3POQA

Crystal structure of e.coli ompf porin in lipidic cubic phase: space group h32, small unit cell
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords OmpF protein
publication title Structure of Escherichia coli OmpF porin from lipidic mesophase.
pubmed doi rcsb
total genus 105
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3poqA00
3T20A 1BH3A 1GFQA 3HWBA 1OPFA 3PRNA 2Y0HA 4JFBA 5DL5A 5DL7A 3VZWX 2PRNA 2XG6A 2J1NA 1HXUA 3UU2A 4FT6A 4KRAA 3SZVA 5JDPA 4RJWA 3FYXA 4BUMX 4FMSA 2ODJA 1PRNA 2Y0LA 3EMNX 4FRXA 4D5UA 4LSHA 2XE3A 2PORA 6PRNA 2K4TA 3SYBA 2ZFGA 3NSGA 1GFPA 1GFNA 5DL6A 3POQA 3A2SX 2FGQX 1HXXA 4GCSA 4LSEA 1GFOA 3VY8X 2XE5A 2Y2XA 2OMFA 4FSPA 1E54A 3O0EA 3PORA 2QTKA 2O4VA 3WI4A 4AUIA 3SY9A 4C69X 4GCPA 2Y0KA 3T24A 4KR8A 3POXA 4LSIA 3POUA 3SYSA 3WI5A 8PRNA 4GCQA 3K19A 4LSFA 2J4UP 4FRTA 2XE1A 4D64A 1HXTA 4FOZA 5DL8A 1MPFA 1H6S1 2FGRA 1BT9A 3SY7A 2ZLDA 3VZTX 3VZUX 3SZDA 1GFMA 5PRNA 5FVNA 3VY9X 1OSMA 3HW9A 4KR4A 3T0SA 4FSOA 4RJXA 4D65A 3UPGA 2XE2A 3JTYA 7PRNA 1PHOA
chains in the Genus database with same CATH superfamily
2IWVA 3AAAB 4O3ZA 1Q9FA 4GF4A 3T20A 1BH3A 5E79O 1GFQA 3PGUA 2JQYA 2ERVA 2YNKA 3LK2A 4AZLA 4AYID 3DZMA 3HWBA 1OPFA 4O3XB 2GE4A 3PRNA 5AFUL 5H2FO 2Y0HA 2R4PA 4JFBA 2K0LA 5DL5A 4PR7A 5DL7A 3VZWX 2R4NA 2PRNA 3AAAA 2XG6A 2J1NA 3KZIO 2KC0A 1HXUA 3LK41 3V8UA 3UU2A 3JTYA 2M06A 5B5EO 1S5LO 2MNHA 4QQ1A 4N59A 3AA7A 3LK3B 3QRCA 2YPVA 4FT6A 4G76A 2W81C 3HOEA 4N74A 4KRAA 2JMMA 5IYUA 3SZVA 2KZ7B 1QJPA 3DWNA 2M07A 2XTRA 4K3BA 4AKRB 3PGRA 2X9KA 2XMXA 5JDPA 4IL6O 4RJWA 2KDYA 3FYXA 4O49A 4C4VB 4BUMX 5ADXK 4FMSA 4PUXA 4JCHA 4AKMA 2ODJA 2Y7SA 1PRNA 2Y0LA 3BRYA 1G90A 5GV0A 3EMNX 4FRXA 4UB8O 1T16A 4N58A 4U9CA 4LSHA 2XE3A 4D5UA 2KXPA 2PORA 3AA6B 2K4TA 1BXWA 3AA1B 3NJTA 6PRNA 1MM4A 4FZMA 3SYBA 5EE2A 2ZFGA 5G38A 4O3WA 3NSGA 1GFPA 1GFNA 3HOLA 5D5DA 1QJ8A 4FUVA 5DL6A 4C00A 3POQA 2MHLA 3A2SX 2FGQX 5KAIO 1HXXA 4GCSA 3AA1A 4CTDA 4LSEA 1ZHTA 2N2LA 1GFOA 5G26A 4XNLA 4FZLA 3VY8X 3PF1A 2XE5A 2F1VA 1ZHYA 2F1TA 2WJQA 2Y2XA 1ZHXA 5GTIO 2OMFA 2R4LA 4FSPA 3LK3A 3AAEB 3KVDD 1E54A 5B66O 4E1SA 4FESA 4UB6O 4AYMC 3O0EA 2R89A 3A0BO 2KZ7A 2QTKA 2O4VA 3GP6A 3PORA 2LFUA 3WI4A 3C5OA 4B61A 