3KVDD

Crystal structure of the neisseria meningitidis factor h binding protein, fhbp (gna1870) at 2.0 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
242
structure length
242
Chain Sequence
AGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the uncomplexed Neisseria meningitidis factor H-binding protein fHbp (rLP2086).
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Protein binding
molecule keywords Lipoprotein
total genus 60
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 3kvdD02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3kvdD01
2KC0A 3KVDD 2Y7SA 4O4UA 3HOEA 3V8UA 3PQSA 5EE2A 4O3WA 2W81C 2W80C 3HOLA 4AYEC 5T5FA 3UAQA 4AYID 1YS5A 2LFUA 4O3YA 3VE1A 4O3XB 2KDYA 4O49A 4U9CA 4AYDC 4QQ1A 2YPVA 4AYMC 3VE2A 4O4XA 3PQUA 4O3ZA 4AYNA 4Z3TA
chains in the Genus database with same CATH superfamily
1KWGA 2HT4C 4YBQD 3IJ9A 3OMIB 4PG2A 4BHUI 4OLWL 3WFCH 2R2EB 4IRJD 3DVFA 4WW2F 3S36X 4NZTL 1S2EA 4UOQA 5F3HA 3CUPA 4OD1H 5B21A 2J20A 1AJ7H 3F8UB 2OXGA 2HVKA 1DFXA 1RIVH 1VA9A 2X4OA 1HXXA 2F5AH 2YPKA 4QHKJ 1CG9B 5C7XH 4W1TA 4XP4H 1PX8A 4GXUN 1TUPA 4A63A 1X9QA 4P2AA 4F80A 4ILDA 4CA4A 3NH7H 4GHBA 5L9DL 1P7KA 5B8CA 5ICUA 4CKQA 5KW9H 3IU4H 3O3AB 2FQGA 4IGBA 5I30L 3B2XA 4R7XA 3W2DL 2IWWA 4HPOH 5GRXG 3QDGD 5I1EL 5EEYA 1HE8A 2CO6A 3HBZA 1KTDB 1OCZB 1UYWH 1KC5H 2GHZA 5SWSA 3T4YB 5DMGC 1CN4A 1NOFA 1QO3B 1O9WA 2JF1A 3C5SA 4OZFH 3FJTA 4TLUA 1FFNA 5DDHA 4MKTA 4JO1H 2BNRE 4NX0A 3X14A 5EN2A 4MXQD 4LLDA 2XTRA 2PNDA 3JT0A 3THML 2NNCA 3MREB 2R4RL 5CD3B 2BZ7A 2RFXA 4X9IA 3BRYA 3DZMA 5DL6A 3NESA 4UB0H 1CLCA 3CDGA 4F7MA 3QUXA 1MI5A 3MX0B 4MCYA 4ZTOH 4B95C 4V33A 3S3CB 1OQOA 3UTTD 1QPXA 5D7LB 2JSFA 3OR6A 2APXA 2ZCKH 1IGFH 3FYEB 4UQ2A 3A5VA 5EEWA 5J6SA 3HZVB 4UQEA 4D94A 2Z6FA 1IVLA 3C8HA 5I74C 1CCZA 1Z6JT 2C1PB 4RRPG 3G6JF 4MNQE 1N2RB 2K70A 1F1GA 2ZUQC 1HHGA 3M46A 4DP0X 2AAAA 2CBTA 2QKSA 3EFFA 4XWGH 2AITA 1X9LA 3I9AA 5LGYA 2P8LB 1T5XA 5I1DB 4GAYA 4JFSA 3D69B 2WXLA 4N8VB 3KZIO 1PNDA 3CC5A 1C5CH 3HZKB 1TEGA 3LOWA 4PGEA 5KSAC 1YA5A 3POHA 4EXKA 1IGTB 1P4BH 4H8HA 4QJ3B 5L2JB 2HP4A 4D8OA 5I75B 4U4IA 4I2XB 2F7IA 1W6WA 5C0JB 4G9FB 2K4AA 4KPHL 1NCWH 5IV2B 4GQZA 4TMPA 2AABH 4ZW8A 1KT2A 4JFEA 4NKOB 2F1TA 4ZO8A 4BFEA 4I18A 2VDPH 2R2HB 4YZFE 1MHPH 1MW2A 2CMRH 1YQ2A 4KROB 1NMAH 5EN3A 2QMKA 5CN1A 2Q2LA 2O5ZL 4APXB 2PWHA 3ZTNH 3U4BH 2IGLA 1SYSA 1LL1A 2Z35B 3FQ4A 4DPBX 2ARJA 5AW4B 2V33A 1ZLSL 4WZ9A 1OB1A 2Y2WA 3GM8A 1U8MB 1VGEH 1UFUA 2R69L 3BAJA 2CJUH 4NP9A 4KKPA 1BZDA 3H7BA 1TJHL 4G9DA 1YNLH 3WNMA 1NEZA 2DYPD 1DSYA 2K6ZA 1JMXA 4LAJH 1JWSA 1U8HA 1TPXB 4M93B 3MDJA 5I16A 4GNKB 3AAZB 2UXFA 1MKFA 4OJEH 5LG1A 3J7HA 4JRXB 4OZGB 3BH8B 3MTRA 3TYGH 4G76A 2JB6B 2Y1ZA 3S3DB 3II1A 3BQUA 1A6TB 2HRLA 3UAJA 2XY1A 3IDYC 2Y2YA 4QTHA 4HLEA 1E2VA 3QDMD 3QEQB 1HKLH 5K59E 3ZTJH 2WBJA 3HS8A 1GZPB 1AYRA 4Q7DA 4F7EB 1D5XA 5CMAB 2DDQH 4MA8L 1M7UA 4X7CC 3T77A 1BFSA 5AD0B 5MERA 1M1XA 1UG9A 2IANB 3KWUA 1ACXA 3WXWH 4JFYA 5LAPA 1R24B 1OAUH 3OKLB 2JQAA 2WQVA 2O5ZH 3FONB 3S5LG 3ZE2E 1UZ8B 3BH8A 1J0ZA 2FNBA 2XWTA 3BKMH 3GMNB 1UB5B 2ZWLT 5DHMC 4ZUUB 1RV6X 3X3GL 1EAPA 1YY8B 4JZOA 4YHIA 4EMZA 4D5UA 1I1CA 3D2TA 4M62H 4X5LA 1MCOH 4XC1H 3JWOH 1DQJA 1JWSB 1U8HB 3TGXA 2KXPA 4OBRA 5DK0B 1KN4L 1IRAY 1IGTA 3CHRA 3HE6A 2VQ1A 4P2RE 3TEZA 2WZAA 4C47A 5FHBH 4PV1C 4L9LA 5KVGH 4FQHA 2OK0H 2NY6D 3MVSA 1EBPA 1WWCA 1D5MB 4ANKA 3L08A 2JCWA 2EXWD 3KWWB 5BQDA 2XG4A 5KAIO 4GKNA 4K94H 1KCKA 3SY0A 3D33A 4XXCA 4A67A 5KSBA 5CEZE 5AW8B 1M53A 1OF2B 2OXHA 4FRTA 5FUCE 3SDAA 3LZPA 4YHKL 3GB7A 1KTRL 1G7JA 4W9FC 3S97C 1HYSD 3FW6A 4UT7H 2OMUB 4MTMA 1S3KL 5K9QG 2CHZA 2D7NA 4AIEA 1Q0XL 1EEYA 4H8PA 5I8CA 1XT5A 1CC3A 4JM4H 4ZMXA 4P9ML 4LLVB 4KK9C 2VW7A 3VVVA 4BRJA 1MJ7L 1QFWI 3DRTB 3FN0L 3H4HA 2VDRH 3IPFA 3PABB 2XZZA 4XOBA 2QQKH 1CICD 2RQEA 3IB4A 4ANVA 1A1MA 2P47B 2UWEF 4AENA 3K6SB 3VD1A 1CXKA 1YMHA 2XRAL 2IGFL 3BESR 4V1DB 4XNBA 3QA3B 5JOPE 5T1MA 4LP5A 4QKXB 1OXYA 4YFDB 3TA3C 4P5SA 1BPVA 1WIUA 1LWHA 4JM2F 4HCRH 2JTYA 1RUAH 1WFOA 2A77H 4NDMB 3OHXB 4JN2B 3VG0L 2GJPA 3H42H 3SBQA 4PI0A 4XMZA 5FYLE 4X9HA 1F86A 5IG7A 4P4KC 1JE6A 3O3AA 3O2VL 3HLKA 1OTSC 3U1SL 1UZ8A 3CX5J 2YD3A 1XF5B 1JNNH 3QWNA 4MMZB 2OR8A 2K8QA 5IFJB 4U6YA 3CVIL 4U49A 4FQCH 3V6OE 1T6BX 1JYXA 3QQ9D 4XO3A 1BT9A 3ULUF 2NTSP 2YD9A 2ISDA 2Q6WA 2EDJA 4OLZL 2M07A 3CHOA 3FTXA 3OTTA 1CLYH 1LQBC 3G08A 3EGXA 2ZXDA 3DHMA 2HLAB 5C7XL 4WU5B 5IKCA 1OP3H 5C0RH 2CBQA 3P4LA 3IGFA 1IT9H 1C9SA 3P0GB 2EDEA 1L6XA 5I6OA 4PJ9B 4YFLI 2ZXCA 2E6PA 4OZ4B 2YBRA 4OUUB 1YSOA 1DSFL 2WQUA 4RDQG 5D5DA 2VLLB 2BZDA 3MYZA 4R4BB 1LK3L 1K5NB 3VDBA 3Q13A 3QZWA 4KK5C 4Q9QH 3UTSD 3VG0H 4BQBA 1BOGB 5TH2A 4HWZA 5BRZE 4WUUD 4TUOB 1J8HA 4FZLA 4JFFD 1LJMA 4EN2A 2VSDA 2H47C 4A6YB 1G1OA 3O3DB 5KJ4A 4FA6A 1YPZB 1BIIB 4L3CB 2QPDB 3NCWA 4AQ1C 5F72S 4WGWB 2YKLH 4I0PA 3N9GH 3CMOH 3NRPA 4E41B 4XBPB 3DX9A 5C0ND 1NL0H 4XBEL 2LW3A 2WZ5A 2Z34A 3PXLA 5GS0C 1BFVL 2NUPA 4N0YL 2W9EH 2X70A 4JRLA 4NAQA 3O3UN 1H19A 1D6VH 4R96B 2WD0A 1SXCA 4UQ9A 2HYMA 3MRRA 1LMIA 4X6DE 1XHHA 4ZMOA 1E2ZA 3BT0A 4OAWA 4WW2C 2SEBB 4X5WB 1NKGA 2HFFA 3VXUA 