4O3XB

Crystal structure of the vaccine antigen transferrin binding protein b (tbpb) mutant phe-171-ala from actinobacillus pleuropneumoniae h49
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
241
structure length
241
Chain Sequence
PALGYVVKVPVSSFENKKVDISDIEVITNGNLDDVPYKANSSKYNYPDIKTKDSSLQYVRSGYVIDGEHSGSNEKGYVYYKGNSPAKELPVNQLLTYTGSWDFTSNANLNNEEGRPNYLNDDYYTKAIGKRVGLVSGDAKPAKHKYTSQFEVDFATKKMTGKLSDKEKTIYTVNADIRGNRFTGAATASDKNKGKGESYNFFSADSQSLEGGFYGPKAEEMAGKFVANDKSLFAVFSAKHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transferrin binding protein B
publication title Nonbinding site-directed mutants of transferrin binding protein B exhibit enhanced immunogenicity and protective capabilities.
pubmed doi rcsb
source organism Actinobacillus pleuropneumoniae
molecule tags Metal transport
total genus 64
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 4o3xB01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4o3xB02
2KC0A 2W80C 3VE1A 2LFUA 5T5FA 4O4XA 4AYMC 3HOEA 4O3XB 1YS5A 4O3WA 4AYNA 4O4UA 4AYEC 3VE2A 3UAQA 4O49A 4U9CA 4Z3TA 3PQUA 4AYID 5EE2A 3KVDD 2YPVA 3PQSA 2KDYA 4QQ1A 3HOLA 3V8UA 4AYDC 2W81C 4O3ZA 4O3YA 2Y7SA
chains in the Genus database with same CATH superfamily
1VWLB 8PRNA 3WXQA 1W6FA 4Z28A 2FS6A 2WEXA 1P4TA 4D5UA 2XG6A 4K3BA 4HWMA 2M07A 1HXZA 1LDQA 5K68A 3UEXA 1Q9GA 2BHVA 2XE1A 2P8GA 3GAQA 3RKGA 2W2AA 2RTBB 5B10O 3P6FA 5T5FA 3HWDA 4INNA 5IO7A 2OFAA 2JN3A 2XTQA 5D48A 3FA7A 4QZTA 4E1TA 1H6S1 3JCUO 3BU1A 4KR8A 1GX8A 1QABE 1D2UA 1E00A 4FZMA 3VPJE 4AZOA 2XSTA 3B2HA 1ZHYA 1YIVA 2IFBA 4NV8A 1EPBA 3HWEA 1OPBA 3KQ0A 2R4LA 3QKGA 1I4UA 2IZGB 1KZXA 1SRHA 1BEBA 1VWDB 1E02A 1S5LO 3UPGA 3FMZA 2RTNB 4BUMX 1GFMA 3UAQA 1MM9A 4GF4A 4QRLA 4OELA 4ALBA 5LJCA 5FVNA 4A1YA 3AA0B 1RSTB 2K23A 3LV4A 4GK9A 1BM5A 4I60A 2Y3FA 1ZNDA 4FZNA 1SY2A 4HPDA 4XMDA 2PY1A 2BC3A 5TISO 4PJ2A 3D97A 3LK2B 1K3BA 3O19A 4AKRB 2AT0X 4ORWA 5HWZA 5DL7A 4GCQA 1YP6A 3RDMA 1ERBA 2NP1A 1Q9FA 2ANSA 4GHBA 3FW4A 2WQ9A 1NP1A 3DWNA 3O22A 4YMYA 4IMOA 3OE3A 4ZR2A 1IKJA 2UZ2A 3AA0A 1LCZA 2FGRA 1VWOB 4ES7A 5GTHO 3SZDA 2OL6O 3NSGA 1LUQA 2F1CX 1LELA 3TF6A 1JYJA 5D45A 1GFPA 1KT6A 1GM6A 3STNA 5KAIO 3CWKA 4CDDA 3EM0A 3CBCA 3HWFA 4YGHA 2A0AA 1B0OA 4AZLA 4BBOA 1A2DA 1LF7A 4IBAA 2NNQA 3IA8A 3POQA 2FR2A 5AFUL 4YBPA 2AXTO 2WUTA 3U0DA 3H3IA 1FEMA 5EE2A 4QYPA 4IRWA 2LHFA 3HOLA 3CQRA 4ORUA 2Y7SA 1SLFB 3PF1A 4ZHHA 1KQWA 3PRNA 4ZCBA 4O49A 1U18A 1EALA 2W2FA 3WJDA 4A1HA 1GFOA 3WYPA 3KVDD 1DFVA 4FGIB 2GTFX 1QG5A 3MBTA 1VWEB 3LHNA 2A2UA 1VWNB 1SA8A 3A0HO 1SWCA 2ACPX 3PPTA 4TKHA 5ADXL 4YDBA 1GX3A 4F4BA 2OVDA 4WFUA 3OD9A 2WJRA 6PRNA 3Q34A 2A5CA 4Y0PA 4I9RA 3WZQA 4ZHDA 5IRWA 3A2SX 1E5PA 2AT6X 3APWA 4KC8A 3AA6B 3PDFA 1STRB 2Y0HA 4K3CA 3SAOA 3SLJA 4IABA 4I3CA 4OS8A 2R56A 1AB0A 1EPAA 4PJ0O 4NW4A 2K0LA 2E4JA 1SWOA 4ODDA 3SYSA 2G8CO 4MISA 4Z6JA 1THQA 4JNJA 5KICA 1EIOA 3SLOA 1I78A 1JJJA 4YVBA 4OMXA 3STKA 2A8GA 3UU2A 3AA1B 4XMCA 2I5ZO 5F6BA 4CDFA 3VG2A 3NR3A 3TGAA 2FKGA 2OY8A 4UU2A 3P24A 3FEKA 2IZHB 3D95A 3VG3A 3B2LA 3I17A 4G75A 2KC0A 5EDBA 1MX7A 2F09A 2HZRA 1QJ8A 1SXUA 3HTYA 1QY2A 2AF5A 4JFBA 1X8PA 4QQ1A 2UYWA 1KL3A 5AEOA 1MOYA 4Y0SA 2X8TA 2RTFB 1CBSA 1SXWA 3RWXA 3UEVA 1JMXA 1FELA 1DZJA 3P6DA 5EPQA 5AJCA 1SY0A 2ALLX 4Z27A 4JO6A 4QNIA 1AVGI 4RLBA 1HY2A 2RQ0A 1CJ5A 1SWQA 4GDAA 3T0SA 3ZW2A 2HNXA 5EZ2A 4XMFA 1N43A 3T1DA 3KVNA 3NP1A 1JMZA 2XE2A 1NC9A 1B56A 3I0AA 3WYQA 4ZHGA 3WI4A 2Y0LA 1LIFA 4BX7A 1SWHA 5HCDC 4TJZA 5G38A 4C4VB 1ACDA 5FQ7E 2XE3A 4KCAA 4UU3A 3SZJA 1MUPA 5L8NA 3PGRA 5AJBA 4HPCA 3HW9A 1HXTA 1LIEA 1MEPA 3B2IA 3DWOX 4ORXA 5HA1A 2OFBA 1TOUA 3MM0A 4BQUA 2AVIA 1ADLA 3NBXX 4U46A 2GE4A 1SWLA 4ZH6A 1GT3A 2A13A 1SRGA 1RBPA 4COTA 4PR7A 5BYPA 3DA3A 3PECA 1PTSA 1RAVA 4Z2VA 4CDCA 1LIDA 2NNDA 4D64A 3T20A 2MM3A 1YWCA 4C4VA 4YCEA 3ELXA 3WVMA 1XKIA 5B5EO 5FFHA 3MX7A 2OF8A 1SLDB 1IW2A 1DV9A 2G78A 2CM4A 3O2YA 4C00A 2ZFGA 1YWAA 1SWNA 1VWBB 1H91A 1OEKA 1G85A 1T68X 2CZUA 4R0BA 2CM9A 1ZNHA 2DJGA 2M06A 4ORRA 4BX5B 1SLEB 4XMGA 2W80C 2YMSA 5KHPA 4O3WA 5CYBA 4MVIA 2R89A 3PORA 1QY1A 1LCVA 2ACOA 4U9CA 5H8TA 2LBVA 3KFHA 3P6GA 4GH7A 4CTDA 4CPEA 2JQYA 4L1NA 1EW3A 4ZH9A 4EKVA 1ZHWA 1VPRA 1Y9TA 4IB6A 3UEWA 4JGLA 1BT9A 1SWPA 5B11O 4KH8A 3WOVA 2LFUA 2Q39A 2Q4NA 4N58A 1QFTA 1HBQA 4ZGUA 1Y0GA 1SY3A 3L4RA 2Y3EA 4BX5A 2R73A 2WR6A 1U0XA 4QZUA 2KTDA 2G5LA 2J4UP 4O3XB 5LKFA 4EXZA 1BLRA 1X8NA 5H9KA 2L68A 2R4NA 4Y5DA 1YUPA 3SZHA 1X71A 1EIIA 4OS0A 4KT5A 1EI5A 3PP6A 3D4RA 4QGWA 3JSQA 4XMEA 2F73A 2WSJA 1X89A 1T8VA 5D4AA 5BVSA 1KT4A 4FT6A 3BSZE 4DQ3A 1SWKA 2JU8A 5HCEC 1G74A 5HBSA 1JJXA 3PK2A 1BBPA 1SWSA 5F1EA 1S7DA 4IMNA 1KQXA 2JU3A 3S60A 3FR2A 5LKEA 1CBRA 1AQBA 2QO5A 3KZAA 3KFFA 3S5VA 3N91A 2RTEB 1HMRA 1GFQA 3EW1A 4GETA 2CAMA 4LSIA 3LK41 4IAWA 2ZLDA 1W4TA 4I3DA 5HZ5A 2R74A 3FA9A 2IZJA 3ZI8A 3E3CA 4YKOA 4NYQA 2OVEA 4CK4A 1SWUA 1NDJA 2GTLN 3TZGA 5HA0A 1B8EA 3CBSA 1IIUA 4YH0A 1A57A 2OFRX 4AYMC 4OMWA 3G7XA 2KTSA 3POXA 1OSMA 5IYUA 1SWJA 4YBUA 4NNSA 1BSQA 2QM9A 4ON1A 2RTIB 3A0BO 2RTLA 5CHKA 4AZQA 2RTRB 3CKGA 4GU8A 3T6LA 3BDRA 3C5OA 1MDCA 2L5PA 2XTRA 2OVAA 4I3BA 4ARHA 1Z24A 5BVQA 4ZGFA 3RZYA 3ZW1B 1HBPA 2ODJA 4FQBB 1SWBA 1TW4A 1ZNLA 4RJWA 2OZQA 4EFGA 2LA7A 2LBAA 4FBOA 4ORSA 2JU7A 3BRZA 5HCCC 