3POQA

Crystal structure of e.coli ompf porin in lipidic cubic phase: space group h32, small unit cell
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OmpF protein
publication title Structure of Escherichia coli OmpF porin from lipidic mesophase.
pubmed doi rcsb
molecule tags Membrane protein
total genus 105
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3poqA00
1HXUA 1PHOA 3T24A 2Y2XA 2ZFGA 1GFOA 3SY7A 3NSGA 1MPFA 1HXXA 1H6S1 1GFMA 2XE2A 3SY9A 4LSHA 4AUIA 2ODJA 6PRNA 3POXA 3PRNA 3SYBA 2Y0LA 4FSPA 4RJXA 4FSOA 4GCPA 3PORA 1GFQA 3O0EA 3HWBA 2PRNA 3SZVA 4RJWA 5DL5A 7PRNA 3POQA 4GCSA 5FVNA 1GFNA 2XE1A 3VY8X 4D64A 5JDPA 2Y0KA 2J4UP 3JTYA 3HW9A 4FMSA 3FYXA 1HXTA 3UPGA 2QTKA 3EMNX 5PRNA 4KR4A 2FGQX 4D5UA 4FT6A 4FRTA 1PRNA 2XE5A 1GFPA 2FGRA 5DL8A 4KR8A 2J1NA 2PORA 8PRNA 2Y0HA 3POUA 2O4VA 4KRAA 3VZTX 4BUMX 4GCQA 1OPFA 4JFBA 2XE3A 5DL7A 3A2SX 3SZDA 2ZLDA 1OSMA 4C69X 3UU2A 3T20A 3WI4A 4LSFA 2K4TA 3T0SA 5DL6A 4D65A 4FRXA 2OMFA 4FOZA 1E54A 4LSEA 4LSIA 1BH3A 3SYSA 2XG6A 1BT9A 3VY9X 3VZUX 3VZWX 3WI5A 3K19A
chains in the Genus database with same CATH superfamily
1HXUA 3GP6A 4CTDA 3NJTA 1PHOA 3T24A 4PJ0O 4AZLA 4N75A 2KZ7A 2W80C 4O3YA 5ADXK 2R4OA 2Y2XA 2ZFGA 4AYNA 4O49A 4XNKA 4PUXA 1GFOA 2YPVA 4C4VA 3AAAA 3SY7A 2R8AA 3AAAB 2XTRA 4FZNA 3LK41 3LK42 3NSGA 5G38A 1MPFA 1HXXA 1H6S1 3DA3A 4IL6O 4O3WA 1GFMA 2XE2A 4N58A 4AKRA 2F1VA 4AKRB 1ZHYA 2F1CX 4UB8O 4K3CA 3SY9A 4E1TA 4LSHA 4AUIA 4F4BA 2ODJA 3BS0A 1QJ8A 3PQSA 6PRNA 3DZMA 3POXA 2R4LA 3PRNA 2JQYA 2N2MA 3SYBA 4PR7A 2Y0LA 4FSPA 2IWWA 4RJXA 4FSOA 4GCPA 3PORA 4RLBA 1GFQA 4Z3TA 3O0EA 5EE2A 3HWBA 2PRNA 5KAIO 4GF4A 4FUVA 3PF1A 2R4PA 3SZVA 4RJWA 2XMXA 3LK2A 5DL5A 3LK2B 2F1TA 4FZMA 4AKMA 2KZ7B 2LFUA 1Q9GA 2R89A 3POQA 7PRNA 4GCSA 4N74A 5FVNA 4AYMC 3A0HO 1G90A 3HOLA 4C4VB 1GFNA 2AXTO 1IZNA 2XE1A 3VY8X 1IZNB 1S5LO 2WJQA 4D64A 5JDPA 3WU2O 2XTQA 3UAQA 2WJRA 2Y0KA 1MM4A 2J4UP 3JTYA 3HW9A 2W81C 4FMSA 4O4UA 3RBHA 2ERVA 3FYXA 1HXTA 1P4TA 3QRCA 3DWOX 5KAFO 1THQA 2R88A 5G26A 3DA4A 3UPGA 2QTKA 1Q9FA 2KC0A 3EMNX 4XNLA 3TZGA 4B61A 5PRNA 1QJ9A 4KR4A 2N2LA 2FGQX 4D5UA 2WVPA 4O3XB 5IYUA 3AA0A 1MM5A 1ZHXA 3AA0B 3DWNA 4FT6A 4FRTA 2YNKA 3C5OA 1PRNA 2XE5A 1GFPA 