3KVDD

Crystal structure of the neisseria meningitidis factor h binding protein, fhbp (gna1870) at 2.0 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
242
structure length
242
Chain Sequence
b'AGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein
publication title Structure of the uncomplexed Neisseria meningitidis factor H-binding protein fHbp (rLP2086).
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Protein binding
total genus 60
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 3kvdD02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3kvdD01
2W80C 2W81C 4O3WA 2Y7SA 2YPVA 3PQSA 4O4UA 3KVDD 4AYMC 5T5FA 4AYNA 1YS5A 2KC0A 4O4XA 5EE2A 4O3ZA 2LFUA 4AYID 4AYEC 4O3XB 4AYDC 3V8UA 3PQUA 3HOLA 4QQ1A 3VE1A 2KDYA 3VE2A 3UAQA 4U9CA 4Z3TA 3HOEA 4O3YA 4O49A
chains in the Genus database with same CATH superfamily
3K2UL 4L8SA 4S0SD 3HIZA 2NRDA 3U2SB 4J27A 1F3JB 5C0ND 3U0WH 2Y0HA 3HBGA 3GRWL 1D6VH 1RI8A 2H2PC 1LMIA 1H3XA 4PG9B 4HS6A 1KPVA 4JM2A 4HWZA 1CDYA 2FGQX 4FA7B 3SDCB 1THCA 2E59A 2X28A 4X4KA 4XCNA 2XUWA 4XZUA 2X27X 2DEXX 1KF9B 2CM6A 3MV8D 1KTLA 4PH8A 3QZWG 2W60A 2PPDA 5E5UB 2HWZL 3T0EB 4M7JL 4R84A 3RTQD 3LZLA 3EHBB 4UM9A 5DFAA 3KLHC 2PWGA 3GP6A 3V4VL 4XXDA 3OF6D 5DK2A 1CDIA 4BFFA 2BP8B 3DTUB 2BP0B 2D7PA 2EDRA 2EICA 1XZ0A 2R88A 2N7AA 1UD2A 3APDA 3P30L 4YFLI 5DD0H 3ZQXA 4AE0A 5DUML 1HXXA 1N2RA 2WCGA 3A5VA 4L3EA 1I31A 1SYSA 4NNPH 4YBQC 2A6JB 3CFCL 4ETYA 2CDEB 4QQ1A 3RJOA 4X0KA 1VCAA 2A3TA 3RB7A 4F7PA 2K7PA 1KB5L 3S0PA 1IFGA 3WNPA 1JJUA 3KZIO 4KK6C 3VD5A 4GG6E 4X4ME 2HSIA 5IB1A 1QSFE 3RY4A 1WV7T 3V7AE 1MCWW 5BUAA 1ZLDA 5HGHA 5C70A 4QO1A 1VFUA 4AKRA 1IKNC 2Z91B 3KBEA 3NG5A 1N3NA 3BQUD 1W8NA 2R2EB 4ZO8A 4Q2ZB 3OGCA 3JV5A 2WMPA 4ELMF 5J11B 2C8NA 1QKZL 3BISA 2BNQE 5DHVH 3KPRD 2ZX7A 1Q72L 3LSOA 2HAZA 2FQEA 1QHOA 4WUUB 1EHKB 2ICES 2VE6B 5TK4A 4M56A 1Z32X 1GFOA 3GXNA 3IFPB 1CFVL 1ZS8A 1P7KA 4EKJA 1ZPLA 4IIQA 3S96B 5F6IB 2DQIL 2ZXGA 3L1OL 2PTVA 3ATBA 3IMVA 3SKJH 5IKCA 4MA8L 3WFBL 1QMUA 3VI3F 3GLZA 5I0DA 2BHUA 4G6JL 3REVB 5J89A 3PDOB 1OGAD 4XX1G 3TBWA 1MLBB 3L7EA 3ZDYF 3UC2A 4XBMA 2W0LA 2PYEB 3DLQR 1CDUA 4ELMA 3OXSB 4JY4B 2APBA 3QK0A 1UH3A 2WJ5A 1FCCA 4JFUA 2V5TA 5C09D 1B6DA 3WO4C 5TDNA 3V8CA 3QUXD 2GJ6B 1FO0L 2YPLB 4G8GE 1TFPA 2EDWA 3FTWA 3EYFA 3IFNL 3KPPB 2HLFC 4OZFG 3GBLA 4KROC 3UGUA 3IDNA 4R26H 5AW4B 2JCCF 5HYJE 1U8LA 2Y0LA 3Q2LA 2A9CA 3FUMA 2D73A 3BVXA 1CF1A 3EFFB 2NSMA 3EYVB 2OZ4A 3GM8A 1FG9C 5AVUB 3HCVA 1MCWM 4I77L 3IFLH 4P3CL 1MWAL 2AQNA 2CALA 1BXVA 3OLGA 2P80D 3PL6D 5IFJA 4NQCB 4X4YB 3BRZA 5JNYA 1N4XL 1QAWA 1CD1B 4Y8AA 1IAII 4DEPC 3FUFA 4E41A 5B1JC 1JERA 1A7RH 1HVXA 5DJ0A 2EVJA 3EBAA 2IG2H 3CHXA 2Q0ZX 3SD2A 1DJIA 1C12A 1HILA 1PZ2A 2NXZC 3N5AA 3QIBC 4NM8L 4R4NC 3S35H 4NGHL 4N8CH 5EBMA 5MEQA 3CHPA 1AQ8A 4U1NA 3GSXB 3QJVB 3PGDA 4JPIB 2JCCA 5E9NA 1YEGL 3O2VH 3I50H 1X9LA 3H9ZA 3C5ZD 3OAYK 4YDZA 3FNKA 4GRLA 2XIBA 1RLWA 5F3BB 3O6LL 4RGMC 4HPHA 1KEML 2P5WD 5JW4R 4M7LL 3L9YA 4JZJA 3TVMC 2CK0L 4MDRA 5ANHA 2FQFA 1LEKA 1KXQE 1QYGH 3POCA 1EHLL 1BJ1J 3N42F 1DBJH 1CYWA 4Q0XH 1IT9L 3GJEA 4PJ8A 1JNNL 3O4LB 1F42A 1MCCA 1U0QA 1UCBH 3DDGA 4JGNA 3NFPB 2Z31D 1DQQB 1KXTB 2DQTL 3FZUC 4JJ5B 1HXYA 4WTXA 2Y2TA 1DDHA 1YN6A 2G75B 2DS4A 1L9PA 4N90D 1N0XH 1JD7A 1X5XA 1WTLA 4BDVB 4G76A 1UVQA 4JFFB 3ZR6A 4ZAKB 3QB7C 4C83A 1M6OB 2QADB 2OMBA 3ULUH 4XPHH 1MRFL 4V1DB 2CUAA 3QQDA 4TLTA 3ARYA 4A7TA 1V3JA 2OMUA 1QHQA 1E4XI 3PREA 4ODHH 5FIEA 4GRMA 4DF9A 1ZEAH 1VEMA 2H6PB 4QNPE 1LK3L 4M3JA 2CDGA 5F0MB 3BZ4A 2XN0A 4GSQA 4GPVA 3ULVF 5IBUG 1YAIA 5DYOA 5DRNA 3PQYA 4U1JA 3NJGA 4WU5B 3TT1H 2N2MA 3QUZB 4C4VB 3FH7A 2APTA 2K70A 3SDCC 2ZYHA 3NYKA 2PYFB 1MJJA 3KVPA 3TNMB 3WN6A 4KDVA 5FUZH 1Q38A 1EJOL 1W8EA 2AANA 2VNCA 3ILEA 4ONHA 4F57H 1FN4A 2V3DA 3Q2CA 3MRMA 4FYQA 3WDIA 5ABDE 3G7TA 4AXWB 4WENB 3T0EC 1YJDH 2WY3B 2Z34A 4K5OA 3L3JA 5SX5K 1SHWA 2AJSH 4IRJB 2I26N 1NBQA 3AXHA 4KK5C 1JGVL 3D18A 4G6ML 1CF8H 2FK9A 1TJGH 3QUYC 3BCFA 5L4JA 1XMEB 5FEBA 2YMXL 43CAA 5GHWL 1T16A 2K6ZA 3MKKA 4NENA 1X7TA 4AQEA 1YQVH 2B5IC 5HDOA 2DWDA 4AGPA 3UTQA 5I76A 1JPTL 4G9FD 1JS4A 4UB0H 3TYGL 2IAMD 5JW3H 4MX7B 4NXSA 3LZNA 3ET9F 4F9PC 2R69H 4BUQA 1XF1A 2WVPA 4KJPD 4OCSL 1JGUL 1KJ3H 1E5AA 1OLZA 4FG4A 1JHTB 4BXSV 5E4AA 5LBGA 1ZHNA 4FFZA 4FYSA 3MRBA 1EHAA 1G9MH 2FR4A 3LV3A 3QBTB 3Q2NA 1K85A 4Y1AA 1O9ZA 3DTXB 3VQLA 4B9FA 5D6CA 1X5YA 4LLQB 4H0IA 1XGTA 2F19H 1SN0A 1DJSA 3UAJA 4AYSA 3LKNB 2GIYA 1NMBL 1U2HA 3C08H 4HUWB 5EIIG 4HS8H 5F6IC 5LQBL 3BESR 1KULA 1M2OA 5JA8B 4P5TD 2OV0A 1RJZB 3ESPA 5FCSH 1J8HB 3WJJC 3HFFA 5CU9A 1ZHBA 1IAIM 1LO0H 3L3OB 2VDNL 3VXNA 1Y0LB 3CFQA 3MLTA 4UIKH 3VWJA 3GKZA 3V55A 4HLZG 1E7VA 1MVUA 3G6JF 4FL4C 4XN4A 3IRCA 5I6XB 4B3EA 2VSKB 2R4SH 3GPSA 4JQXC 3MLRL 1NWPA 1U93B 2ZOUA 2WWMD 2ZWSA 4LOUD 4M7LT 4B9PA 4WI3A 5T1KD 1JK9B 1NFDB 4KO5A 2H8PA 3MCG1 1SFDA 1OB0A 1AYRA 1RZGB 3VVVA 5B38B 4GMTH 1G9NC 2GJRA 4XBGA 4TUJB 1QSFD 4K7PL 3MX0B 5F7DB 2IH1B 2F1VA 2KLRA 2VT0A 3OPUA 4LVNB 3A4AA 5GS0L 4X6DE 4CKVX 3V0WL 5F8QC 3LK3A 1NSNL 2C9RA 1MY5A 4GP5B 2BNQD 3QJXA 4IBQA 2FHBA 3G6JA 5CAYB 4WV1A 4C4UA 3WMSA 