2M07A

Nmr structure of ompx in dpc micelles
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
148
structure length
148
Chain Sequence
b'ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein X
publication title Optimized phospholipid bilayer nanodiscs facilitate high-resolution structure determination of membrane proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 18
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2012-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2m07A00
1QJ9A 2N2MA 1ORMA 2ERVA 1MM5A 1P4TA 1MM4A 3QRAA 1G90A 2LHFA 2M07A 3G7GA 1THQA 4RLCA 2M06A 2F1TA 2K0LA 2N2LA 1Q9FA 3GP6A 3QRCA 2GE4A 1QJPA 4PUXA 3C5OA 1QJ8A 1BXWA 2MNHA 2X27X 2F1VA 1Q9GA 2JMMA 2MHLA
chains in the Genus database with same CATH superfamily
5DL8A 4O49A 4FQEA 3HWBA 1ORMA 3K19A 4FOZA 5AFUL 4CTDA 1E54A 3HOEA 4PR7A 2WJQA 3VE1A 3T0SA 1ZHWA 3A0BO 4PJ0O 4AKRA 3POXA 1H6S1 4UB8O 5DL7A 4N74A 4FRXA 6PRNA 2XTQA 2KXPB 4FESA 5DL6A 2W80C 3AAAB 1GFOA 3LK3B 3PGRA 4RJWA 4RLCA 2X9KA 2K0LA 3FYXA 4C69X 4FSPA 2OMFA 1Q9FA 3GP6A 4N58A 2Y0HA 3WI4A 7PRNA 2KC0A 2Y2XA 3VY9X 2ZFGA 3C5OA 4FSOA 4KR8A 1QJ8A 4GHBA 4LSEA 4O4XA 5TISO 3SY7A 1BH3A 1YS5A 2PRNA 1IZNB 1PHOA 2X27X 1Q9GA 1MPFA 2KXPA 3POUA 4JCHA 2J1NA 2YNKA 3AAAA 3DZMA 4FT6A 3SZDA 4GCPA 5H2FO 3NJTA 5G38A 3VZWX 3UU2A 4AYDC 3WU2O 2N2MA 4JFBA 3LK41 1HXTA 3JTYA 3RBHA 1GFPA 3JCUO 4AYMC 4O4UA 2ERVA 4QQ1A 3VE2A 1P4TA 5AFUK 4E1SA 2WJRA 1G90A 2M07A 4GCQA 3AA0B 4U9CA 1IZNA 3HOLA 5E79O 3T24A 5KAIO 4D5UA 8PRNA 1OPFA 2XE5A 5ADXL 4XNLA 1THQA 4E1TA 4B61A 4C4VB 3KVDD 3NSGA 2Y0KA 5GV0A 5B66O 1QJPA 2ZLDA 4GCSA 3BS0A 2XMXA 4LSIA 4Z3TA 2FGQX 1BXWA 2WVPA 2MNHA 3A2SX 4BUMX 5B5EO 5IYUA 3AA0A 4FRTA 2R4OA 1T16A 3DWOX 2LFUA 4RL9A 3AA7B 1PRNA 4F4BA 2YPVA 5T5FA 4C4VA 2XG6A 4N59A 4O3XB 1QJ9A 1ZHXA 2JQYA 2XE2A 5G26A 3PGUA 4FUVA 5PRNA 3DA3A 3HW9A 3DWNA 4XNKA 1GFNA 3PGSA 1T1LA 1MM5A 4FZNA 2F1CX 3QRAA 1S5LO 4O3YA 5EE2A 2KDYA 2J4UP 3UPGA 2LHFA 3AAEA 5GTHO 2W81C 3O0EA 4RLBA 2XE1A 