3GSXA 2CA3A 4L3CA 3QRAA 4AYEC 1HDMA 1MIML 5TPWH 3VUAA 2AC0A 2HH0L 4ONHA 4Y19A 3BVVA 1JGEB 3NJJA 1UURA 4W81A 4AGPA 5BVPH 1AR1C 4KTDH 2DQCL 5M94B 4DEPC 2UZIH 4HGKC 4A6YH 3KWVA 1HAUA 1UGNA 1XF5A 1H6EA 5DTFB 2MNWA 5I8OH 5B39B 2CGYA 4QOKD 2XIDA 1NLDH 3V55A 2A2QT 1SMOA 2BINA 3X13B 2F61A 4Y9FA 1R3JA 3GSOB 3QXDA 5CJXA 3LEXA 4WNQB 2EDBA 2AQTA 1MLCB 2Y07L 3KW7A 3WGUB 4TVPD 3TV3H 1DE4B 3GXPA 3TIEB 1FC2D 1KBPA 5AVWB 5BXFA 1UCBH 3CFEB 2BP0B 1OT2A 3LNFA 1KBGL 2JB6A 1VLXA 2LFUA 1ZOXA 2HVJB 3FQUA 4LLMA 4M7KL 1OPGL 5EEUA 3VZTX 3QIUA 4WI2A 3RVXC 3ROLA 5IB2B 4KXDA 1MFAL 4BCZA 4EI5D 2CJUL 4N87A 3CFTA 3OKOA 1SLVA 3DARA 1AH1A 2AZUA 4M8UA 5EE2A 4GAGL 2UUDK 3RWIA 5DS8B 3V4PL 2GAZA 1IM3A 3RVWD 4MD0B 4GSRA 1RP8A 3VNYA 4YDIH 3RNKA 4HJ1A 2ARJB 2RR3A 2ZIDA 2AJYL 4FFZA 4N0UE 1NCCL 3EIFA 1CT8B 4PJXF 4DGYH 2BDNH 3QJXA 4NQSB 3V4UL 1S8DA 2AEPH 4LSPL 2MJWA 1DFBH 4FERA 4LGSB 5IF0A 1QFOA 1YAIA 4NKOA 4P06A 3NIGF 1I85C 4M61A 2GI0A 4ORGA 1FGVH 4L9LB 1OW0C 3N06B 1KCRH 3BH4A 2P7TB 1JD7A 2EDKA 4L37B 1AHKA 4IIZA 3K4AA 4YSQA 1IGYB 1ONQA 3MNMA 3MRDA 5M7QA 1URLA 1TQVA 2WUCL 2X6UA 4U7KA 4TULL 2BH0A 1NIBA 3MNZA 3T1FB 5IUCA 4ZFOA 3QUZA 2FWUA 2APSA 1WAAF 5EG6C 5D2LB 2YRPA 5I19L 3AA0A 3A47A 3V0WH 5JW3L 2F5BL 5KWYC 3MRFA 3S88L 2KS0A 3WFDL 1MCOL 4GAYB 4NQDE 4F2FA 3JWOL 4L0ZA 3WHE0 1E6JL 1GZHC 4PVLA 1A7OH 2X4TA 3L2LA 3HFFA 3JTSB 3RGBA 1HXMB 4UZUA 4J23A 4Y4FD 5BRQA 1OTTC 3UTTB 1KZQA 4HEMA 3GO1H 1KMGA 3T65A 4F8QA 1GJUA 4NQDA 3SZKC 2JKWA 2YGVA 4UTAA 1QLRB 1MFUA 5I1GL 1Y07A 3PWNB 4A04A 3KHQA 4XO5A 2J4WL 3WV0A 3GBLA 4YE0A 3VCLA 1NEZG 3TZVC 1CFBA 1CIDA 1ED3B 1I3GH 5ALCL 3EMNX 1QRNA 2VDOB 4L4JA 4U1KB 4PWEA 4U1GC 4UQAA 4C55A 3M6DA 3UMNA 2X10A 3R4DA 2YC1A 3TYGL 4NN5B 4XNMA 2OR9H 3ATAA 1A02N 5K5YA 4OFDA 2KZ1B 1VAHA 3UABA 3ZHFA 3T24A 2DQTH 4X8GA 1N64H 3QI9C 4FQJL 4XP9H 1DVFC 4NQDB 4HLZH 5FB8B 3QIWA 2O6EA 3TBSB 2C26A 3TZVB 3LKQB 4Q9RL 1U33A 2W91A 1L0XA 3BGAA 3OLIA 3TO4D 2V5TA 4Z3IA 5IY5B 1JUFB 4PWHA 2B15A 3PHQB 4WV1C 1TMCB 4O4UA 3B2PA 3VB9A 2FTAA 5DJDB 1JMZA 3T0SA 2IWFA 2NY1C 5F8RC 3UL4A 1NCBH 1IV8A 4JKPL 5DWUL 3NFSL 1AQDA 4F1ZA 3VGGA 1MDAA 2WJ7A 3X1FA 4QNPE 4FCAA 2F53D 2NYKA 4LVHC 3IDIA 2ICEA 4Z7QF 4L3EB 4QRRD 4HW6A 2G30A 3P77A 4YE4L 1I8UA 4TS6A 3WI9A 4UOW1 4ZMPA 3RX8A 5JLZA 3QG6A 3S0PA 3SBPA 1A9BA 3VAEA 4Y7MA 3UPRB 1NICA 1U8NB 5AZEH 2F19H 3T2LA 1RJCA 4ELKB 2QDVA 2L8AA 4WDIB 3VGFA 4OW6A 3PDOA 1KEGL 1DVQA 2D7TH 3L9YA 1OM3L 3FAWA 1NDMA 1U8KB 3UAJD 5I71B 3TV8A 5IVXE 2G3NA 5KSVA 3UTTA 2OJZL 3FCTA 3IS1X 1FJ1B 5DD5L 4FQXD 2HFEB 4AI7A 2F15A 1IGJA 4XXDA 3ZYJA 3PNRB 4RH4A 3KYOB 3POUA 4DQOH 1HNFA 4I1PA 1L9OA 4FEIA 4EI5A 3VY9X 4QRRB 4UU9A 4R7VA 2X40A 5TK4A 5IMOB 1U8OB 4YHML 2H6UA 4N2DA 5AL8A 4PSRA 1LK3H 1W0WB 3GPSA 3QFGA 5KS9A 4IJ3C 4MJIE 2O6PA 4OJCA 5IB2A 2X4QA 1Z3GL 5I15L 5FYKD 2BK8A 3H9YA 4IRSB 3CDGB 1N5AA 4F7MB 3U0TB 1JRHI 5DT1L 3ML9A 3DJZA 3LY6A 5KANI 1RIHL 4J4PC 4OFQA 4CRPA 2JELH 4Z0XA 3T3MB 1F6AA 5IFAL 1ED3A 3TTSA 4HS3A 4X7FC 1XO8A 1K8DB 2W0LA 1RU9H 4C83B 1NA8A 4MGXA 4TXVB 1TDQA 2P24B 3F01A 1Z5YD 5JMOC 5D72L 5JZ7C 2EDMA 5F6HJ 3QUMH 1IC0A 2W65B 2VNCA 4G8AC 1AGCB 2OMWB 4CMMB 3GMOA 4YDJB 3WNJA 4JNXA 2MNHA 4IDJL 2BRQA 1MCWW 3EJJX 2I9LA 3TNMA 2VCOA 1NC2B 3BQVA 4HDIB 4TNGA 3X13A 3WUWA 4RMTA 4AL8L 1CGSH 4B9JA 5BS0B 4O9HL 3C8KA 3RVXD 3CG8A 1FGNL 1MCKA 4IL6O 1DQML 3W2DH 2CUMA 2VLRB 2QT6A 4BH8B 3JZ7A 3S96B 5IJDC 1KB5H 3OWRA 3TJEL 2DLFH 3VXSB 3FFCB 3L4CA 1OSPL 3RWJA 5HPOA 1E4XL 2O5XH 2FGWL 2XXMB 3FULA 1OTUD 5CJOL 4PJCA 4L18A 3K6OA 2CSPA 4FXLA 4IBQA 1EAJA 1AC0A 1P7QD 1ZIAA 3H2WA 2GSMB 4X6FB 5T1KA 5HYQA 4U3SA 4AJ0A 3IM1A 3IDGB 4FFWD 2DQFB 3WIIL 2OMUA 3ZIMA 3MRQB 4QXVA 1IIIA 2VXQA 2YRBA 2OTUB 4DN3H 4PJ8D 1YRKA 5FUCC 1WZKA 3WAKA 3SKMA 3OKMB 1ASPA 2DWYA 5B39A 1BZOA 3D9AL 4KUCD 5FW6A 3NZ8A 4XO8A 3UROR 2N1KA 4IJTA 4R2GC 3VXOA 2OTWA 5FUZH 2Y9RT 3FPXA 2ZP0T 3GNML 4FQQA 2G0LA 4HIHA 5LGJB 4OLXH 1FZOA 5H4ZA 2F7RA 2MFNA 2FJHA 3CDZA 4OGAC 4QRRA 1RL1A 2HFFB 3D05A 3QZWB 4YSUA 3Q01A 4QCIB 4GFTB 2YBGA 5TE6H 3T6QC 1XZ0B 4JZOB 1PDKA 3ZDZE 3CFCH 5H2FO 1IJ9A 3CZEA 4O58L 2VR9A 3RB7A 3KPRB 4PS7A 1QKZH 4HT1L 3K71A 3QRFM 3BD5A 4P59L 2F18A 1ASQA 4PYHA 1ERNA 1OGAA 5AL0A 4G8GD 5EUOF 3REWB 1OP3K 4I0PD 4QRFA 2KXPB 1TYJA 1JUFA 2K1MA 1TPXC 3MLSH 3QC6X 1TJMA 4HPYL 4M93C 4B9GA 1KCRL 4X4ZA 5EBWA 1VENA 5L8LB 1SOKA 5T8IA 3W81A 1ANUA 3GMNA 3RDTD 4PJ9D 1XSKA 1ZKAA 5F9JA 4MXQC 3GDBA 4J3UA 1DVYA 2GT9A 3SGDH 3LKSA 2BNRD 4Z7VE 4P46D 2ZP8A 3VWKB 3CPLB 4BFJA 4NHCL 4G7YL 2YC1B 5K9QI 5KYYB 2N2LA 3V0WL 4PH8A 1BBJB 5D4IA 1QRNB 2JB5L 1F11A 1L9PA 3ALWA 3L6FB 4OJFH 5HDBB 5E2UH 2ZX8A 2VDPB 1K4CA 3FT2A 3QCVL 2PF6A 4K94C 4X9GA 3QJHA 5T3XH 3JWNE 4FSOA 2JMRA 3EGDB 3G9VA 1OT1A 2P5WB 5EF3A 1JNLH 3KPRA 3G5VB 3VWKC 4V1DA 1QBBA 1NAMA 4G8EB 4LEXH 4Z5RB 3VTTA 2CO7B 4YDLC 5KJRL 1C12A 5DS1A 3CXDL 2CHDA 3N43B 3D6GA 1T03H 1J0HA 4XH2A 4WI6A 5G5DB 4O00A 2J5LB 1TJIL 1IZJA 2RALA 2WO3B 4PJEA 3FNKA 3PG2A 4BBWA 3KPPA 3LIZH 2VDOL 3QJSB 3Q44A 5F1OB 4A7TA 1T2QL 3TN0B 4UUJB 4UQCA 4EE2A 2GTZB 4YDIL 4Z76A 3HRPA 2WXJA 3S5YA 1MRCH 3WN5B 3VXOB 1CL7I 1TJGH 1MXDA 2A4ZA 2NW3B 3E2HC 1I8LA 1M42A 3OV6A 