4HCRH 1PY4A 3HFML 1IGFH 4HOXA 3KS0H 2LHFA 4JY6B 5BOZG 2DM7A 1R3LB 5KN5A 2R0KL 4P8QA 4JRXA 3PXLA 1DEEA 1T4KB 2R0WH 1HS6A 4LFHD 3U48A 4PRHE 5ACZA 5LXGL 3V0GA 2GI7A 4WO0A 1KLGA 3PV7A 4HF5H 1FFOB 3RAJH 4MVBD 4X9YA 4DP7X 2EH8H 4U6HA 3EJQA 3SZVA 2BIPA 4EN3B 5JQHC 1DE4B 2HRLA 4XAKE 3VGAB 1IBDA 2GG1A 4UOW0 5EUKB 1XF3B 5D7LA 1I1RA 5GZOD 4RFOL 4IBUA 3BSGA 1C5BH 4G8EB 4UCFA 5B7FA 2X2YA 1NANI 5DEFB 3PWNA 1K2DA 2B2XL 1M7IA 3QCVL 3Q8CA 1WWWX 4ANXA 2I5YH 1FL3B 4ZODA 3UBHA 1MCJA 5IEKB 2E47A 3I02A 4JMNA 5HYJD 4G42B 4UDTB 1MDTA 2AK4A 4AUIA 4XWGH 4JO1L 4XMTA 1RFDH 3T24A 2E86A 5T5FH 2VXSL 4DPBX 4NRZB 3BUBA 1R33A 5LAXA 1SJEB 4ZAKC 4UANA 1R3JB 3F64A 1ZT1A 3FO0L 4NO5B 1CVRA 2H3KA 2QADC 2QGDA 4FN0A 3FO2B 2ZKYA 4M48L 1UXWB 1W6WA 1E4KA 3GHBH 4GKSB 1Z2KA 4K9JA 1L0YA 3O45B 1ID5I 1GFPA 2NW2A 3TASA 1PL3A 2W59A 3I84A 4L9DA 1LO3H 3BPCA 3MMEA 3WL9A 1CBJA 4AQAA 3VFUB 4OCRL 4UOJA 4YNYB 5TGBA 4ZNEE 2H0JA 5HI3C 3BN9C 4HWBL 5A2AA 3QZBA 4EDWH 3QUZC 2GHWB 1JTPA 5HHQB 2GFBB 2AEOA 4LAQH 2WZ6A 3HMWL 3M88A 1A5FH 1A7BA 2M06A 1SBSH 1Y6NR 3Q6GH 3VXUB 4YK4C 4GCSA 1SVBA 3P0GB 2ERJB 2P5PA 2F54E 3TM6A 2V5MA 4HD5A 4X5PA 3PWJA 3R06B 3TT3H 1L7TH 1R3KB 4AJWA 3FSWA 1GGBH 1LO2L 1QPPA 3ETBJ 4IRJC 3HAEA 4OZIB 1ZTXE 4HUCA 4R97C 3T8VA 4GBXC 1SDDA 3WEAA 5IBUB 4QMEA 3OGOE 4OFIA 1BQLL 5GGSB 5IJBC 1IEBA 5K9OB 4LGSB 1KYOJ 3K91A 2X5PA 1UTDA 1T2QL 1OARH 2WD0A 3OKNB 4H26A 3CZJA 1A47A 1FH5L 2ZKXA 5KAQF 4DGVH 1DVFA 3NACH 1ZLWH 5JZ7D 4YZWA 2MH4A 4QY8B 1N59B 5I6LA 1NCDL 1S7XB 4N86A 5KVGL 2IPUG 3B7TA 5D5ME 5IROD 3Q48A 4PW9A 1OCWH 4KHXL 1BMGA 4WI9A 1KCRL 2G5RA 2I9LA 4G59C 4PJGE 1YPZE 3T2NH 1GKOA 4YXLH 4IEFB 1EEYA 4LKXB 5ID0B 4P2QB 4JZNA 2XZQL 6PCYA 5C2BL 5TF1L 4AUJA 4R7NB 4FFYL 1J5OH 2B1HL 4L9LB 2F1BA 2CHXA 2J1WA 3EH1A 3EH2A 3GJFA 4KJYA 4WTWA 3E8UH 4XMLH 4LCYB 3B9KB 5IG7B 3DPDA 5J13C 3FT9A 1T7VA 3VZTX 1KYFA 1HJCA 3S6CA 2VL5A 3G6DL 5L6YL 4Z1PA 1CFNA 3CBRA 2VLME 3GMLA 4ORZC 1N5AA 5DD5L 3LXUX 2ENJA 2GEEA 4AE1A 2X70B 3RKDD 3A3YB 5T1DH 1AD9B 3K2IA 5BPPA 2WSDA 5I8EA 3ZDZF 2UV3A 2HH0H 4PRAA 4B9JA 2OMZA 5DVOA 2TAAA 3UG4A 3ARFC 1UT9A 2IPTL 3DHJA 3DVIA 2FBOJ 3TCTA 4H88L 4WKXA 1IILE 1XIWA 1K3IA 3VCLB 2YQGA 4G5ZL 3JV4B 5CBEB 4X5XB 1HSAA 5FS5A 5SV4A 5TE6L 3B83A 3HG1B 5LWYL 3EKCA 5FK9B 1AO7A 4NBYB 5EIIB 4KAQL 2BSSA 2UYLB 4PP2A 3V5DB 5AYUL 3G5VB 4ISVA 2X6MA 5AW8B 4XTRC 2YQ3A 4BIKA 3ZRCC 5DLMH 2CH8A 2VJ8A 4BUMX 4GP4B 4RAHA 2CBOA 3HC0B 4UINH 1UOLA 2OR8A 4RX4A 3IDGA 4Z6AT 4R90L 5FKPA 4GAJH 4NKDB 4BFBD 2WHVA 3PWLA 3OMZA 3CVIL 1U2YA 5BV7H 1ZA3B 3GZOA 1L9TA 4PTTB 4AYEC 4ZZFA 3NJMA 1NCCH 1OGTB 5IB3B 1P6WA 1R3IH 1TQCB 3S5LG 3GSNL 3TTSA 4EQ3A 1OLLA 1XH1A 2H7WA 3D50A 4ODWA 4RZKA 5CJOL 2J88H 1ADQL 1FAIH 4JDEB 3GBNH 4GG8A 4UWQB 3L13A 2Y1VA 4NKMA 4LGRB 4JFEE 2QJDA 2OMVB 2MEJB 4KK9C 3VXSB 4HV8B 1MJ7H 3AJ7A 4Y5XA 1MCRA 3SDDD 1HOEA 1BOGA 4Z95L 4EN3C 3PRNA 1YEEH 4M1DH 5CGYC 3VGAC 2X4QA 2ADGB 1X9QA 1UZGA 3NJLA 4XP9L 1YN7A 3BKJH 5DI8A 1MCNA 1MJUL 5C0AA 2DV6A 1W16A 4ABUA 1GHFL 4Z18A 1A1MB 4F37F 3V52H 5FDWB 3FFOA 1FC2D 1KC5L 1MHHA 1XGPA 1YLBB 2AEWA 4IMKC 5DJ8A 3BE1H 4NUMA 5AOZA 3AU0A 5PCYA 4LSPL 3VW3L 3FTXA 1MIEL 3EOTH 3QNXA 4Z0XA 2VERA 4UQAA 3P4MA 3EUUA 1TZIB 2IQ9H 2W9DH 4P3DA 2CLRB 1C7SA 3RHWF 1AQDA 3LZRA 3RNKB 2Y07L 1T2XA 2W65B 1OD9A 5HY9B 5KVEH 5DYFA 4TVSa 5LNDA 1P6AB 1V27A 1CGSH 2W07A 5JW5A 4NWUL 3H0TB 3F00A 3OKKA 2Z8VC 1KYOK 4FHKA 3BUDA 2ZF9A 3F58L 5EUOE 1CD0A 3V6BR 2F74A 3N41F 3UJTH 5HXMA 4UOZA 3JTSB 2F1AA 2N7SA 4OIBA 3VXMA 3N1QC 5DS2A 1P7QA 4JG0H 4IBLT 4LEXH 2DZEA 3WYRA 3PXHA 5A16A 1PYWB 4ZG1A 2K45A 2CG9X 3O2WH 2WGXA 3F7YB 2SEBA 1BD2A 4XAKD 4MLSA 2FEDC 4IOSA 2D7TH 4JFPB 4CU8A 5CD3A 1FFNA 1L5GB 2ERJC 2V7HA 5DDHB 1SM3L 2B1AH 3GXTA 4OM1L 3HZKA 4ZMQA 2XWJA 4C4BA 5J1AA 4AZUA 4GIAA 2ODHA 3FQ1A 3AAEB 5AL0A 5DQDL 2E9BA 2X6AA 4NI6A 5DJAA 1DHKA 2ZOOA 1R46A 2Y3NA 5GGUA 2NNAA 4QRSB 2XG5A 4FQXB 1ZHLB 4FI8A 4F24A 5CEYB 2EXYC 1KGYE 1FLRH 2V5SA 3AREA 1H0DB 4X6FB 1Q0YH 2A9NH 2APSA 3O4OC 2AJ3A 2A83A 5GS0C 3S37H 5K59F 1SPDA 4QR7A 4OCXL 4DKTA 4DGIL 3IVKA 3RA7H 2OJZL 3DX1A 5I5JA 3LIZA 4IMLA 1WFJA 3NSFA 2AW2A 3P9MA 2X3CA 5C0RL 2OPCA 4N8PA 2GE4A 2E56A 2IDUA 2VM3A 3KLDA 1J18A 1KSRA 2Q7NA 4LCIL 1VZGA 1I75A 1VA9A 5TE4H 2J21A 4N0UA 3S36H 1U8JA 3IM1A 1UD6A 2W38A 4NO3A 4PSPA 1TU2A 2D31B 3B9KC 4ZOCA 1F3DH 1G5GA 4LIQL 4RFNB 5HHXH 4K71B 4AIEA 1I9JH 5IQMA 2F54D 4CN1A 5TE7L 3OWRA 2APVA 2Z3FA 4QHMB 5IQ7L 5E2VH 2ZUTA 2WXFA 4K9EH 4OAWA 3KWUA 4TOYH 3MLZL 4GW1A 3VU1A 1R24B 1WAAA 2VXTH 3RPBA 2AV1B 2FQGA 1QEWA 3RNQB 4I89A 4UU9B 4LSUL 3LEXB 4NKIL 2F8OA 4AZ8B 4PR5A 3MV8B 1A6TB 3FCTB 5DRZB 4K3EH 2VMFA 5I71B 1N26A 3P2DA 5BRZE 1QZNA 1CIUA 3MLYH 5IT2L 2MQCA 3RY6A 9PCYA 4YHNB 2WOYA 2C9QA 2HTKC 4AG4H 4LDCA 1CFQB 3WNLA 2PCXA 1G5AA 4DQOH 4JRYB 1ODAA 1H6UA 3N1FC 4D0BB 1A7QH 1NCAH 2EDNA 1VACB 1PS3A 1MFEH 4H1LH 3WEXB 3QJQB 3U7AA 1TJHH 3O6MH 3P73A 3FAWA 4IHOB 1H3VA 4ZSOA 5HVGB 2PRNA 1BIIB 1L3WA 2DWEA 3L5JA 3BSHA 5CD5C 1KTCA 4ZFZA 2EDMA 4XOBA 1I8MB 3L5WB 2ZXWB 5FOJA 1A9EB 1QLEL 1CGWA 1X4YA 3JBG7 2GJZA 4HJEA 5BZWA 4PJ9A 4APQD 3U1SL 2BVOB 3MHZA 5ENWA 2EABA 5IB2A 2JTYA 3GO1H 2P5EA 4LRIA 4P59H 