2M07A

Nmr structure of ompx in dpc micelles
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
148
structure length
148
Chain Sequence
ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Outer membrane protein X
publication title Optimized phospholipid bilayer nanodiscs facilitate high-resolution structure determination of membrane proteins.
pubmed doi rcsb
source organism Escherichia coli
total genus 18
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2012-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2m07A00
3QRAA 2N2MA 2LHFA 2M06A 2K0LA 2N2LA 3GP6A 1Q9GA 1MM4A 1MM5A 1ORMA 2MHLA 1QJ8A 2X27X 4RLCA 1G90A 2JMMA 2GE4A 1P4TA 2MNHA 1BXWA 1THQA 2F1VA 4PUXA 1QJPA 3C5OA 2ERVA 1QJ9A 3QRCA 2M07A 3G7GA 1Q9FA 2F1TA
chains in the Genus database with same CATH superfamily
4C69X 2N2LA 2JQYA 3GP6A 3AAAB 3LK41 4K3CA 5GTIO 5PRNA 4N59A 2KDYA 1Q9GA 3UAQA 1MM4A 3DA3A 4FQEA 4O3WA 4D5UA 4F4BA 1MM5A 2YPVA 1PRNA 3DZMA 1OPFA 2R8AA 3HW9A 3PQSA 1QJ8A 4FZNA 3BS0A 1HXXA 3POXA 3SYSA 4AYID 3HOEA 2QTKA 4KR8A 4LSEA 4RL9A 3VE1A 4RLCA 5AFUL 3LK2B 1GFPA 4QQ1A 3HWBA 3SYBA 1IZNA 2JMMA 4K3BA 3SZVA 4UB6O 3V8UA 3A2SX 1THQA 2R88A 3SY9A 4XNLA 5DL5A 3A0HO 1ZHXA 2Y0KA 2Y0LA 4GCQA 1QJ9A 4GHBA 5ADXK 2OMFA 2K4TA 4N74A 4JCHA 3AAAA 3VZUX 2J4UP 2XG6A 5JDPA 1HXTA 2R4PA 2F1TA 3BRZA 2PRNA 3KZIO 4G75A 4JFBA 2N2MA 2LHFA 3FYXA 2K0LA 2ODJA 4GCSA 4UB8O 2PORA 3T24A 2XE2A 2Y7SA 4PJ0O 4XNKA 3EMNX 4O49A 3JCUO 3LK2A 4N58A 3RBHA 3LK3B 4AKRB 2F1CX 1GFMA 5ADXL 3WI4A 3AA0B 4GF4A 4IL6O 3WU2O 2X27X 2WVPA 2XTQA 4B61A 3KVDD 1ZHWA 4AYMC 3BRYA 4C4VB 5T5FA 3A0BO 5DL7A 3AA7B 4AZLA 4O4UA 4RLBA 5KAIO 4PUXA 5IYUA 4FMSA 1QJPA 3UU2A 3PGSA 4O3YA 4LSIA 3NSGA 2XMXA 3PORA 4FUVA 2M07A 3SZDA 3AA1B 3G7GA 3SY7A 1GFNA 2W81C 4O3ZA 4AUIA 1MPFA 5D5DA 5GV0A 3VZTX 2M06A 2YNKA 5G39A 4RJWA 3LK3A 5DL6A 3DA4A 4AKRA 2R4NA 3AA6B 2XE3A 3AA0A 1ZHYA 2XE5A 4U9CA 3VE2A 1ORMA 4FT6A 8PRNA 3PRNA 2XTRA 3WI5A 2WJQA 3JTYA 4C4VA 5FVNA 2IWVA 2KXPB 2FGRA 3AA7A 2KZ7B 3O0EA 4FOZA 