3KVDD

Crystal structure of the neisseria meningitidis factor h binding protein, fhbp (gna1870) at 2.0 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
242
structure length
242
Chain Sequence
AGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein
publication title Structure of the uncomplexed Neisseria meningitidis factor H-binding protein fHbp (rLP2086).
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Protein binding
total genus 60
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 3kvdD02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3kvdD01
4O3XB 3V8UA 4O3WA 2KDYA 5T5FA 2Y7SA 3PQUA 4O4UA 4U9CA 2W81C 2W80C 4AYDC 4O3YA 3PQSA 4Z3TA 2KC0A 4AYEC 2LFUA 4O3ZA 4O4XA 4QQ1A 2YPVA 3KVDD 4AYMC 3HOLA 4AYNA 3HOEA 3VE2A 4O49A 5EE2A 1YS5A 3UAQA 4AYID 3VE1A
chains in the Genus database with same CATH superfamily
4JPWH 5GGTH 4I3SL 3GD1C 4YHYB 1EHLH 1J5HA 1KMGA 5K33A 5C97A 5FO7A 5CHNB 2CZNA 4GQPH 3RGBA 1OSZA 3UZQB 3NPSB 3OXRA 4WO4D 3MX0A 1ETB1 3SDXA 3BESR 3LIZA 3HUJF 3FCSB 5EZIH 1BZ9A 3OB0K 2JMMA 4HMCA 3EGSB 2AJ3A 1PKQA 2FX9H 1Z9PA 5EU6E 2D73A 2DKMA 4M6MH 4WGWB 4JDVA 1LK3H 2CCLA 3BP7A 3N06B 1T83A 4X99A 4C54A 1H3UA 2H1PL 1KV7A 4YQXL 4U7KA 2CU9A 4L5FH 4DIXA 5DLMH 3RVWC 3MV7E 5FW7A 4OZ4B 4X9BA 5LLIC 4WIQA 3WMQA 5I6KA 4GW1B 1H6TA 2A0LC 2BIPA 2AVFA 4U0RC 3LK3A 4M62L 4Z76B 4FMVA 1AQKH 2EZ0C 1R3LA 2GT9B 2NZ1A 5F6HI 1KGUA 3NTCH 3VU1A 4LL1A 3CFBA 3MBEA 3N85H 5KSVB 4Q9RL 4RQQB 1JF6A 1IX2A 3JWNE 1JUFA 3B2UD 4KJPC 5G39A 2OZ4H 4R26H 5I6MA 1TPXC 5LWYH 1M05A 5EF1A 1CR9L 2VN7A 3QHZL 2V8MA 4FMFA 4PJ8B 4CKQA 4HXBH 1VSCA 4RGMB 5D7IF 3W82A 1IGTB 4N25A 4J3UA 1E6JH 5FO2A 2XE3A 2D31B 2GFBA 3RHWF 2XA3A 4XNMA 5DFVD 2Q87A 1P9MA 3UTPE 3DV4B 3P40A 3GS0A 1P4BL 5HVHC 5IFJA 2IFFH 