4N1HB 3HUJA 3VRLF 2C3HA 1TQCC 2VLMD 5ADOH 2YBRB 3KBPA 5CJQH 1WFOA 2VXQA 3BQUB 4HKBA 1YNTF 1ES0A 4O2EA 3QRGL 4F9LA 4K73A 4HULB 3F2LA 4TN9A 1IUZA 2CAKA 3BC9A 3MNMA 2WO2B 1MCLA 2CRYA 1A7PL 1OAUH 2L0DA 3HR5B 1RCYA 1WZKA 1G7IA 2NY5L 3SPCA 4KI5F 1EMTL 5H37A 1I8AA 4MAUH 1Z9LA 3TU6A 3M1BB 1YMHB 1KB9K 3AWFA 4L3EE 3BAXA 4JB9H 2VW6A 3MR9A 4ES8A 4L18A 4WUKL 1EV2E 3HMXH 3ZT5A 2F68X 2OCFD 4GW5B 3NIDB 3T77B 3FO9A 4I4WA 2WWKT 4LL9A 4AFKA 3UDWA 2R0ZH 2EIEA 3S5LB 5HJ3A 2PTUA 2HPTA 8CGTA 3N9GL 4UUJB 5AD0B 3ZJAA 2FX7H 4L8CB 1FZJA 3AAAB 1YNTA 1ZV2A 3DECA 3GBML 2QTEA 5AZEH 1AKJB 5SWZB 3LEVH 3MACH 1P7BA 3IDUA 4KXCA 4U1MB 3TH4T 1T83A 2BNUA 3QUXB 4YH6A 3LZFL 1WG3A 4ADJA 2I07B 5LJYH 4RMSA 2FYYA 4QT5B 3BXNB 2Y1YA 1NUNB 3FYIB 3H6AA 5GGVL 5K9QG 2X4TB 3NEOA 5I1IL 3UYRH 3ES6A 3DVGB 1AOZA 1FYHB 1F11B 1CLYL 1P1VA 1UURA 2YAOA 2XTJC 3GZKA 2NUTA 1DQJB 5DC2A 2FJHB 2PPEA 2YK1L 2AJYH 2Y5TA 2PW1B 4M02A 4NUGH 2ICWJ 3BVNA 4JFED 4JVPA 2ZXDA 4MRCA 3QRFM 1T3FA 3BDXA 5EU5B 2DQCL 5FYJE 3KR3H 2L7EA 4BZ2A 2ZX6A 4DGYL 1PLCA 3K4DA 1G9EA 3WLBB 4RGOL 1PMYA 5GRUH 4LSFA 2WUCH 1YMMB 4ELME 3JWDH 4PS3A 2R2CA 1RUKH 3A0HO 3MCLH 3MLUH 5CZRA 4ESKA 3DZMA 3X13B 2K9UA 5BW7C 2ATPA 2YAMA 3L4TA 3MA9L 1CTNA 3GSQA 2HKFH 1VEPA 3F83A 2P5WB 4J3OF 5C6WH 1P84J 2IBZX 3FCSB 4NZRH 3QWOB 2ROYA 3QDHA 4FQXC 3OJ2C 2Q3ZA 4JJHA 5EMYA 3EZ8A 5D1ZD 3MV11 2F2HA 2YSSA 1ZVNA 5B3NA 1MQKL 3QR2A 3CMOL 2Z31B 3L95B 1U92B 2IALA 3DV4A 1GZHA 3V4PH 2V8LA 4JGMA 3ZDYE 5GGTH 3BWUC 5AOIA 4X99B 1IMHC 5BO1L 4E41E 1U8OA 3JWNH 3S5ZA 4DIXA 4LEOA 2WXNA 1WZ1H 1DQKA 2WLNA 2XG4A 4FNUA 1DLHA 4ALAH 4BGLA 3SKNA 2KC0A 4GSDL 4OF5A 4U6YA 3TFBA 3IGAA 4NOBA 3MV9B 4RRPA 5I8CB 1KIPA 2JCCE 4NP4H 5IHBA 4QXVA 3KGUA 3L5XL 1UZ8B 2ZG1A 2CK2A 1JZ4A 3RVUD 3ELAT 3BP5A 4RFNC 4FQQB 2MCG1 5C0NC 1I7RB 4K71C 1GGTA 1KFAH 3LNEA 5AVXB 3DX9B 2GSIB 1A1OA 2ARWA 1MFAL 5CN3A 2OCCB 1Q1JH 4D5UA 2E6PA 5LDSA 1JL8A 4G6FD 4XP1H 3VTMA 2WB7A 5AFAA 1YO4A 3MLPA 3ZL4L 1BZ9B 1A22B 2ID5A 3TJPA 2ENPA 2DD8H 3AG1B 4MA3A 3FQNB 5GISL 2J8HA 1K6QH 1BXXA 1WD8A 4QUOA 5J6HA 4LPTA 1CBVH 5EB9A 3RTQC 5K39A 4PJDA 5F8RC 5C0BA 5ID1A 3RFZC 1VEOA 4Z76A 3V4UL 3RGVB 2QHLA 3C8DA 3UADA 1VPOH 3LKPA 2AABH 3N50A 4HZLB 5EEWA 2C1OA 3VDBA 4I1NB 5KW9H 4HGWA 4U49A 4JKLA 4J6RL 2Z35B 5ESQB 5FF6B 4P4RA 3KD4A 2HVKA 1EFXA 3B56A 1W0VA 2AXGA 4G9FB 5FYLH 1MFVA 3IJ7A 2I60L 3HW7A 1X7QA 2JKXA 5KSUA 1J86A 1AACA 2OR9L 3PQYE 5GS1C 2NY6D 4PWEA 3OHXB 4YHOH 1WEJH 5E8NB 4CJ1A 3QRCA 2DRUA 3CN2A 4G3YH 5JW4M 3L6FB 5DMJB 1DJXA 2EIJB 5ADPL 5D1QA 4WK2B 2V9UA 3NZ8A 4HH8A 2XPYA 1JZ3A 2BRRL 3LKQB 1XGUB 3BQUC 4YDKL 3SJVA 4P23D 4MD5B 5JHLH 3TO2B 4R6UA 2VQUA 1HEHC 5F9DC 3L3HA 4IU3B 2P9RA 3HC4L 4P9MH 5ITFB 3SGKA 4MZ3A 3ARGD 3GIZL 3RI5F 1B4LA 2CBQA 4NCC1 4PJXB 4U6TA 3GJFH 4DP4X 4Z7WF 5K9KB 1DUYB 2DQGH 2PR4H 5BRZD 1KCBA 4YHLL 3QIUA 3OX8A 4K94H 4F8NA 2XNAA 2Y7LA 3L4UA 1VZIA 2EACA 2OMTA 1YECH 1F6AA 2IPUK 3SGJC 4PB9L 2EUXA 3A21A 1D7CA 3AROA 2Z8WC 1ECZA 3OAUH 3R1GH 5E94B 4OIIL 2PW2A 5F1SA 4WWPA 4GW4A 1MZYA 3EDDA 3VFRA 3HRZB 1EEZA 5E7BA 1E4XH 3EJSA 2YAQA 5T1KB 3CFKA 1X5AA 4GUPB 1E9OA 3QUXC 4JM2D 4GRWF 1BF8A 1U21A 2AQ2A 4MYPA 2ZXBA 4Y1AE 4ONFL 1YUKB 1RK0B 4X80L 5BUPA 5I19L 2ATAA 3G5XB 1HHJA 2B16A 5IW1B 4YE4L 5CM1A 2CCWA 1AXTH 1P84K 5F1OB 4FABH 2H26B 3D30A 3PDGA 3QARA 5F3HA 2J5LB 3T0XA 3QJOA 4FLHA 4LK4A 1S7VA 3CN3A 1ETJA 5J9PA 3NSYA 4XPAH 1YDPA 2WO3B 4PRDA 5KJRH 4UM9D 3PL6C 3IFOA 4Z7UF 2RB8A 5I1CL 2DLFH 2JI1A 3O0LA 3CPUA 1P53A 3CSYB 2FJSA 3CFDB 4MNGB 4NLHA 4EEEA 4OD3H 4MD0B 1FDLH 3MXVL 4X4XA 2LFGA 2VLJA 1J0ZA 1GYWA 3MLXH 2BOLA 4WFFE 3AA6A 3MRHA 1BWWA 1HH6B 2IGFH 2XACC 3KGSA 3L3GB 4FQCH 4G6AD 3MO1A 5C6TH 3VGEA 5D7SL 3C5ZC 3NEXA 3WN5A 2N7BA 4XN7A 4LLAA 4G43B 2WV3A 2B7DT 2R7EA 2F53A 3VNZA 4J3WA 1NAMA 1ZIBA 1IO4C 2EUWA 3BW9A 2WQRA 4QTFA 4OFKA 4KBPA 3U0WL 2HVJB 4MAZA 3LIUA 4GLRH 5E2WH 2CSPA 4MXWH 1I7ZB 1RUPL 2Z31C 4OV5B 2D7NA 4D8PA 5SX4I 3G6JE 2BJML 3FT4B 5JUEL 1J7VR 3US1A 3RWDA 5AOMA 1N8ZA 1E50A 1TVBB 4Q8BA 4Y16A 3TZVB 1MAJA 1HFUA 1R3HA 4S1RL 3QCTL 1M71B 4TVUA 3WS6C 4JRXE 5INCA 4CVZA 3LEYL 2DOCA 4BFKA 2XE5A 2J8OA 3MYZA 2WLIA 2XN2A 5K1VA 4OW6A 1BFOA 1CGYA 1S46A 5FYJD 1OM3L 4OF6A 1OB1B 5I1EH 5TF0A 4IS6A 5KWYC 1PZ3A 2J1YA 5C86A 1ECYA 1A7NH 2NY5C 5D7LE 2WTPA 1PD6A 2J73A 3SZDA 1QEXA 4LE8A 1D5MA 5FO7B 4IKIA 4HPOL 1RJLA 3V8UA 3GUTB 4TS6A 1D5IL 1O7DC 2VITA 1EH9A 3MBXH 3Q5OA 3KXFA 3ISWA 3S2CA 1F4HA 3ZIYA 2XN1A 4AX3A 2ADJA 3T3PF 4F91B 3HI6L 1WA0X 3VA2C 1PTZA 3FQWB 2AK4E 3AZUA 1MIML 1B2YA 1YY9D 3SIKA 1UWFA 1UWEH 2G60L 5EU3B 1IFRA 3BDYL 4AIZA 2W94A 4YO0B 4Y19A 4PLJD 2FLMA 3VXTB 2YEZA 4FZLA 3PV6B 3GXIA 3TIDA 4D64A 5AVTB 5BS0A 4FFWD 3VXPB 4E41D 3SKUD 5ANMB 1VKXB 4NKOA 1BEYH 2CMRH 1QPXA 1MUJB 4ZUVA 1EXHA 3QXUA 4F7TB 1ZANL 5E1AB 2JB6B 3EYUH 1A4KA 1PZDA 3QP3A 1BBJA 2IAMC 4UQ9A 4G8FA 2BXYA 2P49B 1XF5B 4J8RB 5ELIA 5FO9B 4OF3A 3QT2A 2CWRA 3OHXC 1THQA 3MREB 4ZFOB 1OCRB 2KQMA 4MCYB 4D94A 3O3EA 3MROA 3LNGA 1IGYB 2XWDA 1M3JA 3LIZH 1NMAH 1LQSR 3V0EA 3UG3A 1IKFH 1JZ2A 1IKNA 1D5XA 2FLBT 5HYQB 3EJJX 3SKOA 3U9UB 4D9LH 3ETTA 2DQUH 5I16B 5IHWA 3SDXA 4M61B 2W9EH 4M3KB 1BT9A 1NANH 5ICZB 