2M07A

Nmr structure of ompx in dpc micelles
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
148
structure length
148
Chain Sequence
ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimized phospholipid bilayer nanodiscs facilitate high-resolution structure determination of membrane proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Outer membrane protein X
total genus 18
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2012-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2m07A00
2ERVA 2M07A 1MM4A 1ORMA 1Q9GA 2F1TA 4RLCA 2M06A 1G90A 1Q9FA 2GE4A 2X27X 2MHLA 2N2LA 2N2MA 3G7GA 1P4TA 1THQA 2F1VA 2LHFA 2JMMA 2MNHA 3C5OA 4PUXA 2K0LA 3QRCA 1QJ8A 3GP6A 1QJPA 1BXWA 3QRAA 1QJ9A 1MM5A
chains in the Genus database with same CATH superfamily
5G39A 1PHOA 2IWVA 2KDYA 1ORMA 2ZLDA 2XE2A 4GCPA 5TISO 3BS0A 4LSIA 3PORA 1Q9FA 4LSHA 3POUA 3WI4A 4LSFA 3AAEA 1HXUA 5DL5A 4FUVA 3DA4A 3LK42 4CTDA 1OSMA 2X9KA 3HW9A 2X27X 4AKRB 1GFQA 4FESA 4D65A 4UB8O 1BT9A 3BRYA 1ZHZA 3DWNA 3HOEA 4AYNA 5ADXK 3C5OA 2K0LA 3AA0B 3KVDD 4IL6O 4FMSA 4GF4A 3VY8X 3WI5A 3VY9X 1QJ8A 4O4UA 3DWOX 2XMXA 2O4VA 3SY9A 4Z3TA 3POQA 3QRAA 5GTHO 1GFMA 1MM5A 2XTRA 4UB6O 1IZNB 2J4UP 2F1CX 4GHBA 4XNKA 3AA1A 4RL9A 3O0EA 1GFNA 1MM4A 3LK2B 4O4XA 2KZ7B 3RBHA 3NSGA 2F1TA 1T16A 2W81C 4XNLA 4RLCA 2M06A 3JTYA 5GTIO 3HOLA 4AKMA 1BH3A 3AA6A 3T20A 2FGQX 3HWBA 4KR8A 3SYBA 2LFUA 3PQSA 4O3YA 5IYUA 4O3WA 5EE2A 4G75A 3UAQA 2XTQA 3V8UA 3UPGA 3FYXA 3VZTX 2R88A 2WJQA 2N2LA 4AYDC 4K3CA 1T1LA 2XG6A 2Y0HA 3AA6B 3G7GA 1PRNA 1THQA 2MNHA 2W80C 2R4LA 4PUXA 2XE1A 3LK41 4D64A 5KAIO 3KZIO 2XE3A 3NJTA 2AXTO 3SY7A 4AKRA 4C69X 2R8AA 4FSOA 4FT6A 4FZMA 3PQUA 5G38A 3GP6A 3VZUX 2ODJA 3EMNX 5DL8A 4AUIA 4B61A 3PGUA 4FRTA 4F4BA 5AFUK 4N75A 2XE5A 2ERVA 2R4PA 2M07A 2Y2XA 4N74A 1GFOA 2R89A 3T24A 3PF1A 3WU2O 4QQ1A 4FQEA 4FOZA 3VZWX 4AYMC 2K4TA 1OPFA 4FSPA 4PR7A 1G90A 4O3ZA 3AA1B 1GFPA 1ZHWA 1ZHXA 3JCUO 3PGRA 3PGSA 2KZ7A 4KR4A 1ZHYA 4JCHA 2GE4A 3VE1A 2Y0KA 1ZHTA 1HXTA 