3QUZB 3CU1A 3ILEA 4GT0A 3UYOD 3QDME 3QNXA 5C92A 5DJ2A 5KSBB 3DA4A 4QRUA 1ZHTA 5C6TL 3SIKA 4NJ9H 1IBFA 2VM9A 2QV4A 3QQDB 2ICES 4UQBA 5MP6L 5CGBA 1U91B 3UBGA 1RZ8A 3LN5B 5JXEC 2UY7B 3ZXAC 4ZI8A 5C0JA 1OL0A 1HOCA 3HB3C 3RA7H 3MC0A 4NFCA 2NNAA 2P80D 1G9MC 5IK3B 4JFHE 3GS0A 4JX0A 3E0GA 3LZLA 4YO0B 4FFZL 2P1YA 3ZTCC 5GV0A 4X4XA 4EI6A 3EXLA 2WB7A 3KPTA 4R5VA 4MD0A 1MCDA 2H2PD 4PN6A 2AV1A 3HJEA 1TZGL 2R29A 1B0WA 1YMMB 4GQQA 4NZJA 4UUJA 2NY0C 2VLRE 4Y2OB 1HHKA 4I9XA 3CSFA 4MJ2A 4BA8A 3TT1L 5C8JA 1K9TA 3NCYS 1ZT7A 1M1XB 2UWEA 3CHXA 3ATEA 3UGUA 1E65A 3ES6A 3FO2A 4XPHL 4H20H 3T0AA 1NSNL 1HXUA 2QHLA 2D7TL 4LCIH 2OMFA 3EFOB 4CBZA 5DVPA 3X1BA 1QFWH 5I66B 2H6OA 3R0MA 1I8IA 4WEEA 1AD9B 4L3AA 4BZ2A 1GY1A 1HSBA 3AQDA 4U3SB 3UCRA 3AWFA 4TM9A 1CZ8L 3U2SA 1BMZA 3MBWA 1SYVA 2ORBH 3G6JB 4UAHA 1QBLL 1NMBL 1SVBA 4D8PB 1A9BB 3MXVL 5J89A 5D1QD 5DK0A 3QIBA 3B7UX 5DRWB 1DVSA 4XHQA 1UXWA 4KI1A 4NO2B 1J87A 4U1NA 1S5IL 4GO9A 1G90A 4O51B 2K45A 2ZKWA 4N1CA 1F4XH 1Q9KB 3UMTA 2CO7A 1Q9OB 3OKNB 2YEVB 1YUHB 5FYJL 1NAMB 4G8EA 2ZSVA 3EBGA 4MHHG 4XTRC 2NY5C 2VISB 1RUMH 5C0BA 4KKCC 4ALAL 3O9WA 2R23A 2CUAA 2ZQKA 5FDWA 2G75A 1RIHH 2WQSA 4JO3L 4FP8L 4GCPA 4MQ7B 3EF7A 5AQ0A 4LNVA 4YVNA 2BOCB 2ENSA 3MLVH 2FZ3A 1KELH 4N9OB 4ONFH 5CSZB 3V7AG 2B14A 5GISH 5BS0A 4GEIA 2XV0A 4GFXA 2IH8A 3D08A 3VXUB 3FS9A 5GGVH 1YPZF 1AHWB 1T89C 1U0QA 4UTBH 3FQTB 1AZNA 3ARBD 2C7FA 2Q86A 1X5KA 1G6VK 5I1JH 4RSVA 2AXTO 4A2MA 5DZOA 1FE8H 4GSXA 4K3GA 2OKMA 3K71B 1RPQA 2TRYA 2H5UA 4QHUA 3UERA 3OPZH 5E94B 4GW4A 3DSNA 1G7HA 3QFJD 3C5JB 1E4HA 3R1GH 5DFVD 4YSRA 2IV8A 3TONA 1RK7A 1ZLUH 2CO1A 1U8LA 1C1EH 3WI5A 2DTML 3BZ4B 1EZVX 2NMSA 4JQXC 4QXTA 3P9MA 1U4EA 4LEOB 1JV2A 3JUYA 4NQCE 5EEZA 3UJJL 4Y5YB 2CKBB 4XCNA 1HL9A 3GJFB 2WLMA 2VN4A 4B6ZA 4DUXA 3PUUA 3V52H 2OTWB 2YZ1A 4DK5A 5JHDA 1X4ZA 4PSPA 4UV7L 4XHJD 3BP6A 2R9HD 1I9IL 3LS5L 4JMNA 5ADOL 4QAWA 5E2JA 3D52A 1MCHA 3B7SA 3U48A 2NW2A 2ZWYA 3A22A 2OQJA 4HPOL 2CRMA 1BF8A 3GSQA 2IH1A 4LBEB 1IEAB 4ZAKC 3UPGA 1OZUA 3N1FC 1PJWA 4PR5B 1KBVA 5E00B 3CHSA 1OY3B 1XH3A 4F27A 3O0RH 3Q6FA 5ID0B 1QSED 5L4JA 5JQIB 4GG6F 4WEMB 1ZJAA 2ARWA 2XTLA 3DLQR 1M3IA 2MMXA 2WKOA 4J3OD 2BSCA 2WIIA 1X5YA 4UT6H 3OKNA 3VFPB 4WHDA 3TWYA 2H0JA 1U8LB 1ZAGA 4X7SL 1ONQB 3GHEL 3SDDB 5JW4R 3M1BB 2A38A 3MRQA 5SWZE 4KKZA 1F90H 1JXFA 3IRCA 1BQKA 4J5VA 2YWYA 1LO2H 4ORGB 2Z8VC 3TBTB 2Z31B 3ZMEA 1I9RH 4GIPD 5JIPA 2GK0B 3KYKL 3PPEA 2DQGL 3ETBF 4XMPH 2CDEB 5FC9A 4YHZL 4KNQA 3GWJA 1MVUA 1AIZA 3AA7B 2OMVA 1GW0A 5DHVB 2QKIB 3KL0A 5C09D 1I31A 1TO4A 2XFGB 3FSVA 1D9KD 1OP4A 1B4JH 3RNKB 5A40E 4RIRA 4GOSA 3RWCA 2V17H 2QPFA 1GS6X 2GPZA 3IDNA 3QDGA 4G7SB 3MBXL 2VWEC 2FSDA 3VD4A 4Y2DD 3T0EC 3D8MA 2XZQH 3GRWH 5J3HC 1F4WL 1FAKT 3KPOB 3CUPB 1AXTH 5DUML 2HA1A 2Y2XA 5ETUA 5IJBC 2FO8A 1G9EA 5AW2B 1T66C 3O11A 3VNZA 3W11C 1RK1B 3PJNA 1KDJA 3SHSA 2XMXA 1JGVL 2DD8H 3Q5YA 1L5GB 2KLTA 1I8KA 2E7LC 1SDDB 2Y0HA 3G5YA 4NZ8A 1PIFA 4DSYA 1JHLL 3P2TA 5JXAL 1A7NL 1S4IA 2H3NA 3I75B 4D0BB 4PJ6A 2YAEA 2XQBL 4FHJA 4M9PA 4OIIL 4P2OC 1I7ZA 1JD9A 1FNLA 1SHMA 2IG2L 3J2PA 4FEMA 4HIJA 4KDTC 4MXVE 1YYCA 2D9QB 3QUYB 4FLRA 3QXTA 4PJBF 4WO4D 2SODB 5JXED 1PZUB 2ALWA 1E9PB 1MCRA 4WK0B 1Q9FA 1E8YA 4OCXL 4PJDF 4RLCA 2YPLA 1UOWA 4JCLA 1Z5HA 1TQUA 4ABVA 3W1ZA 1KGIA 4AJWA 3X1EA 1OCCB 1T1XB 3N3EA 5IB3A 2OMYB 2BVUA 3T9WA 4LPUA 5E8OA 4G59C 1BJ1J 1KB5A 3AGVA 4JG1L 2W0FA 4PWFA 4YL4A 3TPUA 4LGRB 3QUXB 2Q76A 4AK1A 1BIHA 1ID5I 5KTEL 3BYTA 5EBLB 1E28A 1H5BC 3QXUA 1T7XA 1J0IA 4HAGA 3NJTA 4ZUUA 4HK3J 5DUMH 1MFCL 4IRJB 3AQZA 3I6KA 3ZKSD 2HVJA 4M1GH 3WSQL 4X98B 1MCPL 3ZL4H 4Z78B 2E27L 2AQ3A 4B96A 2PCFB 4NT6A 4ODVL 4LLQA 4GSDL 2VQ1B 3I6GA 3PJSB 2VXSL 1YEHL 3V4VA 4WW2B 5CEXB 1TZHA 5JLZB 5C97A 5BV7C 2Q3ZA 4HG4K 3DHPA 3SYQA 4ZMQA 4XAKE 4AYID 2A9ML 4N2HA 5FB8A 2CDEA 1Z9OA 5DJZA 3BUQA 1IBGL 4ZW6A 4FUVA 5FO7B 1H9VA 2F8VA 2FWLB 5C3TA 2A99A 1F2QA 1PVHA 2J1WA 4YAQA 5CHNB 4TV3A 2OJEB 2UUDH 3BZDA 4DKEH 3X3GH 1I9EA 1GS7A 4JRXA 4OZGA 3PY9A 1AGEB 5SV3A 1EZUA 4KXBA 3F2LA 4K2UL 2NQ3A 3A0HO 4D9RE 1JZ5A 5GGQH 2VJ0A 4KXZI 3OKEB 3HAEA 4NRYA 1WAEA 3V5KA 3JV6B 1J0JA 2BSRA 2B9BA 4ODSH 1A0QL 4YDVB 5CJQH 5FWRA 1AZCA 5IM7A 4PMEA 4DKFL 1JSYA 4IKLA 2PPDA 2ODHA 1E9QA 1R0AL 1IBDA 1SYSB 4EN3A 2AKRB 1ZANH 4J2XA 3AT0A 3WKMH 4HUWB 1PEZA 3QS2A 1LWJA 3WFBH 5DHEA 2A1WL 1EO8H 3FF8A 1SXZA 1NIEA 3UDWA 5E8OB 1MJUH 3FQRB 4FTDA 3LKRB 4CVZB 4CSZA 4R2GB 1P1ZA 2VLJA 4P48A 5DGQA 2C3HA 3LS4L 4XT1C 4ZW7A 4IU2B 1JV2B 1YAZA 3TS8A 3VE1A 2XG5B 4XVUD 2J73A 1ORSB 5KVDH 3LK41 1RUKH 4YS4A 1LEIA 1UCTA 2Z0BA 2ZAIA 6PAZA 5HI3D 3GSUA 1ZHZA 3U46B 2YPVH 4EN3D 4FNSA 4LLWA 1RPKA 1O6SB 4WCYH 5T3ZE 3H3PH 3AREA 4FN0A 2VLMD 3CMOL 2ERJB 2R1YB 4X5XB 5CIPB 4JGUA 5IBUG 2WLIB 2ZWSA 3CJJA 4PWIA 3IXTB 2HG5A 5DJ0A 4PY8J 1UJTA 2BFVL 1B6DA 1A7RH 4PJCB 3FU6A 4UM8B 1F8TL 5CEZD 3IFNH 1DQDL 5TE4H 1SJHB 3EHBD 2Q3AA 3QUXD 3NJHA 3IU4L 3O3DA 5DC9B 2LU7A 2BJML 3ARBB 1XWVA 3QO0B 4K8RD 3EJCA 4L4VB 5IUSA 3AUWB 4N2MA 1M1SA 1E42A 1JNJA 2XN0A 1RD6A 1JPGB 1RVFH 2O5YL 4HV8A 1CD0A 3ZOAA 3MX0A 3Q1EA 4MCYB 2FGRA 3VXRD 3CN1A 4P23B 1HIMH 4LVOC 4NXSA 3V6FB 1P7QA 3GMOB 4YDJA 