW A;  3PH5 A;  3AA6 B;  3GP6 A;  4BCS A;  5KIC A;  1DZJ A;  1YWB A;  5L8N A;  4HPC A;  3RDS A;  4C69 X;  2FTB A;  2F1V A;  2CBR A;  3D9W A;  4BVM A;  4TKH A;  1HMT A;  3QRA A;  4ON1 A;  1SA8 A;  4UB8 O;  4GJS A;  4FRT A;  4AYD C;  1GFM A;  4WHI A;  5B27 A;  1SWF A;  1KOI A;  2GH7 A;  3SYS A;  2KXP A;  1LCW A;  4ZHH A;  1CBS A;  1YP7 A;  1ZND A;  4AYH A;  3VG3 A;  1FTP A;  1VWD B;  1KXO A;  4I9R A;  4MVL A;  2AT0 X;  3OBL A;  1KQX A;  3HOL A;  5D48 A;  4QGW A;  3BRN A;  2K0L A;  1BT9 A;  1FEL A;  2BHV A;  5AQ6 A;  4NYR A;  3UEW A;  1L6M A;  4ES7 A;  3A0B O;  3ZUI A;  3NX1 A;  5HA1 A;  5F1E A;  3OE3 A;  3UU2 A;  4JGL A;  3DWO X;  4DQ4 A;  4AZL A;  2ANS A;  1VWA B;  1HXU A;  2N2M A;  4AKR A;  2GC9 A;  2G78 A;  1E54 A;  3T24 A;  1VWO B;  5EZ2 A;  3ZW1 B;  4LKT A;  2XE2 A;  1QJ8 A;  1SWG A;  2IZH B;  4GGT A;  4ZHG A;  4ARH A;  1O1V A;  1I78 A;  2CZU A;  3DSZ A;  4CPH B;  1NQM A;  2R8A A;  4JHQ A;  2R73 A;  3O19 A;  1BSQ A;  1H91 A;  5IO5 A;  4HPA A;  4WFU A;  3H3I A;  3FID A;  4HPD A;  4YCE A;  3FR4 A;  4PJ0 O;  2QM9 A;  2HZQ A;  5LKE A;  4OS0 A;  2R4O A;  2JW1 A;  5FEN A;  2ERV A;  2OVD A;  1LIE A;  1GT3 A;  3HWG A;  3AA7 B;  4D5U A;  2RTM A;  3EM0 A;  1TXL A;  2A2G A;  1GX3 A;  1QY2 A;  2LA7 A;  5LJE A;  1CRB A;  1ALB A;  4I9S A;  4XNL A;  3VPJ E;  1X8U A;  4F4B A;  5H2F O;  3HTY A;  1VWH B;  2IZK A;  5JD2 A;  3VHM A;  2FLJ A;  5L3Y A;  2YPV A;  5AJC A;  5EED A;  4YFP A;  3LK3 A;  4Z2V A;  4IAW A;  2RN4 A;  5KID A;  1G5W A;  3WJG A;  1ML7 A;  2HKD A;  4G76 A;  1TVQ A;  3KQ0 A;  3ZW0 A;  1HBP A;  4FOZ A;  4EFG A;  2RTN B;  1MEP A;  3PDF A;  4MVI A;  1EAL A;  1SLG B;  1SWL A;  3V8U A;  1KFF A;  3CR6 A;  3WJF A;  4GKC A;  1AB0 A;  3BX8 A;  5KAF O;  5IRW A;  4XMF A;  4FQB B;  1ZHY A;  5F7G A;  2JN3 A;  3L4R A;  2WJR A;  4BX5 B;  4Z2P A;  3QQ2 A;  1R0U A;  3T2W A;  3RDO A;  2WEW A;  1N9Y A;  3T2X A;  5B29 A;  1TW4 A;  2OFR X;  1ZNL A;  4M7M A;  1LIC A;  2AH7 X;  5FAZ A;  3GE2 A;  1X89 A;  1SWQ A;  1HBQ A;  5B11 O;  3WJB A;  2DM5 A;  2K62 A;  1SLD B;  1O8V A;  2R89 A;  1A57 A;  1FE3 A;  2KTS A;  4LQZ A;  4JFB A;  3KZA A;  4ORU A;  5FQ7 E;  1Y52 X;  2QCB A;  4QGX A;  4FSO A;  3DTQ A;  5LJC A;  5JR8 A;  3SZJ A;  1Y9T A;  1Y55 X;  4AZR A;  3PGU A;  4GCP A;  2OMF A;  3BX7 A;  