3AA0B 5G3AA 5GTHO 4AKRA 4AUIA 1T1LA 1IZNB 1MM5A 5AFUK 3SY9A 2F1CX 3DWOX 4K3CA 1YS5A 4N75A 4O4XA 3VE1A 4FQEA 4C4VA 3RBHA 3PQSA 4RL9A 4D64A 2WVPA 4C69X 3UAQA 4GCPA 3BS0A 2Y0KA 3T24A 4KR8A 4AYNA 4O4UA 3POXA 4LSIA 4RLBA 3POUA 3SYSA 3AA0A 3TZGA 1THQA 3WI5A 2IWWA 8PRNA 3AA6A 1P4TA 2X27X 4GCQA 3K19A 4LSFA 2LHFA 2R88A 2WJRA 5ADXL 2J4UP 4AYEC 1ZHZA 4FRTA 3BRZA 4AYDC 3DA4A 2XE1A 4O3YA 3DA3A 4RLCA 3LK42 1QJ9A 3AA7B 2AXTO 4GHBA 4Z3TA 4G75A 1HXTA 4FOZA 3JCUO 1MPFA 2XTQA 1ORMA 1ZHWA 3G7GA 5DL8A 1H6S1 1BT9A 2FGRA 4AFKA 1Q9GA 3SY7A 2ZLDA 3VZTX 2R8AA 3VZUX 5TISO 3SZDA 1GFMA 3WU2O 3AAEA 2N2MA 5G39A 4F4BA 5PRNA 5FVNA 5KAFO 3VE2A 1OSMA 3VY9X 3HW9A 4FZNA 2R4OA 3LK2B 4FSOA 4KR4A 5T5FA 3QRAA 4RJXA 3T0SA 4PJ0O 2W80C 4E1TA 3PQUA 1IZNA 4D65A 3UPGA 2XE2A 3A0HO 7PRNA 4XNKA 2KXPB 3PGSA 1PHOA
chains in the Genus database with same CATH topology
3AAAB 4O3ZA 1Q9FA 4GF4A 3T20A 1BH3A 1GFQA 2YNKA 2ERVA 3LK2A 4AZLA 4AYID 1PHOA 3HWBA 1OPFA 4O3XB 2GE4A 3PRNA 5AFUL 2Y0HA 4JFBA 2K0LA 5DL5A 5DL7A 3VZWX 2PRNA 3AAAA 2XG6A 2J1NA 2KC0A 1HXUA 3LK41 3V8UA 3UU2A 2M06A 2MNHA 4QQ1A 4N59A 3AA7A 3LK3B 3QRCA 2YPVA 4FT6A 4G76A 2W81C 3HOEA 4KRAA 2JMMA 5IYUA 3SZVA 2KZ7B 1QJPA 2M07A 4AKRB 5JDPA 2XMXA 4RJWA 2KDYA 3FYXA 4O49A 4BUMX 5ADXK 4FMSA 4PUXA 4JCHA 4AKMA 2ODJA 2Y7SA 1PRNA 2Y0LA 1G90A 5GV0A 3EMNX 4FRXA 4N58A 4D5UA 4U9CA 4LSHA 2XE3A 2KXPA 2PORA 3AA6B 2K4TA 1BXWA 3AA1B 6PRNA 1MM4A 4FZMA 3SYBA 5EE2A 2ZFGA 4O3WA 3NSGA 1GFPA 1GFNA 3HOLA 5D5DA 1QJ8A 4FUVA 5DL6A 3POQA 2MHLA 3A2SX 2FGQX 1HXXA 4GCSA 3AA1A 4LSEA 1ZHTA 2N2LA 1GFOA 5G26A 4XNLA 4FZLA 3VY8X 2XE5A 2F1VA 1ZHYA 2F1TA 2Y2XA 1ZHXA 2OMFA 4FSPA 3LK3A 3AAEB 3KVDD 1E54A 4E1SA 4FESA 4AYMC 3O0EA 3PORA 3GP6A 2KZ7A 2QTKA 2O4VA 3WI4A 4B61A 2LFUA 3C5OA 3AA0B 4AKRA 4AUIA 1IZNB 1MM5A 5AFUK 3SY9A 3VE1A 1YS5A 4O4XA 3RBHA 3PQSA 4RL9A 4C69X 3UAQA 4GCPA 2Y0KA 3T24A 4KR8A 4AYNA 4O4UA 3POXA 4LSIA 4RLBA 3POUA 3SYSA 3AA0A 3TZGA 1THQA 3WI5A 8PRNA 3AA6A 1P4TA 2X27X 4GCQA 3K19A 4LSFA 2LHFA 5ADXL 2J4UP 4AYEC 1ZHZA 4FRTA 4AYDC 3DA4A 2XE1A 4O3YA 3DA3A 4RLCA 3LK42 1QJ9A 3AA7B 4GHBA 4Z3TA 4G75A 1HXTA 4FOZA 5DL8A 1MPFA 2XTQA 1ORMA 1ZHWA 3G7GA 4D64A 1H6S1 1BT9A 2FGRA 4AFKA 1Q9GA 3SY7A 2ZLDA 3VZTX 