4BZ2L 4L1LA 2CDGB 2X4NA 1PZ5B 5IESH 3SKUD 3LNIA 3KWWA 1A4CA 1VIWA 5IGXH 1JWMB 1T3FA 3LEVH 2X9KA 5DHYA 1ILUA 3FAXA 5MHSD 1S7XB 4I18C 3IMTA 4DVRL 4MMXA 4PJXB 3RJOA 5MI0B 5I66A 3ZDWA 2APFA 4XMTA 3O0RL 2ZXGA 1J11A 1B4LA 1JERA 1GFQA 4NP4H 1MFNA 1FG2B 5EZIH 2EDFA 2XIBA 3RWJB 3FFCA 4TOYL 2D3VA 2YFOA 2OSXA 3E6HB 4PRAA 4GW1A 4AGLA 3H56A 3QPXL 1HHKB 3FONA 3VFOA 3C9NB 5JIIA 2JCCB 5JW4M 1K5WA 4JKKA 2VJ8A 4WO4A 1OPOA 2H3XC 3IGAB 5BUAA 3DVNB 4JRXD 1FI8C 2NNFA 3W9DA 1CXIA 2NY6C 2BNQB 5LBSH 3ZE1B 3SE9H 4KRPB 5FOBA 3RRQA 4NC2B 4MA7L 4R26H 1D9KB 4ZSOB 3T0WA 1I9RL 4RESB 2ZD0A 2J8OA 5FA4A 1DCEA 2DEYX 3ARFD 1LO0H 1MRDH 3WBDA 1WG3A 2B4CC 2MIZA 2VMDA 2BS71 2A9BA 1E5ZA 1QRND 4JHWH 3R1GL 3RDJA 5C0RL 1NIDA 2YD5A 5HDRA 1IIKA 1KLFB 1CMOA 4P2QD 3KNBA 2QELA 3GXDA 3DBXA 5HJ3A 1WBZB 5C9JB 4LHUD 2X05A 1BW8A 3ZE1F 2XWZA 1UHVA 2AK4A 3UJJH 1MIMH 4G9DB 3US9A 3VB8A 2LR4A 3MO1B 2WUBL 4L3EA 2AANA 3WMSA 5CILH 1Q9WA 5DGRA 3LK3B 4M8QB 4QRQA 2CXGA 2YIHA 4RGNB 3PQYA 4HBCL 5CCKH 4J4PD 4KZEH 4EVNA 5ADOH 4O3WA 5IMOA 1UOVA 2FEDC 3O2WH 1S7UA 4ODXB 3IWUA 1EVTC 2R0LL 1ROCA 3CFNA 3LPGA 2M1KA 4R7LA 5HPMB 5KSAB 4LL9A 2EXYD 5KBDA 4XXDB 2G5UA 1YYLL 3APNA 3MJ9L 4HKZB 4QHMB 5I18L 2Q0ZX 5DJXA 3U9UB 1T83A 3A2SX 3PNWA 4OUUA 2YAPA 4UIKL 4LARH 2OBGA 1QJ9A 3RUGF 5IIEB 1JK9A 1DUZA 3HHSB 4LHUA 3U7YH 4JM0A 1ZT4B 5TDPB 3CFQA 3MO1A 1GGUA 2B7DT 4I13B 2EH7H 1XL4A 2VISA 2W59A 4UINL 1R3KA 5H94A 2NUTA 5IM7B 2FQFA 1R3IH 5DUJA 1RHHB 1J05B 1RZ7L 2G9HB 1ICTA 1WBZA 3ULVL 4GJTB 1ZTXE 3AS1A 2OCFD 1GVIA 1HS6A 1SHWA 1YNKH 2XWBB 4H0IA 1FO0A 3DV6A 3OKLA 4OFYD 2W60A 2C4XA 1GC1L 3PP3K 4MX7A 5DMIH 2LU5A 2XV2A 3DXAE 3BHBB 1A7QH 2ZUXA 2Z35A 1TO5A 2RH0A 5FOJA 5GPRA 3RWEA 5L2KD 5LDUA 1J88A 1Q8MA 3BKML 5KOMC 3ZKNC 5AZ2L 4UOZA 5E08H 4YHOH 3AS2A 3MYJA 5DJ6A 3RVTD 2J5LC 4GI8A 3D4ZA 2BSTB 3CQPA 3D4GA 5D1XA 3WEBA 2ED7A 3BCFA 3QJOA 1KN4H 2D3LA 3HNVL 5A2LH 4O3YA 4AUJA 4NO0A 4RDBA 3F7VA 3HG4A 3NA4A 4U1SB 4Z0BH 4KOBA 2DL9A 2F74B 5GRVK 1QSZA 3QJUB 1S7TA 4KGJA 2PCXA 3BVTA 4P4KA 3KBEA 1QLFB 5GTHO 2F6AA 2ZXEB 4RMVA 3AA1A 4Z7UF 1FUNA 3KJ6H 4JFOA 4M7KH 5HD8D 4QRSB 4EDXB 2ZKHH 5I19H 3DRTA 4BA0A 3MLUH 1FZJB 5D1QB 1F97A 1FFNB 1QFHA 1RMFL 4K8RH 4N3UA 4ONOA 4IDLA 3WIHA 3WY1A 2V9UA 4XGZA 5EBMA 1G9NC 2JV6A 2P8LA 1ZSDB 3VXTA 4PJFF 1IM3D 4L0PB 4EI5B 1GKEA 2AK1L 4ZTEA 4EN3C 2NY2D 4NQEE 5I17B 5CLXA 4B53A 3VE2A 1V3MA 4X9FA 4OCRH 2G3MA 5C8JB 5ICZA 1G4RA 3NCFB 3UH8A 2JE8A 1ZD6A 3UTSB 1ZLWH 3VWJA 3A6BL 3O0LA 5I0VA 3ML8A 4QXWA 5D7LA 3V8OA 2JKNA 2VL5B 3AJ7A 3P2DA 5D7LE 4W4NA 4QHKI 3ZY7A 3JYCA 3MODH 2EC8A 2Y7LA 3S35H 3O11B 4Q9CA 3V6ZB 4LL4A 1PZBA 3NSFA 1GY2A 2EXWC 2J88H 3W0WD 5GS2H 4JFED 3FK3A 3OL2A 2PN5A 3QQ9C 3U7WL 3EF4A 4L29A 4QYOA 4PJ8C 4UIMB 4Y9GA 5TQ2H 2X4SB 1VACB 2H1PL 1QX1A 1PG7W 2JKSA 2X0UA 3B2VH 5D1XE 5FLUA 3BE1H 3QDGB 3HVDA 3S8WA 5IF0B 3WUWB 2DI8A 3C09C 3OWEA 3RWFB 1FIGL 5KS9F 2HAZA 4WCYL 1LO5A 3DI3B 4HXBH 4J8RA 3WJMB 5C3LD 3QUHA 1SMDA 3ESVF 5C0GA 1FPTL 4G83A 5KYYA 1MI5D 1WITA 3VX1A 2BMKB 3BUIA 3IYLW 5C70A 1ZVYA 5I1LA 2WY3B 3CMGA 4NHUB 1CD1B 4JO8A 1IC4L 4I8DA 1I1FB 1AGFB 1ITCA 4M48H 1LTXA 4AQZA 3REVB 3U0PB 3WO3B 43CAA 5AYQA 4HUUB 1F6AB 2WN3A 1R9FA 4NUJA 2QZQA 3WI4A 4E9WA 4HIPA 4Z0XB 4JQVA 2X09A 4NO5A 3L8QA 2AJZB 1N8ZA 5IVZA 3QSKB 5LKNA 2GCYB 3GM0A 3H7BB 3L3HB 3SY6A 5E6IA 5HDQL 3TO4C 1PCXA 3C5SB 4ZPVB 2D7OA 1IC5L 3FRPB 1NCOA 4ZZFA 2Y06L 5C0NC 2GK2A 2OL3B 2JLPA 4OLEA 3SKOB 5I6KA 4CVXA 2R27A 4XX1E 3QAZC 2FB4H 4GINA 2ZUWA 4MJ5B 4XBGA 4FQ2H 5JPMB 3VGDA 2VLJD 5CR8A 3BO8A 3RBSA 2I85A 2C5DC 5ALBH 2YO3A 1MCFA 3CDZB 4LASH 1M9SA 4YAQB 4PJCF 2FX7H 4ANWA 4G5AA 1U92A 5DVNA 2CALA 4NNXB 5C86A 3AM8A 5ANME 2CXKA 2V8MA 5I5JA 3W11D 5L8JB 1U8NA 3LEYL 1H3WM 1KTCA 3BKYL 4CUCA 1VDGA 4HXAL 1GGIH 1TENA 6FABL 1BOGA 4Q9BA 3WTSA 2H2PC 3DTDA 3AQXA 4WGKA 5E8DH 5ERWB 3QEGH 3D09A 4U2ZA 4XCFH 4BK8A 4PRIE 2R8SL 2N2MA 2WPGA 3EKCA 3PHOA 1H3VA 3FOMB 3MCKB 2I60H 3Q8FA 1RU9L 1EGJA 4NJAH 4NZUL 4KV5F 2ICWA 1EJ8A 3JWDL 2XG6A 1JPSL 2X4UB 3SE4A 2WVVB 1F58L 4XAKD 2X2YA 4K5LA 5DJDA 4F33A 1F4YH 2D7QA 3PQYE 1KGUA 3DX9B 5ECJE 4LEBA 1Q0EA 3V52L 1OSYA 3BGFC 3VFWB 1NLBL 2ZNWA 4Z7WA 1AI1H 4LSTL 4ENEC 3TBSA 1IO4C 3HC3H 2VZVA 4C4KT 1AMXA 4FQ2L 1H0DB 2A73A 4FNTA 5E1GA 43C9B 1YQVL 3MXWL 2PTUA 1A7BA 5AFUK 2QADC 5KOVC 1BECA 1PD1A 4AC4A 3VD0A 4X5RA 4LVHB 1HHGB 2WJRA 1EFXD 1T1YA 4X4ME 1CDCA 3O4OC 3CV5A 2KPNA 3QUYA 2YAHA 3PWPA 1RURL 2GFBB 3VE0B 3BGFB 3GLDA 3MAWA 4LRIA 3TVMB 3QIBB 3IAPA 4XOAA 1WO2A 5CSGA 1N59A 3RY4A 4JFEE 3U6XA 2ZYSA 2OAAA 5HGAA 5BZDB 2HXAA 3THMH 5FECA 3MJ7A 1TQWA 1HSBB 4UT9H 1JV5B 1CGVA 3GIZH 5H2BA 1AIFB 5A7EA 1RK1A 4HETA 1YG9A 4FZMA 5LWYL 1UA6L 3EFOA 4NKDA 5LAXB 3QCUH 4IGBB 5EU7C 1U95A 3I3DA 1U2CA 1X7QA 2WKGA 3IFLL 1KTKE 1DBKH 3FQXA 1YEFH 2VH5H 2Z65C 2F7OA 4OCYL 4M1CC 2AI0H 3Q2VA 4L23A 3W56A 4IDJH 3ARUA 2ZXQA 3LQAC 4XPFH 3CXDH 2CZNA 3HNTL 5EU3A 1H0DA 2A73B 1S6NA 2M2DA 1OCWH 2YD2A 5CS7A 1U8OA 1JWUB 1C5BH 4PS3A 2YAOA 1JGIA 1KIPB 1OCOB 5E6YA 4I9WE 2IXQB 3L3KB 5F0MB 3MBED 3ME0A 3ZBMA 5TE6L 4AMKH 5CBEB 2B2XL 4HHWA 1WUZA 2EEBA 3IBEA 5F97E 4MYPA 4IOSA 3LRKA 1ECZA 1HOCB 1Q94B 3RTQD 2WVVA 4ETQB 1XH1A 