4AKMA 3KZIO 4N75A 3WI5A 1HXXA 1ZHTA 3AA7A 5G39A 2KZ7B 5ADXK 4D65A 4UB6O 2ODJA 2F1TA 2PORA 4AZLA 4KRAA 3PORA 3EMNX 2GE4A 3BRZA 3QRCA 4FZMA 3PF1A 4G75A 5DL5A 3SYSA 3TZGA 3AA1B 2K4TA 1ZHYA 2R4NA 2Y7SA 4O3ZA 3VZTX 3SYBA 5D5DA 4AYEC 3LK2B 2O4VA 4AYNA 3AAEB 3PQUA 2R8AA 5G3AA 3T20A 2JMMA 4LSFA 4AUIA 2XTRA 2KZ7A 4C00A 4LSHA 4AFKA 1GFMA 2R4LA 2Y0LA 4AYID 2IWWA 2R4PA 3V8UA 4K3BA 3AA1A 1MM4A 1GFQA 4IL6O 3SZVA 2QTKA 3PRNA 3G7GA 4D64A 3AA6A 5KAFO 1BT9A 1ZHZA 3LK2A 3PQSA 2XE3A 4O3WA 4K3CA 3VZUX 5JDPA 3UAQA 3LK42 4FZLA 2AXTO 4KR4A 5GTIO 5FVNA 2M06A 3BRYA 3SY9A 2N2LA 1OSMA 3DA4A 4GF4A 4PUXA 4AKRB 1HXUA 3VY8X 3A0HO 4FMSA 2R89A 3AA6B 2F1VA 2IWVA 3POQA 2R88A 3LK3A 2MHLA 4G76A 2FGRA 4RJXA
chains in the Genus database with same CATH topology
5DL8A 4O49A 3HWBA 1ORMA 3K19A 4FOZA 5AFUL 1E54A 3HOEA 3VE1A 3T0SA 1ZHWA 4AKRA 3POXA 1H6S1 5DL7A 4FRXA 6PRNA 2XTQA 2KXPB 4FESA 5DL6A 2W80C 3AAAB 1GFOA 3LK3B 4RJWA 4RLCA 2K0LA 3FYXA 4C69X 4FSPA 2OMFA 1Q9FA 3GP6A 4N58A 2Y0HA 3WI4A 7PRNA 2KC0A 2Y2XA 3VY9X 2ZFGA 3C5OA 4FSOA 4KR8A 1QJ8A 4GHBA 4LSEA 4O4XA 3SY7A 1BH3A 1YS5A 2PRNA 1IZNB 1PHOA 2X27X 1Q9GA 1MPFA 2KXPA 3POUA 4JCHA 2J1NA 2YNKA 3AAAA 3SZDA 4FT6A 4GCPA 3VZWX 3UU2A 4AYDC 2N2MA 4JFBA 3LK41 1HXTA 3JTYA 3RBHA 1GFPA 4AYMC 4O4UA 2ERVA 4QQ1A 3VE2A 1P4TA 5AFUK 4E1SA 1G90A 2M07A 4GCQA 3AA0B 4U9CA 1IZNA 3HOLA 3T24A 8PRNA 5ADXL 4D5UA 1OPFA 2XE5A 4XNLA 1THQA 4E1TA 4B61A 3KVDD 3NSGA 2Y0KA 5GV0A 1QJPA 2ZLDA 4GCSA 2XMXA 4LSIA 4Z3TA 2FGQX 1BXWA 3A2SX 2MNHA 4BUMX 5IYUA 3AA0A 4FRTA 2LFUA 4RL9A 3AA7B 1PRNA 4F4BA 2YPVA 5T5FA 2XG6A 4N59A 4O3XB 1QJ9A 1ZHXA 2XE2A 5G26A 4FUVA 5PRNA 3DA3A 3HW9A 4XNKA 1GFNA 4O3YA 1MM5A 4FZNA 3QRAA 3UPGA 5EE2A 2J4UP 2KDYA 2LHFA 3AAEA 2W81C 3O0EA 4RLBA 2XE1A 4AKMA 3WI5A 1HXXA 1ZHTA 3AA7A 5ADXK 2KZ7B 4D65A 2ODJA 2F1TA 2PORA 4AZLA 4KRAA 3PORA 3EMNX 2GE4A 3QRCA 4G75A 4FZMA 3SYSA 5DL5A 3TZGA 3AA1B 2K4TA 1ZHYA 2Y7SA 4O3ZA 3VZTX 3SYBA 5D5DA 4AYEC 3LK2B 2O4VA 4AYNA 3AAEB 3PQUA 3T20A 2JMMA 4LSFA 4AUIA 2XTRA 2KZ7A 