4RLCA 5GTIO 2K0LA 1T1LA 3BRYA 3G7GA 4E1SA 2FGRA 5DL8A 4KR8A 1QJPA 4C00A 4O3ZA 2GE4A 5B66O 4O4XA 1T16A 2J1NA 2PORA 3KZIO 3QRAA 4JCHA 4K3BA 5D5DA 2IWVA 3JCUO 5AFUL 3VE2A 8PRNA 2R4NA 3HOEA 4AYID 2Y0HA 2MHLA 2O4VA 3POUA 4KRAA 4QQ1A 3VZTX 5E79O 2Y7SA 3VE1A 2KXPA 3AA7A 5ADXL 3AA7B 4BUMX 4G76A 4G75A 1ZHTA 3AAEA 4GCQA 1OPFA 2M07A 2X9KA 3AAEB 2LHFA 1BXWA 4JFBA 3PQUA 2MNHA 2XE3A 4FESA 5DL7A 5H2FO 1ZHWA 3A2SX 3SZDA 2ZLDA 3AA1A 1OSMA 3PGSA 3AA1B 3UU2A 4C69X 3T20A 3WI4A 4FZLA 4FQEA 4LSFA 2K4TA 2JMMA 5DL6A 4U9CA 3BRZA 3T0SA 4D65A 4FRXA 2OMFA 3PGRA 4FOZA 1E54A 3PGUA 4RL9A 4UB6O 2X27X 4LSEA 4LSIA 1ORMA 2M06A 1YS5A 5G39A 1BH3A 3SYSA 2XG6A 4AYDC 1BT9A 3V8UA 4AFKA 5GTHO 4AYEC 3VY9X 5GV0A 3VZUX 3VZWX 2KDYA 3KVDD 3WI5A 2KXPB 5AFUK 5TISO 3LK3A 3LK3B 3AA6A 4GHBA 3K19A 1ZHZA 3AA6B 5B5EO 5T5FA 3A0BO 4N59A 5G3AA
chains in the Genus database with same CATH topology
1HXUA 3GP6A 1PHOA 3T24A 4AZLA 2KZ7A 2W80C 4O3YA 5ADXK 2Y2XA 2ZFGA 4AYNA 4O49A 4XNKA 4PUXA 1GFOA 2YPVA 3AAAA 3SY7A 3AAAB 2XTRA 4FZNA 3LK41 3LK42 3NSGA 1MPFA 1HXXA 1H6S1 3DA3A 4O3WA 4AKRA 1GFMA 2XE2A 4N58A 4AKRB 2F1VA 1ZHYA 3SY9A 4E1TA 4LSHA 4AUIA 4F4BA 2ODJA 3PQSA 1QJ8A 6PRNA 3POXA 3PRNA 2N2MA 3SYBA 2Y0LA 4FSPA 4RJXA 4FSOA 4GCPA 3PORA 4RLBA 1GFQA 4Z3TA 3O0EA 5EE2A 3HWBA 2PRNA 4GF4A 4FUVA 3SZVA 4RJWA 2XMXA 3LK2A 5DL5A 3LK2B 2F1TA 4FZMA 4AKMA 2KZ7B 2LFUA 1Q9GA 7PRNA 3POQA 4GCSA 5FVNA 4AYMC 1G90A 3HOLA 1GFNA 1IZNA 2XE1A 3VY8X 1IZNB 4D64A 5JDPA 2XTQA 3UAQA 2Y0KA 1MM4A 2J4UP 3JTYA 3HW9A 2W81C 4FMSA 4O4UA 3RBHA 2ERVA 3FYXA 1HXTA 1P4TA 3QRCA 1THQA 5G26A 3DA4A 3UPGA 2QTKA 1Q9FA 2KC0A 3EMNX 4XNLA 3TZGA 4B61A 5PRNA 1QJ9A 4KR4A 2N2LA 2FGQX 4D5UA 4O3XB 5IYUA 3AA0A 1MM5A 1ZHXA 3AA0B 4FT6A 4FRTA 2YNKA 3C5OA 1PRNA 2XE5A 1GFPA 4RLCA 2K0LA 3G7GA 4E1SA 2FGRA 5DL8A 4KR8A 1QJPA 4O3ZA 2GE4A 4O4XA 2J1NA 2PORA 5D5DA 5AFUL 3QRAA 4JCHA 3VE2A 8PRNA 3HOEA 4AYID 2Y0HA 2MHLA 2O4VA 3POUA 4KRAA 4QQ1A 3VZTX 2Y7SA 3VE1A 2KXPA 3AA7A 5ADXL 3AA7B 4BUMX 4G76A 4G75A 1ZHTA 3AAEA 4GCQA 1OPFA 2M07A 3AAEB 2LHFA 1BXWA 4JFBA 3PQUA 2XE3A 2MNHA 4FESA 5DL7A 1ZHWA 3A2SX 3SZDA 2ZLDA 3AA1A 1OSMA 4C69X 3AA1B 3UU2A 3T20A 3WI4A 4FZLA 4LSFA 2K4TA 2JMMA 5DL6A 4U9CA 3T0SA 4D65A 4FRXA 2OMFA 4FOZA 