3LQZB 3LQAH 3PGUA 4LDLB 4R26L 4C56A 3V0VA 4FCHA 2COQA 4LO9A 5FYLE 3ZTCC 2B0SL 2AQ3A 5DJZB 1P9MC 2WQVA 2MFNA 1AOHA 3NCJL 1IBFA 3QQ4B 4JFDB 5E9AA 5FHAL 2B4CL 5JW3L 1MI5A 1OWWA 3D85B 3EOYG 1G6VK 2XV6B 4NWTL 4ONGH 4P5TC 2HX7A 1ETZA 1NL0L 4R0LA 4R4BB 4DW2H 4BGDA 1TPXB 4J3UA 2QPDB 4FXGB 4M00A 1MHCA 1T66D 4LMQI 4MZRA 3WIFA 3VFWB 2N4IA 1V05A 4WHDA 1IQDA 1T7ZA 1M7DB 2W80C 3QJFB 3HRZC 2JLPA 4Y5VB 1HL9A 2WWMC 4LOUC 4B0MM 1I4FB 4YFDB 1JYWA 2DIJA 3NCMA 3EGXB 1Q9LA 3S35L 1OSPH 1UJ3B 4KZDH 2HFEA 4EMZA 4CC4C 5AQ0A 4YSSA 4FRTA 3JVFC 4FS0A 5C97A 4PCYA 4Q9RH 3O2VL 4R96A 4PJAA 5CGBA 3N06B 2GKIA 1XFPA 1L9OA 1KPRA 1ITCA 2J5LC 2E75C 5EZPA 1BM3L 2MPVA 3HLAB 3KW8A 1IARB 1VLXA 3FOLA 5JORA 4XVTH 1OO2A 3V0DA 3NSCA 2G9HA 4FMSA 2X4RA 1TIUA 1SXCA 2AJUH 5JOFB 4PFEA 4F7CA 3BGAA 1Z66A 3QUGA 1CLZH 1MNUL 1DBJL 4Q0XL 2HVBA 3N55A 3I3DA 1UCBL 2HFGH 5CLTA 1MF2L 5GSRB 3ULVD 1SDAB 2RA1A 1Z9SB 3RFRA 4DKFH 3RVXD 3OR7B 4YPGB 2XIDA 5FWQA 5KBLA 5B1JA 1N0XL 5MEPB 2P7TA 3BZEA 4XN9A 1AGBA 2KPNA 4N87A 1D2OA 3QZOA 3EGSB 5TQ2L 3AQXA 43C9A 3FHEA 3HC3L 4MVBC 2XG6A 4XPHL 3UZEC 1YZZA 3SDDB 4Q9CA 1AO7E 1T04A 5K1NA 4HOZA 4ODHL 3BGFC 3WOVA 1N10A 4H8VA 4LCCB 4FNLH 4PJFB 5H37H 3S35X 5GZOC 2WINB 4WY7H 3TS8A 4XNZB 3G5ZA 3DGCR 1AH1A 4LSVL 1L9MA 3ECBA 3ZDZE 5JQIB 2ZUXA 3ZKND 4Y1AD 5DEGB 5IB5B 5E1HB 3TT1L 5EU7C 2EDBA 1H3WM 3AU1B 3U9PH 2QKSA 4PGEA 32C2A 4Q14A 2VGLM 1TJMA 3OKOB 5I30H 2EDLA 4QOKA 4NUQA 3MRGB 1FSKB 3EBHA 5FUZL 2FIKB 3C6SB 5HYSA 2VDLL 3AA7A 4N9GA 5F7BA 3OJDA 4ZTOH 3LKSA 5KOVC 1YJDL 1QW9A 3AG2B 5EU4A 4U1IB 2VL4A 4QHLB 3EO9H 3J27A 5G2NA 3PHOA 3P4OA 4A1RA 3MRQB 1QLRA 4W93A 3BVUA 1D5ZB 4PRBB 3VWJD 3L4VA 3S3JA 1TJGL 4NUPA 4RZCB 4XN1A 1PKQA 1OAKH 1RIHH 4MAYB 5EO1A 1TEGA 4DVBA 1HHHA 3HBQA 4WFFD 1MJ8H 2VAAB 3ZKMD 4N2OA 3QC6X 1YQVL 3HHSB 3U2SA 1T1ZB 2ZTBA 3IETA 2OM5A 1PX4A 3VD2A 5C0AE 5DQJB 2LFEA 3MJ8B 3O3BB 4WW2F 3Q9PA 5BOJA 1XSKA 4PG9A 5HGGS 5FUCE 4TQEH 1CR9L 4L3CB 4AZLA 2A6DB 2R69L 1PF3A 3GRBA 2BVTA 1T1LA 4W9EC 3H54A 3SDCA 3G6AB 4B9GA 2OSLB 4Q9QL 4IYKA 2P43B 2YUXA 4Q56A 4YSDA 5IVXB 4IDJH 4MNHB 2FH8A 4A6YH 1MRCH 3HI5H 3ZT6A 3T0EA 3PIQB 4OLUL 4CA4A 2LVEA 3ROLB 2IV9A 3Q8EA 2Q76B 3A0OA 5D93C 4LSRH 3VFPB 3BAEL 2F19L 2JF1A 2J57A 2FH6A 4P5MB 2BP8A 2EDHA 4OCWH 5F1IB 2BP0A 4JRXD 3DSFH 1Y07A 3MOAL 5LGJB 3T5WA 3Q7JA 4ZMZA 3FAXA 5AG8A 3ULAB 4AVKA 4KZEH 5I1HH 2AJVH 2A6JA 1YNKL 3D33A 2CDEA 1A6PA 3CE1A 4W6XB 5JZ7C 1GPOL 4JCHA 3SQOL 1BYPA 3PAUA 5HHME 2JVUA 2XKNB 4KRLB 3QQNA 4YSAA 4F9PA 3MRDB 3TP4A 5IROC 5EOQH 4E2OA 1BD2E 1E42A 2AXTO 1LO0L 2GY7B 4V33A 4F8QA 4UIKL 1B4TA 3UJJH 5D7LD 2ZCLH 1IGCH 1IBHA 5GGRB 4J39A 1ZDQA 3IMUA 4N1EA 3KGTA 1U3ZA 1CXIA 2Z1PA 2Z91A 2O30A 3H9YA 2R2EA 4QRPD 4Q2ZA 1KTKE 1YC7A 1G7HB 3IBOA 3M07A 4K7FB 5I6NA 3FQUB 4GMTL 4DHLA 2H0FA 1RIVL 3BO8B 4ZPTB 5CCKH 2AK4D 1UFGA 2CKBL 3ATFA 5MI0B 5FVNA 3CFBB 2KT6A 1KZYA 4WUUA 1RZKH 3LZOA 5E99L 2VE6A 1L9SA 4UILH 2GAZB 3GMRB 1HSBB 3IFPA 1WBXB 1E6JH 3RKDC 3S96A 3SD5A 1F90H 1OAYH 5LHDA 1D7FA 2P8MB 2ZG3A 4U4BA 4FXGC 1JI2A 1DQLL 3CX2A 3FB8A 4HCRL 2X9YA 3WJJA 5KG9B 1J5DA 4NO0A 3REVA 2FO1A 3PDOA 4RDQF 1MLBA 4Y5VC 7CGTA 3AWEA 2K4TA 3LS5L 2Q1EA 2PYEA 5I8OH 4F2EA 3OXSA 4JY4A 4N0UE 1UJ3C 4O4YH 3GSVA 3DRQB 3CVCA 2XYCA 4U0RB 2DQ6A 4ANWA 4HF5L 5E00B 3K19A 2XE3A 4I2XB 2GJ6A 4MWFB 1ASQA 2YPLA 3D05A 4AKOA 2Z7YA 4Y5YC 3SYQA 3AMLA 5I15H 3LXCA 3BJLA 4N75A 5K59E 4ZUTA 3EFFA 2X6UA 3EYVA 1E4JA 1V7NH 5L88H 3VGGA 5LN4A 1T89C 1LGVA 1WAAE 1CGUA 4UTAL 3MPCA 3VH8G 1TQWA 2NCMA 4NQCA 4X4YA 5LGKA 2BSEA 4LVHB 3RWJB 1CD1A 4H0LC 5DEJA 4XWGL 5IIEB 4U3SB 1G1YA 1H3PL 5T5FL 2Y7QB 1CDHA 3ASNB 3B2VH 4YHIB 3UCRA 3F12B 1BOYA 2H1XA 4ZMTA 3BEWB 3MJ6A 4BZ1L 2WP3O 1E6OH 3NQKA 5CJXA 3SDDC 3GSXA 4JPIA 3W9DB 3S8FB 1JZGA 1NUDA 1Q9WB 4GYBA 5T1LB 1JF6A 4TPRL 4ZSOE 5F3BA 1LO3L 3DO7B 5AAMC 4A2HA 2L04A 5B3SB 2ZT9C 1R19A 2VDQH 4DZ8B 2GY5A 1INDL 5H2FO 1SHXA 2FWOB 3GHEH 2WANA 3O4LA 3OXRB 3SQBA 4P9HC 3NFPA 3VY9X 1DQQA 1SBSL 1X5KA 1KXTA 3NZUA 3Q6GL 4JJ5A 5KVDH 1FSKC 1SLVA 2P5EE 5F7HA 3HUJE 3CFEB 4FULA 2G75A 1CZ8H 3KYKH 3T08A 4YDLB 4E9TA 2BSCA 4NNYB 4BDVA 5ADXL 1DQMH 1WUNT 2WO4A 4JFFA 3VTTA 4ZAKA 2GBVA 2WYZA 3D3VB 1M6OA 1ZY9A 1J05A 4V1DA 2Q9OA 4P2RB 3TN0D 2CR3A 1XDTT 1S7TB 4MAYC 1UA6H 1SXSA 1P7HL 3EIFA 5DJ2B 1XIWD 1F13A 2IV8A 5J5EA 2G5BB 2H6PA 2YA0A 3MUUA 4M8VA 5IVZB 4JJOA 5IGXH 4P57B 3CHOA 2QSTA 1HCZA 5D7HA 4N1CA 1E27A 4MQXD 4U1HA 2C26A 1AO7D 4U05A 3SQRA 4IBSA 1FORH 3GMPB 3NACL 1B3IA 4WU5A 1P5UB 2B4CC 3QFDB 3MZTA 4C4VA 3QUZA 2YKLH 4ZT1A 4FG6D 1G7JB 2PYFA 1QTSA 5J6SA 3U4KA 4OD2B 3TNMA 1OCWL 5AAPA 3MOBH 4NKQB 1JF5A 5DC4B 4RX4D 2XZAL 4KI5E 3VG0H 4AXWA 2HB0A 1TOXA 3U7YH 1MN4A 2WBJA 5BUGA 3OQ3B 1J5OL 5I75C 4XMLL 3E8UL 5I6OA 3LNFA 4IRJA 2VCOA 3JVGC 3WG7B 2XE2A 4QJ4B 4O9HH 4NS0A 2GVYA 1BW8A 4JFSA 2Q7YB 4UT9L 3VZUX 3W2DL 5GGRY 5IJKA 4WHYG 5F9WB 1AG6A 2APXA 5LG1A 2CJUH 1ILUA 4N68A 1UQSB 4L37A 5HHPB 3VMPA 1Z5LB 1JNHB 1MDAA 1R5VB 2CO6B 3W81A 2AZAA 2FO4B 5DZLA 1RD6A 2QPEB 3JTTB 3GRGA 4DEUA 4WDIB 3CXHJ 5EHFA 2XWRA 4CADB 4UMGA 5C0AD 5IW6B 1JHTA 3L5HA 3G5YB 4FNQA 4X7DC 3SDYL 3RJQB 2CRIA 3RB5A 4L1TA 4NUJB 2XJLA 2ZLDA 4B6ZA 2IH3B 