1SWT A;  4MVK A;  5D45 A;  4YCH A;  1OBU A;  2WJQ A;  4ORY A;  2E4J A;  2JMM A;  4FZN A;  1AEL A;  1EW3 A;  5D47 A;  5BVS A;  4IB7 A;  1K3B A;  4R0B A;  2C1S A;  1PM1 X;  1FEN A;  3AA6 A;  3RDM A;  2RTL A;  2L9C A;  3F6Z B;  4EKV A;  3WBG A;  4NLI A;  4CPE A;  2JU7 A;  2WPU A;  1Q9F A;  2KW1 A;  1LNM A;  2KT4 B;  1VWN B;  3RDU A;  1OEJ A;  2WR6 A;  5IRA A;  2HYS A;  3O22 A;  4PUX A;  5D8J A;  3SZH A;  1QG5 A;  2WQA E;  1W5R A;  5DG4 A;  4AZQ A;  2MF6 A;  3AKM A;  4ML7 B;  2MO5 A;  2EU7 X;  3KZI O;  1IKJ A;  2R88 A;  2JOZ A;  4RUN A;  1JIW I;  4FES A;  3CQR A;  5HZ6 A;  3JQO A;  1XCA A;  1D3S A;  1SRF A;  1GFN A;  5H9N A;  4NW4 A;  1Z24 A;  3BRZ A;  5TIS O;  2NP1 A;  4TKJ A;  1G90 A;  1STR B;  3HK1 A;  4K3C A;  4RJW A;  1MX8 A;  1QY0 A;  2PRN A;  1CBI A;  3C77 X;  1VWL B;  2FGQ X;  5B5F A;  2A2U A;  4TQ2 A;  3ZW1 A;  1ADL A;  1N7Y A;  4LSH A;  2X9K A;  5EE2 A;  3JS1 A;  2N93 A;  2Q9S A;  1GFO A;  2XG6 A;  3UAQ A;  4CPH A;  1DZM A;  2VFC A;  4YKO A;  1T0V A;  4KH8 A;  2R4L A;  2YG2 A;  3VG7 A;  2FR3 A;  4DCB A;  4O4X A;  3ZI8 A;  1SWJ A;  2Y7S A;  5GV0 A;  1BBP A;  1ZNE A;  1MPF A;  2Y0L A;  3T6L A;  3NQ3 A;  1Q9G A;  4Z6J A;  4XME A;  3PGS A;  1HXZ A;  3OJY C;  4YFR A;  2Y3F A;  1KT4 A;  1SY3 A;  1GKA B;  2IZB A;  1SLE B;  5KHP A;  3NSG A;  2KDY A;  2F1T A;  4ORS A;  2IZG B;  4FZM A;  1RSU B;  4LZV A;  4ORX A;  1EI5 A;  1T68 X;  1STP A;  4GGR A;  4GNW A;  3POR A;  5HCE C;  2UZ2 A;  4CTD A;  3NQK A;  3UEV A;  3T1D A;  1OPF A;  4GUZ A;  4ZJ0 A;  3D95 A;  2K4T A;  3NQ9 A;  2NNE A;  4ID2 A;  5HZ8 A;  4ODD A;  3QKG A;  4DNE A;  2OYB O;  5BVQ A;  1JMZ A;  1LFO A;  2Q2M A;  3STN A;  4HFO A;  3APV A;  1THQ A;  3JSQ A;  2Q39 A;  4O3Y A;  1X8N A;  4U8U O;  2QO5 A;  2RA6 A;  3TGB A;  2WWP A;  5G38 A;  5FFH A;  5CHK A;  3WZO A;  1EQD A;  1NP1 A;  1X71 A;  4NV8 A;  2QMI A;  3P6G A;  4I60 A;  1LDQ A;  5B66 O;  3GAQ A;  2AXT O;  4D6B A;  2AVI A;  1RXJ A;  1RXK A;  2RTF B;  3IA8 A;  3C78 X;  2VDF A;  3BDR A;  2RTA A;  4GZV A;  1LF7 A;  1JMX A;  4GU8 A;  4CDD A;  3DA4 A;  1VWM B;  1SXU A;  3P6E A;  3MVF A;  1EPA A;  4I6S A;  1ZHT A;  2F09 A;  3ZUO A;  2OL7 A;  5DL7 A;  2IWW A;  3VG2 A;  5D5D A;  4IRW A;  4ORR A;  1FJ1 E;  1I9H A;  2HLV A;  3AA0 B;  5F2B A;  5DL6 A;  3RDQ A;  3TZG