1E54A 4RL9A 2X27X 4LSEA 4LSIA 1ORMA 2M06A 1YS5A 4AYDC 1BH3A 3SYSA 2XG6A 1BT9A 3V8UA 4AFKA 4AYEC 3VY9X 5GV0A 3VZUX 3VZWX 2KDYA 3KVDD 3WI5A 2KXPB 5AFUK 3LK3A 3LK3B 3AA6A 4GHBA 3K19A 1ZHZA 3AA6B 5T5FA 4N59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HXU A;  1PHO A;  3T24 A;  2Y2X A;  2ZFG A;  1GFO A;  3SY7 A;  3NSG A;  1MPF A;  1HXX A;  1H6S 1;  1GFM A;  2XE2 A;  3SY9 A;  4LSH A;  4AUI A;  2ODJ A;  6PRN A;  3POX A;  3PRN A;  3SYB A;  2Y0L A;  4FSP A;  4RJX A;  4FSO A;  4GCP A;  3POR A;  1GFQ A;  3O0E A;  3HWB A;  2PRN A;  3SZV A;  4RJW A;  5DL5 A;  7PRN A;  3POQ A;  4GCS A;  5FVN A;  1GFN A;  2XE1 A;  3VY8 X;  4D64 A;  5JDP A;  2Y0K A;  2J4U P;  3JTY A;  3HW9 A;  4FMS A;  3FYX A;  1HXT A;  3UPG A;  2QTK A;  3EMN X;  5PRN A;  4KR4 A;  2FGQ X;  4D5U A;  4FT6 A;  4FRT A;  1PRN A;  2XE5 A;  1GFP A;  2FGR A;  5DL8 A;  4KR8 A;  2J1N A;  2POR A;  8PRN A;  2Y0H A;  3POU A;  2O4V A;  4KRA A;  3VZT X;  4BUM X;  4GCQ A;  1OPF A;  4JFB A;  2XE3 A;  5DL7 A;  3A2S X;  3SZD A;  2ZLD A;  1OSM A;  4C69 X;  3UU2 A;  3T20 A;  3WI4 A;  4LSF A;  2K4T A;  3T0S A;  5DL6 A;  4D65 A;  4FRX A;  2OMF A;  4FOZ A;  1E54 A;  4LSE A;  4LSI A;  1BH3 A;  3SYS A;  2XG6 A;  1BT9 A;  3VY9 X;  3VZU X;  3VZW X;  3WI5 A;  3K19 A; 
#chains in the Genus database with same CATH topology
 1HXU A;  3GP6 A;  4CTD A;  3NJT A;  1PHO A;  3T24 A;  4PJ0 O;  4AZL A;  4N75 A;  2KZ7 A;  2W80 C;  4O3Y A;  5ADX K;  2R4O A;  2Y2X A;  2ZFG A;  4AYN A;  4O49 A;  4XNK A;  4PUX A;  1GFO A;  2YPV A;  4C4V A;  3AAA A;  3SY7 A;  2R8A A;  3AAA B;  2XTR A;  4FZN A;  3LK4 1;  3LK4 2;  3NSG A;  5G38 A;  1MPF A;  1HXX A;  1H6S 1;  3DA3 A;  4IL6 O;  4O3W A;  1GFM A;  2XE2 A;  4N58 A;  4AKR A;  2F1V A;  4AKR B;  1ZHY A;  2F1C X;  4UB8 O;  4K3C A;  3SY9 A;  4E1T A;  4LSH A;  4AUI A;  4F4B A;  2ODJ A;  3BS0 A;  1QJ8 A;  3PQS A;  6PRN A;  3DZM A;  3POX A;  2R4L A;  3PRN A;  2JQY A;  2N2M A;  3SYB A;  4PR7 A;  2Y0L A;  4FSP A;  2IWW A;  4RJX A;  4FSO A;  4GCP A;  3POR A;  4RLB A;  1GFQ A;  4Z3T A;  3O0E A;  5EE2 A;  3HWB A;  2PRN A;  5KAI O;  4GF4 A;  4FUV A;  3PF1 A;  2R4P A;  3SZV A;  4RJW A;  2XMX A;  3LK2 A;  5DL5 A;  3LK2 B;  2F1T