2JGSA 3AAAA 4C5PA 3BLGA 3VHIA 3AEHA 3SLTA 1O1VA 4LZUA 5HZ8A 4G76A 3QQ2A 2IZEB 3RE6A 4PSQA 2AMMX 1LICA 3ZW1A 1FE3A 3FIDA 3U9PC 2N93A 4KIIA 1PEEA 1PHOA 3CMPA 2MO5A 3HWBA 4KC7A 3CQNA 3APVA 2G7BA 4IB9A 4I9SA 1OBQA 4GGZA 1KGLA 1RXJA 3P02A 2RTOB 5JDPA 2HKDA 4OS3A 3LK42 4UB8O 1E2TA 3FA6A 3APXA 1OPFA 3VY8X 4O4XA 5DL6A 1KZWA 1ORMA 2MHDA 3T24A 3WZOA 1VWQB 4AYEC 1SRFA 4AZPA 1E06A 1G90A 2QO4A 1KOIA 4TNNA 2X8SA 1N9YA 4M6SA 5F58A 1OBUA 1LIBA 1RXKA 2IWVA 3NQKA 2F1VA 1UYNX 1AVDA 1EUOA 3RBHA 1VWJB 1UREA 3U03A 4MIRA 4K19A 2LKKA 3C76X 5HZQA 4FOZA 2A2GA 4BCSA 1I06A 4GE1A 2RCTA 5DG4A 5B29A 1YWDA 2OY7A 3WI5A 4TLJA 2HLVA 2BT9A 5BVTA 1E54A 2C1QA 2RTMA 1LPJA 1WBIA 2JMBA 1I9HA 3NQ9A 3DA4A 5EDCA 4D65A 1ML7A 1XCAA 1TXLA 5KIDA 2RTGB 4BX7B 4YGGA 5L8OA 1SWRA 4EQAC 1VYFA 4ZJ0A 4UB6O 1VWGB 1IKEA 4EEJA 1T1LA 3EW2A 3F6ZB 2MF6A 2JW1A 4LQZA 2FWVA 3WZPA 2YPVA 1IZNB 4FESA 1JBHA 2PRNA 2Y2XA 3FA8A 3WJBA 1KL5A 2XE5A 2PORA 5B5GA 1JJUA 2GTLO 4QYNA 2Z4HA 2FR3A 4AYNA 2X9KA 1QQSA 3RBYA 4ORYA 4LKPA 2RCQA 3ZQ3A 2WJQA 1DF3A 1RXHA 3FYXA 4BOEA 5E79O 3NPOA 2FKJA 1G5WA 4QGVA 3AUMO 1VWAB 4GDZA 3RDUA 1MK5A 1GT4A 2N2MA 2L67A 3VG7A 2QO6A 1OBPA 3PH5A 2FHNX 2W2BA 1EQDA 5B66O 1LDOA 4AYID 1MPFA 5H9AA 2FT9A 5D8JA 1IZNA 2R8AA 2AH7X 4AYDC 1YP7A 4GJSA 2IWWA 1X8OA 1OEJA 1HXUA 1VWFB 3RDSA 1ZNEA 4IB7A 3LK3A 3RDXA 1Y53X 3PEDA 4GKCA 5G3AA 4IL6O 1SRIA 2RTHB 3RDQA 1VWPB 4CSBA 1NQMA 1JYDA 4NNTA 2JOZA 3QRAA 1NQNA 1ICMA 4WFVA 4IAXA 3V8UA 2X46A 2J1NA 1Y52X 3RSWA 5LJGA 4LKTA 2BLGA 2HMBA 2Q2MA 4BGFA 1AVEA 5FAZA 4CDEA 4M7MA 4TQ2A 4YFRA 3WZNA 4CV7A 2OMFA 3MVFA 2A3FX 4EDEA 5K67A 3FLLA 1GKAA 3SZVA 1W5RA 4I95A 4O9SA 1ZRYA 3NX1A 4NP1A 3APUA 4AYHA 1UYOX 2RTDB 1WUBA 4KR4A 3VGWA 5LJHA 2IZLB 3EC5A 3PQUA 4GGRA 2Z4IA 5IO6A 1SWGA 1TVQA 1RLBE 4U8UN 2N2LA 5L3YA 1CBQA 3VHMA 1GFNA 1MX8A 2RN4A 5IXGA 4GCPA 4MVKA 3VZWX 3AA7B 4HFOA 5H9LA 2Q2PA 3BY0A 4A60A 4WHIA 2ASNX 3VG4A 3FEPA 3FENA 5DPQA 5JD2A 4GRJA 2GC9A 1I04A 2RTJA 1Y9LA 3FR4A 4N7CA 5HTDA 4YKMA 3KZIO 2OY5O 3RY2A 5AQ6A 5H9NA 3K3LA 1SWTA 5HZ9A 5D5DA 1HMTA 4LSHA 2YG2A 2ZAIA 5F2BA 1STPA 3BRNA 1FENA 1FJ1E 1T16A 5FENA 3AA7A 1QY0A 2Y0KA 1OSPO 2K4TA 4FZLA 4RUNA 3P6EA 2R4OA 1L6MA 4N75A 5F6ZA 2GJ5A 2L9CA 3VZTX 4AW8A 1PMPA 1PBYA 1RSUB 4AZRA 4BX6B 3JQOA 1I05A 4KRAA 2FLJA 4FBVA 4FQEA 2C1SA 2A5BA 3EMNX 2ZSCA 4N59A 3AKMA 5F7GA 2AT8X 4RLCA 1SWDA 4Y59A 2I5VO 2R88A 1NP4A 3BS0A 1HN2A 1X8QA 1JZUA 1A3YA 2O62A 2F01A 1DZKA 4JCHA 2FTBA 1JIWI 2HYSA 5PRNA 3AAEB 1NBXA 3OBLA 5G26A 3CR6A 1LCWA 3F9DA 4NLIA 4RL9A 1G7NA 5LJBA 4BX6A 5DL5A 3NJTA 1SY1A 2MNHA 3VZUX 1UZ2X 2X55A 1SRJA 1PM1X 1QJ9A 1BSYA 1HXXA 5IO5A 4DNEA 3NX2A 2QTKA 1ALBA 2X32A 1B4MA 2IZDB 4YGZA 3BX7A 3EYCA 1FTPA 2MHLA 3AAAB 1DF8A 3VE1A 2GH7A 5EEDA 3FIQA 1N7YA 4RUUA 4DCBA 3AAEA 3CKFA 4O4UA 1VWCB 1CBIA 4N7DA 2OFMX 2OL8O 3POUA 2FRSA 1DZMA 1SLGB 2R4PA 3FR5A 3VHHA 5D47A 3BS2A 2ZAGA 5DL8A 2OF9A 2CBRA 4GD9A 4GZVA 1SWEA 2OVSA 3JS1A 5L8IA 2WVPA 1VWKB 1GGLA 4JHQA 4NV7A 3SOTA 1BWYA 1GT1A 1S2PA 4Y0RA 1GXAA 4O3YA 1BRQA 1KT3A 2X45A 2MJIA 2BSZA 2RD7C 2QCBA 4OEMA 2YNKA 1N0SA 1JV4A 3LK2A 2KT4B 4AUIA 2LFOA 2OL7A 2G79A 3DTQA 2OY1O 3EBWA 4U8UO 4AKRA 2JMMA 1HQPA 1A18A 3PGSA 3VY9X 3ELZA 2OYBO 1N9MA 1QFVA 1TOWA 3LTWA 2MWHA 2RTKA 2AT3X 2BS6A 3B2KA 2AT5X 4FUVA 1OPAA 1AELA 1ZHXA 2FHLA 2X34A 2DJFA 3KFIA 4GJVA 3ZUIA 1QJPA 5LJDA 2Q9SA 1P6PA 4YDAA 3D96A 1QWDA 4OKAA 4RJXA 3P6CA 3RY1A 1VYGA 1KXOA 2RTAA 1ICNA 3GP6A 1KT5A 2X8FA 1MVGA 4ZFXA 2IZFB 1LNMA 3WU2O 1KFFA 2WPUA 4FBRA 4DQ4A 4B55A 1Y55X 4HPAA 4ID2A 5LJEA 2X56A 5KAFO 1LKEA 2WEWA 4ML7B 1CRBA 4CPIA 3S26A 3ZZVA 4U3QA 5HAEA 3WJGA 3FDCA 3SZIA 2DM5A 3O0EA 2IZAA 2POAA 4LSFA 1LFOA 2AKQA 1JQPA 1ERXA 2AL0X 3B2JA 3HOEA 1ZHTA 4TKJA 2VFBA 3VE2A 4LZVA 1ZNGA 2IZBA 3VU1A 4QGXA 4Z3TA 1PRNA 3C78X 4U8UM 2ERVA 5H2FO 3IFBA 1BSOA 3WJFA 2HZQA 2XKLA 3P6HA 5IRAA 4AFKA 3F8AA 1YWBA 4YCHA 3ZW0B 4B61A 3G7GA 4FMSA 2KZ7B 4GGTA 2EU7X 3UEUA 3MG5A 3TGBA 2O4VA 2Y32A 1IJ8A 3BU9A 1VYOA 3AA6A 3BRYA 1GT5A 2IZIA 3GE2A 4BJ8A 4WBKA 4GNYA 1BRPA 5LJKA 7PRNA 3JTYA 1DC9A 2KD2A 1EXSA 2WWPA 3LK3B 3WJCA 2FGSA 4ALOA 3NADA 5B2AO 5GV0A 1BH3A 4N74A 3RE5A 4AKMA 5CSEA 1BJ7A 5C0NA 3T6FA 2C4IA 3ZW0A 2KZ7A 3ZUOA 2PI3O 2RA6A 1SXXA 1HXLA 3AA1A 3RDOA 4O4OA 4XMHA 3T2XA 2QOMA 1U17A 2VFCA 4C69X 4I6SA 5IRUA 4CPHB 4XNLA 2KW1A 1N4JA 3S5XA 4YFPA 4NYRA 5B27A 2CBSA 1BXWA 1GKAB 4AZNA 3D9WA 2FGQX 2NNEA 2KXPB 4Y0QA 2VDFA 1SXYA 2M4LA 4GUZA 3OJYC 3ZWEA 5CE4A 3SY9A 1KT7A 5HZ6A 1O1UA 4D6BA 4IB8A 1VWMB 2F1TA 5HTEA 1T0VA 4MVLA 4E1SA 3EMMA 1HQQA 3DSZA 1KL4A 1STSB 4A8ZA 1ZHZA 1ZNKA 4LSEA 4O3ZA 4GCSA 4CPHA 1K24A 3KFGA 2LB6A 1DZPA 2GTLM 2FS7A 4ZHCA 4NLJA 1X8UA 1SREA 4GNWA 3T2WA 1SMPI 3QRCA 4CPFA 2RTPB 4Z2OA 3PQSA 4L3RA 2IZCB 2QOSC 3FW5A 3FYFA 4TKBA 2KXPA 3PGUA 4QAEA 2X27X 3VG5A 1R0UA 3BX8A 4FSOA 2CZTA 3HK1A 3TGCA 1IFBA 1O8VA 5JR8A 3DZMA 3X00A 4BVMA 1OEEA 4Z2PA 1PBOA 5EEEA 5AFUK 4YFQA 2RTQB 3EBKA 3HPEA 5GTIO 1VWRB 1MM5A 2WQAE 1MM4A 3STMX 4FRTA 2BS5A 3PH6A 4FRXA 1NGLA 1D3SA 3NQ3A 1IFCA 5K06A 4ZHFA 3HWGA 3C77X 3SYBA 2QMIA 4PUXA 3AKNA 3Q6LA 2XMXA 4FSPA 1YS5A 3FELA 1SWFA 2IZKA 1VWHB 4MEEA 3WJEA 3SY7A 2X4MA 2KDYA 1FDQA 4AZMA 2W81C 5ADXK 3TZSA 5B5FA 4XNKA 3K19A 4D6AA 3WBGA 1SWAA 1S44A 5B3MO 2K62A 2RTCB 5FQ8E 4O4SA 1VWIB 4HPBA 1GX9A 3VG6A 1HMSA 5FQ6E 4MVEA 5G39A