A;  4OKA A;  1ERX A;  1DF3 A;  3ELZ A;  2NND A;  1URE A;  3ELX A;  3TF6 A;  1KL5 A;  3HWD A;  1PMP A;  4OS3 A;  5PRN A;  3POX A;  5H9A A;  4XMD A;  4E1T A;  3PRN A;  1Y0G A;  5HCC C;  2W2A A;  4JO6 A;  5AEO A;  4E1S A;  4BX6 B;  1P6P A;  1W6F A;  2ALL X;  4D6A A;  4YGH A;  1S7D A;  3FYF A;  2K23 A;  5F6Z A;  4O49 A;  3RY1 A;  3DWN A;  4AZM A;  3JTY A;  4XMH A;  4MIS A;  1EXS A;  2A0A A;  1OEE A;  5D4A A;  3PQS A;  4GET A;  4AZP A;  2OVA A;  2ODJ A;  1ACD A;  3I0A A;  3NBX X;  5CSE A;  5F58 A;  4A8Z A;  3CWK A;  2RQ0 A;  5IXG A;  4AUI A;  4Z3T A;  3KFF A;  2AT6 X;  2XKL A;  1SRG A;  2FR2 A;  1MDC A;  4Y59 A;  2W2B A;  2WEX A;  4Z2O A;  1RLB E;  2FGS A;  4U46 A;  1HN2 A;  4KC7 A;  4PSQ A;  4C4V B;  2AF5 A;  1XKI A;  2XTR A;  4CPI A;  2MWH A;  4YGZ A;  2XE3 A;  4N59 A;  1IFC A;  1GX8 A;  1K24 A;  3TZS A;  4YMY A;  1KGL A;  5H9L A;  5C0N A;  1BWY A;  1H6S 1;  3POU A;  4HPB A;  2IFB A;  5K68 A;  2XMX A;  1CJ5 A;  1HXT A;  1NGL A;  4NP1 A;  3SAO A;  2XTQ A;  2AT5 X;  1VWK B;  4A1Y A;  4L3R A;  1U17 A;  1HQQ A;  1LPJ A;  3SZD A;  3FA9 A;  1RST B;  1PBY A;  4GCS A;  2GE4 A;  4KRA A;  1ICN A;  3FA6 A;  3VGW A;  5AJB A;  4Z28 A;  4N7C A;  1T1L A;  1SWE A;  3SZV A;  4I95 A;  1GKA A;  3SLO A;  4KT5 A;  1OPA A;  3PED A;  2PY1 A;  1VWB B;  5B5E O;  1QJ9 A;  3B2H A;  2R4P A;  2X46 A;  2LBA A;  3RE5 A;  3AAA A;  5K06 A;  3JCU O;  1ZRY A;  3A2S X;  4BJ8 A;  1MOY A;  2LFO A;  3VZT X;  1HQP A;  2ACP X;  3KFH A;  3K3L A;  1BRP A;  1NBX A;  2JU8 A;  3PQU A;  5ADX L;  1SRH A;  3ZW2 A;  1LDO A;  1EII A;  4D64 A;  1GXA A;  2A5C A;  4YKM A;  1BH3 A;  2X8F A;  2QTK A;  2XST A;  4ZGU A;  3K19 A;  2OY1 O;  3C76 X;  2BS5 A;  5EEE A;  1G85 A;  2QO6 A;  3RSW A;  1VWF B;  2WSJ A;  3DZM A;  1U18 A;  1SRJ A;  1G74 A;  2X32 A;  3KFG A;  1QJP A;  4FBV A;  2QOM A;  3UEX A;  3AEH A;  4IAX A;  1ZHW A;  4RUU A;  1SXY A;  3NP1 A;  1S44 A;  4FUV A;  2LFU A;  1G7N A;  2IZD B;  3BS2 A;  2KZ7 B;  2O4V A;  1IFB A;  4FRX A;  1VWJ B;  4AYN A;  4O3W A;  2OY7 A;  2IZC B;  5BVT A;  1EIO A;  2W81 C;  5AFU L;  1MM9 A;  1DFV A;  2FKJ A;  3SY9 A;  1A18 A;  1MVG A;  4XMG A;  4CK4 A;  3APW A;  1ZNG A;  3VG4 A;  2A13 A;  2C4I A;  1LKE A;  2RTK A;  2RTH B;  2QO4 A;  3WI4 A;  1SY2 A;  3VE1 A;  5HA0 A;  3VE2 A;  4XMC A;  1MUP