A;  4FZM A;  4AKM A;  2KZ7 B;  2LFU A;  1Q9G A;  2R89 A;  3POQ A;  7PRN A;  4GCS A;  4N74 A;  5FVN A;  4AYM C;  3A0H O;  1G90 A;  3HOL A;  4C4V B;  1GFN A;  2AXT O;  1IZN A;  2XE1 A;  3VY8 X;  1IZN B;  1S5L O;  2WJQ A;  4D64 A;  5JDP A;  3WU2 O;  2XTQ A;  3UAQ A;  2WJR A;  2Y0K A;  1MM4 A;  2J4U P;  3JTY A;  3HW9 A;  2W81 C;  4FMS A;  4O4U A;  3RBH A;  2ERV A;  3FYX A;  1HXT A;  1P4T A;  3QRC A;  3DWO X;  5KAF O;  1THQ A;  2R88 A;  5G26 A;  3DA4 A;  3UPG A;  2QTK A;  1Q9F A;  2KC0 A;  3EMN X;  4XNL A;  3TZG A;  4B61 A;  5PRN A;  1QJ9 A;  4KR4 A;  2N2L A;  2FGQ X;  4D5U A;  2WVP A;  4O3X B;  5IYU A;  3AA0 A;  1MM5 A;  1ZHX A;  3AA0 B;  3DWN A;  4FT6 A;  4FRT A;  2YNK A;  3C5O A;  1PRN A;  2XE5 A;  1GFP A;  4RLC A;  5GTI O;  2K0L A;  1T1L A;  3BRY A;  3G7G A;  4E1S A;  2FGR A;  5DL8 A;  4KR8 A;  1QJP A;  4C00 A;  4O3Z A;  2GE4 A;  5B66 O;  4O4X A;  1T16 A;  2J1N A;  2POR A;  3KZI O;  3QRA A;  4JCH A;  4K3B A;  5D5D A;  2IWV A;  3JCU O;  5AFU L;  3VE2 A;  8PRN A;  2R4N A;  3HOE A;  4AYI D;  2Y0H A;  2MHL A;  2O4V A;  3POU A;  4KRA A;  4QQ1 A;  3VZT X;  5E79 O;  2Y7S A;  3VE1 A;  2KXP A;  3AA7 A;  5ADX L;  3AA7 B;  4BUM X;  4G76 A;  4G75 A;  1ZHT A;  3AAE A;  4GCQ A;  1OPF A;  2M07 A;  2X9K A;  3AAE B;  2LHF A;  1BXW A;  4JFB A;  3PQU A;  2MNH A;  2XE3 A;  4FES A;  5DL7 A;  5H2F O;  1ZHW A;  3A2S X;  3SZD A;  2ZLD A;  3AA1 A;  1OSM A;  3PGS A;  3AA1 B;  3UU2 A;  4C69 X;  3T20 A;  3WI4 A;  4FZL A;  4FQE A;  4LSF A;  2K4T A;  2JMM A;  5DL6 A;  4U9C A;  3BRZ A;  3T0S A;  4D65 A;  4FRX A;  2OMF A;  3PGR A;  4FOZ A;  1E54 A;  3PGU A;  4RL9 A;  4UB6 O;  2X27 X;  4LSE A;  4LSI A;  1ORM A;  2M06 A;  1YS5 A;  5G39 A;  1BH3 A;  3SYS A;  2XG6 A;  4AYD C;  1BT9 A;  3V8U A;  4AFK A;  5GTH O;  4AYE C;  3VY9 X;  5GV0 A;  3VZU X;  3VZW X;  2KDY A;  3KVD D;  3WI5 A;  2KXP B;  5AFU K;  5TIS O;  3LK3 A;  3LK3 B;  3AA6 A;  4GHB A;  3K19 A;  1ZHZ A;  3AA6 B;  5B5E O;  5T5F A;  3A0B O;  4N59 A;  5G3A A; 
#chains in the Genus database with same CATH homology