3MXVH 5D1ZA 5CR1A 4M3JA 1G43A 1RU9H 2ZTBA 5B8CC 1S7QA 3QDGE 1BF5A 4N2LA 1PS3A 5K9OB 3MR9B 3LKPA 3ZOAA 2J8HA 1D7BA 1HNYA 4BQBA 1XH0A 5DEGB 1QLEH 5DK2B 4MNHA 1LWJA 2FEDD 4QTHA 4ABQA 2DH3A 2AJSH 2VIRA 3BVNA 2HVJA 2CHZA 2HJKA 4LRIC 2XN9B 4U1HB 1FJ1B 3MOQA 5E6SB 2NSXA 3VG9C 4BQCA 3RWCB 4JPKL 4FYQA 5I6XB 4QKXB 3BEVB 2QKIA 1FZMA 4F2MA 4ZYKA 4CVXA 5E8EA 4K7PH 1DL7H 4NO0A 4GSRA 4M4RA 2BXZA 5AOZA 5BV7H 1AKJD 1PSKH 3IAPA 1UXSB 4ONHA 5J6HB 3ECVA 5TGBB 5D2LE 5I0YA 3MRHA 3JUYA 3RURA 3IFOA 3V6OA 3OB8A 3WY4A 3UTTB 1N5AB 1ZA6A 2ODHA 1LO5B 3D08A 4JUTA 2DYRB 2V2XB 5TQ2H 1ILUA 5JDSB 2FWLB 4GI6A 2WZ0A 3D69A 4ALAL 2OYKA 3LZNA 1JXFA 1D6VH 4LIQL 3D4ZA 2WQUA 1INDL 1MOEA 2WSDA 2NY5L 3IDNB 4JFEE 1G9NL 5C92A 1NC2D 3UIYA 3DGGB 4ZW6A 4CJ0A 4FQIH 2VR6A 4X5RA 1HCFX 3EBIA 3Q1EA 3U0PA 4L4VB 4XRCA 5EO1B 2VXVH 1BIHA 5EZOL 1D5BA 1XGPA 4NM4L 4NUGL 4PLKD 5BXFB 1G7IA 5F9OL 4RAVB 3LZLA 2AQPA 1QWNA 4A2GA 3T3MF 3NFSL 5I1HL 4E41B 1WS7A 3SPHA 3BXNA 4HJTA 2R69H 4XO9A 2NY1B 3VH8G 2C7UB 1JV2B 4NAMA 2FX8H 2QPFA 4PCKA 1OPGH 3P2DA 5B7FA 1FNEA 1MAKA 4FG4A 4MNGB 5IM7A 1JFQH 1TEGA 3QJFA 4FNUA 5DYOB 3ZQ9A 4PREA 3KM1A 1NDMA 2XWTA 2NY2D 4PJ8C 4ZT1A 4RGMC 1CXLA 3UFIA 4L2LA 1I1YB 2Y3AA 1RQ5A 1REIA 3D8MA 3NSJA 4D8PA 3DWNA 1VESA 3QJRB 3BN3B 1E5CA 3I02A 1P5UB 2DB8A 4NN7C 3RPIA 1UUSA 4GUPB 4TULL 4JW3A 4KHTL 4OFKA 3AG3B 1KTDB 4ZNEE 1QWHA 1ZHLB 2OPCA 3QNZB 5HHQB 4QWWD 3VD7A 1NBVL 2L7JA 2YPLA 1W72H 4OCSL 4WK4B 4PCYA 2JTDA 4FAAB 4HJUA 4LLDA 5AAMA 2R0LL 2R39A 3SDDA 2LW3A 5E5RB 3IETB 2L4OA 5T1KB 1YPZF 2Y7SA 2B1HH 5I23A 3VD4A 2EINB 1BOGB 3CN3A 1OAUH 4IMKC 5TDOA 2ODIA 4KK5C 4RLDA 1SNRA 5I6XC 4KKLC 1ZGLB 1XH2A 2VTFA 1QR1A 4FQXD 4B27A 3TBYB 5KANI 2X70B 4MNQA 4XPBL 1MJJA 3QPXL 4WUUE 3BWUF 4K3GA 2WCSA 2WKGA 5IVZA 3NEXA 3LDBB 4RX4A 