4LSHA 4AFKA 1GFMA 2Y0LA 4AYID 3V8UA 3AA1A 1MM4A 1GFQA 3SZVA 2QTKA 3PRNA 3G7GA 4D64A 3AA6A 1BT9A 1ZHZA 3LK2A 3PQSA 2XE3A 4O3WA 3VZUX 5JDPA 3UAQA 3LK42 4FZLA 4KR4A 3SY9A 5FVNA 2M06A 2N2LA 1OSMA 3DA4A 4GF4A 4PUXA 4AKRB 1HXUA 3VY8X 4FMSA 3AA6B 2F1VA 3POQA 3LK3A 2MHLA 4G76A 2FGRA 4RJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QJ9 A;  2N2M A;  1ORM A;  2ERV A;  1MM5 A;  1P4T A;  1MM4 A;  3QRA A;  1G90 A;  2LHF A;  2M07 A;  3G7G A;  1THQ A;  4RLC A;  2M06 A;  2F1T A;  2K0L A;  2N2L A;  1Q9F A;  3GP6 A;  3QRC A;  2GE4 A;  1QJP A;  4PUX A;  3C5O A;  1QJ8 A;  1BXW A;  2MNH A;  2X27 X;  2F1V A;  1Q9G A;  2JMM A;  2MHL A; 
#chains in the Genus database with same CATH topology
 5DL8 A;  4O49 A;  4FQE A;  3HWB A;  1ORM A;  3K19 A;  4FOZ A;  5AFU L;  4CTD A;  1E54 A;  3HOE A;  4PR7 A;  2WJQ A;  3VE1 A;  3T0S A;  1ZHW A;  3A0B O;  4PJ0 O;  4AKR A;  3POX A;  1H6S 1;  4UB8 O;  5DL7 A;  4N74 A;  4FRX A;  6PRN A;  2XTQ A;  2KXP B;  4FES A;  5DL6 A;  2W80 C;  3AAA B;  1GFO A;  3LK3 B;  3PGR A;  4RJW A;  4RLC A;  2X9K A;  2K0L A;  3FYX A;  4C69 X;  4FSP A;  2OMF A;  1Q9F A;  3GP6 A;  4N58 A;  2Y0H A;  3WI4 A;  7PRN A;  2KC0 A;  2Y2X A;  3VY9 X;  2ZFG A;  3C5O A;  4FSO A;  4KR8 A;  1QJ8 A;  4GHB A;  4LSE A;  4O4X A;  5TIS O;  3SY7 A;  1BH3 A;  1YS5 A;  2PRN A;  1IZN B;  1PHO A;  2X27 X;  1Q9G A;  1MPF A;  2KXP A;  3POU A;  4JCH A;  2J1N A;  2YNK A;  3AAA A;  3DZM A;  4FT6 A;  3SZD A;  4GCP A;  5H2F O;  3NJT A;  5G38 A;  3VZW X;  3UU2 A;  4AYD C;  3WU2 O;  2N2M A;  4JFB A;  3LK4 1;  1HXT A;  3JTY A;  3RBH A;  1GFP A;  3JCU O;  4AYM C;  4O4U A;  2ERV A;  4QQ1 A;  3VE2 A;  1P4T A;  5AFU K;  4E1S A;  2WJR A;  1G90 A;  2M07 A;  4GCQ A;  3AA0 B;  4U9C A;  1IZN A;  3HOL A;  5E79 O;  3T24 A;  5KAI O;  4D5U A;  8PRN A;  1OPF A;  2XE5 A;  5ADX L;  4XNL A;  1THQ A;  4E1T A;  4B61 A;  4C4V B;  3KVD D;  3NSG A;  2Y0K A;  5GV0 A;  5B66 O;  1QJP A;  2ZLD A;  4GCS A;  3BS0 A;  2XMX A;  4LSI A;  4Z3T A;  