1UM6L 4FXKA 1UT1A 2OX5A 4PJEF 4WDIA 3FQWA 5D7SL 1GJIA 1NUGA 1TFPA 2ZG2A 4Z7NF 3QHZL 3IFPA 3PHOB 4BK4A 1KPRB 1OEZW 3HE7A 5E7BA 3CVBA 1PAZA 5EU5B 1T4KA 1S8DB 3ZQXA 3W0WE 2YSSA 4KKBD 1IEBA 1YEDB 2ED9A 1A7PH 4ODTL 5DVLA 1HQ4A 5E56A 4U6XB 5HYSB 1DBMH 2GBVA 3MV9D 4LLVA 5DA4A 5TD4A 5CAYB 2CIKA 3AB0B 3WE6A 2XV3A 4XCCL 1A21A 5CO1A 5SWSE 4L9LC 4HULB 2R0LH 5CP7A 3SDDD 4HOXA 3HZMA 3NAAH 5E9DA 3R8QA 3VJ6A 5TH2B 2VB5A 2AEOA 4D0CA 1L0YA 4JO2L 1U21A 3RHWK 1T1YB 1PY9A 4N6QA 2UZYB 4ZYKA 4JCHA 1ET5A 3OB0K 4PJAE 3RP1A 2WWOA 3NSYA 4PGBA 2HTLC 4M00A 1I3GL 4FCHA 5ALCH 3N0AA 3PL6D 3L9BA 2VDLB 4ZPVA 4DUVA 3Q8EA 1NSNH 1RP9A 1NOAA 3HE6B 1YEIL 2VLJE 2LTQB 3ZT5A 2EVHA 1GA2A 4KDVA 4KOCA 1N19A 1IM9B 3SDDC 3NEXA 1X6LA 1H3GA 3RKDD 1L6ZA 4XP5L 2FATH 2XN9E 1J1OH 3CNKA 1S3KH 3REVA 2P8MB 4L3ED 4DUWA 3PWNA 3GBEA 2DDQL 1KJMA 4WTQA 4WTWA 1MJ8H 5D5MA 5DMIL 1X5FA 2R1XB 2VN3A 4P9MH 5DO2D 5J9PA 4JHAL 1WP6A 7CGTA 3IVKA 1HDMB 3D3VE 5CCGE 3R19A 3V8UA 4BE6A 2VN7A 3IJHA 1D5ZB 2WVUA 1KPVB 3P4MA 4A2LA 2H26A 1YMME 3Q3GA 2RTTA 4G42B 4GG8A 4IBZA 4P99A 5L2KE 4HIIB 3D0LB 3MRRB 3B3IA 2R0WL 5HGDB 5JIDA 4BIKA 3BVWA 4H26B 3NK4A 5C0AD 4JE4B 2X2HA 1PD6A 3CH1A 3DYOA 3RKDC 1F4HA 4K5NA 3BWAB 4DTGH 3OJ2C 4FX5A 4AEIL 3UZEC 1Q9KA 1U8QA 2K0RA 3S3SA 1H8NA 3SKOA 2VAAA 1TZ8A 4ONGL 3MROA 2OL3A 1TOXA 3S3PA 1EHLH 1JDDA 1RMFH 4K8RL 2YQBA 1CD9B 4DO4A 5DD5H 1YPZA 2DF3A 3O4LA 3CC5B 3HZKA 4U6TA 5FFLA 2E0PA 4LVEA 2XCMC 3QEQE 4U31A 5T5NF 1SGKA 1BLIA 4FG2A 5HY9A 5FO8B 4NC1C 1ETZA 5D4QA 3KLKA 3K4DA 1XAKA 1BREA 4BK5A 2EABA 3ZT7A 1AVAA 3C2AH 4YBLC 4JRWA 3LHAA 4GKNB 2Q5BA 2N0MA 3HBGA 2H1LM 5F88A 1PLCA 1IGIH 2K8MA 4EO5A 2VDRL 3PWPD 5EBMB 4FQHB 3MRFB 1BG9A 1CK0H 1IQDA 3GSRB 2CR0A 4U6HB 4LASL 3SYCA 3ASWA 1SY6L 4J8RB 3WJMA 3BP7A 5AAMC 5B7EA 3T71A 3HRZB 2V5MA 1DO6A 4OJDH 3EGXB 1RH8A 5HHNA 3T3ME 1KV7A 1BEYH 3L17A 1TU2A 2JCCF 1U3ZA 1QOKA 2P7TA 5D71L 3U9PL 3VD3A 4KXAA 3T04D 3LPPA 5FW8A 5B3NA 5DYFA 2WMPA 2EUZA 4H8WH 4GG6A 3CVDA 1X3DA 2DLIA 1TKWA 3N40F 3IDYB 2PRNA 5E2VL 2FJUB 3C5ZA 4OCLC 3SY9A 4WIQA 1X5LA 1U3HC 2A6KA 1FRGL 3TLRA 3DIFA 4P5TA 1JJUA 2XTSA 3RB5A 5C0EA 3K7UA 3L7EB 4N5UA 5D6CA 3TNNA 5F6IB 3RIKA 5GJSL 2XKNB 3K2IA 3WFEL 4KV5E 3CU7A 5K69A 1NCAH 4RWYL 5DRZA 2DBLH 1TITA 4MVBD 2Y25A 1I53A 1NCCH 4NWTH 4ADGA 1W15A 1U36A 5KW9L 3RFZC 2ZCLH 3NVQA 4OY9A 4WW1B 4XZ4A 2FE0A 4HS3B 4I5BB 2QMJA 1TQBB 3IRPX 2WLLA 2EKSA 1J12A 2JJUA 2HKHL 2WTOA 5I74B 2I7SA 3MBXH 2ZOKB 4Q74A 4XNAA 3BIKA 1XV8A 5E8NA 3US1A 1LO3H 4NQUA 1RHHA 3JWOC 1W2KT 1U8JB 2ADJB 2FUTA 4O2CA 1G84A 3EFDL 3S7GA 4R5XA 1KTLA 2I69A 3DO7B 4KK9D 4ODUA 1HCVA 1C08A 2VMCA 1RURH 3MA9H 4K9JA 3TBVB 3CXHK 4HKBA 4X7TA 5MHSE 1A6UH 1MEXH 2CO6B 4DQAA 3F85A 4AQ8A 2EUXA 4GP5B 1R17A 1HWWA 4Z8FH 5CD5C 1BAFL 1L4IA 2WWMC 3MLVL 4ONFL 3LNGA 4U1HA 4X42A 2BNUA 5IQOA 4H5SB 1J18A 1SEQL 4Y4FA 2TSAA 4JUTA 5D70L 3INUH 1P84J 3X12A 1XF3B 2NYZA 1P69B 1Q9WB 2IDUA 3IFLH 2DM4A 1JGLH 3DJTA 5EFIB 2MTAA 3VW3L 5DEFB 1QKZL 2B1OA 2R4PA 1FF5A 4Y5VC 2ZCLL 2JXMB 1WSST 2B1AL 3HAEG 1CFTB 5J57B 5I1GH 3K19A 2W60B 4PJDB 5F71A 2ICEB 3WTVA 4YVUA 4WSGA 4HCRA 4D9RD 3BPOC 3MLSL 4ENZA 2YWZA 2C7UB 3EAKA 1AQDB 3KPRD 3EFFB 2EKJA 4N6RB 3A4EA 4GRWB 3DGGB 3L3OC 3Q5TA 4MDIB 4Y1AA 4YSTA 4MS8C 2LVCA 1OAXH 1PTZA 3C6SB 1MCPH 4HPHA 2J72A 4I0PB 4LESA 4ZMTA 3FUMA 1QFUH 3L4WA 3AMLA 4JPSA 2PR9A 3OZ9H 1PZSA 1EHNA 4LEEA 5FUOL 5BS0E 2AJXL 3IGAA 3GSWA 3I02A 2FIRT 4YNYA 4WUKH 5D8JL 1IARB 3DK0A 4PAZA 1T2JA 2WNGA 2Y1AA 4XRCB 5F6HI 4C56E 1E2WA 3VFRA 4LSRL 2H32H 2Z1KA 2WUCH 3ZYZA 3L1FA 3L1OL 1P4LA 1KYDA 2JQZA 3QP3A 4P57B 5C09A 4B61A 5D7LD 2QPUA 5E9DE 4AJYV 2FO4B 5KVDE 4APQA 2FO1A 2C1OB 4JJOA 5HYJE 2VLKD 4XCYB 3F00A 3DTUB 4LAQL 5KN5A 1IKNA 3LK42 5A6MA 1KCUH 5J0BA 3TTYA 1CE1L 3IMSA 1B0RA 3IXAB 1QG3A 3QQ4B 3V4VH 4GLRH 1KY6A 2XZAH 4FESA 1CPUA 5GIRB 3IF1A 3TPKA 1FYHB 3FU7B 2AQRA 1KTLB 3HUJA 3U4KA 5IHZA 3FU8A 3T0BA 5HYSA 5SX5K 3BUYB 4PJ9C 2CDGA 2XA8H 4K23L 5IW6B 1CLZL 4FQ1L 5F70A 2Z4QB 3BXNB 4MD5B 1MRCL 2EYRB 3QAQA 2PO6C 1SVCP 2EEFA 4R4ND 3V10A 3ARFA 3WDIA 3KBPA 1IGCL 4XMKL 3FQWB 5A6LA 2CIIB 1AO7A 2WINA 2Z8WC 1NGPL 3EO0B 2XJKA 4XWOD 2N7BA 2J7LA 5DJ8B 3D51A 4R4FL 3BRFA 4OGXH 4Z9KB 2VZ1A 3QRCA 1WC7B 3BW9B 2WLYA 1KBWA 3CHPA 4HJUA 4ZMYA 3W38A 1NC2A 4PS4H 2J8UB 2L0DA 3IJ8A 3FU5A 4A7GF 3MKKA 4GQPH 2A4EA 3LNDA 4CJ0A 5EPMB 3BSZH 2E9GA 1BCIA 4LPYA 1B6UA 2WLIA 1Z7JA 4M5YL 4H4NA 1XSJA 4IBTA 5KYNA 3NSDA 2CRIA 5C0CD 2C4FT 4DCQB 4I3RL 4M7JL 4M7LL 4WV1A 4YMPA 2AP2A 1AR2A 1FHNA 3CN0A 3FOLB 5DD0L 1BGXL 2P46B 4PUXA 1U95B 1T6WA 1FYTA 3CZGA 1TZGH 4LSFA 2RCSH 5I75C 4PB9L 2GTQA 3GBNL 5FHBL 1EBAA 4L8DB 5EZLB 1VKXB 2ZX5A 1A7RL 3DPDA 4R8WH 3O45B 3FUFA 2E3VA 2ZX7A 4HS8L 4OLWH 1E4KC 2FEEI 3EOYG 4JVUA 4NENB 5DURD 2BZCA 1H8OA 3GI9L 1U8CB 4W68A 2V2TA 4LRNH 3PL6A 1KACB 3B34A 4U1IA 5KYUA 1O75A 2EAEA 2NXZC 2R39A 2ALAA 4M5ZH 4QRTB 4F2EA 1DEEB 1BBDH 4D7BA 1SJEB 4DOHE 5CINH 1ZDSA 8PRNA 1KB5L 2ZAGA 1RLBA 1FL6A 4PRIA 2WAHA 1YN7B 2BP0A 1KEMH 3LJ3A 1ZA6A 2LLNA 5HJBA 3JV6A 1A3ZA 2XNAB 1EX0A 2WW8A 2OPCA 2ZXAA 4JQXA 1RUML 3VACA 4LCCC 4EBQH 3V0FA 3MRIA 3L3IA 4AZ8A 4XCEB 1BBJA 2BSDA 4HKXB 3UIYA 2UY6B 