3A0BO 5D5DA 2N2MA 3VE2A 1P4TA 4E1TA 2F1VA 2LHFA 2JMMA 3LK3B 5G3AA 4D5UA 1S5LO 3AAAB 4G76A 4AZLA 5GV0A 4FZNA 3AA0A 3UU2A 5JDPA 2J1NA 2PORA 4O49A 4PJ0O 1H6S1 2PRNA 3LK3A 4K3BA 5G26A 3AAAA 1MPFA 3DZMA 3DA3A 5ADXL 2R4NA 5DL7A 6PRNA 4RJWA 4GCSA 5H2FO 3AAEB 5FVNA 4N58A 1YS5A 2JQYA 3AA7A 5KAFO 1Q9GA 7PRNA 2OMFA 8PRNA 5B66O 2WVPA 2Y7SA 4AFKA 3A0HO 2YNKA 4JFBA 3SYSA 4AYID 4E1SA 2IWWA 2KC0A 3AA7B 4GCQA 4AYEC 4FRXA 4KRAA 3T0SA 2MHLA 5AFUL 1HXXA 4C4VA 2Y0LA 2QTKA 5PRNA 5E79O 3PRNA 4O3XB 3POXA 3TZGA 2KXPA 1IZNA 4RJXA 3A2SX 3QRCA 4BUMX 3SZVA 2ZFGA 2FGRA 4N59A 5DL6A 4LSEA 4C4VB 1QJPA 1BXWA 3K19A 1E54A 3LK2A 1QJ9A 4C00A 5B5EO 2R4OA 4U9CA 2KXPB 2WJRA 3BRZA 4RLBA 5T5FA 4FZLA 2YPVA 3SZDA
chains in the Genus database with same CATH topology
1PHOA 2KDYA 1ORMA 2ZLDA 2XE2A 4GCPA 4LSIA 3PORA 1Q9FA 4LSHA 3POUA 3WI4A 4LSFA 3AAEA 1HXUA 5DL5A 4FUVA 3DA4A 3LK42 1OSMA 3HW9A 2X27X 4AKRB 1GFQA 4FESA 4D65A 1BT9A 1ZHZA 3HOEA 4AYNA 5ADXK 3C5OA 2K0LA 3AA0B 3KVDD 4FMSA 4GF4A 3VY8X 3WI5A 3VY9X 1QJ8A 4O4UA 2XMXA 2O4VA 3SY9A 4Z3TA 3POQA 3QRAA 1GFMA 1MM5A 2XTRA 1IZNB 2J4UP 4GHBA 4XNKA 3AA1A 4RL9A 3O0EA 1GFNA 1MM4A 3LK2B 4O4XA 2KZ7B 3RBHA 3NSGA 2F1TA 2W81C 4XNLA 4RLCA 2M06A 3JTYA 3HOLA 4AKMA 1BH3A 3AA6A 3T20A 2FGQX 3HWBA 4KR8A 3SYBA 2LFUA 3PQSA 4O3YA 5IYUA 4O3WA 5EE2A 4G75A 3UAQA 2XTQA 3V8UA 3UPGA 3FYXA 3VZTX 2N2LA 4AYDC 2XG6A 2Y0HA 3AA6B 3G7GA 1PRNA 1THQA 2MNHA 2W80C 4PUXA 2XE1A 3LK41 4D64A 4AKRA 2XE3A 4C69X 3SY7A 4FSOA 4FT6A 4FZMA 3PQUA 3GP6A 3VZUX 2ODJA 3EMNX 5DL8A 4AUIA 4B61A 4F4BA 4FRTA 5AFUK 2XE5A 2ERVA 2M07A 2Y2XA 1GFOA 3T24A 4QQ1A 4FOZA 3VZWX 4AYMC 2K4TA 1OPFA 4FSPA 1G90A 4O3ZA 3AA1B 1GFPA 1ZHWA 1ZHXA 4KR4A 2KZ7A 1ZHYA 4JCHA 2GE4A 3VE1A 2Y0KA 1ZHTA 1HXTA 5D5DA 2N2MA 3VE2A 1P4TA 4E1TA 2F1VA 2LHFA 2JMMA 3LK3B 4D5UA 3AAAB 4G76A 4AZLA 5GV0A 4FZNA 3AA0A 3UU2A 5JDPA 2J1NA 2PORA 4O49A 1H6S1 2PRNA 3LK3A 5G26A 3AAAA 1MPFA 3DA3A 5ADXL 5DL7A 6PRNA 4RJWA 4GCSA 3AAEB 5FVNA 4N58A 1YS5A 3AA7A 8PRNA 1Q9GA 7PRNA 2OMFA 2Y7SA 