1G6RB 5AOJA 4AYFB 2B15A 1S7SB 4OQTA 5EIQA 4CAGA 3L9BA 3DTXA 2X2IA 2V7NA 4LLQA 5DR5H 5KVFE 5MI0C 4X7SH 4KKCD 5ISZD 1I7UA 1TENA 3VA6A 1P2CB 4HIJB 4WSKA 3PS6A 2WXHA 4KX7A 2Q87A 1A02N 2DQFA 4GI6A 4HUWA 1DVQA 4PJIB 1PEWA 2CO7B 3A4EA 2ISDA 5DFWH 4JFQB 3MCKB 4YEFA 2FGRA 1AJ7H 1K4DA 3GLDA 1ZHKB 5DWPA 1VFOA 1RJZA 2ED9A 1J8HA 1QA9B 3BFWA 1NCCL 3CMGA 2P45B 1CGXA 3MGOB 2KDGA 3L3OA 3R7QA 4IRSA 1Y0LA 4B9CA 5DD1H 4JPWH 3ZTJH 3KPMB 2CRZA 2BP3A 2VZ3A 3IDXH 3BUPA 1P7QD 3BWZA 4GO6B 3VG9B 3T1FB 1U93A 4AEIH 1G0YR 4WO4D 5L7XL 5JA9A 4HKZB 5HHMD 1U30A 1PU0A 1QJPA 1JK9A 1T5KA 3IN2A 4YR6B 1NFDA 1BD2D 4IOSD 4EI5B 1UASA 1ZLUK 1RZGA 3FT3B 5B38A 1E8XA 1OAXL 1FI8C 4HDIB 4TV3A 1R0AH 4TUJA 5KSAB 1ZLVK 3MX0A 1YEEL 1HCFX 4M1DL 5F7DA 3T0AA 1L3NA 5IJDC 4HHAB 1CDGA 1F8TL 1GSMA 3NOIA 2NY6B 1EDHA 4PBXA 4LLVA 1JP5A 4HIXH 4N0CD 3CH1B 3R4RA 1OSEA 4NPYB 3RVWD 3H9SB 4XO5A 4OFDA 5CGMA 4LVHC 3BE1L 4H13C 1IC0A 4E42B 5FYJL 3WAJA 2YZ1A 4AQ1A 3EOTL 4LPYA 5EEXA 4JR9H 4JY6A 3ARED 4PJDE 5C0BE 1O5DT 4NAJA 5I0WA 4CSSA 1T4KA 4ODVH 4M7KH 3NJFA 2CQVA 5D9SB 3QFGA 1Z9MA 3CC1A 5EOCH 2UZXB 4M5YH 1FFOA 2K4AA 4O58H 1WQVT 4JBSA 2YFNA 1WA1X 4CJ0A 3VH8B 1DE4A 2VN6A 4S11A 4EN3A 5IWLC 1EO8H 5EUKA 4BKLB 1CPUA 1XF3A 3T4AC 3WIIL 2OZ4L 3OAYH 3WD5H 2MHAB 3MV7B 4G8EA 1CLVA 4ODXB 4JG0L 5HBBA 2YBGA 3GGWB 5DEFA 1YEKH 1OGSA 1BVZA 3K6DA 5D1QE 4FE9A 4IMKA 5AB0A 5IEKA 1KCSL 1AZUA 2D7TL 4RGNB 3ROOB 4UBDD 4G42A 4UDTA 4B97A 2VW7A 3SJVE 3ARSA 4LRNH 3BOVA 1AC6A 3AAZB 4NRZA 2ITFA 2Q2EB 4P2CG 5DVLA 5F7FA 1UT1A 2EE0A 2QQLH 1SJEA 1AFVH 1R17A 2ICWI 1R3JA 1JVKA 5JIKA 1IC4H 1PNDA 4NO5A 4DT2A 4JN1H 3FO2A 4UTCA 1V8HA 1UXWA 4GKSA 3GMMB 5FX3A 4TF4A 3ZE2B 1FF5A 5AVQB 4OZIF 3QCUL 4XAWL 4WLCA 1FLRL 2WJRA 3POHA 4RWHA 1GFMA 1Q0YL 2A9NL 3FFDB 4PD4K 4WVRA 3VFUA 3VD1A 5E4EB 1IC5L 4YNYA 1KDJA 2IDSA 3S37L 5KVDE 1P5UC 3VQMA 4LOFA 3D8MA 5CKGA 2PCYA 3HHMA 5D1XD 2GFBA 4I7ZC 5HHQA 3RA7L 5BVJB 2D2CC 3VXUA 5C7ZA 1FFPB 4HJUA 3C5OA 4AV4A 2ZCHL 4MZIA 5FWRA 4LSDA 2I32A 3U1PA 4U31A 4PRNB 3S36L 3LNHA 3R06A 1R3KA 3V4LA 3HPLB 2NY2D 4LF3B 4W70A 2WN2A 3UZQB 5ABZA 4OZIA 2OS7A 1DVYA 3WEBA 4QO1B 1K72A 1KZQA 2YGOA 4ZFFB 2IDTA 5F9OL 2FZ3B 4H8WH 4YBLB 5SX5H 1S4IA 5D1ZC 4AGNA 4IBZA 4XHJD 1N6QH 4CVUA 2R8AA 5F9WC 4K9EL 5K9OA 5DTFA 1AZRA 2A74C 4TOYL 4OF8A 5DMIL 2R8SH 2YEQA 2VWEE 3OKNA 3RDTA 2VXTL 3FN3A 1F41A 2HJLB 4ZFGH 1S9VB 3QHTC 3GHPA 1TYRA 3D9AL 2JKSA 5I8KH 5E6ZA 1NGXA 3IEAA 2GK2A 2VLJE 2EDQA 3QQ3B 4LARH 5KUKA 4QY8A 1N59A 4GRWE 4K3EL 5BXFB 1S7XA 3K3QA 3ZQWA 3S37X 5FXCH 1HXTA 4HCGA 3ERXA 1DJZA 2H47C 3MLSH 1NBYB 4IEFA 4LKXA 4ZMAT 4QAWA 5ID0A 4P2QA 4HSCX 4AG4L 3RVUC 1XV8A 4J3SA 4OZHF 4R7NA 1YEIL 4L9LA 4X6BB 4GAAA 4KI1A 2WTOA 1A7QL 2F53E 3B9KA 5IG7A 1ETB1 1IGJB 1T0NB 2N59A 2FUQA 3O6ML 5D7JD 3W37A 4XNLA 3S36X 4FEIA 3NQIA 2ZWLT 4KI5D 4XC3H 4JFTA 4AYMC 2RBLA 3EBIA 1E5BA 5AB1A 3INUH 5EBLB 1ETA1 5DT1L 5F7NC 1OQOA 2YUVA 3NFSH 4ODUB 2X70A 5LCVH 1S9KC 4U2ZA 4XNBA 7TAAA 1AD9A 4WNJA 3EJCA 4TL4A 4GS7B 3VI3B 2WQXA 1RPQA 2EIDA 4MJIB 4FKEA 3VFTB 5IFJB 1EJ8A 3KJ6L 2J43A 3ZDYB 3VG9C 3BD4A 3JZYA 1Q1PA 4FFZL 4WNSA 3VCLA 5CCHE 4QLWA 3JV4A 1GA2A 3FQXB 2GUOB 5CBEA 5CJ8A 2D9QB 1OAUL 4X5XA 1U4EA 3HG1A 5HDBF 1JNLL 5FGRA 4EI5C 1ZV9A 4G8IA 4MAUL 5FK9A 4BA0A 1UWGL 5EIIA 1QJ9A 5KSAC 1X9UA 2UYLA 2Q20A 1QWNA 5MEQB 3V5DA 3G5VA 2HX9A 4JB9L 4BCXA 1MCBA 5FFLA 4YDMA 4OCYH 2NY6C 2FEJA 3LPFA 1LNUB 5T33H 1ACZA 3HC0A 1LLAA 3HOEA 1TNNA 3KXFE 3L3IB 1GFNA 3UO8B 4AYBA 5CIPB 4RAVB 1II4E 4NKDA 1RU9H 3FN9A 1G84A 3X12B 2EC8A 3QDGB 4C4KT 1BJ1H 2FX7L 5DS1A 3U25A 4DSYA 3GIVA 1ZA3A 3BP6B 4PTTA 4Q58C 5IREA 3LEVL 5IB3A 2F5BH 1PZBA 5AVYB 2DQEH 3MXWH 2GITB 4Y19E 1ZK9A 3MRFB 3ARGC 3LKRB 1C5DB 4L2YA 4JDEA 1DDHB 2ZUQB 4EO5A 3KJ4B 4ZX5A 1EANA 5BS0E 2O5YH 5KAFO 3B7RL 4M8QB 3GKWL 1LM8V 4OFQA 1N12A 1THAA 1BZDA 4HV8A 3VXSA 4KKBC 5SX4H 2BFGA 4G71B 2MMXA 3D0AA 4ZMLA 1F56A 3OWEA 4C83B 2BVUA 3U0TB 1I9EA 2ADGA 5CFHA 4J5VA 1H3UA 3V6ZB 5FUOH 5HJDA 2ATKB 2OMUB 1R5IB 4J3OD 4NUGL 4U4IA 5C0FB 4PWHA 1GJWA 4XWOC 1AGCB 5LAPA 4L8SC 5EE2A 3NJXA 4N59A 1A1MA 3N42B 2WVTA 4L0PB 4N2FA 5FDWA 5I5RA 5F2FA 3AT8A 4BSJA 5DUPL 2OL3L 3U6RB 2WQ8A 1RUMH 3CD4A 5GRUL 4RGNC 1GTNA 1H6S1 5D96C 1J9CT 2F7RA 4L1HA 1RPUA 5AFUK 3MLUL 1TZIA 4GY4A 3MRNB 1ADWA 1XEUA 2CLRA 2XQBH 4W6YB 3KWXA 5E0QA 1NFKA 1TETH 3SDXE 2JQMA 2W65A 5HY9A 2E4FA 5KBKA 3DV6B 2WXJA 1JPEA 2LU7A 5AW0B 3LK42 4MJ5B 4C56E 4Z7QB 4G1EB 2WBXA 3H0TA 4HUKB 1G9NH 4NZRL 4YZFE 4HU2A 4GCPA 2NUPB 1MI5E 2MKWA 2OZNA 4NC0B 1HKLH 3ZR5A 4ZNCD 3JTSA 2BDNL 4TMPA 2Y25A 1BF5A 3JCUO 1DSYA 1ZHTA 1E7UA 3WUWG 2BZCA 4YSQA 1B3JA 1SDYA 4JHAH 7FABH 1QNZH 2CO1A 1PYWA 5AKSA 3HG2A 3Q8FA 1EFXD 3F7YA 2GCYB 3GRWH 1BZQK 4JLRB 1T7YA 4JFPA 3CFIC 4MJHA 1L5GA 3MAWA 4EZKA 4MQTB 3VY8X 4G6AC 5KAQG 3CZKA 5DDHA 2WK2A 3A22A 1EUUA 1IGTB 4FQLL 1WFNA 2RMNA 2HUHA 2PWDA 4NP4L 1MFBL 4P2OB 4PJAE 4FA6A 3GLAA 3VB9A 4BELD 3AAEA 2WLLB 1TYJA 2UX6A 3MYJB 3UBXG 4ZTEA 4YBLC 1D9KB 1HJBC 2HWZH 1ROCA 3SJVD 4R2GD 4Y1AB 4QRSA 5INDB 2N01B 4FQXA 4JO3L 3T3MF 3CFUA 2QMKA 2CGYA 4I18B 4JDVB 4XP1L 5CEYA 3UTSB 1ZGLB 3V4VH 2ZICA 4X6FA 1H0DA 2PWHA 1A4JA 3OTTA 5JOPD 4XNUL 