4J4PA 2OYMA 1VFAA 4JPVH 5BW7A 1OOWA 5KBPA 3CQQA 1MFDH 2E7MA 1ZHBB 1BZ9A 5FYJE 4HX1B 4S1DD 1ZT1A 2A6IA 4JPWL 4AYSA 4KTEL 2H8PA 2XTQA 4OV6F 5E03A 1JL8A 4WTZG 1WTLA 3FBKA 5GHWH 2IOIA 3QH3A 4LKCB 5C0AA 1CFNB 1WT5A 5E2TL 1LEKA 1MNUL 4FNUA 4DETA 2LV4A 3EYSH 4BKTC 1G7IB 3TBBA 4WNJA 3BI9X 1OGAE 4MA7H 3QEHB 4R26L 1BQHB 4NZTH 2FYYA 5ITFA 1HH6A 4WEUD 1IVTA 4NKQB 1DBJH 4DT2A 2DQEH 1ZCRA 3EYFA 4PRBA 4PJHA 5JHBA 2AQNA 3V5HB 1CFSB 1P7BA 3GS7A 1T1ZB 4ODSL 4E9XA 4G7QB 4KQ3L 3R18A 3IFNL 2PR4L 5ESVA 5TE4L 3T2NH 2EDXA 4H40A 3BN3B 5IHBA 2QEJA 1LMKA 4APQD 3V0HA 3SCMB 2IOMA 4B5ZA 2YD0A 5IB3B 1CGUA 3QXAB 4XI5D 4RAUA 5IEHB 3VFMB 4N90E 3DJSA 4DP6X 4N85A 3QDJD 2P43B 2KZBA 4GBXC 2V7NB 4JFQA 3D25B 1MVYA 3ZW3A 5KZCD 2HJFB 3DYPA 3L3JA 1UWEH 3NZHH 1EGJH 3WO4C 4WQOA 4E9RA 1WHOA 3PYCA 4YDKH 1URIA 3KPQB 4G1MB 2A6DB 1RZGB 1BVNT 2ENYA 5E95B 5F89B 1SN0A 1JXKA 1MNUH 3M45A 2IPKB 4QLWA 3GHEH 1XGQA 3VY8X 4NQXA 2DIEA 4BSVA 4QT5B 4B41A 1S5HA 3ILQC 4KMLB 3WNOA 4CGUB 4ZS6C 1SEQH 2WNKA 1IAOA 1MREH 4LGPB 4PRHD 4DVBA 5I1CL 4OZFG 4PJEE 3INUL 3NP4A 1R33A 3FCUB 1GYUA 4GBXD 3HE7B 1S9VA 1CBJA 4FMFA 4AT6A 2VSKB 3D9AH 3RBGA 4JPIB 2Z7UA 2G5BB 4MWFB 5J4MA 4LEXL 1JPFB 1XCTA 1NFIB 2R4SL 2WTPA 4AM0A 1NFAA 1HHJA 2Q7YB 1CVSC 4LSTH 1DQDH 2JJWA 3ULVH 3KCPA 3RUGA 1J5CA 5CEYB 1PZAA 1KNOA 4PCTA 1DVFB 3CK0H 3H6JA 4M1DL 3MRHB 1I1YB 3RGVD 4C4BA 4RLBA 1YUKB 2FWOB 1D5BA 1DQMH 1JF6A 5GRUH 1SJXA 5E5MA 4N1HB 2JFCA 4U1MA 2LOEA 2D0GA 3HMWH 4PJCE 1J5OL 4J6RH 2QVIA 2DOCA 4UWQB 3PGCA 5KUMA 3OMAB 3WEMA 1MUJA 1EEZA 1T21A 4TVPH 5TF0A 4XO4A 2GSIB 3A23A 5ITBL 1HOEA 1FG9C 5I24A 3AA6A 1V3KA 1P2CB 2JJVA 1Q0YH 1FYTB 3MRNB 1JHLH 1DQVA 1R5IA 4JG5A 1MHHA 1WBXA 3ABZA 2EIZA 5K9OB 5KYWB 5HHMD 4F20A 2YQ2A 1CF8L 3EO1B 4O02L 5PRNA 2D73A 3LH2H 3VFMA 1VZGA 1JG9A 3RTQA 2ENPA 5EZIL 4E42A 5GSVA 4CDHA 1QO3A 1XGTB 2C3GA 3OAWA 2VR3A 5HI4D 3T0EB 5AENA 3NJFA 4PJ5A 4NUMA 4JFZL 4S1SH 3BZEA 4GCSA 2O61B 1MN4A 3DJRA 3V4VL 1UEMA 3C75A 3H3KA 3LHPL 2B20A 2X7LA 4FFYA 2Q7AA 2PYEA 2QHRL 4QGTA 1K2DA 3DHJA 4Z7UA 2YN3A 1D2PA 4DZBB 3UC0H 3QZPA 3I9GH 4F7CA 4K7PX 2VITB 3NJKA 1RXLA 2WXPA 2JIXA 3ULUE 2CO2A 4TTDC 4PJ7E 4PJ7B 2K9UA 2NY7L 4HC1A 5C6WH 4PJFA 4BFRA 3UAAA 5IHUH 1DFBL 4KXCA 3KPSE 2ADIB 4GMTH 2FX8L 3JUZA 1B9ZA 1MG3C 3P11H 5I1KH 5FFOA 1G7HB 4PS4L 3ZJAA 4AXWB 2DQHH 3T2OA 4QTFA 4E5XG 4GP4B 5BZWA 5AOMA 1FN4A 1JNHA 1H3PH 1CLOL 1D7BA 4PVMA 1P4LB 1MDTA 2MSPA 2EZ0C 3T0EE 2AJSL 1UXSA 4L4TB 1AS6A 3GXMA 2MPAL 1T16A 1ZHKB 1OKEA 2X89D 3BAEL 4G43A 5G4MA 3FT1A 3HG0A 2VXTH 3FCGA 3WFDH 3PFUA 1SFHA 4QTHB 4K3EH 3CFKA 4OI7A 5FKAA 1F2XK 3BQUB 4MSWA 4XC1L 1JBJA 5L7XH 2PLTA 5F3BA 1FAIH 3QJZA 1QPPA 1HVXA 4FABL 4Y4HA 5BXFB 2UVFA 4ABWA 5LDSA 1ZS2A 3I9GL 3WTYA 3QJQB 1A0QH 3KYAA 4PRPA 3VMPA 3MV7B 4I2XE 4W9EC 2X44D 4NC1E 4D7PA 1SOQA 1TQBC 4K3JL 4EDWH 1FN4B 3RAJH 4B9CA 1GGCL 2UX7A 2AXGB 1DHKA 2YBRB 5DL7A 2QQQA 4Y4HC 3PQYB 2NY1B 3DUSB 3DX8B 5ACZA 2N0KA 5BVJB 1H6FA 3VI4B 4KHTL 4N2BA 1AKJA 2WJ5A 2HMID 4L5FH 4PHZA 2DWSA 2PP8A 4DGYL 1OLZA 1YEDA 2WSDA 3EDJA 1P5VA 4K7FB 2BNRA 1MJ8L 1QWHA 4RMQA 2Z8RA 5J7CC 1BX2A 2ZSWB 3MRJA 1TFHA 2XQ0A 1QFWL 3D18A 3L95A 1CL7L 3GMPA 5GGRA 2QVMA 1IZKA 4DFHA 3TO2A 1WUNT 2DV6A 1FZMB 25C8H 4ZFOL 3G04B 1MAJA 2WP3T 1MCQA 2X7LB 2DYPA 1GS8A 3APCA 4NO0D 4R90H 2J56A 5MP6H 3ILPB 3K2MC 3BWUF 1V54B 2UX6A 3QHTC 1XZWA 2XN9A 3ZE0F 4LSUL 1DN2A 4BWUA 1RFDH 1HQRB 5FYJH 1MWAB 4CU6A 3NIGB 3T6ZA 1THCA 2AJVL 3EDKA 1U9KA 5AUMB 3SYAA 3COOA 5SWZD 4DP7X 4PBWD 2DQJH 2XPGA 3F3HA 3L2MA 1P53A 3D2UA 5F9AC 3W0WB 4IRZH 4G8FA 4P5MA 3K6NA 4AEHL 1ZGLB 3AGWA 5CP3A 4XP1H 1R1CA 2LHFA 3TL5A 2G2RA 1KWKA 2HKFH 4LSVL 1KULA 2PW2B 3PL6C 4L5FL 5AAPA 2KERA 3HNSL 4PJ5E 5IFHL 3BP4A 3WOVA 4WI0B 3TFKC 1FNFA 1MWAL 3KPNB 3QUMB 1AXIB 3SDCD 2W07B 3B6SB 5KSUB 2D03H 3SDAD 3GZOA 3GSNB 2W8CA 2XN2A 4G1MA 1QYGL 1TQCB 4N8CL 4BFFA 3VQ2C 1RCYA 2R2BA 1WDAA 1W91A 1IT9L 3WY3A 1U3JA 5CUSH 3QQXA 1QEXA 2CCLA 2IDQA 2YMOA 3P1VA 4OTXL 4CDGC 4NKMA 2Z93A 3VD9A 1G0XA 4Z5RA 2XXGA 1GAFL 1NFDB 3LZNA 1K4DB 1DJIA 2DKUA 4AKRA 4MS8D 4F2MA 3LDBC 5AYUH 4WI9A 1AXTL 4N0UA 5EU6A 2P8PA 4DEUA 5C0DB 1I9IH 1S9XB 3JV0A 4GUPA 5FGCB 1QQDA 2BHZA 1KOAA 4UMSA 4PD4K 1UUNA 4HHAA 3L3DA 4HJ0D 2H1PH 6CGTA 4N6RA 3UTOA 1X44A 5GRYA 5C08D 4AWJC 2DIAA 4B50A 3II3A 2HJLB 3KAAA 2I32A 1G6RA 2AERT 2E9BA 3MLYH 4IMKC 4GT7A 3LNEA 5FX3A 5FKPB 4NUGL 3HPLB 1OPGH 32C2B 4AZLA 1UWGH 5ANMA 4DAGH 3VFUB 5MERB 5JO5B 1FNEB 5JIQA 5F7DA 5B7FA 2E6JA 1NPJA 3B2UC 4G2AA 1B4RA 4X6CF 1XGPB 3RGHA 2DYPB 4CU8A 5CUSL 4LL1A 1R5WA 4YEFA 4M1DH 5I82A 8CGTA 3RI5K 1HXYB 2A74C 1X9UA 3A0OA 1QEWA 4U3HA 2PWDA 1C5CL 3F83A 4XOCA 4YZWA 4UYQA 4D64A 3PFQA 2DQEL 4JZNB 4KITB 3KGUA 1PG7X 3BIBX 5JHLL 2WXFA 1E4XH 2Y36L 4HKXA 5LQBH 4G8GB 3SQOL 1BM3H 5D1QE 2CK0L 4PJIE 1PU0A 5AFAA 1T80A 5FM5M 4Z7OF 5BVPL 2Y7SA 4PP1D 5FV2A 3FTZA 1R3KB 4KHXH 5HYEA 1RULL 4FQLH 2B0SH 4JCMA 3EDFA 2B59A 4BINA 2WKOF 5LGJA 4FOZA 3CLFL 5FKAB 2A74B 1QHOA 2BWQA 3HAEB 4B7LA 4X4YB 5D9SA 4JR9L 4DGUA 5D2NA 3IRZA 4APQB 3GKWL 4ZOCA 5GZOC 1E67A 2J6EA 3BAWA 5F7NC 4YR6B 3AADB 4YDKL 1RZQA 3VFUA 1LILA 1L9MA 5B1KA 1JNLL 3OHMB 1ZLSH 4F7KA 2E6QA 3N85L 1H3UA 