3VZUX 3SZDA 1GFMA 3AAEA 2N2MA 4F4BA 5PRNA 5FVNA 3VE2A 3VY9X 1OSMA 3HW9A 4FZNA 4KR4A 3LK2B 4FSOA 5T5FA 3T0SA 3QRAA 4RJXA 4E1TA 2W80C 3PQUA 1IZNA 4D65A 3UPGA 2XE2A 3JTYA 7PRNA 4XNKA 2KXPB 2XTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T20 A;  1BH3 A;  1GFQ A;  3HWB A;  1OPF A;  3PRN A;  2Y0H A;  4JFB A;  5DL5 A;  5DL7 A;  3VZW X;  2PRN A;  2XG6 A;  2J1N A;  1HXU A;  3UU2 A;  4FT6 A;  4KRA A;  3SZV A;  5JDP A;  4RJW A;  3FYX A;  4BUM X;  4FMS A;  2ODJ A;  1PRN A;  2Y0L A;  3EMN X;  4FRX A;  4D5U A;  4LSH A;  2XE3 A;  2POR A;  6PRN A;  2K4T A;  3SYB A;  2ZFG A;  3NSG A;  1GFP A;  1GFN A;  5DL6 A;  3POQ A;  3A2S X;  2FGQ X;  1HXX A;  4GCS A;  4LSE A;  1GFO A;  3VY8 X;  2XE5 A;  2Y2X A;  2OMF A;  4FSP A;  1E54 A;  3O0E A;  3POR A;  2QTK A;  2O4V A;  3WI4 A;  4AUI A;  3SY9 A;  4C69 X;  4GCP A;  2Y0K A;  3T24 A;  4KR8 A;  3POX A;  4LSI A;  3POU A;  3SYS A;  3WI5 A;  8PRN A;  4GCQ A;  3K19 A;  4LSF A;  2J4U P;  4FRT A;  2XE1 A;  4D64 A;  1HXT A;  4FOZ A;  5DL8 A;  1MPF A;  1H6S 1;  2FGR A;  1BT9 A;  3SY7 A;  2ZLD A;  3VZT X;  3VZU X;  3SZD A;  1GFM A;  5PRN A;  5FVN A;  3VY9 X;  1OSM A;  3HW9 A;  4KR4 A;  3T0S A;  4FSO A;  4RJX A;  4D65 A;  3UPG A;  2XE2 A;  3JTY A;  7PRN A;  1PHO A; 
#chains in the Genus database with same CATH topology
 2IWV A;  3AAA B;  4O3Z A;  1Q9F A;  4GF4 A;  3T20 A;  1BH3 A;  5E79 O;  1GFQ A;  3PGU A;  2JQY A;  2ERV A;  2YNK A;  3LK2 A;  4AZL A;  4AYI D;  3DZM A;  3HWB A;  1OPF A;  4O3X B;  2GE4 A;  3PRN A;  5AFU L;  5H2F O;  2Y0H A;  2R4P A;  4JFB A;  2K0L A;  5DL5 A;  4PR7 A;  5DL7 A;  3VZW X;  2R4N A;  2PRN A;  3AAA A;  2XG6 A;  2J1N A;  3KZI O;  2KC0 A;  1HXU A;  3LK4 1;  3V8U A;  3UU2 A;  3JTY A;  2M06 A;  5B5E O;  1S5L O;  2MNH A;  4QQ1 A;  4N59 A;  3AA7 A;  3LK3 B;  3QRC A;  2YPV A;  4FT6 A;  4G76 A;  2W81 C;  3HOE A;  4N74 A;  4KRA A;  2JMM A;  5IYU A;  3SZV A;  2KZ7 B;  1QJP A;  3DWN A;  2M07 A;  2XTR A;  4K3B A;  4AKR B;  3PGR A;  2X9K A;  2XMX A;  5JDP A;  4IL6 O;  4RJW A;  2KDY A;  3FYX A;  4O49 A;  4C4V B;  4BUM X;  5ADX K;  4FMS A;  4PUX A;  4JCH A;  4AKM A;  2ODJ A;  2Y7S A;  1PRN A;  2Y0L A;  3BRY A;  1G90 A;  5GV0 A;  3EMN