4LSFA 5B66O 4GCPA 4E1SA 1G90A 1GFQA 1P4TA 4FZMA 5E79O 3VY9X 3HOLA 2KC0A 6PRNA 3PGRA 2IWWA 4FESA 3DWNA 2F1VA 2AXTO 2R4OA 5TISO 3AAEB 3AA1A 1ZHTA 3DWOX 5B5EO 2ERVA 2LFUA 3K19A 2J1NA 5KAFO 4AYDC 1S5LO 2R89A 2X9KA 4FZLA 3VY8X 3PGUA 4CTDA 4E1TA 4D64A 3AA6A 2ZFGA 4FRXA 3T20A 3QRAA 1BH3A 3POQA 4BUMX 7PRNA 2W80C 4RJXA 5G3AA 4FSOA 4AFKA 2ZLDA 5EE2A 3UPGA 2MHLA 1PHOA 2KXPA 3NJTA 2KZ7A 4KRAA 1T1LA 4Z3TA 4O3XB 2O4VA 5G38A 1ZHZA 4N75A 1T16A 4AYEC 4FRTA 3VZWX 4D65A 1E54A 1BT9A 2WJRA 5H2FO 2GE4A 2Y0HA 3AAEA 2XE1A 2MNHA 1BXWA 2R4LA 4G76A 4LSHA 4C00A 1H6S1 4PR7A 5GTHO 1GFOA 5DL8A 4AYNA 1IZNB 3PF1A 4FSPA 5G26A 3T0SA 4KR4A 3TZGA 2FGQX 2Y2XA 3C5OA 4AKMA 1OSMA 1YS5A 3QRCA 3LK42 3POUA 4O4XA 1HXUA 5AFUK 1Q9FA 3PQUA
chains in the Genus database with same CATH topology
4C69X 2N2LA 3LK41 3GP6A 3AAAB 5PRNA 3UAQA 2KDYA 1Q9GA 4F4BA 1MM4A 3DA3A 4O3WA 4D5UA 1MM5A 2YPVA 1PRNA 3HW9A 1OPFA 4N59A 3PQSA 4FZNA 1QJ8A 3SYSA 1HXXA 3POXA 4AYID 3HOEA 2QTKA 4KR8A 4LSEA 4RL9A 3VE1A 4RLCA 5AFUL 3LK2B 1GFPA 4QQ1A 3HWBA 3SYBA 1IZNA 2JMMA 3SZVA 3V8UA 3A2SX 1THQA 3SY9A 4XNLA 5DL5A 1ZHXA 2Y0KA 2Y0LA 4GCQA 1QJ9A 4GHBA 5ADXK 2OMFA 2K4TA 4JCHA 3AAAA 3VZUX 2J4UP 2XG6A 5JDPA 1HXTA 2F1TA 2PRNA 4G75A 4JFBA 2N2MA 2LHFA 3FYXA 2K0LA 2ODJA 4GCSA 3T24A 2PORA 2XE2A 2Y7SA 4XNKA 3EMNX 4O49A 3RBHA 3LK2A 4N58A 3LK3B 4AKRB 1GFMA 5ADXL 3WI4A 3AA0B 4GF4A 2X27X 2XTQA 4B61A 3KVDD 1ZHWA 4AYMC 5T5FA 5DL7A 3AA7B 4AZLA 4O4UA 4RLBA 5IYUA 4PUXA 4FMSA 1QJPA 3UU2A 4O3YA 4LSIA 3NSGA 2XMXA 3PORA 4FUVA 2M07A 3SZDA 3AA1B 3G7GA 3SY7A 1GFNA 2W81C 4O3ZA 4AUIA 1MPFA 5D5DA 5GV0A 3VZTX 2M06A 2YNKA 4RJWA 3LK3A 5DL6A 3DA4A 4AKRA 3AA6B 2XE3A 3AA0A 1ZHYA 2XE5A 4U9CA 3VE2A 1ORMA 4FT6A 8PRNA 3PRNA 2XTRA 3WI5A 3JTYA 5FVNA 2KXPB 2FGRA 3AA7A 2KZ7B 3O0EA 4FOZA 4LSFA 1G90A 4GCPA 4E1SA 1GFQA 1P4TA 4FZMA 3VY9X 6PRNA 3HOLA 2KC0A 4FESA 2F1VA 3AAEB 3AA1A 1ZHTA 2ERVA 2LFUA 3K19A 2J1NA 4AYDC 4E1TA 4FZLA 3VY8X 4D64A 3AA6A 2ZFGA 4FRXA 3T20A 3QRAA 1BH3A 3POQA 4BUMX 7PRNA 2W80C 4RJXA 4FSOA 4AFKA 