2FGQ X;  1BXW A;  2WVP A;  2MNH A;  3A2S X;  4BUM X;  5B5E O;  5IYU A;  3AA0 A;  4FRT A;  2R4O A;  1T16 A;  3DWO X;  2LFU A;  4RL9 A;  3AA7 B;  1PRN A;  4F4B A;  2YPV A;  5T5F A;  4C4V A;  2XG6 A;  4N59 A;  4O3X B;  1QJ9 A;  1ZHX A;  2JQY A;  2XE2 A;  5G26 A;  3PGU A;  4FUV A;  5PRN A;  3DA3 A;  3HW9 A;  3DWN A;  4XNK A;  1GFN A;  3PGS A;  1T1L A;  1MM5 A;  4FZN A;  2F1C X;  3QRA A;  1S5L O;  4O3Y A;  5EE2 A;  2KDY A;  2J4U P;  3UPG A;  2LHF A;  3AAE A;  5GTH O;  2W81 C;  3O0E A;  4RLB A;  2XE1 A;  4AKM A;  3KZI O;  4N75 A;  3WI5 A;  1HXX A;  1ZHT A;  3AA7 A;  5G39 A;  2KZ7 B;  5ADX K;  4D65 A;  4UB6 O;  2ODJ A;  2F1T A;  2POR A;  4AZL A;  4KRA A;  3POR A;  3EMN X;  2GE4 A;  3BRZ A;  3QRC A;  4FZM A;  3PF1 A;  4G75 A;  5DL5 A;  3SYS A;  3TZG A;  3AA1 B;  2K4T A;  1ZHY A;  2R4N A;  2Y7S A;  4O3Z A;  3VZT X;  3SYB A;  5D5D A;  4AYE C;  3LK2 B;  2O4V A;  4AYN A;  3AAE B;  3PQU A;  2R8A A;  5G3A A;  3T20 A;  2JMM A;  4LSF A;  4AUI A;  2XTR A;  2KZ7 A;  4C00 A;  4LSH A;  4AFK A;  1GFM A;  2R4L A;  2Y0L A;  4AYI D;  2IWW A;  2R4P A;  3V8U A;  4K3B A;  3AA1 A;  1MM4 A;  1GFQ A;  4IL6 O;  3SZV A;  2QTK A;  3PRN A;  3G7G A;  4D64 A;  3AA6 A;  5KAF O;  1BT9 A;  1ZHZ A;  3LK2 A;  3PQS A;  2XE3 A;  4O3W A;  4K3C A;  3VZU X;  5JDP A;  3UAQ A;  3LK4 2;  4FZL A;  2AXT O;  4KR4 A;  5GTI O;  5FVN A;  2M06 A;  3BRY A;  3SY9 A;  2N2L A;  1OSM A;  3DA4 A;  4GF4 A;  4PUX A;  4AKR B;  1HXU A;  3VY8 X;  3A0H O;  4FMS A;  2R89 A;  3AA6 B;  2F1V A;  2IWV A;  3POQ A;  2R88 A;  3LK3 A;  2MHL A;  4G76 A;  2FGR A;  4RJX A; 
#chains in the Genus database with same CATH homology
 5DL8 A;  4O49 A;  3HWB A;  1ORM A;  3K19 A;  4FOZ A;  5AFU L;  1E54 A;  3HOE A;  3VE1 A;  3T0S A;  1ZHW A;  4AKR A;  3POX A;  1H6S 1;  5DL7 A;  4FRX A;  6PRN A;  2XTQ A;  2KXP B;  4FES A;  5DL6 A;  2W80 C;  3AAA B;  1GFO A;  3LK3 B;  4RJW A;  4RLC A;  2K0L A;  3FYX A;  4C69 X;  4FSP A;  2OMF A;  1Q9F A;  3GP6 A;  4N58 A;  2Y0H A;  3WI4 