A;  3LK4 1;  4GNY A;  4GF4 A;  2OL8 O;  4O4S A;  1X8O A;  1VWQ B;  4Y0R A;  1QWD A;  5E79 O;  2JMB A;  3CMP A;  4ZR2 A;  4ZGF A;  3ZQ3 A;  5HZQ A;  1RXH A;  2W2F A;  2CAM A;  4A1H A;  5DL8 A;  1NQN A;  1GGL A;  1EUO A;  2FKG A;  3FW5 A;  4QRL A;  2IZJ A;  4IL6 O;  4BX6 A;  4AZN A;  1N0S A;  4LSF A;  2M07 A;  4C5P A;  4D65 A;  4RLC A;  3BY0 A;  3E3C A;  5L8O A;  4ZH6 A;  3MM0 A;  1B4M A;  1LUQ A;  4EQA C;  4Y0S A;  4BX7 B;  2RTG B;  2OF9 A;  4NLJ A;  3X00 A;  2ZSC A;  3LK4 2;  1YWC A;  2C1Q A;  1HY2 A;  2O62 A;  1KT6 A;  1GT5 A;  2RTP B;  4CDC A;  3HWE A;  1YIV A;  1E02 A;  2HMB A;  2RTD B;  1OSP O;  4UU3 A;  1OBQ A;  1NC9 A;  1A2D A;  4ALB A;  4K19 A;  2BSZ A;  1SWA A;  1SY1 A;  4C4V A;  4QZT A;  3EMM A;  4TJZ A;  3SY7 A;  3RZY A;  1OEK A;  3AA7 A;  1GFP A;  1FDQ A;  3T0S A;  1SWP A;  2KD2 A;  1EPB A;  4TLJ A;  5CYB A;  2OFB A;  3WZN A;  1SWR A;  5CE4 A;  1JJU A;  2ZLD A;  5GTH O;  2BLG A;  4QYP A;  1DZP A;  2OL6 O;  2RTO B;  2XE5 A;  1O1U A;  4ZHC A;  5B2A O;  3P6C A;  2NNQ A;  3VZW X;  4GDZ A;  4WFV A;  3SOT A;  1TOU A;  4QGV A;  3FDC A;  2GTL M;  3TGC A;  3S60 A;  4YBU A;  4ZHF A;  3BS0 A;  1SWD A;  2X27 X;  3P6D A;  4IB8 A;  1B8E A;  1LEL A;  3NX2 A;  1KL3 A;  5FQ6 E;  1VWI B;  2R4N A;  2XE1 A;  4GHB A;  3VY8 X; 
#chains in the Genus database with same CATH homology
 4GKC A;  1AB0 A;  3FYF A;  2K23 A;  5F6Z A;  2RD7 C;  3BX8 A;  3B2K A;  4O49 A;  3CQN A;  3MBT A;  5FVN A;  2G7B A;  7PRN A;  1NP4 A;  3BU1 A;  4AZM A;  2FGR A;  3JTY A;  4XMH A;  4XMF A;  4IBA A;  4INN A;  2M4L A;  4MIS A;  1EXS A;  2A0A A;  4FQB B;  1ZHY A;  3DA3 A;  2M06 A;  1OEE A;  5D4A A;  5F7G A;  2BT9 A;  3PQS A;  1I04 A;  2JN3 A;  3L4R A;  4AFK A;  2GTL N;  3F9D A;  4OMX A;  3PPT A;  5HTE A;  2J4U P;  2YNK A;  1BJ7 A;  2AT3 X;  4GET A;  4PJ2 A;  4AZP A;  1D2U A;  2OVA A;  1R0U A;  2ODJ A;  3AAE A;  4RL9 A;  1ACD A;  3I0A A;  1VYG A;  3NBX X;  5F58 A;  4EEJ A;  4A8Z A;  4BQU A;  5BYP A;  1VYF A;  2RQ0 A;  3CWK A;  5G26 A;  2WEW A;  3KFI A;  4TKB A;  4BUM X;  5B29 A;  1PRN A;  1TW4 A;  1ZHX A;  2OFR X;  4GRJ A;  3U9P C;  4AUI A;  3OD9 A;  1ZNL A;  4M7M A;  1ZNK A;  1E00 A;  1IW2 A;  4FBO A;  4GK9 A;  2ACO A;  4I3B A;  4Z3T A;  1LIC A;  3O2Y A;  3KFF A;  2AH7 X;  4N58 A;  2AT6 X;  1IZN A;  