2ZLDA 5EE2A 3UPGA 2MHLA 1PHOA 2KXPA 2KZ7A 4KRAA 4Z3TA 4O3XB 2O4VA 1ZHZA 4AYEC 4FRTA 3VZWX 4D65A 1E54A 1BT9A 2GE4A 2Y0HA 3AAEA 2XE1A 2MNHA 1BXWA 4G76A 4LSHA 1H6S1 1GFOA 5DL8A 4AYNA 1IZNB 4FSPA 5G26A 3T0SA 4KR4A 3TZGA 2FGQX 2Y2XA 3C5OA 4AKMA 1OSMA 1YS5A 3QRCA 3LK42 3POUA 4O4XA 1HXUA 5AFUK 1Q9FA 3PQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QRA A;  2N2M A;  2LHF A;  2M06 A;  2K0L A;  2N2L A;  3GP6 A;  1Q9G A;  1MM4 A;  1MM5 A;  1ORM A;  2MHL A;  1QJ8 A;  2X27 X;  4RLC A;  1G90 A;  2JMM A;  2GE4 A;  1P4T A;  2MNH A;  1BXW A;  1THQ A;  2F1V A;  4PUX A;  1QJP A;  3C5O A;  2ERV A;  1QJ9 A;  3QRC A;  2M07 A;  3G7G A;  1Q9F A;  2F1T A; 
#chains in the Genus database with same CATH topology
 4C69 X;  2N2L A;  2JQY A;  3GP6 A;  3AAA B;  3LK4 1;  4K3C A;  5GTI O;  5PRN A;  4N59 A;  2KDY A;  1Q9G A;  3UAQ A;  1MM4 A;  3DA3 A;  4FQE A;  4O3W A;  4D5U A;  4F4B A;  1MM5 A;  2YPV A;  1PRN A;  3DZM A;  1OPF A;  2R8A A;  3HW9 A;  3PQS A;  1QJ8 A;  4FZN A;  3BS0 A;  1HXX A;  3POX A;  3SYS A;  4AYI D;  3HOE A;  2QTK A;  4KR8 A;  4LSE A;  4RL9 A;  3VE1 A;  4RLC A;  5AFU L;  3LK2 B;  1GFP A;  4QQ1 A;  3HWB A;  3SYB A;  1IZN A;  2JMM A;  4K3B A;  3SZV A;  4UB6 O;  3V8U A;  3A2S X;  1THQ A;  2R88 A;  3SY9 A;  4XNL A;  5DL5 A;  3A0H O;  1ZHX A;  2Y0K A;  2Y0L A;  4GCQ A;  1QJ9 A;  4GHB A;  5ADX K;  2OMF A;  2K4T A;  4N74 A;  4JCH A;  3AAA A;  3VZU X;  2J4U P;  2XG6 A;  5JDP A;  1HXT A;  2R4P A;  2F1T A;  3BRZ A;  2PRN A;  3KZI O;  4G75 A;  4JFB A;  2N2M A;  2LHF A;  3FYX A;  2K0L A;  2ODJ A;  4GCS A;  4UB8 O;  2POR A;  3T24 A;  2XE2 A;  2Y7S A;  4PJ0 O;  4XNK A;  3EMN X;  4O49 A;  3JCU O;  3LK2 A;  4N58 A;  3RBH A;  3LK3 B;  4AKR B;  2F1C X;  1GFM A;  5ADX L;  3WI4 A;  3AA0 B;  4GF4 A;  4IL6 O;  3WU2 O;  2X27 X;  2WVP A;  2XTQ A;  4B61 A;  3KVD D;  1ZHW A;  4AYM C;  3BRY A;  4C4V B;  5T5F A;  3A0B O;  5DL7 A;  3AA7 B;  4AZL A;  4O4U A;  4RLB A;  5KAI O;  4PUX A;  5IYU A;  4FMS A;  1QJP A;  3UU2 A;  