5I1KL 2ITEA 2KKQA 3QIUD 4JG5A 1JPFB 2BVEA 2LV4A 4AYGA 4Z78B 3CFCH 4XPGL 2EXWD 3GZPA 2YAHA 3J8F7 2QBWA 5CHNB 4CBPA 4AENB 1S7WB 2VW4A 3CDZB 3ECWA 1FE8L 4BZYA 4G5AA 2E7MA 1CS6A 1I8LC 1WT5A 2IEPA 2AABL 1MVUB 1GYUA 1LQBC 4MA7H 1KWKA 1UA3A 5E70A 2D31A 5KW9L 1NJ9B 2R4LA 1QLFB 4HSQA 1B0GA 5E8OB 3N85H 2RCSL 3D2UB 3TA3D 5FYLL 1BYOA 4PJCF 1QKZH 3F85A 4IRZA 4DOHE 1NCHA 1Q72H 5D7EA 2Y22A 3GBEA 3FU0A 4BINA 2AV1A 3ZE0F 4QOKE 5HVWA 3RNQA 3TJHD 4UU9A 3LEXA 1CFVH 2CRMA 1ILSA 2NYZA 4QKTA 5FW6A 5TDOB 2YWYA 4FQIL 4AZ8A 5B3JF 1ND0B 4YVUA 3MV8A 1A6TA 3QDJA 4JW3A 3FCTA 2DQIH 3BZ5A 3HB3B 4PLJC 2GABA 2AZUA 2G2RB 1NIBA 2OL3B 3WFBH 4ZZKA 4YHNA 4Q74A 3KPLA 4FFWC 3VGFA 1VF5C 4P07A 1SXZA 2AXJA 4ZQTA 2ICEA 1LEGB 1H9VA 1CFQA 2VZVA 2XSKA 2VLJD 1CXLA 4JRYA 1OD7A 4N2IA 4XB7A 4JRXB 4D0BA 5GXBB 1PKQE 2DQGL 3WMPA 1SOQA 1VACA 3WEXA 4M3HA 4K94L 1W91A 4DFIA 3CVDA 3TNNB 3M45A 1YECL 4IHOA 2NMSA 4OLYL 3AM8A 1FO0H 1BIIA 1H6EA 4KUCF 4KZCA 3IFNH 2J3SA 3QPKA 3RGHA 1I8MA 2IOMA 3X1FA 4XMUA 2F53D 1A9EA 4JZJC 2BVOA 2OSYA 4Z7AA 1FL5B 2MCMA 4OB5H 8PAZA 2ZP8A 3NIDF 4NFBA 2CJSA 4RESB 4Z8FH 1UXLA 4P3CH 3PWNB 1E4XL 5J7CC 4H0HB 3ULSB 1YEDB 3BQUA 4QRPB 3T0EE 3QPXH 4ZFQA 3KJ4C 4NM4H 4QTIL 3NCEB 4Y16D 3HR5A 5F72S 2ZJSL 2CXKA 4NAQA 1OAJA 4X9BA 4GB9A 2YKKA 1T20B 2D0FA 3ASWA 3SY7A 1RZJL 4JFHE 4NM8H 1ZT1B 1A3LL 3M1BA 1YMHA 1NCGA 4M43H 1XCQB 3GTTA 1U2CA 1GZQB 1JSYA 4NGHH 5G4NA 4D7PA 4ZW5A 1BBDH 1YEGH 4ZS6C 1L4IA 1M7UA 2DLFL 3SGJA 3T6ZA 4BFJA 1G90A 1T66C 4H8QA 3UTOA 2DMCA 3NZHL 4GW5A 3FT0A 3T77A 4OLWH 2FE0A 3BH9A 3PHQA 3O6LH 3PJSB 3S5LA 4RISL 1KEMH 4M7LH 1JXJA 2Z0UA 3BGMB 2CK0H 4UUJA 3SGDI 4AQAB 4L8CA 1J1OL 4JZOB 5AOKA 2ZWKA 1EHLH 2QMJA 3B2PA 3P0VL 4ZO9A 1AKJA 3AA0B 1Z7JA 1IT9H 1RUAL 5SWZA 2H2PD 1JNNH 5HD8D 2Y5EA 4HAGA 4FQCL 3DGGB 3WI5A 1IV8A 3HNTL 3QUXA 4N0FB 1N64L 2V8MA 2I07A 3DOHA 4J4PA 4QT5A 4LSQL 3BXNA 3PAVA 1JN6B 2X4TA 4TSBL 5CMAB 4TUUA 4LASH 5F9AC 3DVGA 4WUUE 1OE3A 1F11A 4Y19D 2QQQA 5E2WL 4PVBA 3TEYA 1MRFH 1DQJA 2P80A 3K74B 2FJHA 5BS0D 2OXHB 2PW1A 2KPWA 3K2MC 4YJZL 1WUZA 2K7QA 3ULVC 2I9TB 1IEBB 3RVXC 4LPCA 2EYTB 5EU5A 1DYZA 5GJTL 2QT6A 4FNTA 4PB0L 4HEPG 5GRJH 2BX5A 3WLBA 5A7EA 2EC9U 3MRCB 1YMMA 4NN6B 2PYEE 3QW9A 3OBAA 1GMEA 5F89B 3KAAA 2OW7A 3VTAA 3X13A 1JXKA 1G1KA 5HGAB 2ZUVA 4P2OC 4OZFH 2GJ6E 3WTUA 2YPLE 5I1EL 4QGTA 4JG1L 3LVEA 1DBML 3JXAA 4GSUA 1D9KC 4L05A 4URKA 3WUWB 4E9SA 1A7NL 3FCSA 4EUPG 2DN7A 1PY9A 4AJ0A 1NCTA 3BIAX 3QWOA 3MODL 4N2LA 4ZUSB 3APMA 3FTYA 1JGVH 3D48R 4G6MH 1Z3GL 3AG3B 1WPCA 3AXIA 1MHPH 3TO4B 3L95A 2X9XA 1A21A 1U92A 2YMXH 3E1F1 4NQCE 3RVTD 2CNYA 2EDFA 1IRAY 2IF7A 1A3QA 3TH3T 3WXVL 4X99A 2NLJB 4TQ8A 1GW6A 2VQ4A 1JDAA 4ATWA 1PHOA 1MI5D 5E1GA 3PABA 3JTYA 4HXBL 3SODB 4M5SA 3B6SB 3TYGH 4NFDA 4YE0A 3WS6A 5AUMA 4HGKC 3UBXB 4WZ9A 3CQFA 1DN0B 1OT4A 2VZTA 3MV9A 4I3GA 4QYAA 4OCSH 3EJYD 2MCPH 4I5BA 1JGUH 3T71A 1ZAGA 3L16A 3QRBA 3TN0B 1DSWA 4O4XA 2P3YA 1OV8A 4EXPX 4LHJB 1UZ8A 3ZKMC 3UYPB 2CMRL 4FQQA 1I7RA 4DGUA 3CN0A 3DX9A 3QG7H 2GSIA 3X14B 4PWGA 3WELA 1SJHB 3EYUL 1J9TA 2HMIC 4OSUL 4NRYB 2QPUA 4PP2B 1AZCA 1MWOA 3OPZH 3O4LE 1AQKH 2GJPA 1BZ9A 4YGVB 1M9SA 4KROD 3MJ7B 3ZDZB 1NMBH 3L9RB 1JGDB 4BUGA 2A77L 3FQNA 4MYWB 2ESVB 3LIZL 1GCYA 4EJ1C 3RUGF 5DHMC 5LQBH 3UTPE 1AC0A 2R23B 2BSDA 1G4MA 1BQ5A 1N6UA 4JFFE 1E8WA 2CIIB 4W9GC 2VDNH 3SOBL 3RGVA 1E5CA 3IAQA 4V1DE 1JGIA 1VGEL 2LR4A 4NRXB 3C6LB 4HZLA 5FAAA 4FFTA 5CILL 3MLRH 4X5QA 3DXAD 3LQAL 3AS2A 4Y89A 2Z35A 4RLDA 5FF6A 1M3IA 4AWJC 3K8LA 5FO8B 2AP2A 4G9FA 4L8DB 4DKEH 4JHVA 1QZ1A 4K7PH 2VDPL 5E8NA 3OHXA 2F8VA 4TSCH 1SHSA 3L6FA 3C09B 3OQRA 4M5TA 3IAGC 5GS0H 2B77A 5C0AB 4P49A 4QXTB 1NSNH 4DGWC 4UNIA 1N9PA 2J2ZA 4EN2A 2XY2A 4KITB 3ZOAA 3LKQA 1XGUA 3SCMB 3S48A 4KZDL 1OSPL 1NDTA 4M6OH 3TO2A 3LZQA 4QOKD 4IU3A 4Q9RL 2BNRD 5ITFA 1N5YL 3AT9A 4Z7NF 4N2KA 4PJXA 5ISZB 1HZLA 2PKDA 5CJ5A 5B1BB 1RQ5A 4K07A 1DUYA 5K9KA 4J3VA 3FS9A 3RWGB 1Q4NX 2Z8SA 3CFJA 1FL6B 3KYAA 4P04A 2BP5M 3WJLA 4J2XA 3G7GA 3EFOB 3IDYC 4UQDA 1CLZL 3D4CA 1ONQB 5D4JA 2YRZA 1BZEA 2DMGA 3RPIB 4KQ0A 1CXFA 3H53A 2IBZY 3AWGA 4B9YA 4UQ2B 1ZHZA 3B9DA 4PI0A 3LRGA 3VSTA 1D7DA 1NM9A 4ZMVA 1RK1B 4DKFL 5E94A 3CGTA 4RFOH 3W56A 3IMRA 1OM9A 5TH2B 2EEAA 3HRZA 2JJWA 2N56A 4WO4B 2DKMA 3QCVH 1MAML 2B2XH 5AL8A 2VXQL 3FU8A 4GUPA 3QIWB 2QLYA 4EKXA 2ALAA 4W9DC 4CC4A 1BQUA 5CD3B 1BVNP 2IANB 3LN4B 3SDCD 1RK0A 3V5HB 3NT0A 3G5XA 4JO1H 5IW1A 4HYTB 3RVVD 2VXSH 2H26A 4TRPL 3BHBB 3NGBC 4JPKL 1EUTA 1WZAA 2EDYA 3FO0H 1PIFA 3JT0A 3EHBD 1ORQB 3TOPA 2GTWB 3I9GH 3S3DB 3A4DA 4K5NA 4Q52A 4J3OG 3CSYA 3CFDA 3NMEA 4MNGA 1J5HA 3QG6B 4MD0A 1J8HE 1KLUB 4N85A 2BMKB 3ESOA 4PJ7F 1K3ZA 4ZTOL 4NN6C 4RMQA 4H5SB 4YHPB 4HWBH 2Y69B 4HQQH 2LU5A 1T6VN 3PY9A 1HH6A 2OR7A 2UWEB 3HMWH 2J71A 3L3GA 4RLBA 2ETWA 1NFDE 4TNGA 3ZW3A 2BHZA 4MZ2A 3EYSL 4G43A 4OGZA 3ZSSA 1XT5A 2R56H 1RUQH 1LO2H 4A7GA 1S7RB 1ZLEA 4NPJA 4G82A 1JIBA 5DEZA 2HVJA 3WS3B 2YD1A 4QJ3B 2AAAA 4E9QA 5FW8A 1OTSD 1YY8B 5F7WC 4AM0B 4XX1E 1I7ZA 3TO4C 1GAFH 4OV5A 3FXIC 4TQEL 1IZKA 1OK8A 3NUKA 4J28A 1LYQA 3FT4A 1BQLH 4PJ7A 1JBJA 2AERT 4WUUD 1QABA 2AEQH 1KDIA 2D4FA 2LTQB 4GW1B 3S9DB 1TVBA 2VDPB 5FW7A 