2G79 A;  2XKL A;  5FAZ A;  3GE2 A;  1X89 A;  4RJX A;  2FS7 A;  1MM4 A;  2FR2 A;  2QOS C;  1MDC A;  1HBQ A;  2W2B A;  2WEX A;  3D4R A;  2KTD A;  4U9C A;  3PH6 A;  3WJB A;  1RLB E;  1QAB E;  1QFV A;  2L5P A;  2DM5 A;  5EDC A;  2K62 A;  4FBR A;  4GE1 A;  5LJD A;  1O8V A;  1HN2 A;  4KC7 A;  4PSQ A;  1MM5 A;  1LID A;  1A57 A;  1FE3 A;  1XKI A;  2KTS A;  4LQZ A;  4OMW A;  2XTR A;  4JFB A;  3KZA A;  4ORU A;  4AYE C;  3G7X A;  2MWH A;  5FQ7 E;  4YGZ A;  2XE3 A;  4IMO A;  3MX7 A;  4IB9 A;  5H8T A;  4N59 A;  3FLL A;  1IFC A;  1GX8 A;  4QGX A;  5HCD C;  2CM4 A;  3STK A;  4FSO A;  4FZL A;  3DTQ A;  1BEB A;  3TZS A;  3F8A A;  4YMY A;  5LJC A;  5JR8 A;  1KGL A;  3AA1 B;  1Y9T A;  3P6H A;  5H9L A;  5C0N A;  1BWY A;  1JJJ A;  1H6S 1;  3RWX A;  1JV4 A;  3POU A;  4HPB A;  2RCT A;  3LK3 B;  2IFB A;  2XMX A;  3VZU X;  2R56 A;  1HXX A;  4AZR A;  4DQ3 A;  2LKK A;  1CJ5 A;  2X8T A;  4TNN A;  5HZ5 A;  4GCP A;  2OMF A;  3BX7 A;  2POR A;  3WOV A;  3STM X;  3QRC A;  3P02 A;  1HXT A;  2J1N A;  2W80 C;  2LB6 A;  1BSO A;  1E06 A;  4MVK A;  4QQ1 A;  5D45 A;  5EPQ A;  1NGL A;  4YCH A;  5F6B A;  4NP1 A;  4A60 A;  1YWA A;  1OBU A;  3BU9 A;  4O4U A;  4ORY A;  3SAO A;  2XTQ A;  3LK2 A;  2E4J A;  3EMN X;  1KT5 A;  3FMZ A;  2AT5 X;  2JMM A;  4A1Y A;  4FZN A;  3NAD A;  4L3R A;  1U17 A;  3ZW0 B;  1LPJ A;  3SZD A;  3FA7 A;  2KZ7 A;  1AEL A;  1EW3 A;  5D47 A;  5LKF A;  4ZHD A;  5IO7 A;  5BVS A;  3FA9 A;  1UZ2 X;  1I06 A;  2AL0 X;  4IB7 A;  3C5O A;  3NPO A;  4R0B A;  4U3Q A;  5LJH A;  1QFT A;  1PM1 X;  4GCS A;  2LBV A;  3FA8 A;  1PEE A;  2GE4 A;  4KRA A;  1FEN A;  1ICN A;  3AA6 A;  1T8V A;  3FA6 A;  1DC9 A;  2L9C A;  3F6Z B;  1CBQ A;  4BOE A;  4I3D A;  5LJK A;  5AJB A;  3WBG A;  4N7C A;  2ZAG A;  2HZR A;  3NR3 A;  2JU7 A;  4NLI A;  4FSP A;  1RBP A;  4O3Z A;  1Q9F A;  2KW1 A;  3VG6 A;  2AMM X;  3SZV A;  1JYJ A;  4I95 A;  1GKA A;  1YWD A;  4OS8 A;  4KT5 A;  4LKP A;  2X45 A;  1OPA A;  4ZCB A;  1CBR A;  4CV7 A;  1LNM A;  4NNS A;  3AAA B;  2KT4 B;  3PEC A;  3WJD A;  3PED A;  1LIF A;  1OEJ A;  2WR6 A;  4KCA A;  4AKM A;  2PY1 A;  2HYS A;  3O22 A;  4PUX A;  5D8J A;  3HWB A;  4EXZ A;  1QG5 A;  3VU1 A;  2Z4H A;  4U8U M;  2WQA E;  3B2H A;  1QJ9 A;  1GX9 A;  3RBY A;  3POQ A;  2MJI A;  1JBH A;  5DG4 A;  4AZQ A;  2OVS