1C8QA 2GJZB 5I1GL 1I53A 3DVFA 5E5MB 3LQAH 3GMNA 4WI7A 3QUXB 3STZB 4WTZA 4N2NA 3TNNB 3OLGA 1FNAA 3I9GH 1DFXA 5EOCJ 5IMKA 1S8DB 2XN1A 3CXDL 3TEZA 3L4CA 1MI5E 3BRGC 3VFOB 3HZ3A 1QLRA 4XCNB 3FU9A 2K3HA 2Y2XA 3VXQA 1MCOH 1RUKL 2AK1H 4GMTL 4OB5L 3QT2A 2ID5A 1TVBB 3AXLA 4NN6B 4ERSL 1I3RA 3KLAA 1E2VA 2D3VA 3L5WA 3T1FB 3KYMA 1TZOA 4YDKH 5AW7B 1UZ8A 4U4BA 3HZVA 4ODTH 5DD6A 5AOJA 5G3AA 4KJQC 2NY1C 1AXTL 1Q1JH 2F53B 1MIEL 2YMOA 5L2JB 1E2WA 2K6WA 5EOQL 1QZNA 4E9WA 4M43H 3HNVL 2H0FA 4U6XB 1S7RB 5C86A 1KCWA 1RVFL 2YBRB 3QJOA 4NZRH 4QRRA 3FOLB 2OZNA 1FNGB 1WBXA 3VRLE 1MF2H 3IEAA 4KTDL 4HZLB 4Z8FL 1AMYA 4UQ3B 4FZEH 2BS8A 1G7MB 3IE9A 4H0HB 4HV8B 3SQOH 4YEFA 2Q0ZX 4URTB 3QWQB 4LPYA 4LEOB 5LDSA 1JNNH 4Y9EA 1F4HA 4X0KB 5KN5B 1NCTA 5AAWA 3OZLA 5D96B 5BUGA 3SKJL 3T8XA 2KDYA 4FI7A 3H4FA 3SO5A 5EEXA 3A24A 1JZ6A 4HEMA 3TYGL 4XOAA 3MU3A 4M61B 4R0LA 1ASPA 1MVYA 3AXHA 2NXZB 1CFSB 3L95B 3LQZA 3ZKQD 2KQNA 4PWIA 1DANT 1U3HB 4O2FA 2QVFB 3IKCA 4KZ0A 5ESVA 5IKCA 4YSRA 2J1NA 5B4MC 1G7QB 2C1OB 4FXGB 4TNFA 1KYAA 4OF5A 1NUDA 4DN4H 1J1OH 1RJLA 1OCZB 1UM6H 2D4DA 5CP7A 4B9GA 5IJBC 1S9WA 1UB6B 2BHUA 2BVOA 2XWJB 32C2B 2ICEB 3LKNA 4G9FA 3V4VL 2RQEA 4I3RL 4ODUB 1D5MB 4M7ZB 3SY0A 3ZDYB 4B9KC 2BFVL 4FXTA 1V3KA 3EDDA 2VE6A 3LDBC 2G75B 3A0OA 1MY5A 2RTTA 4PBXA 1NLBL 4KOCA 3WKNA 3QIWA 2A5UA 3NESA 3F2LA 4JRFA 3P30H 4X8JA 6FABL 4G7VH 4AIOA 3UG3A 2ZWNA 5FUZL 2Z0BA 3FU6A 1JAEA 1DVFA 4LCCC 2WJQA 1F6AA 4L1DA 4NN6C 3QWOA 3U4KA 3NIDB 4FXLA 3WUWG 4UTAL 4AG4H 4XVSH 5E2JA 4Y16D 3HR6A 1A3LL 1RJZA 3TYFB 3H85A 1FI8C 3ARVA 3KXFA 1WH0A 4J28A 1JI1A 2G60H 1JK9B 3Q7JA 4M9PA 1QHPA 1DEEA 1TMCB 4XMPH 2X4NB 5B39A 1JXGA 5HHVL 3NCYP 4LOUC 3FU8A 2BLFA 1EEYB 2GVYA 2J43A 5FUCC 4OR1A 2MCG1 3WJLC 3AGVA 3C5ZA 5KANG 5SV3A 2IDQA 3BJLA 3BVDB 