4AFKA 2YNKA 4JFBA 3SYSA 4AYID 4E1SA 2KC0A 3AA7B 4GCQA 4AYEC 4FRXA 4KRAA 3T0SA 2MHLA 5AFUL 1HXXA 2Y0LA 2QTKA 5PRNA 3PRNA 4O3XB 3POXA 3TZGA 2KXPA 1IZNA 4RJXA 3A2SX 3QRCA 4BUMX 3SZVA 2ZFGA 2FGRA 4N59A 5DL6A 4LSEA 1QJPA 1BXWA 3K19A 1E54A 3LK2A 1QJ9A 3SZDA 4U9CA 2KXPB 5T5FA 4RLBA 4FZLA 2YPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ERV A;  2M07 A;  1MM4 A;  1ORM A;  1Q9G A;  2F1T A;  4RLC A;  2M06 A;  1G90 A;  1Q9F A;  2GE4 A;  2X27 X;  2MHL A;  2N2L A;  2N2M A;  3G7G A;  1P4T A;  1THQ A;  2F1V A;  2LHF A;  2JMM A;  2MNH A;  3C5O A;  4PUX A;  2K0L A;  3QRC A;  1QJ8 A;  3GP6 A;  1QJP A;  1BXW A;  3QRA A;  1QJ9 A;  1MM5 A; 
#chains in the Genus database with same CATH topology
 5G39 A;  1PHO A;  2IWV A;  2KDY A;  1ORM A;  2ZLD A;  2XE2 A;  4GCP A;  5TIS O;  3BS0 A;  4LSI A;  3POR A;  1Q9F A;  4LSH A;  3POU A;  3WI4 A;  4LSF A;  3AAE A;  1HXU A;  5DL5 A;  4FUV A;  3DA4 A;  3LK4 2;  4CTD A;  1OSM A;  2X9K A;  3HW9 A;  2X27 X;  4AKR B;  1GFQ A;  4FES A;  4D65 A;  4UB8 O;  1BT9 A;  3BRY A;  1ZHZ A;  3DWN A;  3HOE A;  4AYN A;  5ADX K;  3C5O A;  2K0L A;  3AA0 B;  3KVD D;  4IL6 O;  4FMS A;  4GF4 A;  3VY8 X;  3WI5 A;  3VY9 X;  1QJ8 A;  4O4U A;  3DWO X;  2XMX A;  2O4V A;  3SY9 A;  4Z3T A;  3POQ A;  3QRA A;  5GTH O;  1GFM A;  1MM5 A;  2XTR A;  4UB6 O;  1IZN B;  2J4U P;  2F1C X;  4GHB A;  4XNK A;  3AA1 A;  4RL9 A;  3O0E A;  1GFN A;  1MM4 A;  3LK2 B;  4O4X A;  2KZ7 B;  3RBH A;  3NSG A;  2F1T A;  1T16 A;  2W81 C;  4XNL A;  4RLC A;  2M06 A;  3JTY A;  5GTI O;  3HOL A;  4AKM A;  1BH3 A;  3AA6 A;  3T20 A;  2FGQ X;  3HWB A;  4KR8 A;  3SYB A;  2LFU A;  3PQS A;  4O3Y A;  5IYU A;  4O3W A;  5EE2 A;  4G75 A;  3UAQ A;  2XTQ A;  3V8U A;  3UPG A;  3FYX A;  3VZT X;  2R88 A;  2WJQ A;  2N2L A;  4AYD C;  4K3C A;  1T1L A;  2XG6 A;  2Y0H A;  3AA6 B;  3G7G A;  1PRN A;  1THQ A;  2MNH A;  2W80 C;  2R4L A;  4PUX A;  2XE1 A;  3LK4 1;  4D64 A;  5KAI O;  3KZI O;  2XE3 A;  3NJT A;  2AXT O;  3SY7 A;  4AKR A;  4C69 X;  