A;  4AZO A;  3AAE B;  5HAE A;  1ICM A;  2X46 A;  4N7D A;  2CM9 A;  2LBA A;  3AKM A;  4ML7 B;  3AAA A;  1GM6 A;  5K06 A;  1QQS A;  2MO5 A;  4QAE A;  4YFQ A;  5IO6 A;  2EU7 X;  1QY1 A;  2AKQ A;  3B2L A;  1IKJ A;  4O9S A;  2ZAI A;  2GTL O;  1ZRY A;  3A2S X;  4JCH A;  3FEK A;  2JOZ A;  4RUN A;  4LSI A;  1JIW I;  3ZZV A;  2LFO A;  4FES A;  2Q2P A;  3D96 A;  3CQR A;  5HZ6 A;  8PRN A;  3VZT X;  1HQP A;  2ACP X;  3JQO A;  3KFH A;  1IZN B;  1VPR A;  1Y9L A;  1BRP A;  3K3L A;  5HWZ A;  1XCA A;  2JU8 A;  1D3S A;  3WVM A;  2MNH A;  3PQU A;  5ADX L;  3ZW2 A;  4MIR A;  3U03 A;  1ORM A;  2L68 A;  1EII A;  1GFN A;  3RKG A;  1DV9 A;  1YS5 A;  4D64 A;  3VG5 A;  4QYN A;  5H9N A;  4NW4 A;  1GXA A;  1Z24 A;  3EYC A;  4YKM A;  2ZFG A;  5JDP A;  3VY9 X;  3FEN A;  1BH3 A;  1PHO A;  4XNK A;  2NP1 A;  4U8U N;  3HWF A;  2X8F A;  2QTK A;  2XST A;  3T20 A;  2F73 A;  4TKJ A;  4ZGU A;  3WJC A;  4NYQ A;  3K19 A;  1G90 A;  3O0E A;  1P4T A;  1B0O A;  5LJG A;  3HK1 A;  1SXX A;  3C76 X;  2YMS A;  4RJW A;  2BS5 A;  5EEE A;  1MX8 A;  3PP6 A;  1QY0 A;  2PRN A;  4MVE A;  1G85 A;  1IKE A;  3WXQ A;  1CBI A;  1KZW A;  2FT9 A;  2QO6 A;  3C77 X;  3FIQ A;  3RSW A;  4FT6 A;  2FGQ X;  2Z4I A;  3FYX A;  5T5F A;  2AT8 X;  4NNT A;  1KZX A;  3WJE A;  1E5P A;  1DZK A;  2A2U A;  2WSJ A;  2Y0K A;  1U18 A;  1YP6 A;  4TQ2 A;  3ZW1 A;  1ADL A;  3G7G A;  1G74 A;  1SY0 A;  1U0X A;  4LSH A;  3KFG A;  3CBC A;  3TGA A;  1QJP A;  5EE2 A;  1ERB A;  3JS1 A;  4FBV A;  2N93 A;  3I17 A;  2Q9S A;  3UEX A;  1GFO A;  2N2L A;  2XG6 A;  1JYD A;  4IAX A;  3UAQ A;  1FEM A;  1DZM A;  4YKO A;  1S2P A;  1ZHW A;  1T0V A;  3APX A;  4KH8 A;  4QZU A;  1SXY A;  3NP1 A;  4RUU A;  4RLB A;  1S44 A;  3P24 A;  3RBH A;  2Q4N A;  2X8S A;  2YG2 A;  3VG7 A;  2FR3 A;  4KC8 A;  3LK2 B;  4FUV A;  3LV4 A;  5LJB A;  2LFU A;  4O4X A;  3ZI8 A;  2Y7S A;  1OBP A;  4O3X B;  1G7N A;  5GV0 A;  1I05 A;  2CBS A;  1BBP A;  1ZNE A;  3BS2 A;  2KZ7 B;  2O4V A;  1IFB A;  4EDE A;  4FRX A;  1MPF A;  1TOW A;  4AYN A;  4GH7 A;  4O3W A;  3SYB A;  4QNI A;  5BVT A;  1EIO A;  1B56 A;  3LHN A;  2W81 C;  3EBW A;  4IAB A;  1DFV A;  4KR4 A;  5AFU L;  2KC0 A;  5DPQ A;  2Y0L A;  4D65 A;  3NQ3 A;  1Q9G A;  2POA A;  3SY9 A;  1A18 A;  1BXW A;  3PH5 A;  4XME A;  3AA6 B;  3GP6 A;  3S5V A;  1MVG