4K73A 5F3BB 3ERXA 2XZCL 1YQ2A 3ULUL 4N2KA 5EV7A 3K2UH 1IIIA 1IILE 4UT7H 3UTTE 5D96C 1HHKA 1H19A 4DUWA 1UT1A 3KMDA 4X4KA 4HIIB 1OAJA 4FT6A 2GUOA 4AQZA 1EAOA 4U49A 3SE9L 2D03L 3NK4A 4P5KA 5EBMA 5EO9A 1AZUA 1RERA 4NXSA 5LBSH 3D9AH 2D9QB 3D39D 3PP4H 1CVSC 2BH0A 2NXZC 3BEWA 4XCEA 5GS3A 4L4VE 3T0BA 2WYHA 5ISZB 5HDLA 1U3HC 4PWHA 3T6XA 1OE2A 1S9XB 3AA6A 4H88H 1AZNA 2OXGA 2R4RL 4M5ZL 4ETQA 1L9OA 2GJ6B 4FXGC 1T2JA 5F7YC 4OJFH 1G90A 3NIGB 4E41E 3IMWA 1WA2X 1RXLA 1V7NL 3VWJD 4HHAB 1V3LA 3FL7A 4MNGE 1YAIA 2XICA 1IJNA 4D8OA 1MLCA 3ZT6A 1FUNA 3IFLH 4ZDHB 5F7NC 4CW1A 1FL3B 4M7ZC 3WJMA 3C9NA 3L4TA 3V0VB 1KLUA 3IB4A 5H35A 4JJ5B 5K59E 3UZVA 2UZYB 3DRQA 3F6LA 4GAAA 1DVSA 2YD9A 2IDSA 5CN3A 1S7XB 2E9WA 1MCWM 2F19H 3OZ9H 4FQQA 4XC3H 4D9QD 5IB3B 3B37A 1TXKA 5HGAA 2YMXL 3ARDB 4P2QA 2W07A 1AO7B 1J8SA 2X4QA 4XOCA 1U58B 4KVCH 1I85C 4WDIA 1FVDA 1CE1H 2AJZB 4ELDA 1I7ZB 1LO0L 5CLWA 2CJUH 4NHCH 3DTXB 1L9MA 43CAB 3MNZB 1IGMH 2FBOJ 4XHJC 1SZNA 4MYWB 5K9QI 1NFDA 1O0VA 4H0LC 3D0LB 3AADB 1R3KA 1ZWIA 3RDTA 5BRPA 3MV8B 1CXFA 4JANB 1V3JA 4G7RB 1PD1A 1NCAH 2HJFA 4W9CC 4D64A 5FYLE 3FQ1A 1NOAA 3SBPA 5JXEA 2OP4L 5BQ7B 4RIRB 4KKZA 2WANA 5CF3A 5BNXD 4LVNB 3DA3A 3UO1H 1BQKA 1N0XL 5J12B 5SWZD 5T3ZL 4MCMA 5E1GA 3FQYA 4I1RA 5DGQA 5FO8B 5IB5B 1ETJA 2DM7A 1MM4A 3MRCA 5DQ9A 4X4YB 2WVVB 1KXVA 5GRJL 1RUQH 1U8PB 5F6IB 3WLBA 2WLKA 5E0FA 3SO3B 4G59C 4GAJL 3WS3A 2IDCA 2DJSA 3FTVA 4FMSA 2IANA 5J11B 5GV0A 2MPVA 3SGJA 1G7PB 3U9PH 4GQ9H 4ECNA 1WZ1H 3MAWA 3FH8A 3RILA 5KYWA 1FG2A 4YDVA 3WSQL 1O75A 3OLDA 4NNPH 4FFYH 4ZOEA 1DE4A 2WQAA 2BCMA 3JWNH 5EIVA 8FABB 3CZFA 2NTSP 3N1FC 3T6QC 4Y7OC 4OLZL 3ZYOA 4FOZA 3VY8X 2F53E 3KYAA 2NNFA 2WK2A 4JFYB 4RA0C 2RIKA 1D5IL 1A1OB 4L8CA 4PG9A 4RFOH 3GMRA 5D7JB 2QTEA 2QZ5A 3U7YL 5I66B 5TDPA 