A;  7PRN A;  2KC0 A;  2Y2X A;  3VY9 X;  2ZFG A;  3C5O A;  4FSO A;  4KR8 A;  1QJ8 A;  4GHB A;  4LSE A;  4O4X A;  3SY7 A;  1BH3 A;  1YS5 A;  2PRN A;  1IZN B;  1PHO A;  2X27 X;  1Q9G A;  1MPF A;  2KXP A;  3POU A;  4JCH A;  2J1N A;  2YNK A;  3AAA A;  3SZD A;  4FT6 A;  4GCP A;  3VZW X;  3UU2 A;  4AYD C;  2N2M A;  4JFB A;  3LK4 1;  1HXT A;  3JTY A;  3RBH A;  1GFP A;  4AYM C;  4O4U A;  2ERV A;  4QQ1 A;  3VE2 A;  1P4T A;  5AFU K;  4E1S A;  1G90 A;  2M07 A;  4GCQ A;  3AA0 B;  4U9C A;  1IZN A;  3HOL A;  3T24 A;  8PRN A;  5ADX L;  4D5U A;  1OPF A;  2XE5 A;  4XNL A;  1THQ A;  4E1T A;  4B61 A;  3KVD D;  3NSG A;  2Y0K A;  5GV0 A;  1QJP A;  2ZLD A;  4GCS A;  2XMX A;  4LSI A;  4Z3T A;  2FGQ X;  1BXW A;  3A2S X;  2MNH A;  4BUM X;  5IYU A;  3AA0 A;  4FRT A;  2LFU A;  4RL9 A;  3AA7 B;  1PRN A;  4F4B A;  2YPV A;  5T5F A;  2XG6 A;  4N59 A;  4O3X B;  1QJ9 A;  1ZHX A;  2XE2 A;  5G26 A;  4FUV A;  5PRN A;  3DA3 A;  3HW9 A;  4XNK A;  1GFN A;  4O3Y A;  1MM5 A;  4FZN A;  3QRA A;  3UPG A;  5EE2 A;  2J4U P;  2KDY A;  2LHF A;  3AAE A;  2W81 C;  3O0E A;  4RLB A;  2XE1 A;  4AKM A;  3WI5 A;  1HXX A;  1ZHT A;  3AA7 A;  5ADX K;  2KZ7 B;  4D65 A;  2ODJ A;  2F1T A;  2POR A;  4AZL A;  4KRA A;  3POR A;  3EMN X;  2GE4 A;  3QRC A;  4G75 A;  4FZM A;  3SYS A;  5DL5 A;  3TZG A;  3AA1 B;  2K4T A;  1ZHY A;  2Y7S A;  4O3Z A;  3VZT X;  3SYB A;  5D5D A;  4AYE C;  3LK2 B;  2O4V A;  4AYN A;  3AAE B;  3PQU A;  3T20 A;  2JMM A;  4LSF A;  4AUI A;  2XTR A;  2KZ7 A;  4LSH A;  4AFK A;  1GFM A;  2Y0L A;  4AYI D;  3V8U A;  3AA1 A;  1MM4 A;  1GFQ A;  3SZV A;  2QTK A;  3PRN A;  3G7G A;  4D64 A;  3AA6 A;  1BT9 A;  1ZHZ A;  3LK2 A;  3PQS A;  2XE3 A;  4O3W A;  3VZU X;  5JDP A;  3UAQ A;  3LK4 2;  4FZL A;  4KR4 A;  3SY9 A;  5FVN A;  2M06 A;  2N2L A;  1OSM A;  3DA4 A;  4GF4 A;  4PUX A;  4AKR B;  1HXU A;  3VY8 X;  4FMS A;  3AA6 B;  2F1V A;  3POQ A;  3LK3 A;  2MHL A;  4G76 A;  2FGR A;  4RJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...