X;  4FRX A;  4UB8 O;  1T16 A;  4N58 A;  4U9C A;  4LSH A;  2XE3 A;  4D5U A;  2KXP A;  2POR A;  3AA6 B;  2K4T A;  1BXW A;  3AA1 B;  3NJT A;  6PRN A;  1MM4 A;  4FZM A;  3SYB A;  5EE2 A;  2ZFG A;  5G38 A;  4O3W A;  3NSG A;  1GFP A;  1GFN A;  3HOL A;  5D5D A;  1QJ8 A;  4FUV A;  5DL6 A;  4C00 A;  3POQ A;  2MHL A;  3A2S X;  2FGQ X;  5KAI O;  1HXX A;  4GCS A;  3AA1 A;  4CTD A;  4LSE A;  1ZHT A;  2N2L A;  1GFO A;  5G26 A;  4XNL A;  4FZL A;  3VY8 X;  3PF1 A;  2XE5 A;  2F1V A;  1ZHY A;  2F1T A;  2WJQ A;  2Y2X A;  1ZHX A;  5GTI O;  2OMF A;  2R4L A;  4FSP A;  3LK3 A;  3AAE B;  3KVD D;  1E54 A;  5B66 O;  4E1S A;  4FES A;  4UB6 O;  4AYM C;  3O0E A;  2R89 A;  3A0B O;  2KZ7 A;  2QTK A;  2O4V A;  3GP6 A;  3POR A;  2LFU A;  3WI4 A;  3C5O A;  4B61 A;  3AA0 B;  5G3A A;  5GTH O;  4AKR A;  4AUI A;  1T1L A;  1IZN B;  1MM5 A;  5AFU K;  3SY9 A;  2F1C X;  3DWO X;  4K3C A;  1YS5 A;  4N75 A;  4O4X A;  3VE1 A;  4FQE A;  4C4V A;  3RBH A;  3PQS A;  4RL9 A;  4D64 A;  2WVP A;  4C69 X;  3UAQ A;  4GCP A;  3BS0 A;  2Y0K A;  3T24 A;  4KR8 A;  4AYN A;  4O4U A;  3POX A;  4LSI A;  4RLB A;  3POU A;  3SYS A;  3AA0 A;  3TZG A;  1THQ A;  3WI5 A;  2IWW A;  8PRN A;  3AA6 A;  1P4T A;  2X27 X;  4GCQ A;  3K19 A;  4LSF A;  2LHF A;  2R88 A;  2WJR A;  5ADX L;  2J4U P;  4AYE C;  1ZHZ A;  4FRT A;  3BRZ A;  4AYD C;  3DA4 A;  2XE1 A;  4O3Y A;  3DA3 A;  4RLC A;  3LK4 2;  1QJ9 A;  3AA7 B;  2AXT O;  4GHB A;  4Z3T A;  4G75 A;  1HXT A;  4FOZ A;  3JCU O;  1MPF A;  2XTQ A;  1ORM A;  1ZHW A;  3G7G A;  5DL8 A;  1H6S 1;  1BT9 A;  2FGR A;  4AFK A;  1Q9G A;  3SY7 A;  2ZLD A;  3VZT X;  2R8A A;  3VZU X;  5TIS O;  3SZD A;  1GFM A;  3WU2 O;  3AAE A;  2N2M A;  5G39 A;  4F4B A;  5PRN A;  5FVN A;  5KAF O;  3VE2 A;  1OSM A;  3VY9 X;  3HW9 A;  4FZN A;  2R4O A;  3LK2 B;  4FSO A;  4KR4 A;  5T5F A;  3QRA A;  4RJX A;  3T0S A;  4PJ0 O;  2W80 C;  4E1T A;  3PQU A;  1IZN A;  4D65 A;  3UPG A;  2XE2 A;  3A0H O;  7PRN A;  4XNK A;  2KXP B;  3PGS A;  1PHO A; 
#chains in the Genus database with same CATH homology