2R8A A;  4FSO A;  4FT6 A;  4FZM A;  3PQU A;  5G38 A;  3GP6 A;  3VZU X;  2ODJ A;  3EMN X;  5DL8 A;  4AUI A;  4B61 A;  3PGU A;  4FRT A;  4F4B A;  5AFU K;  4N75 A;  2XE5 A;  2ERV A;  2R4P A;  2M07 A;  2Y2X A;  4N74 A;  1GFO A;  2R89 A;  3T24 A;  3PF1 A;  3WU2 O;  4QQ1 A;  4FQE A;  4FOZ A;  3VZW X;  4AYM C;  2K4T A;  1OPF A;  4FSP A;  4PR7 A;  1G90 A;  4O3Z A;  3AA1 B;  1GFP A;  1ZHW A;  1ZHX A;  3JCU O;  3PGR A;  3PGS A;  2KZ7 A;  4KR4 A;  1ZHY A;  4JCH A;  2GE4 A;  3VE1 A;  2Y0K A;  1ZHT A;  1HXT A;  3A0B O;  5D5D A;  2N2M A;  3VE2 A;  1P4T A;  4E1T A;  2F1V A;  2LHF A;  2JMM A;  3LK3 B;  5G3A A;  4D5U A;  1S5L O;  3AAA B;  4G76 A;  4AZL A;  5GV0 A;  4FZN A;  3AA0 A;  3UU2 A;  5JDP A;  2J1N A;  2POR A;  4O49 A;  4PJ0 O;  1H6S 1;  2PRN A;  3LK3 A;  4K3B A;  5G26 A;  3AAA A;  1MPF A;  3DZM A;  3DA3 A;  5ADX L;  2R4N A;  5DL7 A;  6PRN A;  4RJW A;  4GCS A;  5H2F O;  3AAE B;  5FVN A;  4N58 A;  1YS5 A;  2JQY A;  3AA7 A;  5KAF O;  1Q9G A;  7PRN A;  2OMF A;  8PRN A;  5B66 O;  2WVP A;  2Y7S A;  4AFK A;  3A0H O;  2YNK A;  4JFB A;  3SYS A;  4AYI D;  4E1S A;  2IWW A;  2KC0 A;  3AA7 B;  4GCQ A;  4AYE C;  4FRX A;  4KRA A;  3T0S A;  2MHL A;  5AFU L;  1HXX A;  4C4V A;  2Y0L A;  2QTK A;  5PRN A;  5E79 O;  3PRN A;  4O3X B;  3POX A;  3TZG A;  2KXP A;  1IZN A;  4RJX A;  3A2S X;  3QRC A;  4BUM X;  3SZV A;  2ZFG A;  2FGR A;  4N59 A;  5DL6 A;  4LSE A;  4C4V B;  1QJP A;  1BXW A;  3K19 A;  1E54 A;  3LK2 A;  1QJ9 A;  4C00 A;  5B5E O;  2R4O A;  4U9C A;  2KXP B;  2WJR A;  3BRZ A;  4RLB A;  5T5F A;  4FZL A;  2YPV A;  3SZD A; 
#chains in the Genus database with same CATH homology
 1PHO A;  2KDY A;  1ORM A;  2ZLD A;  2XE2 A;  4GCP A;  4LSI A;  3POR A;  1Q9F A;  4LSH A;  3POU A;  3WI4 A;  4LSF A;  3AAE A;  1HXU A;  5DL5 A;  4FUV A;  3DA4 A;  3LK4 2;  1OSM A;  3HW9 A;  2X27 X;  4AKR B;  1GFQ A;  4FES A;  4D65 A;  1BT9 A;  1ZHZ A;  3HOE A;  4AYN A;  5ADX K;  3C5O A;  2K0L A;  3AA0 B;  3KVD D;  4FMS A;  4GF4 A;  