5ID1A 1PZ5B 4OD2B 5ANMA 3TNMB 3PUCA 5FUCE 3VA2C 4RETB 4HMEA 2CGZA 2J1YA 3JTSB 4K4KA 1HHJA 3EJZC 3CPLA 1KT2B 3NJGA 4RMWA 4GSDL 4WEMB 1TTCA 4K8RC 1H3PL 1QBML 1NLDL 1MQKL 2AEQH 2NMSA 3R4RA 4AYDC 2VLLB 2A4CA 3U6RB 3ARDC 4P46A 1EEZB 2XLLA 2JCCA 2X7LA 1XGTA 4UT9L 5DWUL 4MBOA 1ZLDA 1YEFH 2N1TE 4ATWA 2GJPA 4RSVA 1ZEAL 1MWAL 3KPLA 4PV9A 4BH8A 4P2CG 4DO6A 5J5EA 5DQDL 1PFCA 4XNLA 2YO3A 2VH5L 4UDUA 1PG7H 2XN9D 4K5OA 2BSRA 2H32H 4IGBA 4KK5D 3JT0A 4EO5A 4KKLD 3G5VB 1HQRB 2CKBH 2XV0A 4ZPTA 1SDYA 5A2BA 5HHPA 1KPUB 3J8F7 2Z92A 1QASA 2LHFA 4Z1PA 2EDRA 3OKDB 1B2WL 1EK3A 2HG5B 5DJYA 2XY1A 4KUCD 4CMMA 4O3YA 5AB2A 2PLTA 3BAEL 3PL6D 4CN6A 5F7BA 2C3XA 3PV6A 2I26N 4P9MH 1NEZA 3TIEB 5K9KB 1BG9A 3P4NA 4Z7WF 4H8WL 4LVNC 5I5MA 5J12C 3ZDYE 1KJ2A 3QEQA 4YBLB 2IWEA 4YDMA 1A6ZA 1RPQA 2CCVA 5D55A 4K9EC 5HD8D 3ARBA 4RGOL 5F6IC 1E5AA 5LBGA 3T20A 4HIJB 4M5YL 4MMZA 4OF8A 3KPPB 3ZO0A 5E24E 2W59A 2EDOA 4WHYH 4JHUA 5GS0D 1UYWH 3K6FA 4M6NL 4PJIA 1QFOA 5AW1B 1R24B 1USZA 3QS3A 3UTSB 3LN4B 3QDMA 2WBJA 2IDTA 4NJ9H 3STLA 2WLZA 3SYBA 2VRKA 2J2ZB 3OJDB 3NIDE 3LRHA 2VN5A 3ARFA 3FQ2A 4X6BB 1S4IA 1XAUA 4S1DC 1RIHH 4LBAA 1XGRB 2G2RB 5F7UA 4JKPH 3CBKB 3D87B 2XCMC 4JQIL 5DHVA 4ANKA 2EDWA 2HFTA 5HHXH 1E4WH 1LO2L 4FQCH 4Y1AD 2WNKA 3VI4A 1JZJA 2JKRM 4G6AD 5HGDB 2ITFA 3FOMB 4PN6A 4PB9L 4GFTB 1ZT4A 4PRNA 5ACMA 5E99L 4OLEA 2W81C 2EIDA 1AIFB 5F1NA 1EANA 1TZ8A 5BZZA 4UQ2A 4EDWL 2HXAA 1JPFA 3UDWC 4DK3A 2QELA 1FL5A 4GG8B 5D7JC 2VERA 5TF0A 1M1SA 1Z5LB 4N6QA 3U46B 1J05B 4F5CE 1THQA 2ZZUT 3V8CA 4DPRA 3CFKA 1OD7A 2LVCA 5BUPA 3X2QB 1HESA 3CU7A 2BFGA 5B1KA 2IJ0C 1YYML 4RCAA 4NC2B 5FAAA 3T6ZA 2WTRA 4XMLL 3RPBA 2B1AL 2DQJL 1HXYA 3QUZD 3UP6A 1JZ5A 2H1PH 4L3CB 4GXFA 4PY8J 5FO7B 2O5NA 3T65A 2EIJB 4YQXH 4CDGC 4AKRA 3RBHA 3QA3A 4O00A 3RWJA 