4BZ2L 4YHZL 1T2QH 4LSSL 1KTJA 3TZVA 4ANUA 2WSKA 1LWHA 2QV4A 1MRCL 4D9RD 2V33A 1M71A 2E3VA 3KBHE 3SPGA 3HI5L 3D09A 3KM1A 3BRDA 3TN0C 4UZGA 4G7RB 1NCDH 4EUPB 2LW3A 4NO0D 2MOVA 4BFEA 1KCRH 3D51A 1OB1A 4X42A 5L0QB 4KGJA 2E5EA 1GC1C 4FQJL 4L8BB 4OCWL 2ZXAA 2HT3D 4YFEA 4HK3N 5KVFL 3KWVA 3QORB 1SF3A 4FFYH 4HALA 2B1HH 2GC7C 3IN0A 5CSGA 4NHCH 2CLZB 3QWRA 3O0RL 1JZFA 2NQ3A 1RZJC 2X4UB 5FO7A 4JQIA 2G9KA 3GUTA 2GJ6D 4YDIH 2YPLD 4UNUA 5D1XB 1GXEA 3N1MC 4NC2B 1D5RA 2DF3A 3VUAA 4FG6C 4ZSOB 5L6YH 5FCUL 4YDJB 5EOQL 2XTRA 4POUB 2DWEB 1HKFA 1S5HB 1KXVA 3UJJL 1CFMA 2ZCLL 5DD5H 5D7KD 3FQWA 5L2JB 4FOZA 4P06A 3WFCL 1KTRL 2AK1H 4UIMA 4FYTA 1SFHA 3RQ3A 1E3FA 3QUMB 2NY2B 2D3NA 1I82A 3ARVA 4YO0A 4NQCD 3VXTA 2JH2A 2BSED 3OC5A 2IPTH 3PV6A 3LXAA 3IF1B 2HTLD 1T7WA 4GXFA 4WNQB 5L8JB 2JIXB 3C6LC 3VXPA 4AM0Q 1I3GL 5JHBA 5ANMA 1VKXA 3SE3C 4AQOA 3W5MA 1RZKL 1G1OA 1NPUA 2AEPH 1MUJA 2EC9T 2B3RA 2YFOA 4F7TA 1TKWB 2BHYA 2DI7A 2JB6A 5TE6H 4W9HC 5FYKD 2DJ4A 5IMOB 4LPUA 4J8RA 1OAYL 1XF5A 5FO9A 4N2HA 1PX8A 5AYUH 3PE9A 4ZFOA 3MREA 4MCYA 4ZO7A 3DHUA 2E6JA 3C09C 5K93A 3RPKA 2N3JA 2NYKA 2WB1A 3U30C 5JXED 3FRUB 3VXUE 1IGYA 1CFTB 4XCCH 3UPRB 5ESVB 2H0EA 2VLKB 5FUCC 4K3DH 1D7BA 3SCMC 5EO9B 1IC7H 1VJSA 4O4YL 3CVIH 1KPUB 1FZJB 3FQ4A 1YNTB 1UWXK 5DMKB 3O4LD 2IMNA 5HYQA 3GEWB 3U9UA 5D71L 2K4WA 5ACLA 5I16A 4OZIE 4M61A 5D7JB 2FGWL 4KKCC 1TMQA 4C55A 4RA0C 3C5XA 4B5EA 2BZ7A 5A3ID 5ICZA 2R1WB 3MNZB 4PJEF 1ADQH 1C5CH 1MCOL 4E9WA 3SPJA 5DJZA 3PP4L 3QQ4A 4JFDA 5L88L 3PF2A 3NTCL 5KVMC 3D85A 2QADD 3FT2B 4MB5A 1FGVH 4V1DD 3APNA 1A0QH 2P8PB 4R4BA 5LLIC 4JVWA 2OSXA 4FXGA 1B90A 3EDJA 2NUTB 4KVCL 3WMQA 4LESA 3VFWA 2PP9A 2V37A 3GSWB 5KBDA 4GQPH 1J12A 1BAWA 5BZZA 2X38A 1JZ6A 1MJUH 3LRSB 1HEZB 3BVNB 1KCUH 3QJFA 1INQB 2GSGB 3FBQA 2F58L 4WEMB 2X6VA 4WO4C 1GHFH 2YD3A 2PLTA 1I4FA 3IS1X 1LMKA 3QHZL 4P2QE 1KC5H 1TCRB 3EGXA 1XHHA 1UJ3A 4TLSA 4ZTPL 2QPSA 1FZOB 1B0IA 3L3KA 3J2PA 4LSPH 1WIUA 4NP9A 4NQDA 1BG1A 2EVIA 5KYYB 3LX9A 2RH0A 4X6CF 4HK3J 5JHDD 2YGPA 2Y07H 3HLAA 1S2EA 3DX0A 4N0CC 2GTZB 2WBJD 4FJYA 1A9BA 3B2UC 3RVWC 1GGCH 1UG9A 5JOFA 4OGAD 2Q7AA 3SYAA 5EBGA 2KQNA 5HVHB 1T89A 1BVKA 4NWUH 2WPGA 2OI9B 5D7IB 3GHEL 1JZDC 5GSRA 3VFSB 5AG9A 2WAQA 4OH2A 1QP1A 3QEHB 5KVDL 3AREC 1Z9SA 5D1ZI 5IBTL 1ZWIB 3GUFA 1CZ8L 3OR7A 3KYKL 4YPGA 1B4RA 2ILLA 1F02I 3E1ZA 4LNRB 5MEPA 2JJTA 2X2HA 3K1KC 4D9QE 3IJEB 1F0LA 3WKPA 4QRAA 1CB4A 3EGSA 4X6CA 3HG1E 2XVGA 3ALPA 1ERNA 2VMCA 1NBVL 3SDDA 4OI8A 2GIXA 4FHBD 3IGAB 3KL5A 2H9GB 1SM3H 1Z0NA 3Q3GB 4DH2A 4OM1H 1IM9A 4LCCA 1KIPB 4PJFA 3FQTB 2WINA 2ZIDA 5AW1B 3WGVB 1U9KA 2ZUWA 5AAMA 1JF1B 4HG4J 5IGXL 4ZUWB 1NC4B 2V3FA 5DQDH 2DKSA 4F37K 2NY1B 5DEGA 3C87A 5IB5A 1FORL 1R34A 2IFGA 3QJRB 3AU1A 5M7QA 2A73B 4U7MA 3BSZA 1C7TA 3OKOA 4WI4A 4UBDC 2LTQC 3RZCB 1S9WB 1UKQA 1SXNA 3GLEA 3MRGA 5BQ7B 3LJ3A 4HIIB 1AS7A 3T20A 2FIKA 3EF4A 2FSEB 2IGLA 1GOHA 2TSBA 3OKDB 3RHWK 5HDBE 2AQ1A 3U4BL 2ZXCA 4FQHB 4OCXH 4OV6F 1ZS2A 3IXAB 2QVMA 4QHLA 4DGIH 2OJZH 2YAPA 1GMIA 4HIQA 3C9NB 4Y88A 5J6HB 3MRQA 1J8HD 4F7MB 4IRSD 3RY6C 1D5ZA 3KH3A 4B61A 4PRBA 5IW3A 3VXSE 5L0QC 1OALA 3BWAB 4RZCA 2AQQA 5PRNA 4MAYA 4OF7A 1NAML 2X2JA 4N4YB 2VAAA 1BGXH 3HHSA 2YUWA 1T1ZA 5TPWL 4Y7OC 4PBWD 4Z7OF 5DQJA 4PS8A 1CLCA 3MJ8A 3O3BA 4LIQH 5D1XC 5AVZB 4DCQB 1AR2A 2J1XA 3KYMB 5TE7H 3GNMH 2XCMC 4L3CA 2A6DA 5IQ7H 1U3HB 4QXGL 5I6MA 4WGKA 3DPBB 1DQIA 3G6AA 4D8OA 2OSLA 3TPUB 4ZX4A 5KSUB 3MLZH 4IBTA 5KZCB 1ACYL 1QHPA 4TNEA 1EHNA 5IVXA 4MNHA 4PUBH 1FA4A 2XRAH 2NY2C 2I27N 1NIAA 4NKIH 3PIQA 4I88A 2QSCL 2EADA 3ROLA 4WWOA 6TAAA 5KYWB 3JT2A 2Q76A 3VFPA 4XHJC 3IDIB 3JVGA 4R2GB 4X8CA 5IT2H 4X7SL 1W8OA 2WAHA 3KPTA 4P5MA 5F1IA 3B2XA 5MHSE 5LGJA 1PIGA 5FFGA 3UZVB 1LP9F 3GXUB 1DCLA 3ETSA 4LOVA 2YLKA 5J06A 3TEWA 4RMRA 3IT8D 3FULA 4EN3D 4BHUA 3HWBA 3WENA 4JPWL 3OMNB 3UDWC 2HJFB 3FUIA 3IDXL 5GGRA 1TJIL 4XMVA 3U1SH 3SZ6A 4YLCA 4HVBA 2N2LA 1FHGA 2C9VA 3RTLA 1HXMB 1G7HA 5D7JC 4GF4A 3FQUA 3BI9X 1KV7A 1T83C 3BO8A 4ZPTA 5L4IA 2EO1A 4KI5C 3TA3B 4Z7WB 4NOFA 1A4BA 3CFBA 4LSIA 1E30A 2Z7WA 3S4SA 3DGDA 3LOWA 3P40A 1A7PH 1HHJB 2GAZA 1NAKH 1HSBA 3GMRA 2WLHA 4HLEA 4QXWA 1WBXA 2QTVA 1SQMA 1TTBA 1WIOA 2NY5H 3B8YA 4HIXL 1EMTH 4HH9A 4PCKA 5AW2B 3OC8A 2SODB 4LVOB 4PBVC 1S7VB 2P8MA 2QTKA 1E3ZA 3UG5A 2WKOA 4FGMA 4PRDB 5KG9A 3JYBA 4WUKH 3OAWA 4I87A 2EO7A 4JFBA 5BCAA 1UM5L 1CXHA 3RILA 3MA7B 4LEBA 4HWEH 5D2LB 1OZUA 3SE9L 1KJVB 2B3IA 2OP4H 3I6GB 4RMUA 4LAJH 3EH5B 3N9GH 4XXCC 3HS0A 3DRQA 4HC1A 3NPSB 4GRWB 4QPEA 5E00A 3VXUD 2FEDD 4I2XA 4AYDC 4MWFA 3V9CA 4F15B 2GPZA 6CGTA 4BJLA 4XXWC 5DSCB 3ILDA 3IMTA 1LE5B 3LZFH 4JKNA 1EO8L 3WN5B 4PLNC 2DLEA 2E7CA 4L3AA 4ONOA 3T0SA 4TUOB 5JPNB 5GGVH 2B59B 1NAMB 3OHMB 1KV3A 4Z7UB 5HVHC 2K0RA 2F1EA 2OI9C 2R29A 3LYRA 2LABA 3MJ9A 1YEKL 4TQPA 4BFIB 1CLYH 4DPCX 1AIFB 3VWJC 2NSXA 4F20A 1Z9OA 3MV8E 5IBLD 3QDJE 2YK1H 4LP4A 4MRBA 3HG3A 5IIEA 2EXYD 3R0NA 5CEZE 4U3SA 4HSAC 5EO0B 4V11A 3RDTD 4YHIA 5C0JB 3F12A 1ED3B 1IC4L 4FTVB 4RGOH 4JRYE 3BKML 3JUZA 3EYOB 3W9DA 3ETBF 4J3XA 4MDJB 4DUWA 5C9JB 4BK5C 1Q9WA 2WLIB 2YHGA 5T1LA 5HJGA 4IK7A 1KBVA 1BFOB 4J3OC 3K5SA 5B8CB 4P2QD 3VYNA 