A;  5KIC A;  1DZJ A;  3OJY C;  1YWB A;  5L8N A;  4YFR A;  4HWM A;  4HPC A;  4LSE A;  4YBP A;  4XMG A;  1KT4 A;  4CK4 A;  3APW A;  1ZNG A;  3VG4 A;  4C69 X;  1X8P A;  2FTB A;  1SY3 A;  1GKA B;  2F1V A;  2LHF A;  4GCQ A;  2CBR A;  5KHP A;  2A13 A;  3NSG A;  1BLR A;  4KR8 A;  2KDY A;  2FS6 A;  2F1T A;  2MHL A;  4ORS A;  1LKE A;  4BVM A;  4I3C A;  4TKH A;  3FEL A;  2FWV A;  1HMT A;  3QRA A;  4ON1 A;  4FZM A;  4IB6 A;  1SA8 A;  4FRT A;  2QO4 A;  2MHD A;  4LZV A;  3BLG A;  4ORX A;  1EI5 A;  1T68 X;  3WI4 A;  4ORW A;  4AYD C;  1GFM A;  4WHI A;  5ADX K;  1SY2 A;  5B27 A;  3VE1 A;  5HA0 A;  3VE2 A;  4GNW A;  4XMC A;  1JJX A;  1KOI A;  3POR A;  5HCE C;  1MUP A;  3SYS A;  3LK4 1;  5DL5 A;  1IIU A;  2KXP A;  4GNY A;  3UPG A;  3NQK A;  4ZHH A;  1CBS A;  4GF4 A;  3UEV A;  1YP7 A;  3Q6L A;  1ZND A;  3T1D A;  4AYH A;  2P8G A;  4O4S A;  3VG3 A;  1FTP A;  1OPF A;  2Y0H A;  1X8O A;  1KXO A;  4Y0Q A;  5IYU A;  4I9R A;  4MVL A;  3S26 A;  1BM5 A;  2AT0 X;  3OBL A;  4ZJ0 A;  3D95 A;  3CBS A;  1AVG I;  4Y0R A;  1QWD A;  1KQX A;  1OSM A;  2K4T A;  2JMB A;  3CMP A;  3HOL A;  4ZR2 A;  3NQ9 A;  2NNE A;  4ZGF A;  5D48 A;  3ZQ3 A;  4QGW A;  3BRN A;  4ID2 A;  5HZQ A;  2W2F A;  1OPB A;  4L1N A;  4A1H A;  1BT9 A;  1FEL A;  2K0L A;  3AKN A;  1GGL A;  5HZ8 A;  2BHV A;  4ODD A;  3QKG A;  4NYR A;  5AQ6 A;  3D97 A;  5FQ8 E;  1L6M A;  3UEW A;  1EUO A;  6PRN A;  4ES7 A;  3BSZ E;  3ZUI A;  2RCQ A;  5BVQ A;  3FW5 A;  4AYI D;  3NX1 A;  4QRL A;  5HA1 A;  5F1E A;  3OE3 A;  3UU2 A;  2OFM X;  2GTF X;  4JGL A;  2OVE A;  4DQ4 A;  4AZL A;  2ANS A;  1LFO A;  1N0S A;  2Q2M A;  4AZN A;  3STN A;  1SXW A;  4LSF A;  2M07 A;  4HFO A;  1HXU A;  3APV A;  2N2M A;  1THQ A;  3JSQ A;  4AKR A;  2GC9 A;  2G78 A;  2Q39 A;  3B2I A;  1X8N A;  4O3Y A;  4ZFX A;  1E54 A;  3EBK A;  1GFQ A;  4RLC A;  3BY0 A;  5DL8 A;  1LIB A;  4U8U O;  3T24 A;  4AYM C;  2QO5 A;  3E3C A;  5L8O A;  3P6F A;  4ZH6 A;  2RA6 A;  3TGB A;  5EZ2 A;  3FR2 A;  1PBO A;  3ZW1 B;  2WWP A;  4LKT A;  1B4M A;  2XE2 A;  5AFU K;  5FFH A;  1QJ8 A;  4EQA C;  4Y0S A;  2MM3 A;  4ZHG A;  4ARH A;  1O1V A;  3DSZ A;  2CZU A;  1EQD A;  3KVD D;  3U0D A;  1MX7 A;  4NLJ A;  1NP1 A;  1X71 A;  2R73 A;  3O19 A;  2QMI A;  2WUT A;  3UEU A;  1BSQ A;  3LK4 2;  1BSY A;  3P6G A;  1YWC A;  