1QWUA 1UD5A 1WFUA 4OJYA 1FO0H 2H32B 3VXME 2FLRT 4JO2H 5AKTA 1VFMA 2IH3A 1AFVL 1CU4L 1DVZA 5IEKB 3D07A 1FFQA 3KEDA 2AK4B 3GEWB 4G43B 5I6PA 5DJCB 2Z7YA 4JKLA 3UC0L 4AQEB 4F5CE 2ZFGA 3FB6B 2WBXA 1ADQH 1TKWB 3I2CL 3U1PA 5IMLB 2R4SH 1TF4A 3MMEA 3DA0A 5ISZB 3BEVA 5KVFL 3FB5B 2HJKA 1ZDQA 4QHNB 3F7KA 2W9DL 1AI1L 4PP2A 5TDOB 5F21B 3QYCA 5HHNB 2ZOWA 3SD2A 2IDFA 3IDMB 1J9RA 3DJ9A 1QA9B 1PZ3A 4MRCA 4ZS7H 3HS0B 4ZBJA 1JVKA 4HZLA 3RIFK 4M56A 3SE6A 3R8BB 1DJZA 4FQQB 4HIHB 5DVMA 3ZRCC 3KLDA 1KJ2H 1XGTA 4JKMA 1HI6B 4H1LH 1PG7L 1NEPA 4FKHA 2CO4A 5KZCB 4NFDA 3OAZH 3ZZ1A 4UQ3B 2R7EA 5HHVH 1I82A 1MXGA 2VLRD 4XO9A 3WN5C 2XLLA 4ZXBB 2BVPB 4BUGA 4NNPL 2G2RB 1VFUA 4AITA 3ZTNL 3UZEA 4A68A 5MEOB 3CTTA 4IU3A 2GSIA 5I6LA 1L9QA 1OAQH 5DK2A 1MQKL 1CI3M 2GVYA 4MMXB 4FQ1H 4JDEB 4QKTA 4YC2C 4S2SA 5DR5L 2G60L 4Y5XC 2N7AA 4DGVH 3NBNA 4GS7B 3TVMA 1B88A 2EP6A 1SJMA 2QGBA 4FAAB 1YJDL 1P4UA 2A0LC 1WCBB 1T7ZA 4QRAA 3A6OA 3K2UL 1JXJA 2OW7A 5HJGA 2CLRA 3G6DH 4AG4L 1I8AA 4UT7L 4AGOA 1F3JB 1NCTA 1OSZB 1WVZA 4DFIA 4ZAKB 1S7QB 2Y5TA 4IOSD 1FVEA 4AX3A 3D87B 3ZE1E 4YC2B 3HVNA 4MLSA 5IROD 1CI5A 5I2IA 3DNKA 5KEZA 4NYLA 4OKVA 2JNZA 1VCAA 2LAGB 3SPJA 3IJYB 4UBDC 3V79C 2EH8L 4KRPC 3OKDB 2YAQA 4PGCB 2VDQB 4MRBA 5I76B 1ZGLP 5GJTH 1WBYA 4CMMA 5BRZA 3FO1A 5A2AA 4LPCA 2EEXA 1DVFA 1J1OL 1E50A 1JZIA 1QI3A 2X3AA 4URTB 5D55A 5IEKA 4GG6B 4X2UA 1WWAX 4MZRA 3K5RA 2DWDA 4TVPE 1FLRH 1WE5A 2KPWA 4P5KB 4LDOB 1J5DA 3IJSB 2MCPH 5L4MA 4WKZA 1YHPA 4OD3H 2Y2TA 2IFFL 5DO8A 1G87A 1CFTA 3MV7A 2VZSA 2VXQL 5JHDE 3L5IA 3PWPB 2OK0L 3DWTA 1YZZA 5F9WB 1E4WH 1N5AB 4JFQB 1TYRA 1GZPA 3T6WA 3L5XL 4F7EA 1K72A 4YHNA 3AABA 2DH3A 2IAND 3CQFA 3QXAA 2DTMH 1V27A 3MV11 2DYRB 4PR5A 1MHCB 1A4JB 3FN3A 3TT3H 2BVQA 1RY7B 4FLOA 4WRLA 3N1QC 4YH6A 4F15C 1TTGA 3JWNG 3C5ZC 2WXGA 3VRJA 1BX2B 3DETD 3PU7A 1T5WB 1KJ2A 1VGKB 4PHXA 3ESMA 4JM4L 3QULB 3ULUH 3ZDYF 2Z7WA 3AITA 2MQGA 2F58L 2WYIA 1XFPA 2FH8A 3RE0A 4HKBB 2NCMA 4F3FB 3EW3B 3T08A 3VMNA 5K1JA 4XNXL 3KD4A 2V2XB 3HHRB 4H8WC 1J0YA 4JFFA 4LIQE 4B3VA 3NA9L 5C07B 3VQLA 1FZKB 1XF1A 4PVBA 2VDMB 2P48B 1LM8V 1PX3A 4YPGA 3WJLA 1CICB 4XNZB 3DWNA 3FQNA 1UM4L 5INDA 1G7PB 3ARXA 5JO5A 3MCG1 5JPNC 2HFGL 2X88A 1LO4L 2EIDA 1BD2B 2J71A 2NQCA 4H88L 3QYMA 2P4AB 4QHUB 4IKIA 4ETQA 4Y5YC 1XF4B 2OM5A 4N59A 2VTFA 3MR9A 2IADA 5GSRB 5IJCC 4OZIF 4HFUH 3NJLA 4FDWA 1REIA 1T20B 4Y2DA 4QQ1A 1XR8B 3ARVA 5ENWB 1U58B 1BVLA 5JPMA 4GXVH 3DPBA 4DW2H 5G4NA 2P45B 1NL0L 4XBEH 2MQ0A 3UG4A 3MUGA 4TLKA 4QY8B 4Y5VA 3SEPA 1J0KA 5EBGA 4ZQKA 5JYLA 5BV7H 1IM9D 2IWVA 2XNAA 4PREA 1A5FH 2QLVB 3MOBH 4WKZB 2LLGA 4Q97A 3CN4A 2NY3C 3L4UA 3FCSB 5AZUA 2V2XA 4IRZL 4JRYD 2C4FU 1A1OA 1XB3A 4O2FA 3QORC 3KEHA 1HJCA 1YDPA 1OHZA 3V6ZA 4RNRA 3U6RB 4CADA 4AOFA 1FH2A 8FABA 4E9VA 1WFJA 2Y36H 3H0TA 5LQBL 4XX5A 4UOW0 2Z9TA 2ZCZA 5I8KH 4ATWA 1T04B 3D0VB 4Z7UB 2QPEB 2VDNH 4EI5C 1SUJA 1RULH 4C56A 4GRLC 3CBKB 5GZNC 5CD3A 2BY2A 3BT2H 1U8CA 2V2TB 3E9UA 2WZ6A 5BPPA 3MV9A 2EE2A 1EVUA 1JIBA 2E76C 1EDHA 1JZFA 3R4RA 2XPGB 3QUZD 4B9ZA 3MLTB 3WL9B 5ISZA 4XZUA 4WWKD 4CJ1A 4V2BA 4E2OA 3HMXA 3D39E 1NTDA 3JVFC 4NPYA 4IKJA 2F1EA 4Z7WB 1RJZB 4LCCB 2YKLL 5LBSA 3CXFA 5INCA 1FNHA 5C09E 4GAAA 3OGCB 1FO0L 5AB2A 3LCYA 4QRRE 4PLNC 3KYNA 4EZJA 4J2QA 4JRFA 3N40P 4ZTOL 4FG4A 4LARL 4YSCA 1YNLL 4U1LB 2Q20A 4YLQT 1GZHA 4JQIA 3AVEA 3CAFA 4EKXA 5DEZA 3GK8L 4Q4EA 1T6VN 4D65A 4QRUB 3WENA 2A3TA 1J5OH 5C0FB 4I87A 3EH4B 2XG5A 3RIAK 1HFUA 2FSEA 3JTBA 1G9HA 3RLSA 2F08A 2QSCH 4KVNL 4Y1AE 2V17L 2YLHA 1Z9SB 4ZFZB 4LCUA 2F53E 3HUJB 4ZNEA 2VW4A 4RAHA 1S9KC 1CDJA 4LNRB 3QISA 2VDLH 5C3IA 4F15B 1QSEE 4KAQH 3FQ2A 5E8EB 3ZR6A 2LABA 1GYWA 4JAMA 2NYYD 2CE6A 5A2CA 5EO1A 3KBFA 5MEPB 4IBWA 1M6OB 3AG2B 1Z9NA 5FFGA 1PQZA 4LCYB 1QJ8A 2QBWA 2FYYB 4UBDD 3FRPA 2YMTA 4M6OL 4A7GA 5F6IC 5ILTL 2IH3B 4ZMZA 2F8OA 4WHCA 1M4KA 1FDLL 4MXVF 1Z9PA 2EDTA 4P2QE 1BFOB 1SHSA 5D6DC 3UFIA 1JZ7A 1OK0A 3A67H 4PY7B 1L7TH 4M6NL 1XGYL 4QRTA 3IE4A 4ZD3H 5EEVA 4GAGH 1R3HB 2VXVH 3TF4A 3HR6A 3A21A 3GZQA 4C69X 4E5XB 3B5HA 4NS0A 2I9TB 1LP9F 4N5EC 2NYYC 1JVLA 2ESVA 2ENJA 3LKSB 2XV6B 3QJTB 2FQEA 1EZSA 3LK3A 1MAMH 5LXGH 1PIGA 5D2NE 1RZPA 2DRUA 4GO8A 4IMLA 2VDQH 1AR1D 2D3NA 2UY6A 2W88A 1W72B 1ITBB 2IPTH 3LIZL 4G70B 4J8QA 3KPLA 3F12B 3I6SA 4HKJB 4TNWK 1HEJC 2H41A 1DDHA 4YXKL 1MFCH 5H94B 1QFPA 4NWUH 5IBUB 4C4VA 4I48B 4IOFC 2FR4B 3D85D 2WBJD 4UIMA 1VFOA 1JK9B 3H9HB 1DBBH 5GJTL 3QARA 3P2BA 4P0DA 4FT6A 3W3BA 4HIQA 1F3JA 1T66D 2R0WH 3IDXH 4N24A 1UD3A 1DJSA 4NBYB 1W72L 4LLAA 1NH6A 2LTQC 3QZBA 4N28A 4OF8A 4PRDB 3ETBJ 2G4EA 1FLRL 4RX4D 1C5DA 4YXHL 2IV9A 5B39G 3EZ8A 5GS2D 2YPLE 2UXGA 2ADYA 1Y0LA 3VXMB 5BO1L 4F7CB 2YEQA 1I3RB 1QBML 2C9VA 1JGDB 3FMGH 3MRCA 4RGOL 4LOVA 1U2YA 1FFPB 3UPCA 1BSIA 4KK5D 3LZRA 2ATAA 3ARFB 4E9QA 1QWNA 3UBXG 5DMYA 1KCUL 1YY9C 4PBVC 3L4XA 3K81A 5C9JA 3UO1H 1KYFA 2NRDA 3L2NA 4NQCB 4OLVL 3IDJA 5I8EA 1JNNL 2EC9T 5SX5H 4PJ5B 3QUKB 4G8FB 1IFHH 4P5MB 4X80H 2BXZA 1EV2E 3FTYA 1ZE3H 1JV5A 2MHAA 3MV8B 5DC4B 3U7AA 2I07A 3QG7H 4N0UB 5C0DA 4JDZA 3P0YL 3QB7C 1COBA 1S9WB 1N59B 1TYEB 3VXMA 4RGNC 1IL1B 2F54A 2WKLA 3ULSA 3WKML 4W6XB 2Z93B 2L7QA 2MWCA 