 3AAA B;  4O3Z A;  1Q9F A;  4GF4 A;  3T20 A;  1BH3 A;  1GFQ A;  2YNK A;  2ERV A;  3LK2 A;  4AZL A;  4AYI D;  1PHO A;  3HWB A;  1OPF A;  4O3X B;  2GE4 A;  3PRN A;  5AFU L;  2Y0H A;  4JFB A;  2K0L A;  5DL5 A;  5DL7 A;  3VZW X;  2PRN A;  3AAA A;  2XG6 A;  2J1N A;  2KC0 A;  1HXU A;  3LK4 1;  3V8U A;  3UU2 A;  2M06 A;  2MNH A;  4QQ1 A;  4N59 A;  3AA7 A;  3LK3 B;  3QRC A;  2YPV A;  4FT6 A;  4G76 A;  2W81 C;  3HOE A;  4KRA A;  2JMM A;  5IYU A;  3SZV A;  2KZ7 B;  1QJP A;  2M07 A;  4AKR B;  5JDP A;  2XMX A;  4RJW A;  2KDY A;  3FYX A;  4O49 A;  4BUM X;  5ADX K;  4FMS A;  4PUX A;  4JCH A;  4AKM A;  2ODJ A;  2Y7S A;  1PRN A;  2Y0L A;  1G90 A;  5GV0 A;  3EMN X;  4FRX A;  4N58 A;  4D5U A;  4U9C A;  4LSH A;  2XE3 A;  2KXP A;  2POR A;  3AA6 B;  2K4T A;  1BXW A;  3AA1 B;  6PRN A;  1MM4 A;  4FZM A;  3SYB A;  5EE2 A;  2ZFG A;  4O3W A;  3NSG A;  1GFP A;  1GFN A;  3HOL A;  5D5D A;  1QJ8 A;  4FUV A;  5DL6 A;  3POQ A;  2MHL A;  3A2S X;  2FGQ X;  1HXX A;  4GCS A;  3AA1 A;  4LSE A;  1ZHT A;  2N2L A;  1GFO A;  5G26 A;  4XNL A;  4FZL A;  3VY8 X;  2XE5 A;  2F1V A;  1ZHY A;  2F1T A;  2Y2X A;  1ZHX A;  2OMF A;  4FSP A;  3LK3 A;  3AAE B;  3KVD D;  1E54 A;  4E1S A;  4FES A;  4AYM C;  3O0E A;  3POR A;  3GP6 A;  2KZ7 A;  2QTK A;  2O4V A;  3WI4 A;  4B61 A;  2LFU A;  3C5O A;  3AA0 B;  4AKR A;  4AUI A;  1IZN B;  1MM5 A;  5AFU K;  3SY9 A;  3VE1 A;  1YS5 A;  4O4X A;  3RBH A;  3PQS A;  4RL9 A;  4C69 X;  3UAQ A;  4GCP A;  2Y0K A;  3T24 A;  4KR8 A;  4AYN A;  4O4U A;  3POX A;  4LSI A;  4RLB A;  3POU A;  3SYS A;  3AA0 A;  3TZG A;  1THQ A;  3WI5 A;  8PRN A;  3AA6 A;  1P4T A;  2X27 X;  4GCQ A;  3K19 A;  4LSF A;  2LHF A;  5ADX L;  2J4U P;  4AYE C;  1ZHZ A;  4FRT A;  4AYD C;  3DA4 A;  2XE1 A;  4O3Y A;  3DA3 A;  4RLC A;  3LK4 2;  1QJ9 A;  3AA7 B;  4GHB A;  4Z3T A;  4G75 A;  1HXT A;  4FOZ A;  5DL8 A;  1MPF A;  2XTQ A;  1ORM A;  1ZHW A;  3G7G A;  4D64 A;  1H6S 1;  1BT9 A;  2FGR A;  4AFK A;  1Q9G A;  3SY7 A;  2ZLD A;  3VZT X;  3VZU X;  3SZD A;  1GFM A;  3AAE A;  2N2M A;  4F4B A;  5PRN A;  5FVN A;  3VE2 A;  3VY9 X;  1OSM A;  3HW9 A;  4FZN A;  4KR4 A;  3LK2 B;  4FSO A;  5T5F A;  3T0S A;  3QRA A;  4RJX A;  4E1T A;  2W80 C;  3PQU A;  1IZN A;  4D65 A;  3UPG A;  2XE2 A;  3JTY A;  7PRN A;  4XNK A;  2KXP B;  2XTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...