1EMTL 3NJKA 5T1KD 3MX0B 3SDXB 2HAZA 1ZE3C 5B4MD 1IGYB 3PGFL 3T0EE 3KCPB 5ISZE 4M62H 2AJ3B 1PKQB 1KGIA 3FRUB 4L0ZA 3SOTA 1DBAL 2GJ6E 1FCCA 5GGSB 2X38A 4JDVB 3U4BL 3U0TB 3IVKA 2PPDA 4X99B 4Q9RH 1DZ0A 4JFDD 3TURA 1XDTT 2FEEI 3DRTB 4AV5A 4QXTA 2WXQA 1KCKA 5AOKA 1CR9H 2PXYA 3QHZH 4F3FA 3CZSA 4XPGL 1RV6X 1GC1L 5EOTB 4NOFA 3S7GA 3X1EA 4YBLC 2KC0A 2HFGL 3QCTL 3LK3B 4FP8L 4AJWA 3GT6A 1RSFA 4DP4X 2FYYA 4J3BA 2FX7L 3CNKA 4I87A 1BBJA 3CFBB 3MBEB 4I7ZC 1P4BH 1SN2A 5HGBA 3IJ7A 3DVGA 1JUFB 3CN0A 4ORGA 5I19L 4JCMA 5CEYB 5J06A 5PAZA 1P4LA 1JZGA 1PPIA 1AO7E 2WXJA 5MENE 2CRYA 4JX0A 3CJJA 3ROLA 2QR0A 3MUHL 1T03L 2WXRA 1QZ1A 1U8JA 2GFBB 3GMLB 4HUXA 4PVLA 4X9IA 3TBWA 4CVUA 4KRAA 5EULV 3U2JA 3RI5F 3AACA 1ACCA 1MPAL 3NFNA 4O02A 4LEBA 3ZKSD 1NOLA 3MV8E 5IFJB 4JPKH 3UGUA 4LOUD 2PR4L 5D1ZB 4NNXA 2JI3A 2K6YA 4FQJL 1S7QB 4GXVL 2OCCB 2BJML 3KS0H 4LP4A 2XTSA 2IAMA 1J1XL 4FGMA 4MAYB 4GBXB 3LKPB 4Y4FC 4MD4A 4HAGA 4EI5A 1PL3A 2OL3A 2R2EA 4JGJA 2WLLA 1RHHB 4G8EA 4QJ4B 3C12A 5DFTA 1AGCA 1K8DB 4MNHB 2QLYA 1KBVA 3OX8A 4QTHB 4AV4A 1CB4A 4PLNC 1J5CA 1AZCA 4AL8C 3EAKA 1I7RB 2VIRB 3BVNB 3BVWA 3TO2A 1KEGL 3QZBA 2HVJB 2HJKB 4NBZB 2V2TA 3ECBA 4ALAH 3ZHFA 2X9XA 4BGDA 2ZFGA 4LIQH 2QKIB 4NQDA 1FZMB 3LIZL 1INDH 2F7RA 4ZYKB 2NDGA 4F2MB 4CC1A 1UD4A 2NY5H 3J2PA 4RAUA 3T1WA 1G9NH 3OG6B 4NQSA 5E8EB 4CVXB 5JOEA 2MOQA 4NO0B 4Z78B 1U3HD 4M4RB 1JHKL 5JHAA 1DQKA 4C57C 4OQTA 3L3HB 2XC8A 4XTRC 3MRHB 5EZOH 4NUGH 3IFOB 3L3JA 5F9OH 2WV3A 4OIBA 2ZP8A 1ZA6B 2PWHA 3NFSH 4X6CF 5I1HH 2F8VA 2E4TA 3D69B 4AYBA 2BNRA 2V3DA 5KS9B 3ZYZA 1JPSL 1XCTA 4DNLA 5JMRA 2FATL 3JBG7 2PW1A 4MB4A 1XSIA 1SXBA 2HA1A 4QRPA 3GEWB 1KGCD 2YQBA 3EKCA 2W9EL 3U0PB 3MNWA 4XRCB 3TM6A 4YSQA 1C5DA 3II1A 5DA4A 1D5BB 1XGPB 1UD6A 1HXMA 4F7TB 5TK4A 4KKCC 2OW6A 