chains in the Genus database with same CATH topology
2A13A 2LKKA 8PRNA 1RBPA 3C76X 5HZQA 4COTA 4FOZA 3BS2A 5BYPA 2ZAGA 3DA3A 3PECA 2A2GA 3WXQA 5DL8A 2CBRA 2FS6A 2WEXA 1P4TA 4D5UA 2XG6A 4GZVA 2OVSA 1LIDA 3JS1A 2NNDA 5L8IA 4HWMA 2M07A 4D64A 1I06A 4GE1A 3T20A 2MM3A 2RCTA 3UEXA 1GGLA 1YWCA 5DG4A 5B29A 1YWDA 3WI5A 3SOTA 1Q9GA 2BHVA 2XE1A 4TLJA 2HLVA 1GT1A 2BT9A 2P8GA 5BVTA 3GAQA 1S2PA 1BWYA 1E54A 4Y0RA 1GXAA 1LPJA 4O3YA 2JMBA 3RKGA 2W2AA 1BRQA 1KT3A 2X45A 2MJIA 4YCEA 3NQ9A 3P6FA 3DA4A 5T5FA 3HWDA 5EDCA 2RD7C 1ML7A 4D65A 1XCAA 1TXLA 3ELXA 3WVMA 5KIDA 4INNA 5IO7A 2YNKA 1XKIA 4YGGA 1N0SA 2JN3A 5FFHA 2XTQA 1JV4A 5L8OA 2KT4B 3LK2A 4EQAC 1VYFA 4AUIA 4ZJ0A 5D48A 2LFOA 1IKEA 3FA7A 4EEJA 2G79A 4QZTA 4E1TA 1H6S1 3MX7A 3DTQA 3F6ZB 2JW1A 3BU1A 3EBWA 2FWVA 4LQZA 4U8UO 4AKRA 2YPVA 1IZNB 1IW2A 2JMMA 4KR8A 1DV9A 4FESA 1HQPA 1A18A 1GX8A 2CM4A 2G78A 1QABE 1JBHA 2PRNA 2Y2XA 1D2UA 3ELZA 3O2YA 3VY9X 3FA8A 3WJBA 1E00A 1QFVA 2ZFGA 1TOWA 1YWAA 2MWHA 2XE5A 2AT3X 2BS6A 2PORA 4FZMA 3B2KA 2AT5X 1H91A 2GTLO 3VPJE 1OEKA 4QYNA 2Z4HA 2FR3A 4AZOA 4AYNA 2XSTA 3B2HA 4FUVA 1OPAA 1QQSA 1G85A 3RBYA 4ORYA 4LKPA 1ZHYA 1T68X 2RCQA 3ZQ3A 1AELA 2CZUA 1YIVA 4R0BA 2IFBA 1DF3A 2CM9A 1ZHXA 3FYXA 1EPBA 3KFIA 1ZNHA 1OPBA 3HWEA 3KQ0A 3ZUIA 5LJDA 4BOEA 3QKGA 1QJPA 2Q9SA 3NPOA 1P6PA 2M06A 4ORRA 1G5WA 4YDAA 3D96A 1QWDA 1I4UA 4XMGA 4QGVA 2W80C 1KZXA 4RJXA 3P6CA 4GDZA 2YMSA 1BEBA 1VYGA 1KXOA 1E02A 1GT4A 1ICNA 3GP6A 3UPGA 1KT5A 3FMZA 2X8FA 5KHPA 2N2MA 2L67A 3VG7A 4O3WA 2QO6A 5CYBA 4MVIA 4BUMX 1GFMA 1MVGA 3UAQA 3PORA 1OBPA 4GF4A 1QY1A 2ACOA 4QRLA 3PH5A 4U9CA 5H8TA 2LBVA 4ZFXA 3KFHA 2W2BA 4ALBA 3P6GA 1EQDA 1LNMA 4GH7A 5LJCA 5FVNA 4A1YA 4L1NA 1EW3A 3AA0B 4AYID 4ZH9A 4FBRA 4DQ4A 1MPFA 1ZHWA 5H9AA 2FT9A 5D8JA 3LV4A 1VPRA 2K23A 4GK9A 1Y9TA 1BM5A 4IB6A 3UEWA 1IZNA 4JGLA 4HPAA 1ZNDA 2AH7X 1BT9A 4ID2A 4FZNA 4AYDC 1YP7A 1SY2A 4HPDA 4KH8A 3WOVA 4XMDA 2LFUA 2PY1A 5LJEA 2Q39A 1X8OA 1OEJA 2Q4NA 1HXUA 1LKEA 4PJ2A 3D97A 2WEWA 3LK2B 4ML7B 1CRBA 4N58A 1QFTA 1ZNEA 4IB7A 3LK3A 1HBQA 4ZGUA 3S26A 3ZZVA 3O19A 4AKRB 2AT0X 4ORWA 4U3QA 5HWZA 5HAEA 1SY3A 3L4RA 3PEDA 3WJGA 5DL7A 4GCQA 2DM5A 4GKCA 3O0EA 1YP6A 2POAA 1ERBA 4LSFA 1LFOA 2AKQA 2R73A 2WR6A 1ERXA 2NP1A 2AL0X 1Q9FA 1U0XA 2ANSA 3FW4A 2KTDA 3B2JA 4QZUA 4GHBA 2WQ9A 3HOEA 1ZHTA 1NP1A 2J4UP 4O3XB 5LKFA 4EXZA 1BLRA 1X8NA 3O22A 4YMYA 4TKJA 5H9KA 4IMOA 3VE2A 4LZVA 1ZNGA 2L68A 3VU1A 4QGXA 4Z3TA 1PRNA 3OE3A 4ZR2A 1IKJA 4CSBA 3C78X 1JYDA 4NNTA 1YUPA 4U8UM 2JOZA 2ERVA 3IFBA 3QRAA 1BSOA 3WJFA 3AA0A 1ICMA 1X71A 4WFVA 2FGRA 1EIIA 2HZQA 4IAXA 3V8UA 2X46A 4OS0A 2J1NA 2XKLA 4KT5A 3P6HA 4AFKA 3F8AA 1YWBA 4ES7A 4YCHA 1EI5A 3RSWA 3ZW0B 3PP6A 3D4RA 4QGWA 3JSQA 4XMEA 3G7GA 5LJGA 4LKTA 2F73A 2KZ7B 4FMSA 3SZDA 2BLGA 2WSJA 1X89A 1T8VA 2HMBA 3NSGA 2EU7X 5D4AA 5BVSA 3UEUA 2Q2MA 1KT4A 3TF6A 4FT6A 1JYJA 3BSZE 5FAZA 4M7MA 4DQ3A 5D45A 4TQ2A 1GFPA 3TGBA 1KT6A 4YFRA 4CV7A 1GM6A 2JU8A 3STNA 2O4VA 2OMFA 3CWKA 3MVFA 5HCEC 2A3FX 3EM0A 3CBCA 4EDEA 3HWFA 3FLLA 2A0AA 3BU9A 4YGHA 1B0OA 1G74A 1GKAA 3SZVA 4AZLA 5HBSA 1JJXA 3AA6A 1BBPA 1GT5A 4I95A 4O9SA 5F1EA 1ZRYA 1A2DA 1LF7A 1S7DA 3GE2A 3NX1A 1KQXA 2NNQA 3APUA 4IBAA 4IMNA 4NP1A 4WBKA 2JU3A 4GNYA 4AYHA 3IA8A 3POQA 3S60A 1BRPA 3FR2A 1CBRA 5LJKA 1AQBA 5LKEA 2QO5A 3JTYA 4KR4A 1DC9A 7PRNA 2FR2A 3KZAA 2KD2A 1EXSA 5AFUL 3KFFA 4YBPA 5LJHA 2WUTA 2WWPA 3PQUA 3N91A 3S5VA 3LK3B 3WJCA 3U0DA 3H3IA 4ALOA 1HMRA 1FEMA 3NADA 1GFQA 2Z4IA 5EE2A 4QYPA 4GETA 5IO6A 5GV0A 1BH3A 2LHFA 3HOLA 3CQRA 4AKMA 4LSIA 3LK41 1TVQA 4IAWA 4ORUA 2Y7SA 1RLBE 1BJ7A 2ZLDA 4I3DA 5C0NA 5HZ5A 2R74A 4U8UN 3FA9A 3ZI8A 4ZHHA 3ZW0A 3E3CA 4YKOA 2KZ7A 4NYQA 3ZUOA 2N2LA 1KQWA 3C5OA 2RA6A 1SXXA 3PRNA 4ZCBA 1CBQA 3AA1A 4O49A 1U18A 1EALA 2W2FA 4O4OA 4XMHA 3WJDA 4A1HA 2OVEA 4CK4A 1GFNA 1MX8A 2RN4A 2GTLN 1GFOA 1U17A 4GCPA 4C69X 4MVKA 1DFVA 3KVDD 4FGIB 3VZWX 2GTFX 1QG5A 3MBTA 4I6SA 5HA0A 3AA7B 3TZGA 1B8EA 4HFOA 4XNLA 5H9LA 3CBSA 3LHNA 1IIUA 4YH0A 2A2UA 1SA8A 1A57A 2Q2PA 2KW1A 3BY0A 2OFRX 2ACPX 4A60A 4AYMC 3S5XA 4WHIA 4YFPA 4OMWA 3PPTA 3G7XA 2ASNX 4TKHA 2KTSA 5ADXL 4YDBA 3POXA 3VG4A 2OVDA 4WFUA 1OSMA 3OD9A 4F4BA 3FEPA 5IYUA 4NYRA 3FENA 5B27A 6PRNA 4YBUA 4NNSA 5DPQA 1BSQA 2QM9A 4Y0PA 2CBSA 4ON1A 1BXWA 4I9RA 4ZHDA 3A2SX 1E5PA 2AT6X 3APWA 1GKAB 4KC8A 4GRJA 2GC9A 1I04A 4AZQA 3AA6B 4AZNA 1Y9LA 2FGQX 2NNEA 3FR4A 4N7CA 2Y0HA 2KXPB 4GU8A 4Y0QA 5HTDA 1SXYA 2M4LA 3SAOA 3OJYC 4YKMA 3ZWEA 5CE4A 4IABA 3SY9A 3BDRA 1KT7A 4I3CA 4OS8A 2R56A 5AQ6A 1MDCA 1O1UA 2L5PA 1AB0A 4IB8A 5H9NA 4D6BA 5HZ6A 2F1TA 3K3LA 2XTRA 5HTEA 1EPAA 2OVAA 4NW4A 1T0VA 4I3BA 4MVLA 2K0LA 3EMMA 2E4JA 4ARHA 1Z24A 4E1SA 5HZ9A 5BVQA 5D5DA 1HMTA 4ZGFA 3RZYA 3DSZA 4ODDA 3ZW1B 4LSHA 2YG2A 3SYSA 2ZAIA 4MISA 3BRNA 4A8ZA 1ZNKA 1FENA 5KICA 1THQA 1ZHZA 1HBPA 5FENA 4O3ZA 1EIOA 3AA7A 2ODJA 1QY0A 4GCSA 4FQBB 2Y0KA 3KFGA 2K4TA 1JJJA 4FZLA 2LB6A 4RUNA 3P6EA 1DZPA 1TW4A 2GTLM 1L6MA 2FS7A 4OMXA 5F6ZA 3STKA 4ZHCA 2GJ5A 2L9CA 3VZTX 4NLJA 1ZNLA 3UU2A 3AA1B 2OZQA 4XMCA 1X8UA 4AW8A 4RJWA 5F6BA 3VG2A 1PMPA 4GNWA 4EFGA 3NR3A 3TGAA 2LA7A 1SMPI 2LBAA 4AZRA 3QRCA 4FBOA 4UU2A 3JQOA 4ORSA 1I05A 2JU7A 3PQSA 4KRAA 2FLJA 4FBVA 3P24A 3FEKA 4B61A 5HCCC 4L3RA 3D95A 3VG3A 2QOSC 3FW5A 3FYFA 3B2LA 3I17A 4G75A 3EMNX 4N59A 2KC0A 3AAAA 