 1HXU A;  3GP6 A;  1PHO A;  3T24 A;  4AZL A;  2KZ7 A;  2W80 C;  4O3Y A;  5ADX K;  2Y2X A;  2ZFG A;  4AYN A;  4O49 A;  4XNK A;  4PUX A;  1GFO A;  2YPV A;  3AAA A;  3SY7 A;  3AAA B;  2XTR A;  4FZN A;  3LK4 1;  3LK4 2;  3NSG A;  1MPF A;  1HXX A;  1H6S 1;  3DA3 A;  4O3W A;  4AKR A;  1GFM A;  2XE2 A;  4N58 A;  4AKR B;  2F1V A;  1ZHY A;  3SY9 A;  4E1T A;  4LSH A;  4AUI A;  4F4B A;  2ODJ A;  3PQS A;  1QJ8 A;  6PRN A;  3POX A;  3PRN A;  2N2M A;  3SYB A;  2Y0L A;  4FSP A;  4RJX A;  4FSO A;  4GCP A;  3POR A;  4RLB A;  1GFQ A;  4Z3T A;  3O0E A;  5EE2 A;  3HWB A;  2PRN A;  4GF4 A;  4FUV A;  3SZV A;  4RJW A;  2XMX A;  3LK2 A;  5DL5 A;  3LK2 B;  2F1T A;  4FZM A;  4AKM A;  2KZ7 B;  2LFU A;  1Q9G A;  7PRN A;  3POQ A;  4GCS A;  5FVN A;  4AYM C;  1G90 A;  3HOL A;  1GFN A;  1IZN A;  2XE1 A;  3VY8 X;  1IZN B;  4D64 A;  5JDP A;  2XTQ A;  3UAQ A;  2Y0K A;  1MM4 A;  2J4U P;  3JTY A;  3HW9 A;  2W81 C;  4FMS A;  4O4U A;  3RBH A;  2ERV A;  3FYX A;  1HXT A;  1P4T A;  3QRC A;  1THQ A;  5G26 A;  3DA4 A;  3UPG A;  2QTK A;  1Q9F A;  2KC0 A;  3EMN X;  4XNL A;  3TZG A;  4B61 A;  5PRN A;  1QJ9 A;  4KR4 A;  2N2L A;  2FGQ X;  4D5U A;  4O3X B;  5IYU A;  3AA0 A;  1MM5 A;  1ZHX A;  3AA0 B;  4FT6 A;  4FRT A;  2YNK A;  3C5O A;  1PRN A;  2XE5 A;  1GFP A;  4RLC A;  2K0L A;  3G7G A;  4E1S A;  2FGR A;  5DL8 A;  4KR8 A;  1QJP A;  4O3Z A;  2GE4 A;  4O4X A;  2J1N A;  2POR A;  5D5D A;  5AFU L;  3QRA A;  4JCH A;  3VE2 A;  8PRN A;  3HOE A;  4AYI D;  2Y0H A;  2MHL A;  2O4V A;  3POU A;  4KRA A;  4QQ1 A;  3VZT X;  2Y7S A;  3VE1 A;  2KXP A;  3AA7 A;  5ADX L;  3AA7 B;  4BUM X;  4G76 A;  4G75 A;  1ZHT A;  3AAE A;  4GCQ A;  1OPF A;  2M07 A;  3AAE B;  2LHF A;  1BXW A;  4JFB A;  3PQU A;  2XE3 A;  2MNH A;  4FES A;  5DL7 A;  1ZHW A;  3A2S X;  3SZD A;  2ZLD A;  3AA1 A;  1OSM A;  4C69 X;  3AA1 B;  3UU2 A;  3T20 A;  3WI4 A;  4FZL A;  4LSF A;  2K4T A;  2JMM A;  5DL6 A;  4U9C A;  3T0S A;  4D65 A;  4FRX A;  2OMF A;  4FOZ A;  1E54 A;  4RL9 A;  2X27 X;  4LSE A;  4LSI A;  1ORM A;  2M06 A;  1YS5 A;  4AYD C;  1BH3 A;  3SYS A;  2XG6 A;  1BT9 A;  3V8U A;  4AFK A;  4AYE C;  3VY9 X;  5GV0 A;  3VZU X;  3VZW X;  2KDY A;  3KVD D;  3WI5 A;  2KXP B;  5AFU K;  3LK3 A;  3LK3 B;  3AA6 A;  4GHB A;  3K19 A;  1ZHZ A;  3AA6 B;  5T5F A;  4N59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...