3PGS A;  4O3Y A;  4LSI A;  3NSG A;  2XMX A;  3POR A;  4FUV A;  2M07 A;  3SZD A;  3AA1 B;  3G7G A;  3SY7 A;  1GFN A;  2W81 C;  4O3Z A;  4AUI A;  1MPF A;  5D5D A;  5GV0 A;  3VZT X;  2M06 A;  2YNK A;  5G39 A;  4RJW A;  3LK3 A;  5DL6 A;  3DA4 A;  4AKR A;  2R4N A;  3AA6 B;  2XE3 A;  3AA0 A;  1ZHY A;  2XE5 A;  4U9C A;  3VE2 A;  1ORM A;  4FT6 A;  8PRN A;  3PRN A;  2XTR A;  3WI5 A;  2WJQ A;  3JTY A;  4C4V A;  5FVN A;  2IWV A;  2KXP B;  2FGR A;  3AA7 A;  2KZ7 B;  3O0E A;  4FOZ A;  4LSF A;  5B66 O;  4GCP A;  4E1S A;  1G90 A;  1GFQ A;  1P4T A;  4FZM A;  5E79 O;  3VY9 X;  3HOL A;  2KC0 A;  6PRN A;  3PGR A;  2IWW A;  4FES A;  3DWN A;  2F1V A;  2AXT O;  2R4O A;  5TIS O;  3AAE B;  3AA1 A;  1ZHT A;  3DWO X;  5B5E O;  2ERV A;  2LFU A;  3K19 A;  2J1N A;  5KAF O;  4AYD C;  1S5L O;  2R89 A;  2X9K A;  4FZL A;  3VY8 X;  3PGU A;  4CTD A;  4E1T A;  4D64 A;  3AA6 A;  2ZFG A;  4FRX A;  3T20 A;  3QRA A;  1BH3 A;  3POQ A;  4BUM X;  7PRN A;  2W80 C;  4RJX A;  5G3A A;  4FSO A;  4AFK A;  2ZLD A;  5EE2 A;  3UPG A;  2MHL A;  1PHO A;  2KXP A;  3NJT A;  2KZ7 A;  4KRA A;  1T1L A;  4Z3T A;  4O3X B;  2O4V A;  5G38 A;  1ZHZ A;  4N75 A;  1T16 A;  4AYE C;  4FRT A;  3VZW X;  4D65 A;  1E54 A;  1BT9 A;  2WJR A;  5H2F O;  2GE4 A;  2Y0H A;  3AAE A;  2XE1 A;  2MNH A;  1BXW A;  2R4L A;  4G76 A;  4LSH A;  4C00 A;  1H6S 1;  4PR7 A;  5GTH O;  1GFO A;  5DL8 A;  4AYN A;  1IZN B;  3PF1 A;  4FSP A;  5G26 A;  3T0S A;  4KR4 A;  3TZG A;  2FGQ X;  2Y2X A;  3C5O A;  4AKM A;  1OSM A;  1YS5 A;  3QRC A;  3LK4 2;  3POU A;  4O4X A;  1HXU A;  5AFU K;  1Q9F A;  3PQU A; 
#chains in the Genus database with same CATH homology
 4C69 X;  2N2L A;  3LK4 1;  3GP6 A;  3AAA B;  5PRN A;  3UAQ A;  2KDY A;  1Q9G A;  4F4B A;  1MM4 A;  3DA3 A;  4O3W A;  4D5U A;  1MM5 A;  2YPV A;  1PRN A;  3HW9 A;  1OPF A;  4N59 A;  3PQS A;  4FZN A;  1QJ8 A;  3SYS A;  1HXX A;  3POX A;  4AYI D;  3HOE A;  2QTK A;  4KR8 A;  4LSE A;  4RL9 A;  3VE1 A;  4RLC A;  5AFU L;  3LK2 B;  1GFP