1HMR A;  4O4O A;  1JZU A;  1H91 A;  3GAQ A;  4UU2 A;  5IO5 A;  4HPA A;  4WFU A;  2CZT A;  3H3I A;  1ZNH A;  2GJ5 A;  2O62 A;  4D6B A;  1AQB A;  1KT6 A;  4HPD A;  1GT5 A;  1X8Q A;  4YCE A;  3IA8 A;  3C78 X;  3BDR A;  3FR4 A;  4YDA A;  3HWE A;  4GZV A;  2QM9 A;  1LF7 A;  1YIV A;  1E02 A;  2HZQ A;  5LKE A;  2WQ9 A;  4GU8 A;  1KT7 A;  3DA4 A;  3P6E A;  1SXU A;  4OS0 A;  3MVF A;  3HOE A;  1EPA A;  4KII A;  2HMB A;  4COT A;  4I6S A;  1ZHT A;  4ZH9 A;  2JW1 A;  5FEN A;  2F09 A;  3ZUO A;  2ERV A;  2OVD A;  1LIE A;  4YDB A;  1GT3 A;  5DL7 A;  3VG2 A;  3HWG A;  4UU3 A;  3AA7 B;  5D5D A;  1OBQ A;  4D5U A;  3HW9 A;  5HTD A;  3EM0 A;  4ORR A;  1TXL A;  2A2G A;  3IFB A;  1GT4 A;  1A2D A;  4ALB A;  2HNX A;  2JU3 A;  3FEP A;  5HZ9 A;  1HMS A;  4K19 A;  2HLV A;  1QY2 A;  2R74 A;  1KT3 A;  2LA7 A;  3AA0 B;  4LZU A;  5LJE A;  5DL6 A;  1SY1 A;  1CRB A;  1ALB A;  4I9S A;  3APU A;  4XNL A;  3VPJ E;  1X8U A;  4QZT A;  3EMM A;  4TJZ A;  3SY7 A;  1ZHZ A;  4F4B A;  3RZY A;  3TZG A;  1SMP I;  3HTY A;  1OEK A;  2ASN X;  3AA7 A;  4B61 A;  1GFP A;  1ERX A;  1FDQ A;  1DF3 A;  3T0S A;  3ELZ A;  2NND A;  2KD2 A;  1EPB A;  4AW8 A;  4TLJ A;  2KXP B;  5CYB A;  2FLJ A;  2YPV A;  1URE A;  3ELX A;  5CE4 A;  3TF6 A;  2ZLD A;  2BLG A;  4Y0P A;  4QYP A;  5AJC A;  3FR5 A;  5EDB A;  3AA0 A;  1DZP A;  4FMS A;  3HWD A;  3N91 A;  5EED A;  4YFP A;  5HBS A;  3AA1 A;  2XE5 A;  1O1U A;  2Y2X A;  4CSB A;  4ZHC A;  1A3Y A;  3LK3 A;  1KQW A;  3B2J A;  2A3F X;  5L8I A;  1PMP A;  4IAW A;  4OS3 A;  2RN4 A;  5KID A;  4YGG A;  5PRN A;  4G75 A;  3P6C A;  2NNQ A;  3POX A;  5H9A A;  1G5W A;  3VZW X;  3WJG A;  1ML7 A;  4XMD A;  4GDZ A;  4WFV A;  4E1T A;  3SOT A;  1GT1 A;  1TOU A;  4G76 A;  3PRN A;  4QGV A;  1TVQ A;  5HCC C;  3KQ0 A;  4IMN A;  3WI5 A;  2W2A A;  4M6S A;  4YH0 A;  3ZWE A;  2GTL M;  2BS6 A;  4WBK A;  3ZW0 A;  5AEO A;  3TGC A;  4E1S A;  1HBP A;  4YBU A;  3S60 A;  4ZHF A;  4FOZ A;  5H9K A;  2L67 A;  2X27 X;  3P6D A;  4EFG A;  4IB8 A;  1B8E A;  1I4U A;  2OZQ A;  1YUP A;  3S5X A;  1P6P A;  2FRS A;  4MVI A;  1BRQ A;  3NX2 A;  1EAL A;  5FQ6 E;  4AKR B;  2ALL X;  3FW4 A;  4FGI B;  4D6A A;  3V8U A;  2XE1 A;  4GHB A;  3VY8 X;  4YGH A;  1S7D A;  3CR6 A;  3WJF A;  4ALO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...