4ODXB 3B9KA 3P1VA 4ZD3L 3ZMEA 4OZGA 1FNEB 2K9FB 5IM7B 3QJFB 4TULH 3VDAA 4KHTH 4PREB 4P8QA 3FFCE 4YK4B 3O3EB 5BRZA 1FA4A 4PW9A 2XWTB 4NI6A 1NBVH 2L3BA 4OCSH 2G9KA 2PYEA 3S3SA 2AERT 2ZG2A 1MLBB 5EF0A 4XHJD 1BIIA 4LLMA 1JZ7A 1BYNA 2BVEA 5EHFA 5AFUL 3SDYL 2R0LH 4LPXA 3I02B 3MRMA 5JTWA 3ZE0F 4DZBA 2ORBL 3RPIB 3QUML 3ZTJG 4FLSA 1MELA 4N86A 4S1RL 5D1ZC 5HP5A 4OT1L 4YSCA 3KVPA 2P44B 4DESA 1EFXD 4J2XA 2YPLB 2AANA 4XPBH 1Q9OB 2GSIA 4MAYC 4GBXC 3VFGL 2APTA 1E28A 4GKNB 1SF3A 4I0KA 3WFEL 5DURD 4W9EC 5GGVY 1M4KA 2HFFB 2PN5A 4HFWB 1S7SA 4LLDB 5DC2A 3SDDB 1LEGA 2N0MA 3ZQWA 5I1GH 1EX0A 2CQVA 2HT4C 4N8VB 2UXFA 1NICA 3CDGA 5BCAA 2X4RB 4HFUL 3AJ7A 1N26A 3BHBB 3T4YA 3CXDH 3PDOA 1BYOA 1QR1B 4L05A 2BIHA 1MCRA 2LOEA 3FT3A 5AOMA 4Q4EA 3EOYG 2AEWA 1RUKH 4MNQB 4KR4A 3UTSE 4Y5XA 3BGMA 1CIDA 1MJJB 4FFWD 3BDXA 1JMXA 4GMTH 2R0WL 4OB5H 2GJ6D 4ERSH 4F7EA 2P24A 1GYAA 2Z35A 3V6OC 3VD9A 2OR7A 1BLNA 3AVEA 2WO3B 3GMNB 1UB5A 5LDUA 4PBDA 4X0NA 1AXTH 1QD0A 1N64L 1JWUA 1MIEH 2P8LA 3N1QC 2P46B 1DJXA 5DJCA 1OAYL 5IMKB 4F91B 1ID5I 5F9AC 1RVFH 2JB5L 1QLRB 2MKLC 5J1SC 4PGEA 1FNLA 2EUWA 3MFGB 3AXLB 1L0PA 4KTDH 5CSZB 4OFVA 1I3RB 4Q52A 4Z8FH 5IBLC 1TMQA 2A74A 3KYMB 4K8RD 1UZ8B 3CZJA 4N6RA 5I82A 4ETYA 5IBUG 4QJ5B 5DD6B 3O3AA 3AQZA 2GI0A 4Z6AT 2FBRA 2GTQA 3INUL 1AO7D 1NAKL 3SKJH 3IJYB 3QZWG 3AQDA 2NY7L 2DMGA 5KOMC 1N6UA 2D7OA 4QRRB 1BW8A 1WBXB 2ZX8A 3TYGH 2ZXEB 2XSKA 1T1XB 1FYTA 1U8NA 2AXHA 2XKSA 4YXLL 1QSEA 5I5RA 3ZIYA 3SDXE 4UB0L 1SUJA 4Z7IA 2HTKC 3MV8D 4UMSA 4OCRL 3MTRA 3GPSA 1VGKA 1XB8A 1U8KA 2BW4A 2AZUA 2DQGL 5JPMA 3P54A 3A23A 1PTZA 5E1QA 1O6TA 4ZMNA 1PKQE 4G8GD 4HU8A 3T8XB 4DOHB 5KSUA 1U2HA 1YYCA 4KQ0A 1RULL 5FCUL 1WAPA 2AJVL 4XPFL 1E40A 3V52L 2YRBA 4RMRA 4LAQL 1VCBC 3LIUA 3V4VH 4Z0BL 1BCIA 4I3RH 3HHRB 