A;  4QQ1 A;  3HWB A;  3SYB A;  1IZN A;  2JMM A;  3SZV A;  3V8U A;  3A2S X;  1THQ A;  3SY9 A;  4XNL A;  5DL5 A;  1ZHX A;  2Y0K A;  2Y0L A;  4GCQ A;  1QJ9 A;  4GHB A;  5ADX K;  2OMF A;  2K4T A;  4JCH A;  3AAA A;  3VZU X;  2J4U P;  2XG6 A;  5JDP A;  1HXT A;  2F1T A;  2PRN A;  4G75 A;  4JFB A;  2N2M A;  2LHF A;  3FYX A;  2K0L A;  2ODJ A;  4GCS A;  3T24 A;  2POR A;  2XE2 A;  2Y7S A;  4XNK A;  3EMN X;  4O49 A;  3RBH A;  3LK2 A;  4N58 A;  3LK3 B;  4AKR B;  1GFM A;  5ADX L;  3WI4 A;  3AA0 B;  4GF4 A;  2X27 X;  2XTQ A;  4B61 A;  3KVD D;  1ZHW A;  4AYM C;  5T5F A;  5DL7 A;  3AA7 B;  4AZL A;  4O4U A;  4RLB A;  5IYU A;  4PUX A;  4FMS A;  1QJP A;  3UU2 A;  4O3Y A;  4LSI A;  3NSG A;  2XMX A;  3POR A;  4FUV A;  2M07 A;  3SZD A;  3AA1 B;  3G7G A;  3SY7 A;  1GFN A;  2W81 C;  4O3Z A;  4AUI A;  1MPF A;  5D5D A;  5GV0 A;  3VZT X;  2M06 A;  2YNK A;  4RJW A;  3LK3 A;  5DL6 A;  3DA4 A;  4AKR A;  3AA6 B;  2XE3 A;  3AA0 A;  1ZHY A;  2XE5 A;  4U9C A;  3VE2 A;  1ORM A;  4FT6 A;  8PRN A;  3PRN A;  2XTR A;  3WI5 A;  3JTY A;  5FVN A;  2KXP B;  2FGR A;  3AA7 A;  2KZ7 B;  3O0E A;  4FOZ A;  4LSF A;  1G90 A;  4GCP A;  4E1S A;  1GFQ A;  1P4T A;  4FZM A;  3VY9 X;  6PRN A;  3HOL A;  2KC0 A;  4FES A;  2F1V A;  3AAE B;  3AA1 A;  1ZHT A;  2ERV A;  2LFU A;  3K19 A;  2J1N A;  4AYD C;  4E1T A;  4FZL A;  3VY8 X;  4D64 A;  3AA6 A;  2ZFG A;  4FRX A;  3T20 A;  3QRA A;  1BH3 A;  3POQ A;  4BUM X;  7PRN A;  2W80 C;  4RJX A;  4FSO A;  4AFK A;  2ZLD A;  5EE2 A;  3UPG A;  2MHL A;  1PHO A;  2KXP A;  2KZ7 A;  4KRA A;  4Z3T A;  4O3X B;  2O4V A;  1ZHZ A;  4AYE C;  4FRT A;  3VZW X;  4D65 A;  1E54 A;  1BT9 A;  2GE4 A;  2Y0H A;  3AAE A;  2XE1 A;  2MNH A;  1BXW A;  4G76 A;  4LSH A;  1H6S 1;  1GFO A;  5DL8 A;  4AYN A;  1IZN B;  4FSP A;  5G26 A;  3T0S A;  4KR4 A;  3TZG A;  2FGQ X;  2Y2X A;  3C5O A;  4AKM A;  1OSM A;  1YS5 A;  3QRC A;  3LK4 2;  3POU A;  4O4X A;  1HXU A;  5AFU K;  1Q9F A;  3PQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...