3VY8 X;  3WI5 A;  3VY9 X;  1QJ8 A;  4O4U A;  2XMX A;  2O4V A;  3SY9 A;  4Z3T A;  3POQ A;  3QRA A;  1GFM A;  1MM5 A;  2XTR A;  1IZN B;  2J4U P;  4GHB A;  4XNK A;  3AA1 A;  4RL9 A;  3O0E A;  1GFN A;  1MM4 A;  3LK2 B;  4O4X A;  2KZ7 B;  3RBH A;  3NSG A;  2F1T A;  2W81 C;  4XNL A;  4RLC A;  2M06 A;  3JTY A;  3HOL A;  4AKM A;  1BH3 A;  3AA6 A;  3T20 A;  2FGQ X;  3HWB A;  4KR8 A;  3SYB A;  2LFU A;  3PQS A;  4O3Y A;  5IYU A;  4O3W A;  5EE2 A;  4G75 A;  3UAQ A;  2XTQ A;  3V8U A;  3UPG A;  3FYX A;  3VZT X;  2N2L A;  4AYD C;  2XG6 A;  2Y0H A;  3AA6 B;  3G7G A;  1PRN A;  1THQ A;  2MNH A;  2W80 C;  4PUX A;  2XE1 A;  3LK4 1;  4D64 A;  4AKR A;  2XE3 A;  4C69 X;  3SY7 A;  4FSO A;  4FT6 A;  4FZM A;  3PQU A;  3GP6 A;  3VZU X;  2ODJ A;  3EMN X;  5DL8 A;  4AUI A;  4B61 A;  4F4B A;  4FRT A;  5AFU K;  2XE5 A;  2ERV A;  2M07 A;  2Y2X A;  1GFO A;  3T24 A;  4QQ1 A;  4FOZ A;  3VZW X;  4AYM C;  2K4T A;  1OPF A;  4FSP A;  1G90 A;  4O3Z A;  3AA1 B;  1GFP A;  1ZHW A;  1ZHX A;  4KR4 A;  2KZ7 A;  1ZHY A;  4JCH A;  2GE4 A;  3VE1 A;  2Y0K A;  1ZHT A;  1HXT A;  5D5D A;  2N2M A;  3VE2 A;  1P4T A;  4E1T A;  2F1V A;  2LHF A;  2JMM A;  3LK3 B;  4D5U A;  3AAA B;  4G76 A;  4AZL A;  5GV0 A;  4FZN A;  3AA0 A;  3UU2 A;  5JDP A;  2J1N A;  2POR A;  4O49 A;  1H6S 1;  2PRN A;  3LK3 A;  5G26 A;  3AAA A;  1MPF A;  3DA3 A;  5ADX L;  5DL7 A;  6PRN A;  4RJW A;  4GCS A;  3AAE B;  5FVN A;  4N58 A;  1YS5 A;  3AA7 A;  8PRN A;  1Q9G A;  7PRN A;  2OMF A;  2Y7S A;  4AFK A;  2YNK A;  4JFB A;  3SYS A;  4AYI D;  4E1S A;  2KC0 A;  3AA7 B;  4GCQ A;  4AYE C;  4FRX A;  4KRA A;  3T0S A;  2MHL A;  5AFU L;  1HXX A;  2Y0L A;  2QTK A;  5PRN A;  3PRN A;  4O3X B;  3POX A;  3TZG A;  2KXP A;  1IZN A;  4RJX A;  3A2S X;  3QRC A;  4BUM X;  3SZV A;  2ZFG A;  2FGR A;  4N59 A;  5DL6 A;  4LSE A;  1QJP A;  1BXW A;  3K19 A;  1E54 A;  3LK2 A;  1QJ9 A;  3SZD A;  4U9C A;  2KXP B;  5T5F A;  4RLB A;  4FZL A;  2YPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...