5EDBA 4TKBA 3BLGA 3AKMA 2KXPA 5F7GA 2AT8X 1MX7A 4RLCA 4QAEA 1O1VA 2F09A 2HZRA 2X27X 4LZUA 5HZ8A 1NP4A 3VG5A 1R0UA 1QJ8A 1SXUA 3BX8A 4G76A 3HTYA 1QY2A 4FSOA 2CZTA 3HK1A 1HN2A 1X8QA 3TGCA 1IFBA 1O8VA 1JZUA 1A3YA 2O62A 4JFBA 5JR8A 4PSQA 1DZKA 1X8PA 2AMMX 4QQ1A 4BVMA 1LICA 3ZW1A 5AEOA 1FE3A 2FTBA 4JCHA 1JIWI 2HYSA 3U9PC 1OEEA 4Y0SA 2N93A 4KIIA 2X8TA 1PBOA 1PEEA 5EEEA 5PRNA 1CBSA 1SXWA 1PHOA 4YFQA 3RWXA 5AFUK 3EBKA 3UEVA 3AAEB 3CMPA 3OBLA 1FELA 2MO5A 3VY8X 3HWBA 5G26A 1MM5A 3CR6A 4KC7A 2WQAE 1DZJA 3CQNA 1MM4A 3APVA 2G7BA 4IB9A 4I9SA 3STMX 1OBQA 3F9DA 3P6DA 4FRTA 1KGLA 4NLIA 5AJCA 5EPQA 1SY0A 2ALLX 4RL9A 2BS5A 4QNIA 3PH6A 1AVGI 1G7NA 5LJBA 4RLBA 2RQ0A 4FRXA 1CJ5A 5DL5A 1NGLA 1D3SA 3NQ3A 3P02A 1IFCA 5JDPA 3T0SA 3ZW2A 4LSEA 2HNXA 4OS3A 5K06A 3LK42 4ZHFA 3HWGA 3C77X 3SYBA 5EZ2A 1SY1A 3FA6A 4XMFA 3APXA 2QMIA 1OPFA 4PUXA 3T1DA 3NP1A 4O4XA 2MNHA 3AKNA 1KZWA 5DL6A 3Q6LA 1ORMA 2XE2A 2XMXA 1B56A 3I0AA 3WI4A 4ZHGA 4FSPA 1YS5A 3FELA 2MHDA 2Y0LA 3T24A 1LIFA 4AYEC 5HCDC 3WJEA 1UZ2X 4AZPA 3SY7A 3VZUX 4TJZA 1E06A 1QJ9A 1PM1X 1G90A 1BSYA 1HXXA 5IO5A 3NX2A 2QTKA 2QO4A 1ALBA 1KOIA 1ACDA 2KDYA 4TNNA 5FQ7E 1B4MA 1FDQA 4YGZA 4AZMA 3BX7A 2X8SA 2W81C 2XE3A 4KCAA 4UU3A 3TZSA 5ADXK 3EYCA 1FTPA 2MHLA 3AAAB 4M6SA 1MUPA 5F58A 3VE1A 5L8NA 5EEDA 1OBUA 1LIBA 3FIQA 3K19A 4XNKA 4D6AA 3NQKA 4RUUA 2F1VA 3WBGA 3AAEA 1S44A 2K62A 5AJBA 4O4UA 5FQ8E 1CBIA 4HPCA 3HW9A 1HXTA 1LIEA 4N7DA 4O4SA 3B2IA 2OFMX 4ORXA 5HA1A 1EUOA 3POUA 2FRSA 1TOUA 4BQUA 1DZMA 1ADLA 4HPBA 3RBHA 3NBXX 1GX9A 3VG6A 1UREA 3FR5A 5D47A 1HMSA 3U03A 5FQ6E 2GE4A 4MVEA 4MIRA 4ZH6A 4K19A 1GT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KC0 A;  2W80 C;  3VE1 A;  2LFU A;  5T5F A;  4O4X A;  4AYM C;  3HOE A;  4O3X B;  1YS5 A;  4O3W A;  4AYN A;  4O4U A;  4AYE C;  3VE2 A;  3UAQ A;  4O49 A;  4U9C A;  4Z3T A;  3PQU A;  4AYI D;  5EE2 A;  3KVD D;  2YPV A;  3PQS A;  2KDY A;  4QQ1 A;  3HOL A;  3V8U A;  4AYD C;  2W81 C;  4O3Z A;  4O3Y A;  2Y7S A; 
#chains in the Genus database with same CATH topology
 1VWL B;  8PRN A;  3WXQ A;  1W6F A;  4Z28 A;  2FS6 A;  2WEX A;  1P4T A;  4D5U A;  2XG6 A;  4K3B A;  4HWM A;  2M07 A;  1HXZ A;  1LDQ A;  5K68 A;  3UEX A;  1Q9G A;  2BHV A;  2XE1 A;  2P8G A;  3GAQ A;  3RKG A;  2W2A A;  2RTB B;  5B10 O;  3P6F A;  5T5F A;  3HWD A;  4INN A;  5IO7 A;  2OFA A;  2JN3 A;  2XTQ A;  5D48 A;  3FA7 A;  4QZT A;  4E1T A;  1H6S 1;  3JCU O;  3BU1 A;  4KR8 A;  1GX8 A;  1QAB E;  1D2U A;  1E00 A;  4FZM A;  3VPJ E;  4AZO A;  2XST A;  3B2H A;  1ZHY A;  1YIV A;  2IFB A;  4NV8 A;  1EPB A;  3HWE A;  1OPB A;  3KQ0 A;  2R4L A;  3QKG A;  1I4U A;  2IZG B;  1KZX A;  1SRH A;  1BEB A;  1VWD B;  1E02 A;  1S5L O;  3UPG A;  3FMZ A;  2RTN B;  4BUM X;  1GFM A;  3UAQ A;  1MM9 A;  4GF4 A;  4QRL A;  4OEL A;  4ALB A;  5LJC A;  5FVN A;  4A1Y A;  3AA0 B;  1RST B;  2K23 A;  3LV4 A;  4GK9 A;  1BM5 A;  4I60 A;  2Y3F A;  1ZND A;  4FZN A;  1SY2 A;  4HPD A;  4XMD A;  2PY1 A;  2BC3 A;  5TIS O;  4PJ2 A;  3D97 A;  3LK2 B;  1K3B A;  3O19 A;  4AKR B;  2AT0 X;  4ORW A;  5HWZ A;  5DL7 A;  4GCQ A;  1YP6 A;  3RDM A;  1ERB A;  2NP1 A;  1Q9F A;  2ANS A;  4GHB A;  3FW4 A;  2WQ9 A;  1NP1 A;  3DWN A;  3O22 A;  4YMY A;  4IMO A;  3OE3 A;  4ZR2 A;  1IKJ A;  2UZ2 A;  3AA0 A;  1LCZ A;  2FGR A;  1VWO B;  4ES7 A;  5GTH O;  3SZD A;  2OL6 O;  3NSG A;  1LUQ A;  2F1C X;  1LEL A;  3TF6 A;  1JYJ A;  5D45 A;  1GFP A;  1KT6 A;  1GM6 A;  3STN A;  5KAI O;  3CWK A;  4CDD A;  3EM0 A;  3CBC A;  3HWF A;  4YGH A;  2A0A A;  1B0O A;  4AZL A;  4BBO A;  1A2D A;  1LF7 A;  4IBA A;  2NNQ A;  3IA8 A;  3POQ A;  2FR2 A;  5AFU L;  4YBP A;  2AXT O;  2WUT A;  3U0D A;  3H3I A;  1FEM A;  5EE2 A;  4QYP A;  4IRW A;  2LHF A;  3HOL A;  3CQR A;  4ORU A;  2Y7S A;  1SLF B;  3PF1 A;  4ZHH A;  1KQW A;  3PRN A;  4ZCB A;  4O49 A;  1U18 A;  1EAL A;  2W2F A;  3WJD A;  4A1H A;  1GFO A;  3WYP A;  3KVD D;  1DFV A;  4FGI B;  2GTF X;  1QG5 A;  3MBT A;  1VWE B;  3LHN A;  2A2U A;  1VWN B;  1SA8 A;  3A0H O;  1SWC A;  2ACP X;  3PPT A;  4TKH A;  5ADX L;  4YDB A;  1GX3 A;  4F4B A;  2OVD A;  4WFU A;  3OD9 A;  2WJR A;  6PRN A;  3Q34 A;  2A5C A;  4Y0P A;  4I9R A;  3WZQ A;  4ZHD A;  5IRW A;  3A2S X;  1E5P A;  2AT6 X;  3APW A;  4KC8 A;  3AA6 B;  3PDF A;  1STR B;  2Y0H A;  4K3C A;  3SAO A;  3SLJ A;  4IAB A;  4I3C A;  4OS8 A;  2R56 A;  1AB0 A;  1EPA A;  4PJ0 O;  4NW4 A;  2K0L A;  2E4J A;  1SWO A;  4ODD A;  3SYS A;  2G8C O;  4MIS A;  4Z6J A;  1THQ A;  4JNJ A;  5KIC A;  1EIO A;  3SLO A;  1I78 A;  1JJJ A;  4YVB A;  4OMX A;  3STK A;  2A8G A;  3UU2 A;  3AA1 B;  4XMC A;  2I5Z O;  5F6B A;  4CDF A;  3VG2 A;  3NR3 A;  3TGA A;  2FKG A;  2OY8 A;  4UU2 A;  3P24 A;  3FEK A;  2IZH B;  3D95 A;  3VG3 A;  3B2L A;  3I17 A;  4G75 A;  2KC0 A;  5EDB A;  1MX7 A;  2F09 A;  2HZR A;  1QJ8 A;  1SXU A;  3HTY A;  1QY2 A;  2AF5 A;  4JFB A;  1X8P A;  4QQ1 A;  2UYW A;  1KL3 A;  5AEO A;  1MOY A;  4Y0S A;  2X8T A;  2RTF B;  1CBS A;  1SXW A;  3RWX A;  3UEV A;  1JMX A;  1FEL A;  1DZJ A;  3P6D A;  5EPQ A;  5AJC A;  1SY0 A;  2ALL X;  4Z27 A;  4JO6 A;  4QNI A;  1AVG I;  4RLB A;  1HY2 A;  2RQ0 A;  1CJ5 A;  1SWQ A;  4GDA A;  3T0S A;  3ZW2 A;  2HNX A;  5EZ2 A;  4XMF A;  1N43 A;  3T1D A;  3KVN A;  3NP1 