2OI9C 1NGPH 2QVFB 4QWWC 5FHAL 1NFDF 1FFTB 4GI6A 2R51A 3T6VA 3OQRA 1HHIA 3ARQA 4Y1AD 1KCSH 3KL3A 1OV8A 1PLBA 5JNYA 4KO6A 4IRSD 2PXYB 3AAAB 3HG2A 3QUMA 4RIRB 4CSPA 4EKJA 5EZLA 7PRNA 2Y69B 4S0SD 1S9VB 3TNMB 4MQXC 4JPKL 5E1IA 1MVUB 3QIWC 1CFQB 3OC5A 5SX4I 2FJGB 4YOKA 4F91B 4KX7A 5DU7A 5T33H 2W92A 1MPAH 5J11C 1TVDA 2QSQA 3KCPB 3RUGB 3VI4A 3B7RL 4KK6D 4QRPD 3SE9L 4LSVH 3WXVH 4WO4C 1U91A 4QTIH 1ZVSA 4ELMB 3UTTE 1KIRA 1W8EA 4M7LT 2X9WA 4ADJA 3H53A 5GHWL 4G71B 4ZMVA 2CJ3A 2QJDA 1HAWA 3LXAA 1QNIA 4JEGB 1BWMA 3RQ3A 3WS3A 4WKXA 2W9EL 4C56B 4PJHF 2WXRA 3FN9A 2X1QA 1FBIL 3GSRA 4IYKA 3I3EA 3ZZSA 5I8CB 1J48A 2Z7ZA 5F89A 2ITCA 1NFDE 5I6MA 2YAMA 3PS6A 2VABA 2JJTC 2EXSA 4XP6H 4XVSL 1ZANL 2BIOA 1U3HA 1CGXA 1IEAA 2F53B 3VRIB 2YRLA 1K3IA 3ZQ9A 3FYXA 1P4BL 3PV7A 3HKZA 4GRWE 5E6RB 1N7MH 1OPFA 3GSVA 2KZ7B 3N04A 1USZA 1C7SA 5IESL 1RZIA 1AQKL 5FGRA 4O2FB 1NEZB 1WA2X 3I50L 3WIHH 4KPHH 4KI5D 5ITBH 4N8UA 1NWPA 4IOIA 1W9XA 4HQQH 3N41F 2ZUSA 3B9EA 4JFFE 4GQRA 3UP6A 4Z18A 1A6ZB 1DQQB 5DS2A 5TK2A 4HUVB 2Z64C 4Y19D 4KQ0A 4XBMA 4EDXA 1GFNA 3QDGE 1IMHC 2YGPA 5IFAH 3H2QA 2PWFA 4H0GA 4PWJA 1L7IH 5I6XC 4UT6L 5I1HH 3KS0H 3VXPA 4FJ6A 4H2AA 4NN6C 3QBTB 3BP5B 2Q8AH 4G9FA 1BD2A 3S4SA 5DMKA 3MRJB 2QR0A 4APQC 4P8QA 1ZPLA 4RETB 4JREB 3MV9E 2ODJA 4GRWH 4U2YA 1YNKL 1U30A 5TJWK 1EJ6A 5E70A 1QSFA 4FG6D 4FQXC 3V4PH 2ZAHA 3A4FA 2Z8SA 4HD9A 4NPYB 3HFML 4BZ1A 5DD1L 4HX1A 1B2YA 2P8PB 2AI0L 1ZVSB 2X42A 4HBQA 3NMEA 1I3VA 3LXUX 1KXTB 3CIQA 2WWMD 4J1UB 4NQEB 2K6WA 5B7MA 1HYSC 5F7UA 5HSFA 2B39A 2FNWA 5T3ZL 4L8SA 4JFXB 4YQXH 3ENEA 3PL6B 2OYLA 4PPTA 4I3SH 4LOFA 4XPBL 3AY2A 4N2KA 2XDHA 4JKWA 5F3BB 3WN6A 1WFTA 3L1GA 5KVGE 5B38G 3VWKD 4LHUB 1F4WH 2ZUYA 3BLBA 4NHUA 2R88A 1BZEA 3WE6B 3MUUA 4F9LC 3DK2A 5DFWH 1UOLA 3Q5OA 3QHZH 4KO5A 2ZOOA 2Q1EA 3RGVA 3WEXA 1TVBB 3ARED 2CUHA 3C5ZB 1GYCA 1EDQA 3WHXB 4ES9A 5JW3H 1MCIA 3C60A 5DJYB 3GZPA 4QXUH 3ARGA 3H9ZA 3K6DA 1RAMA 2J25A 5DO2C 2Y72A 3PAUA 3V9EA 2X41A 4HH9B 4O3ZA 3L81A 3EOAA 3P9WB 1OZTG 3IS0X 4M6MH 4XPAL 4AXWA 4KX8A 2IG2H 1TJHH 3M17A 5I6NA 4DNLA 4NO3A 5IQ7H 2H6PA 2E5EA 4D9QE 2VZOA 3FO1B 3H54A 4GBXB 4TLSA 3NSXA 1T7VA 4XPFL 3VFTB 4N4YB 3IJEA 2AW2A 1KYUA 5J11B 4Y2DB 1QVOB 1OGSA 4CL7A 3HBPA 1MCNA 4KKAD 5F93C 3AREB 1A2YB 4M7ZB 1J8HE 1M7DA 3GK8H 4XNUH 3DUUA 5F7FA 4Y5XB 2P3YA 1IAIL 3FQXB 5ABAA 1HQRA 5AFUL 5FA3A 3DIFB 4Z7WE 4MYWB 1NBVH 2J1XA 3QCTH 2E7HA 3J27A 3GRGA 1XCQB 3T0EA 1JWUA 4IKKA 5DLML 1ZV2A 5CEYA 3ZUNC 2VXSH 2R0ZH 4JY5H 3VU1A 5BVJA 4YXHH 4FMSA 5FEBA 3O2WL 4C83A 5GZOD 2GW5A 3O6FC 4NHCH 3ZE2B 2EIEA 2AXGA 4C4VB 4L8CB 3V4PA 3MRBA 5A3ID 3F5WA 2CCWA 4PJ5D 5F96L 3UZVA 3GD1C 4H8VA 5T5NG 2CBPA 5GGVY 2QSVA 2X27X 1INDL 2ZF9A 4CC4A 5ILTH 1MHCA 4RFOH 2K6YA 2WWNA 3RG1C 4S11A 43C9A 4XNDA 2GSGB 4HSCX 3CFKB 1J1PH 2IAMD 4FYQA 1R3IL 1CIUA 2YD8A 1DE4A 3ECUA 2B4CH 3L5HA 4RISL 5CU5A 4OLZH 1DSWA 2JWYA 1BXWA 4B7IA 2FDBP 3P0VH 3VE0A 3FTSA 4K5OA 3VM5A 4CVWA 4J12A 5EIIB 1JXDA 1S3RA 3CSGA 3HZ3A 5K1VA 5BZWB 3TN0D 2ZYIA 1ZXKA 4AKMA 1XL6A 5D9SB 3TO4A 3TVMC 1HWGB 3BX7C 2B1HL 3GSWB 3MV7D 4JJ5B 2DI7A 2F1CX 1JF1B 4QHLB 1T7WA 4JQVC 2R0ZL 2C8NA 2JXMA 2HCZX 3WS6A 1G1YA 3EFDH 1M7IB 2ERVA 2P5EA 3WU1A 3CHQA 3MZGB 3LIUA 3GXFA 5ESQA 1I8LC 1LEGB 3DX4A 3N91A 5TE7H 2IAAC 1QABA 2ADGB 5CIPA 5EOQH 2V8LA 2VC2B 2FLBT 2X70B 3GKZA 4Z78A 1N3NA 3SDXA 4WTZA 1JZJA 2KLRA 1G7IA 1WZ1H 1K2DB 5IT2L 4HISA 3QDJA 2FHCA 4WJ5A 1SY6H 2YMXH 2ADIA 4E36A 1NGYA 2L7UA 4XB8A 2Y0KA 5FGBC 4OM0L 3FQNB 3TEXA 5JPMC 3AWGA 5FGBA 2ZONA 4JM2A 4X8JB 4OM1H 5J9PB 3TBVA 4QO1B 2CLZB 3FT9A 1P9MC 1VPOL 4R7DB 4P2RA 4IOIB 5CJ8A 3SOBH 4W9LC 3TH3T 1F8TH 1MSPA 2P5ED 2IWEA 4MNGE 4TUOA 5EOCL 4QJ5B 2NZ9D 1E54A 5IB4B 3KVDD 2DLEA 2EYTB 3KBHE 3NA9H 3OG6B 1IAKB 4Q14A 5D7JA 3BDBA 3C5XA 2UVEA 2ZNXA 2FYVA 3IK2A 5DZAA 3SBWA 43CAB 3U0PA 4HJJL 4JB9H 4RVBA 1EHKB 5LBVA 4Q6IB 5H8DA 1C08B 3QDJE 2X4PA 4L3EE 4K71C 4PB0L 4UTCA 1OM3H 3SDYH 3SPGA 1QNZL 5EORH 5CBAB 4RJXA 1CBVL 1BH3A 2EIJB 5IMMB 2VM4A 1LEKB 1JZGA 3MV9B 5C0GB 3PDDA 5JR1H 2X6BA 4BWTA 4BGDA 3OJDB 5F7DB 5D2NC 3G08B 5ADXK 3LEVL 2IWGA 4D9LH 2V5SA 4WI7A 4Z7OB 1IKFL 3HOEA 3DROA 2FX7L 1VZHA 3RIFF 5DJ8A 4Q58C 1G6RH 1J1XH 3ARSA 5HHOD 4XB7A 4U6YB 3GKWH 3LZOA 3IKKA 3CLEH 1OQXA 2EADA 3C6LA 3P9LA 3D50A 2DLHA 3GJFK 3QFDA 1AYOA 4P49A 4AGNA 2G5BA 5CCKL 1OIOA 3CFBA 1EA9C 4LLUB 3PGRA 4WI0A 1QZNA 4N0RA 4PJIA 5F7MC 1HQ4B 3S36L 1NJ9B 3BSZA 3DSFH 3DV4A 1ZLVH 1SEBA 2CRZA 2GJ6D 5CSBA 5DI8B 4L0YA 4HHAB 1E8XA 3PLYA 4U6VL 1Q9LA 4XHJC 2VLKA 1A66A 4U6HA 4YX2L 1SYVB 3G6JA 3S3JA 1Q1JL 5D7HA 2AXJA 1ZHWA 2IPKA 3EYOB 2O5NA 4PRPD 5DHYB 5GQBA 3DVIA 4M61B 4UDUA 1XH0A 1Q90A 3OLDA 1PRNA 1DQKA 4IS6A 1N26A 4F7TB 1TETL 3CXHJ 5HHME 5JHMA 4LSHA 5CZXD 4HEPA 1UM6H 5D7SH 2YUZA 1ZTMA 3OJDA 4OD2A 1WPCA 1A6AA 3HC3L 4AUIA 1JF5A 1I3UA 4QR7A 1JTOA 4MNHB 3O45A 3UYRL 1DR9A 3JXAA 5KAFO 3DMMA 4L1SA 3D39D 2X38A 4YQXL 1Q72L 2MQ3A 1HK6A 3MRGB 2J8HA 3IN0A 4IBYA 4HPYH 3MV8A 4J3OH 4AIXA 3QGVA 4IU3B 5G3AA 3E3QE 5D93C 5DEGA 2PW2A 1PMYA 1X7QB 3GMRA 3LB6C 4HMCA 5E23A 3MLRL 1UCBL 5GZOA 3DURA 4RDQF 4G8GA 2XOTA 4F33B 2EYTA 4KZEL 1JGVH 5IB4A 4BJLA 3WELA 1HU8A 3C2SA 5HGBB 1CO1A