5TJWK 5LNGA 5IWLA 3KYOB 2X3AA 1RAMA 3MA9H 5JW4N 4QRFA 2NY1C 4PEEA 1IGIL 2BPBA 4DZ8A 1TVDA 1U8CB 2FWOA 3DNKA 3FSZA 3KLKA 3VXRD 1J8KA 1QASA 3OXRA 1IL1B 5E8DL 3RIFF 2VUYA 4CW1B 5IJCC 1UUSA 2I25N 3CFEA 1MQKH 1JZ8A 3M7FB 2JQYA 2Y7SA 1F2XK 4IKLA 2NDFA 3QRAA 5KAIO 4JFXB 3Q8BA 4BQ8A 5FPIA 3BPOB 2VR4A 3D3VA 1Q9FA 4B9ZA 1J5CA 3O2DA 3AS3A 4P2RA 4GSDH 2C9AA 4A66A 1S7TA 4O3XB 4XH2B 1KBGH 4LOEA 3CSFA 4L4TB 1N6QL 4MB1A 3FT1A 5DJ2A 5I0VA 1OSMA 4D9QD 1JZHA 3Q0HA 5LBVA 2G5BA 2ZQKA 1JHLL 3TCLB 3L5XH 5IVZA 1NFAA 4O49A 3NIDE 4OT1L 4P57A 4B60A 1U33A 2EQDA 2X4PB 4X5WB 3TV8A 2JJSA 4D3CH 4AITA 3FSVA 3S88L 1MFAH 5I8KL 4KZ0A 3GMPA 4CC0A 2NXYB 2EDTA 1O0VA 3QFDA 3OKYA 4LARL 1IIKA 2L7QA 1SQ2N 2ITCB 4UM8B 3T3PB 4N8VG 1G7JA 5DHEA 3IPFA 5SWZE 4OD2A 2FQDA 1MHEB 4MHHG 2EE2A 3K80A 1V3MA 3HZVB 3ZL4H 2G3XA 2H3XC 4PJ5B 1G9MC 3NJIA 2AI0L 3CDYA 3E7JA 1KTDB 3CH8A 3NVQA 3QXDB 3VWKB 2FJFB 4R2GC 3IMSA 2CBPA 3RJDA 4HBQA 1FFQA 3ZZSA 3RBGA 5J12B 4AVJA 5I5MA 4JMXA 1WC7B 3ZE1B 3V4UH 3SGKC 2Q7YA 4Y7MA 5I74B 5C3LD 3KM2A 4JEGB 1TR7A 2IWWA 4UMSA 5F97E 1UQSA 5HHPA 3G3LA 1Z5LA 1JNHA 1R5VA 3NFSL 2CO6A 4Y2OA 1WGOA 4PHXA 4J6RH 3VXSD 3A67L 2FO4A 4NPKA 2BIHA 4LEEA 1CMOA 2EXWC 5EN3A 2KBGA 2VTFA 3EJTA 3JTTA 4U33A 4WDIA 1TTGA 5EC1B 5IUCA 1YMME 1WAPA 2OR9H 5T3XE 5IFAL 2KLTA 1MHCB 4CADA 5IW6A 3BMVA 3G5YA 4HBCL 3ESVF 5KANI 4L4JA 3IS0X 2Q8BL 5ADPH 2X4SA 5IHHA 2CGZA 4WJ5B 3A6CH 4NUJA 4DFHA 4KJWD 3WNNA 4RDQG 2IH3A 1G6RA 1AE6H 3TBCA 4AYFA 1S7SA 1BWMA 4BCYA 2BRRH 1JGLL 4YDKH 1C08B 2VMEA 5KSBF 1T6WA 1YS5A 3TA3C 3NJNA 4MD4B 2FEEL 3H2WA 1P2CA 4HIJA 4J23A 2G5UA 4OCYL 3MKGA 3GIZH 5DCCA 2QVKA 2ZUUA 5EULV 5T33L 4PJIA 3VE2A 2CO7A 4LVOC 1HE8A 3TJHC 2EZ0D 5FM5M 4JFQA 3MCKA 1QBBA 1RU9L 2PCFB 2WVVB 1W80A 4D65A 2G2PA 2X4RB 3TYFA 4N90E 3CHQA 4OBSA 5BV7B 4PB9H 1QA9A 1A6AB 4U1GB 2G0KA 2VWEC 5MHSD 3LRLA 1HNGA 2F5BL 3UEQA 3KPMA 1I1YA 4BRVA 1A3RH 4DO5A 2WBKA 4E9LA 3T1FA 3CSGA 4AL8L 3MV9E 4OIIH 4YLBA 4HMEA 4HKZA 2FVNA 2VMJA 3FRPA 3DJZA 3I74A 3NPSC 4ORGB 5E6SB 3DXAB 2JI2A 4YR6A 4ELKB 3EJUA 5IOKA 4F15C 4EI5A 5C9KA 4LLUA 2YLHA 3FT3A 4DP5X 4HDIA 3MNDA 2YZ8A 5A2JH 2X6CA 5T8IA 5KSAA 43C9B 1ZGLP 2QELA 3WN5C 3KLQA 1FCGA 4HHAA 4NN5B 4X80H 5HHNB 4U6VL 3NDZE 5JPNC 5T5NF 3L54A 5DO8A 4XOEA 4NQXB 1T7XA 1FLTX 5G39A 2ZYRA 4NPYA 1UD4A 3H9SA 4G7YH 1XGYH 2IDFA 4JCLA 1M57B 3B9EA 3VGBA 2E76C 4JDTH 1NCOA 3AACA 1RUML 2J25A 4ZX6A 5I1CH 5FLVA 1BZ8A 4FQXD 3SY0B 2E46A 32C2B 3CQPA 5DU7A 5GRZA 3IMBA 4JO5A 2AEIT 2J1KA 2XQBL 1HINH 4LSTH 1EXUB 2BNRB 2E4TA 4OIAA 1KN2L 4P46B 4NZFA 5D6DC 3RI5K 3FUDA 3AA7B 1F18A 4QWWC 4Z7VB 5E23A 5LG6A 5D9SA 5GRXG 2UXTA 2UZXA 2LVCA 3POXA 1Y18B 2IFFH 2DH3A 5KS9F 1M7XA 3VH8A 1BECA 4G9FE 4BKLA 3PG2A 3Q43A 4JK0D 4HP5A 4FRXA 2DLTA 3F8UB 5EO1B 1PKQB 3RL1B 3UP1A 2MHAA 3MV7A 1LEIB 4ODXA 3C60D 5CJBA 4JHAL 1UXSB 1QNZL 1CT8B 3GGWA 4RAUA 2R2HB 5B4MC 1SUJA 1OANA 3IETB 2FL5B 1NICA 2HFTA 2C7FA 2CPCA 2GT9B 5C3TA 5HD8C 2XBZA 1D5BB 3IMWA 1RUPH 2QGCA 3ROOA 3NFNB 3DK0A 3H4FA 4N6RA 4NQEB 5JUEH 2BJMH 2WQAA 1AP2B 3AAZA 4QHKJ 4GQZA 5ES4B 2HJKB 4YDVB 3L8QA 1KBWA 4ODSL 1R75A 4PJXE 3WI4A 4RNRB 4S1RH 3QCTH 1WBZB 3QDJD 3L2NA 5E8EB 3LEYH 3OB0K 1AD0A 5CLYA 5CEZD 3GMMA 1JNJA 4YGAB 1HT6A 3DUHA 5A2CA 2QVTA 3K46A 1OM3H 1KJ2B 2H1LM 1AHWB 2VC2B 3FFDA 3QR0A 3B5HA 4JRYD 1H8NA 4WW2B 4RDBA 1OW0C 3QO0B 4GT0A 3IWUA 1Z1WA 2Q5BA 2NXYC 4DJMA 1L0XA 3B37A 3D0VB 5BVJA 1RL1A 3FTGB 4UT6A 5FFOA 3ZGIA 2EKJA 1OAQL 3L17A 4HPOH 1D5IH 1FFPA 3SY6A 1ZLSL 2UZYB 4PTUB 4ZX3A 4XNMB 2MWCA 1SBBA 5PAZA 2FATL 2ZOLB 3QISA 3X3GH 2WXMA 1J9SA 4PRNA 3HI6H 1NZRA 1I3RB 4MA7L 3HPLA 3I9AA 5JDJA 1RSFA 2XOTA 4LF3A 3UZQA 4F1SA 1MIMH 4P2YA 1MLCB 2G60H 2NSQA 1FNAA 4FLQA 3BDYH 4ZFFA 2FZ3A 5J12C 3N85L 3LTVA 2XFGB 5AVSB 4GXVL 5I74C 3HR6A 4DK6A 1SY6A 3NABL 2BLFA 1CE6B 4JO2L 3RVTC 4L5FE 2BSBA 1GS7A 4N8VB 2J4WL 4MNGE 2HJLA 4TKWA 1S9VA 1AKPA 1ZANH 4KMLB 3U6XA 2CHWA 5B38G 4KUCD 1EDQA 2IDCA 2VRAA 1A9VA 1C1EH 3QQ3A 4R0LC 4UYPA 3QNZB 1FC1A 2JFCA 4BWTA 5BXFA 1DANU 3FB8B 3EJYC 2PXYA 1NBYA 3U0PB 4RL9A 2DM2A 4NO0B 3ENEA 5AENA 1I8LA 2OJEB 2FAUA 4X6BA 5I73B 2K6WA 1AKJD 5IMKB 5SWZD 3BYYA 1IGJA 2BO0A 1T0NA 2EDOA 3GSVB 4H1LB 1HQ4B 3PAZA 3LHAA 1B0RB 1K4CB 1XBDA 3H42H 5IHZB 2O1AA 5EBLA 4DK3A 4J4PD 2WXRA 5EU7E 4ODUA 4PJ7E 5E95B 4W68A 3VFGL 2B0SH 4UTBA 4OB5L 4ZUTB 3O81A 5DZPA 4PV9B 3NCJH 2O5XL 1ET7A 4OKVA 1SJXA 2B4CH 4LHQB 5FHAH 3D87B 4X5RA 3KLLA 3H1ZA 1BREA 1VAHA 1ODUA 4NWTH 4Z8FL 1FP5A 1NL0H 4MJIA 3VFTA 2X7LA 1ZGLM 4FZNA 4GT7A 4DP6X 5JPMB 1CDBA 3QPXL 4MSWB 3VGDA 4Z3HA 3L7FB 2YD5A 4LT7A 5B21A 4NM4L 3FQXA 2GUOA 4WTZG 3EAKA 3RE0A 2K3HA 4OQTL 2E9WA 4AEHL 2AXWA 1J11A 1NGPL 2WSPA 1YMMD 5T3XD 4M43L 4X8JA 2BSRB 1BBDL 4N58A 1MCFA 5H2BB 1ZLUH 3A6BL 3ABKB 2LFUA 3AQZA 1JCKA 4E68A 5DXWA 1ZLVH 1LNUA 4LDEB 1WWAX 4EVNB 4OLWL 2Y3AA 3LQMA 3BLPX 1BM3H 2VB5A 3L3IA 5JHAA 5CIPA 5I0YA 4RAVA 5AW3B 2ZPKL 2AFNA 3X12A 3QDGA 4ZPVB 1Y1DA 5G3AA 3BP6A 1MNUH 3H2PA 4R3SB 3N40F 4HK0B 4IBVA 4OFYA 1KWGA 3SQBB 1QR1A 1MF2H 2GITA 3MRFA 1JPGB 3LKRA 2Q6WB 3WEMA 3MVSA 1C5DA 4FZEH 1RKRA 1GH7A 4Y2DB 1GYVA 4F7EB 1VDGA 4M8QA 5ANME 4LASL 3ZXAC 5HI5D 2MNHA 3ARXA 1CICB 2ENYA