A;  1JMZ A;  2XE2 A;  1NC9 A;  1B56 A;  3I0A A;  3WYQ A;  4ZHG A;  3WI4 A;  2Y0L A;  1LIF A;  4BX7 A;  1SWH A;  5HCD C;  4TJZ A;  5G38 A;  4C4V B;  1ACD A;  5FQ7 E;  2XE3 A;  4KCA A;  4UU3 A;  3SZJ A;  1MUP A;  5L8N A;  3PGR A;  5AJB A;  4HPC A;  3HW9 A;  1HXT A;  1LIE A;  1MEP A;  3B2I A;  3DWO X;  4ORX A;  5HA1 A;  2OFB A;  1TOU A;  3MM0 A;  4BQU A;  2AVI A;  1ADL A;  3NBX X;  4U46 A;  2GE4 A;  1SWL A;  4ZH6 A;  1GT3 A;  2A13 A;  1SRG A;  1RBP A;  4COT A;  4PR7 A;  5BYP A;  3DA3 A;  3PEC A;  1PTS A;  1RAV A;  4Z2V A;  4CDC A;  1LID A;  2NND A;  4D64 A;  3T20 A;  2MM3 A;  1YWC A;  4C4V A;  4YCE A;  3ELX A;  3WVM A;  1XKI A;  5B5E O;  5FFH A;  3MX7 A;  2OF8 A;  1SLD B;  1IW2 A;  1DV9 A;  2G78 A;  2CM4 A;  3O2Y A;  4C00 A;  2ZFG A;  1YWA A;  1SWN A;  1VWB B;  1H91 A;  1OEK A;  1G85 A;  1T68 X;  2CZU A;  4R0B A;  2CM9 A;  1ZNH A;  2DJG A;  2M06 A;  4ORR A;  4BX5 B;  1SLE B;  4XMG A;  2W80 C;  2YMS A;  5KHP A;  4O3W A;  5CYB A;  4MVI A;  2R89 A;  3POR A;  1QY1 A;  1LCV A;  2ACO A;  4U9C A;  5H8T A;  2LBV A;  3KFH A;  3P6G A;  4GH7 A;  4CTD A;  4CPE A;  2JQY A;  4L1N A;  1EW3 A;  4ZH9 A;  4EKV A;  1ZHW A;  1VPR A;  1Y9T A;  4IB6 A;  3UEW A;  4JGL A;  1BT9 A;  1SWP A;  5B11 O;  4KH8 A;  3WOV A;  2LFU A;  2Q39 A;  2Q4N A;  4N58 A;  1QFT A;  1HBQ A;  4ZGU A;  1Y0G A;  1SY3 A;  3L4R A;  2Y3E A;  4BX5 A;  2R73 A;  2WR6 A;  1U0X A;  4QZU A;  2KTD A;  2G5L A;  2J4U P;  4O3X B;  5LKF A;  4EXZ A;  1BLR A;  1X8N A;  5H9K A;  2L68 A;  2R4N A;  4Y5D A;  1YUP A;  3SZH A;  1X71 A;  1EII A;  4OS0 A;  4KT5 A;  1EI5 A;  3PP6 A;  3D4R A;  4QGW A;  3JSQ A;  4XME A;  2F73 A;  2WSJ A;  1X89 A;  1T8V A;  5D4A A;  5BVS A;  1KT4 A;  4FT6 A;  3BSZ E;  4DQ3 A;  1SWK A;  2JU8 A;  5HCE C;  1G74 A;  5HBS A;  1JJX A;  3PK2 A;  1BBP A;  1SWS A;  5F1E A;  1S7D A;  4IMN A;  1KQX A;  2JU3 A;  3S60 A;  3FR2 A;  5LKE A;  1CBR A;  1AQB A;  2QO5 A;  3KZA A;  3KFF A;  3S5V A;  3N91 A;  2RTE B;  1HMR A;  1GFQ A;  3EW1 A;  4GET A;  2CAM A;  4LSI A;  3LK4 1;  4IAW A;  2ZLD A;  1W4T A;  4I3D A;  5HZ5 A;  2R74 A;  3FA9 A;  2IZJ A;  3ZI8 A;  3E3C A;  4YKO A;  4NYQ A;  2OVE A;  4CK4 A;  1SWU A;  1NDJ A;  2GTL N;  3TZG A;  5HA0 A;  1B8E A;  3CBS A;  1IIU A;  4YH0 A;  1A57 A;  2OFR X;  4AYM C;  4OMW A;  3G7X A;  2KTS A;  3POX A;  1OSM A;  5IYU A;  1SWJ A;  4YBU A;  4NNS A;  1BSQ A;  2QM9 A;  4ON1 A;  2RTI B;  3A0B O;  2RTL A;  5CHK A;  4AZQ A;  2RTR B;  3CKG A;  4GU8 A;  3T6L A;  3BDR A;  3C5O A;  1MDC A;  2L5P A;  2XTR A;  2OVA A;  4I3B A;  4ARH A;  1Z24 A;  5BVQ A;  4ZGF A;  3RZY A;  3ZW1 B;  1HBP A;  2ODJ A;  4FQB B;  1SWB A;  1TW4 A;  1ZNL A;  4RJW A;  2OZQ A;  4EFG A;  2LA7 A;  2LBA A;  4FBO A;  4ORS A;  2JU7 A;  3BRZ A;  5HCC C;  2JGS A;  3AAA A;  4C5P A;  3BLG A;  3VHI A;  3AEH A;  3SLT A;  1O1V A;  4LZU A;  5HZ8 A;  4G76 A;  3QQ2 A;  2IZE B;  3RE6 A;  4PSQ A;  2AMM X;  1LIC A;  3ZW1 A;  1FE3 A;  3FID A;  3U9P C;  2N93 A;  4KII A;  1PEE A;  1PHO A;  3CMP A;  2MO5 A;  3HWB A;  4KC7 A;  3CQN A;  3APV A;  2G7B A;  4IB9 A;  4I9S A;  1OBQ A;  4GGZ A;  1KGL A;  1RXJ A;  3P02 A;  2RTO B;  5JDP A;  2HKD A;  4OS3 A;  3LK4 2;  4UB8 O;  1E2T A;  3FA6 A;  3APX A;  1OPF A;  3VY8 X;  4O4X A;  5DL6 A;  1KZW A;  1ORM A;  2MHD A;  3T24 A;  3WZO A;  1VWQ B;  4AYE C;  1SRF A;  4AZP A;  1E06 A;  1G90 A;  2QO4 A;  1KOI A;  4TNN A;  2X8S A;  1N9Y A;  4M6S A;  5F58 A;  1OBU A;  1LIB A;  1RXK A;  2IWV A;  3NQK A;  2F1V A;  1UYN X;  1AVD A;  1EUO A;  3RBH A;  1VWJ B;  1URE A;  3U03 A;  4MIR A;  4K19 A;  2LKK A;  3C76 X;  5HZQ A;  4FOZ A;  2A2G A;  4BCS A;  1I06 A;  4GE1 A;  2RCT A;  5DG4 A;  5B29 A;  1YWD A;  2OY7 A;  3WI5 A;  4TLJ A;  2HLV A;  2BT9 A;  5BVT A;  1E54 A;  2C1Q A;  2RTM A;  1LPJ A;  1WBI A;  2JMB A;  1I9H A;  3NQ9 A;  3DA4 A;  5EDC A;  4D65 A;  1ML7 A;  1XCA A;  1TXL A;  5KID A;  2RTG B;  4BX7 B;  4YGG A;  5L8O A;  1SWR A;  4EQA C;  1VYF A;  4ZJ0 A;  4UB6 O;  1VWG B;  1IKE A;  4EEJ A;  1T1L A;  3EW2 A;  3F6Z B;  2MF6 A;  2JW1 A;  4LQZ A;  2FWV A;  3WZP A;  2YPV A;  1IZN B;  4FES A;  1JBH A;  2PRN A;  2Y2X A;  3FA8 A;  3WJB A;  1KL5 A;  2XE5 A;  2POR A;  5B5G A;  1JJU A;  2GTL O;  4QYN A;  2Z4H A;  2FR3 A;  4AYN A;  2X9K A;  1QQS A;  3RBY A;  4ORY A;  4LKP A;  2RCQ A;  3ZQ3 A;  2WJQ A;  1DF3 A;  1RXH A;  3FYX A;  4BOE A;  5E79 O;  3NPO A;  2FKJ A;  1G5W A;  4QGV A;  3AUM O;  1VWA B;  4GDZ A;  3RDU A;  1MK5 A;  1GT4 A;  2N2M A;  2L67 A;  3VG7 A;  2QO6 A;  1OBP A;  3PH5 A;  2FHN X;  2W2B A;  1EQD A;  5B66 O;  1LDO A;  4AYI D;  1MPF A;  5H9A A;  2FT9 A;  5D8J A;  1IZN A;  2R8A A;  2AH7 X;  4AYD C;  1YP7 A;  4GJS A;  2IWW A;  1X8O A;  1OEJ A;  1HXU A;  1VWF B;  3RDS A;  1ZNE A;  4IB7 A;  3LK3 A;  3RDX A;  1Y53 X;  3PED A;  4GKC A;  5G3A A;  4IL6 O;  1SRI A;  2RTH B;  3RDQ A;  1VWP B;  4CSB A;  1NQM A;  1JYD A;  4NNT A;  2JOZ A;  3QRA A;  1NQN A;  1ICM A;  4WFV A;  4IAX A;  3V8U A;  2X46 A;  2J1N A;  1Y52 X;  3RSW A;  5LJG A;  4LKT A;  2BLG A;  2HMB A;  2Q2M A;  4BGF A;  1AVE A;  5FAZ A;  4CDE A;  4M7M A;  4TQ2 A;  4YFR A;  3WZN A;  4CV7 A;  2OMF A;  3MVF A;  2A3F X;  4EDE A;  5K67 A;  3FLL A;  1GKA A;  3SZV A;  1W5R A;  4I95 A;  4O9S A;  1ZRY A;  3NX1 A;  4NP1 A;  3APU A;  4AYH A;  1UYO X;  2RTD B;  1WUB A;  4KR4 A;  3VGW A;  5LJH A;  2IZL B;  3EC5 A;  3PQU A;  4GGR A;  2Z4I A;  5IO6 A;  1SWG A;  1TVQ A;  1RLB E;  4U8U N;  2N2L A;  5L3Y A;  1CBQ A;  3VHM A;  1GFN A;  1MX8 A;  2RN4 A;  5IXG A;  4GCP A;  4MVK A;  3VZW X;  3AA7 B;  4HFO A;  5H9L A;  2Q2P A;  3BY0 A;  4A60 A;  4WHI A;  2ASN X;  3VG4 A;  3FEP A;  3FEN A;  5DPQ A;  5JD2 A;  4GRJ A;  2GC9 A;  1I04 A;  2RTJ A;  1Y9L A;  3FR4 A;  4N7C A;  5HTD A;  4YKM A;  3KZI O;  2OY5 O;  3RY2 A;  5AQ6 A;  5H9N A;  3K3L A;  1SWT A;  5HZ9 A;  5D5D A;  1HMT A;  4LSH A;  2YG2 A;  2ZAI A;  5F2B A;  1STP A;  3BRN A;  1FEN A;  1FJ1 E;  1T16 A;  5FEN A;  3AA7 A;  1QY0 A;  2Y0K A;  1OSP O;  2K4T A;  4FZL A;  4RUN A;  3P6E A;  2R4O A;  1L6M A;  4N75 A;  5F6Z A;  2GJ5 A;  2L9C A;  3VZT X;  4AW8 A;  1PMP A;  1PBY A;  1RSU B;  4AZR A;  4BX6 B;  3JQO A;  1I05 A;  4KRA A;  2FLJ A;  4FBV A;  4FQE A;  2C1S A;  2A5B A;  3EMN X;  2ZSC A;  4N59 A;  3AKM A;  5F7G A;  2AT8 X;  4RLC A;  1SWD A;  4Y59 A;  2I5V O;  2R88 A;  1NP4 A;  3BS0 A;  1HN2 A;  1X8Q A;  1JZU A;  1A3Y A;  2O62 A;  2F01 A;  1DZK A;  4JCH A;  2FTB A;  1JIW I;  2HYS A;  5PRN A;  3AAE B;  1NBX A;  3OBL A;  5G26 A;  3CR6 A;  1LCW A;  3F9D A;  4NLI A;  4RL9 A;  1G7N A;  5LJB A;  4BX6 A;  5DL5 A;  3NJT A;  1SY1 A;  2MNH A;  3VZU X;  1UZ2 X;  2X55 A;  1SRJ A;  1PM1 X;  1QJ9 A;  1BSY A;  1HXX A;  5IO5 A;  4DNE A;  3NX2 A;  2QTK A;  1ALB A;  2X32 A;  1B4M A;  2IZD B;  4YGZ A;  3BX7 A;  3EYC A;  1FTP A;  2MHL A;  3AAA B;  1DF8 A;  3VE1 A;  2GH7 A;  5EED A;  3FIQ A;  1N7Y A;  4RUU A;  4DCB A;  3AAE A;  3CKF A;  4O4U A;  1VWC B;  1CBI A;  4N7D A;  2OFM X;  2OL8 O;  3POU A;  2FRS A;  1DZM A;  1SLG B;  2R4P A;  3FR5 A;  3VHH A;  5D47 A;  3BS2 A;  2ZAG A;  5DL8 A;  2OF9 A;  2CBR A;  4GD9 A;  4GZV A;  1SWE A;  2OVS A;  3JS1 A;  5L8I A;  2WVP A;  1VWK B;  1GGL A;  4JHQ A;  4NV7 A;  3SOT A;  1BWY A;  1GT1 A;  1S2P A;  4Y0R A;  1GXA A;  4O3Y A;  1BRQ A;  1KT3 A;  2X45 A;  2MJI A;  2BSZ A;  2RD7 C;  2QCB A;  4OEM A;  2YNK A;  1N0S A;  1JV4 A;  3LK2 A;  2KT4 B;  4AUI A;  2LFO A;  2OL7 A;  2G79 A;  3DTQ A;  2OY1 O;  3EBW A;  4U8U O;  4AKR A;  2JMM A;  1HQP A;  1A18 A;  3PGS A;  3VY9 X;  3ELZ A;  2OYB O;  1N9M A;  1QFV A;  1TOW A;  3LTW A;  2MWH A;  2RTK A;  2AT3 X;  2BS6 A;  3B2K A;  2AT5 X;  4FUV A;  1OPA A;  1AEL A;  1ZHX A;  2FHL A;  2X34 A;  2DJF A;  3KFI A;  4GJV A;  3ZUI A;  1QJP A;  5LJD A;  2Q9S A;  1P6P A;  4YDA A;  3D96 A;  1QWD A;  4OKA A;  4RJX A;  3P6C A;  3RY1 A;  1VYG A;  1KXO A;  2RTA A;  1ICN A;  3GP6 A;  1KT5 A;  2X8F A;  1MVG A;  4ZFX A;  2IZF B;  1LNM A;  3WU2 O;  1KFF A;  2WPU A;  4FBR A;  4DQ4 A;  4B55 A;  1Y55 X;  4HPA A;  4ID2 A;  5LJE A;  2X56 A;  5KAF O;  1LKE A;  2WEW A;  4ML7 B;  1CRB A;  4CPI A;  3S26 A;  3ZZV A;  4U3Q A;  5HAE A;  3WJG A;  3FDC A;  3SZI A;  2DM5 A;  3O0E A;  2IZA A;  2POA A;  4LSF A;  1LFO A;  2AKQ A;  1JQP A;  1ERX A;  2AL0 X;  3B2J A;  3HOE A;  1ZHT A;  4TKJ A;  2VFB A;  3VE2 A;  4LZV A;  1ZNG A;  2IZB A;  3VU1 A;  4QGX A;  4Z3T A;  1PRN A;  3C78 X;  4U8U M;  2ERV A;  5H2F O;  3IFB A;  1BSO A;  3WJF A;  2HZQ A;  2XKL A;  3P6H A;  5IRA A;  4AFK A;  3F8A A;  1YWB A;  4YCH A;  3ZW0 B;  4B61 A;  3G7G A;  4FMS A;  2KZ7 B;  4GGT A;  2EU7 X;  3UEU A;  3MG5 A;  3TGB A;  2O4V A;  2Y32 A;  1IJ8 A;  3BU9 A;  1VYO A;  3AA6 A;  3BRY A;  1GT5 A;  2IZI A;  3GE2 A;  4BJ8 A;  4WBK A;  4GNY A;  1BRP A;  5LJK A;  7PRN A;  3JTY A;  1DC9 A;  2KD2 A;  1EXS A;  2WWP A;  3LK3 B;  3WJC A;  2FGS A;  4ALO A;  3NAD A;  5B2A O;  5GV0 A;  1BH3 A;  4N74 A;  3RE5 A;  4AKM A;  5CSE A;  1BJ7 A;  5C0N A;  3T6F A;  2C4I A;  3ZW0 A;  2KZ7 A;  3ZUO A;  2PI3 O;  2RA6 A;  1SXX A;  1HXL A;  3AA1 A;  3RDO A;  4O4O A;  4XMH A;  3T2X A;  2QOM A;  1U17 A;  2VFC A;  4C69 X;  4I6S A;  5IRU A;  4CPH B;  4XNL A;  2KW1 A;  1N4J A;  3S5X A;  4YFP A;  4NYR A;  5B27 A;  2CBS A;  1BXW A;  1GKA B;  4AZN A;  3D9W A;  2FGQ X;  2NNE A;  2KXP B;  4Y0Q A;  2VDF A;  1SXY A;  2M4L A;  4GUZ A;  3OJY C;  3ZWE A;  5CE4 A;  3SY9 A;  1KT7 A;  5HZ6 A;  1O1U A;  4D6B A;  4IB8 A;  1VWM B;  2F1T A;  5HTE A;  1T0V A;  4MVL A;  4E1S A;  3EMM A;  1HQQ A;  3DSZ A;  1KL4 A;  1STS B;  4A8Z A;  1ZHZ A;  1ZNK A;  4LSE A;  4O3Z A;  4GCS A;  4CPH A;  1K24 A;  3KFG A;  2LB6 A;  1DZP A;  2GTL M;  2FS7 A;  4ZHC A;  4NLJ A;  1X8U A;  1SRE A;  4GNW A;  3T2W A;  1SMP I;  3QRC A;  4CPF A;  2RTP B;  4Z2O A;  3PQS A;  4L3R A;  2IZC B;  2QOS C;  3FW5 A;  3FYF A;  4TKB A;  2KXP A;  3PGU A;  4QAE A;  2X27 X;  3VG5 A;  1R0U A;  3BX8 A;  4FSO A;  2CZT A;  3HK1 A;  3TGC A;  1IFB A;  1O8V A;  5JR8 A;  3DZM A;  3X00 A;  4BVM A;  1OEE A;  4Z2P A;  1PBO A;  5EEE A;  5AFU K;  4YFQ A;  2RTQ B;  3EBK A;  3HPE A;  5GTI O;  1VWR B;  1MM5 A;  2WQA E;  1MM4 A;  3STM X;  4FRT A;  2BS5 A;  3PH6 A;  4FRX A;  1NGL A;  1D3S A;  3NQ3 A;  1IFC A;  5K06 A;  4ZHF A;  3HWG A;  3C77 X;  3SYB A;  2QMI A;  4PUX A;  3AKN A;  3Q6L A;  2XMX A;  4FSP A;  1YS5 A;  3FEL A;  1SWF A;  2IZK A;  1VWH B;  4MEE A;  3WJE A;  3SY7 A;  2X4M A;  2KDY A;  1FDQ A;  4AZM A;  2W81 C;  5ADX K;  3TZS A;  5B5F A;  4XNK A;  3K19 A;  4D6A A;  3WBG A;  1SWA A;  1S44 A;  5B3M O;  2K62 A;  2RTC B;  5FQ8 E;  4O4S A;  1VWI B;  4HPB A;  1GX9 A;  3VG6 A;  1HMS A;  5FQ6 E;  4MVE A;  5G39 A; 
#chains in the Genus database with same CATH homology
 2A13 A;  2LKK A;  8PRN A;  1RBP A;  3C76 X;  5HZQ A;  4COT A;  4FOZ A;  3BS2 A;  5BYP A;  2ZAG A;  3DA3 A;  3PEC A;  2A2G A;  3WXQ A;  5DL8 A;  2CBR A;  2FS6 A;  2WEX A;  1P4T A;  4D5U A;  2XG6 A;  4GZV A;  2OVS A;  1LID A;  3JS1 A;  2NND A;  5L8I A;  4HWM A;  2M07 A;  4D64 A;  1I06 A;  4GE1 A;  3T20 A;  2MM3 A;  2RCT A;  3UEX A;  1GGL A;  1YWC A;  5DG4 A;  5B29 A;  1YWD A;  3WI5 A;  3SOT A;  1Q9G A;  2BHV A;  2XE1 A;  4TLJ A;  2HLV A;  1GT1 A;  2BT9 A;  2P8G A;  5BVT A;  3GAQ A;  1S2P A;  1BWY A;  1E54 A;  4Y0R A;  1GXA A;  1LPJ A;  4O3Y A;  2JMB A;  3RKG A;  2W2A A;  1BRQ A;  1KT3 A;  2X45 A;  2MJI A;  4YCE A;  3NQ9 A;  3P6F A;  3DA4 A;  5T5F A;  3HWD A;  5EDC A;  2RD7 C;  1ML7 A;  4D65 A;  1XCA A;  1TXL A;  3ELX A;  3WVM A;  5KID A;  4INN A;  5IO7 A;  2YNK A;  1XKI A;  4YGG A;  1N0S A;  2JN3 A;  5FFH A;  2XTQ A;  1JV4 A;  5L8O A;  2KT4 B;  3LK2 A;  4EQA C;  1VYF A;  4AUI A;  4ZJ0 A;  5D48 A;  2LFO A;  1IKE A;  3FA7 A;  4EEJ A;  2G79 A;  4QZT A;  4E1T A;  1H6S 1;  3MX7 A;  3DTQ A;  3F6Z B;  2JW1 A;  3BU1 A;  3EBW A;  2FWV A;  4LQZ A;  4U8U O;  4AKR A;  2YPV A;  1IZN B;  1IW2 A;  2JMM A;  4KR8 A;  1DV9 A;  4FES A;  1HQP A;  1A18 A;  1GX8 A;  2CM4 A;  2G78 A;  1QAB E;  1JBH A;  2PRN A;  2Y2X A;  1D2U A;  3ELZ A;  3O2Y A;  3VY9 X;  3FA8 A;  3WJB A;  1E00 A;  1QFV A;  2ZFG A;  1TOW A;  1YWA A;  2MWH A;  2XE5 A;  2AT3 X;  2BS6 A;  2POR A;  4FZM A;  3B2K A;  2AT5 X;  1H91 A;  2GTL O;  3VPJ E;  1OEK A;  4QYN A;  2Z4H A;  2FR3 A;  4AZO A;  4AYN A;  2XST A;  3B2H A;  4FUV A;  1OPA A;  1QQS A;  1G85 A;  3RBY A;  4ORY A;  4LKP A;  1ZHY A;  1T68 X;  2RCQ A;  3ZQ3 A;  1AEL A;  2CZU A;  1YIV A;  4R0B A;  2IFB A;  1DF3 A;  2CM9 A;  1ZHX A;  3FYX A;  1EPB A;  3KFI A;  1ZNH A;  1OPB A;  3HWE A;  3KQ0 A;  3ZUI A;  5LJD A;  4BOE A;  3QKG A;  1QJP A;  2Q9S A;  3NPO A;  1P6P A;  2M06 A;  4ORR A;  1G5W A;  4YDA A;  3D96 A;  1QWD A;  1I4U A;  4XMG A;  4QGV A;  2W80 C;  1KZX A;  4RJX A;  3P6C A;  4GDZ A;  2YMS A;  1BEB A;  1VYG A;  1KXO A;  1E02 A;  1GT4 A;  1ICN A;  3GP6 A;  3UPG A;  1KT5 A;  3FMZ A;  2X8F A;  5KHP A;  2N2M A;  2L67 A;  3VG7 A;  4O3W A;  2QO6 A;  5CYB A;  4MVI A;  4BUM X;  1GFM A;  1MVG A;  3UAQ A;  3POR A;  1OBP A;  4GF4 A;  1QY1 A;  2ACO A;  4QRL A;  3PH5 A;  4U9C A;  5H8T A;  2LBV A;  4ZFX A;  3KFH A;  2W2B A;  4ALB A;  3P6G A;  1EQD A;  1LNM A;  4GH7 A;  5LJC A;  5FVN A;  4A1Y A;  4L1N A;  1EW3 A;  3AA0 B;  4AYI D;  4ZH9 A;  4FBR A;  4DQ4 A;  1MPF A;  1ZHW A;  5H9A A;  2FT9 A;  5D8J A;  3LV4 A;  1VPR A;  2K23 A;  4GK9 A;  1Y9T A;  1BM5 A;  4IB6 A;  3UEW A;  1IZN A;  4JGL A;  4HPA A;  1ZND A;  2AH7 X;  1BT9 A;  4ID2 A;  4FZN A;  4AYD C;  1YP7 A;  1SY2 A;  4HPD A;  4KH8 A;  3WOV A;  4XMD A;  2LFU A;  2PY1 A;  5LJE A;  2Q39 A;  1X8O A;  1OEJ A;  2Q4N A;  1HXU A;  1LKE A;  4PJ2 A;  3D97 A;  2WEW A;  3LK2 B;  4ML7 B;  1CRB A;  4N58 A;  1QFT A;  1ZNE A;  4IB7 A;  3LK3 A;  1HBQ A;  4ZGU A;  3S26 A;  3ZZV A;  3O19 A;  4AKR B;  2AT0 X;  4ORW A;  4U3Q A;  5HWZ A;  5HAE A;  1SY3 A;  3L4R A;  3PED A;  3WJG A;  5DL7 A;  4GCQ A;  2DM5 A;  4GKC A;  3O0E A;  1YP6 A;  2POA A;  1ERB A;  4LSF A;  1LFO A;  2AKQ A;  2R73 A;  2WR6 A;  1ERX A;  2NP1 A;  2AL0 X;  1Q9F A;  1U0X A;  2ANS A;  3FW4 A;  2KTD A;  3B2J A;  4QZU A;  4GHB A;  2WQ9 A;  3HOE A;  1ZHT A;  1NP1 A;  2J4U P;  4O3X B;  5LKF A;  4EXZ A;  1BLR A;  1X8N A;  3O22 A;  4YMY A;  4TKJ A;  5H9K A;  4IMO A;  3VE2 A;  4LZV A;  1ZNG A;  2L68 A;  3VU1 A;  4QGX A;  4Z3T A;  1PRN A;  3OE3 A;  4ZR2 A;  1IKJ A;  4CSB A;  3C78 X;  1JYD A;  4NNT A;  1YUP A;  4U8U M;  2JOZ A;  2ERV A;  3IFB A;  3QRA A;  1BSO A;  3WJF A;  3AA0 A;  1ICM A;  1X71 A;  4WFV A;  2FGR A;  1EII A;  2HZQ A;  4IAX A;  3V8U A;  2X46 A;  4OS0 A;  2J1N A;  2XKL A;  4KT5 A;  3P6H A;  4AFK A;  3F8A A;  1YWB A;  4ES7 A;  4YCH A;  1EI5 A;  3RSW A;  3ZW0 B;  3PP6 A;  3D4R A;  4QGW A;  3JSQ A;  4XME A;  3G7G A;  5LJG A;  4LKT A;  2F73 A;  2KZ7 B;  4FMS A;  3SZD A;  2BLG A;  2WSJ A;  1X89 A;  1T8V A;  2HMB A;  3NSG A;  2EU7 X;  5D4A A;  5BVS A;  3UEU A;  2Q2M A;  1KT4 A;  3TF6 A;  4FT6 A;  1JYJ A;  3BSZ E;  5FAZ A;  4M7M A;  4DQ3 A;  5D45 A;  4TQ2 A;  1GFP A;  3TGB A;  1KT6 A;  4YFR A;  4CV7 A;  1GM6 A;  2JU8 A;  3STN A;  2O4V A;  2OMF A;  3CWK A;  3MVF A;  5HCE C;  2A3F X;  3EM0 A;  3CBC A;  4EDE A;  3HWF A;  3FLL A;  2A0A A;  3BU9 A;  4YGH A;  1B0O A;  1G74 A;  1GKA A;  3SZV A;  4AZL A;  5HBS A;  1JJX A;  3AA6 A;  1BBP A;  1GT5 A;  4I95 A;  4O9S A;  5F1E A;  1ZRY A;  1A2D A;  1LF7 A;  1S7D A;  3GE2 A;  3NX1 A;  1KQX A;  2NNQ A;  3APU A;  4IBA A;  4IMN A;  4NP1 A;  4WBK A;  2JU3 A;  4GNY A;  4AYH A;  3IA8 A;  3POQ A;  3S60 A;  1BRP A;  3FR2 A;  1CBR A;  5LJK A;  1AQB A;  5LKE A;  2QO5 A;  3JTY A;  4KR4 A;  1DC9 A;  7PRN A;  2FR2 A;  3KZA A;  2KD2 A;  1EXS A;  5AFU L;  3KFF A;  4YBP A;  5LJH A;  2WUT A;  2WWP A;  3PQU A;  3N91 A;  3S5V A;  3LK3 B;  3WJC A;  3U0D A;  3H3I A;  4ALO A;  1HMR A;  1FEM A;  3NAD A;  1GFQ A;  2Z4I A;  5EE2 A;  4QYP A;  4GET A;  5IO6 A;  5GV0 A;  1BH3 A;  2LHF A;  3HOL A;  3CQR A;  4AKM A;  4LSI A;  3LK4 1;  1TVQ A;  4IAW A;  4ORU A;  2Y7S A;  1RLB E;  1BJ7 A;  2ZLD A;  4I3D A;  5C0N A;  5HZ5 A;  2R74 A;  4U8U N;  3FA9 A;  3ZI8 A;  4ZHH A;  3ZW0 A;  3E3C A;  4YKO A;  2KZ7 A;  4NYQ A;  3ZUO A;  2N2L A;  1KQW A;  3C5O A;  2RA6 A;  1SXX A;  3PRN A;  4ZCB A;  1CBQ A;  3AA1 A;  4O49 A;  1U18 A;  1EAL A;  2W2F A;  4O4O A;  4XMH A;  3WJD A;  4A1H A;  2OVE A;  4CK4 A;  1GFN A;  1MX8 A;  2RN4 A;  2GTL N;  1GFO A;  1U17 A;  4GCP A;  4C69 X;  4MVK A;  1DFV A;  3KVD D;  4FGI B;  3VZW X;  2GTF X;  1QG5 A;  3MBT A;  4I6S A;  5HA0 A;  3AA7 B;  3TZG A;  1B8E A;  4HFO A;  4XNL A;  5H9L A;  3CBS A;  3LHN A;  1IIU A;  4YH0 A;  2A2U A;  1SA8 A;  1A57 A;  2Q2P A;  2KW1 A;  3BY0 A;  2OFR X;  2ACP X;  4A60 A;  4AYM C;  3S5X A;  4WHI A;  4YFP A;  4OMW A;  3PPT A;  3G7X A;  2ASN X;  4TKH A;  2KTS A;  5ADX L;  4YDB A;  3POX A;  3VG4 A;  2OVD A;  4WFU A;  1OSM A;  3OD9 A;  4F4B A;  3FEP A;  5IYU A;  4NYR A;  3FEN A;  5B27 A;  6PRN A;  4YBU A;  4NNS A;  5DPQ A;  1BSQ A;  2QM9 A;  4Y0P A;  2CBS A;  4ON1 A;  1BXW A;  4I9R A;  4ZHD A;  3A2S X;  1E5P A;  2AT6 X;  3APW A;  1GKA B;  4KC8 A;  4GRJ A;  2GC9 A;  1I04 A;  4AZQ A;  3AA6 B;  4AZN A;  1Y9L A;  2FGQ X;  2NNE A;  3FR4 A;  4N7C A;  2Y0H A;  2KXP B;  4GU8 A;  4Y0Q A;  5HTD A;  1SXY A;  2M4L A;  3SAO A;  3OJY C;  4YKM A;  3ZWE A;  5CE4 A;  4IAB A;  3SY9 A;  3BDR A;  1KT7 A;  4I3C A;  4OS8 A;  2R56 A;  5AQ6 A;  1MDC A;  1O1U A;  2L5P A;  1AB0 A;  4IB8 A;  5H9N A;  4D6B A;  5HZ6 A;  2F1T A;  3K3L A;  2XTR A;  5HTE A;  1EPA A;  2OVA A;  4NW4 A;  1T0V A;  4I3B A;  4MVL A;  2K0L A;  3EMM A;  2E4J A;  4ARH A;  1Z24 A;  4E1S A;  5HZ9 A;  5BVQ A;  5D5D A;  1HMT A;  4ZGF A;  3RZY A;  3DSZ A;  4ODD A;  3ZW1 B;  4LSH A;  2YG2 A;  3SYS A;  2ZAI A;  4MIS A;  3BRN A;  4A8Z A;  1ZNK A;  1FEN A;  5KIC A;  1THQ A;  1ZHZ A;  1HBP A;  5FEN A;  4O3Z A;  1EIO A;  3AA7 A;  2ODJ A;  1QY0 A;  4GCS A;  4FQB B;  2Y0K A;  3KFG A;  2K4T A;  1JJJ A;  4FZL A;  2LB6 A;  4RUN A;  3P6E A;  1DZP A;  1TW4 A;  2GTL M;  1L6M A;  2FS7 A;  4OMX A;  5F6Z A;  3STK A;  4ZHC A;  2GJ5 A;  2L9C A;  3VZT X;  4NLJ A;  1ZNL A;  3UU2 A;  3AA1 B;  2OZQ A;  4XMC A;  1X8U A;  4AW8 A;  4RJW A;  5F6B A;  3VG2 A;  1PMP A;  4GNW A;  4EFG A;  3NR3 A;  3TGA A;  2LA7 A;  1SMP I;  2LBA A;  4AZR A;  3QRC A;  4FBO A;  4UU2 A;  3JQO A;  4ORS A;  1I05 A;  2JU7 A;  3PQS A;  4KRA A;  2FLJ A;  4FBV A;  3P24 A;  3FEK A;  4B61 A;  5HCC C;  4L3R A;  3D95 A;  3VG3 A;  2QOS C;  3FW5 A;  3FYF A;  3B2L A;  3I17 A;  4G75 A;  3EMN X;  4N59 A;  2KC0 A;  3AAA A;  5EDB A;  4TKB A;  3BLG A;  3AKM A;  2KXP A;  5F7G A;  2AT8 X;  1MX7 A;  4RLC A;  4QAE A;  1O1V A;  2F09 A;  2HZR A;  2X27 X;  4LZU A;  5HZ8 A;  1NP4 A;  3VG5 A;  1R0U A;  1QJ8 A;  1SXU A;  3BX8 A;  4G76 A;  3HTY A;  1QY2 A;  4FSO A;  2CZT A;  3HK1 A;  1HN2 A;  1X8Q A;  3TGC A;  1IFB A;  1O8V A;  1JZU A;  1A3Y A;  2O62 A;  4JFB A;  5JR8 A;  4PSQ A;  1DZK A;  1X8P A;  2AMM X;  4QQ1 A;  4BVM A;  1LIC A;  3ZW1 A;  5AEO A;  1FE3 A;  2FTB A;  4JCH A;  1JIW I;  2HYS A;  3U9P C;  1OEE A;  4Y0S A;  2N93 A;  4KII A;  2X8T A;  1PBO A;  1PEE A;  5EEE A;  5PRN A;  1CBS A;  1SXW A;  1PHO A;  4YFQ A;  3RWX A;  5AFU K;  3EBK A;  3UEV A;  3AAE B;  3CMP A;  3OBL A;  1FEL A;  2MO5 A;  3VY8 X;  3HWB A;  5G26 A;  1MM5 A;  3CR6 A;  4KC7 A;  2WQA E;  1DZJ A;  3CQN A;  1MM4 A;  3APV A;  2G7B A;  4IB9 A;  4I9S A;  3STM X;  1OBQ A;  3F9D A;  3P6D A;  4FRT A;  1KGL A;  4NLI A;  5AJC A;  5EPQ A;  1SY0 A;  2ALL X;  4RL9 A;  2BS5 A;  4QNI A;  3PH6 A;  1AVG I;  1G7N A;  5LJB A;  4RLB A;  2RQ0 A;  4FRX A;  1CJ5 A;  5DL5 A;  1NGL A;  1D3S A;  3NQ3 A;  3P02 A;  1IFC A;  5JDP A;  3T0S A;  3ZW2 A;  4LSE A;  2HNX A;  4OS3 A;  5K06 A;  3LK4 2;  4ZHF A;  3HWG A;  3C77 X;  3SYB A;  5EZ2 A;  1SY1 A;  3FA6 A;  4XMF A;  3APX A;  2QMI A;  1OPF A;  4PUX A;  3T1D A;  3NP1 A;  4O4X A;  2MNH A;  3AKN A;  1KZW A;  5DL6 A;  3Q6L A;  1ORM A;  2XE2 A;  2XMX A;  1B56 A;  3I0A A;  3WI4 A;  4ZHG A;  4FSP A;  1YS5 A;  3FEL A;  2MHD A;  2Y0L A;  3T24 A;  1LIF A;  4AYE C;  5HCD C;  3WJE A;  1UZ2 X;  4AZP A;  3SY7 A;  3VZU X;  4TJZ A;  1E06 A;  1QJ9 A;  1PM1 X;  1G90 A;  1BSY A;  1HXX A;  5IO5 A;  3NX2 A;  2QTK A;  2QO4 A;  1ALB A;  1KOI A;  1ACD A;  2KDY A;  4TNN A;  5FQ7 E;  1B4M A;  1FDQ A;  4YGZ A;  4AZM A;  3BX7 A;  2X8S A;  2W81 C;  2XE3 A;  4KCA A;  4UU3 A;  3TZS A;  5ADX K;  3EYC A;  1FTP A;  2MHL A;  3AAA B;  4M6S A;  1MUP A;  5F58 A;  3VE1 A;  5L8N A;  5EED A;  1OBU A;  1LIB A;  3FIQ A;  3K19 A;  4XNK A;  4D6A A;  3NQK A;  4RUU A;  2F1V A;  3WBG A;  3AAE A;  1S44 A;  2K62 A;  5AJB A;  4O4U A;  5FQ8 E;  1CBI A;  4HPC A;  3HW9 A;  1HXT A;  1LIE A;  4N7D A;  4O4S A;  3B2I A;  2OFM X;  4ORX A;  5HA1 A;  1EUO A;  3POU A;  2FRS A;  1TOU A;  4BQU A;  1DZM A;  1ADL A;  4HPB A;  3RBH A;  3NBX X;  1GX9 A;  3VG6 A;  1URE A;  3FR5 A;  5D47 A;  1HMS A;  3U03 A;  5FQ6 E;  2GE4 A;  4MVE A;  4MIR A;  4ZH6 A;  4K19 A;  1GT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...