4MXWL 4OTXL 4R0LB 2BFVH 2J21A 2XVBA 1DLHB 3RGVA 2WM0A 5AAMC 3SDDC 1NLBH 4O2FB 5ESVB 1YEIL 3GSRA 3IKCB 1SQ2N 3NCFB 1I1FA 2VDPB 4Q97A 5IKCB 4LSUL 1GW0A 3CFJA 4O2EA 4ONOA 3IXTA 1RJLB 5CP7B 1M3JA 4Q9CA 3D48R 6FABH 2BVOB 2P8PA 5D8JL 5DMYA 4W6YB 1BVKA 2QSVA 3S4SG 1FNFA 3LKNB 4G9FB 4KQ3L 5FUZH 1DJZA 3UCQA 3SY0B 4UTAH 4L18A 2VE6B 3VI3F 2WQXA 1U8MA 2YEVB 4TVUA 2J1ZA 2WZ6A 3NT0A 4A6YL 2FNBA 1EO5A 3V5HA 1OT4A 3QIWB 4MAUL 3TVMB 3DJRA 4XNXL 3I3BA 4JM4L 4BFBD 1CGSL 5HYQA 5CP3A 2VGLM 4YXHL 1Z32X 1RZPA 1HL4A 5D7JD 1TQBB 5T5FA 1HKLL 1KWGA 3CH1A 5HHVH 2YAHA 1DVFB 4NQQA 1I7UA 1F6AB 2DIAA 3QWOB 4JREB 1MFCL 4FHKA 4B0MM 4PW3A 2XHNA 2VWEE 1MEXL 2XZCH 2YAOA 1RJZB 5J13B 1TQSA 3BRYA 4R3SA 3ULUH 3RVVD 4R84A 5IYUA 5DVMA 4NKOA 5DUBB 5EU5A 2NZ9D 2VMFA 2CO6B 5EC1A 4O49A 1CN4A 1JCKA 5J3HD 2OAAA 1ZHKA 4AK2A 1DEEB 1NPJA 5I16A 5B39B 3SE9H 2D03H 1KNOB 1ZD6A 3L5HA 4F2ME 4KHXL 4YDZA 2PCYA 2FSDA 5T5NF 3DNKA 5IG7B 5EEWA 1BVNT 2K45A 2E6QA 2R4SL 3CHXA 1F3DJ 1IMHC 1JDAA 3V6OE 4M5ZH 2R4RH 2CLRB 2ZAHA 3Q6GL 4J3XA 2CR3A 4NYLA 2VERN 5AAWC 1HHKB 1PX8A 4YL4A 1IC0A 1P69B 1VFAA 2AEPL 2J1KA 3EGXA 1MW2A 3OMNB 4IOSA 2G9HA 5E94B 4R5VA 4XP9L 1XR8A 1V7NH 1A4AA 2GUOB 2WHVA 1PZCA 1A9EA 4ADGA 3SKNB 3QXTA 5EBMB 5EO9B 5CGBA 3ABMB 4IOIA 4LSQL 2BS9A 2FQDA 4WI3A 3DJTA 4ACPA 1Q1PA 3I6KB 3NBNA 3LZRA 4YFDB 5IQLA 3POHA 1VZHA 3P73A 3QRLA 5BZXA 3BEWB 4XCEB 1WICA 1UCBL 1ZANL 4APQA 3AA6B 2OXGB 3RIFF 5EN3A 3FTUA 3UYPA 4KUZH 3RWHA 1B6UA 1FQ9C 1X9QA 5EA0L 4ELMA 3RFZA 3C75A 3K46A 3QUYD 2F5BH 2WXOA 4JE4B 3MMEA 1KIQA 2AQ1A 2NY4B 4QO1A 2YMXH 1AKPA 1Y07A 4Y8AA 3ARGA 2Y1YA 3N42B 3Q2VA 1MLCB 4XXCC 3FQWB 3WJMB 3C9NB 4RNRB 3EOBA 1KLUB 3VXTA 1OE3A 2GIYA 5FECB 1LGVA 5LO7A 1LO0H 3UZVB 3GBLA 3DRQB 2QZQA 3HPJA 4IKLA 3IN2A 4LU5L 1SMDA 4L48A 5E2VL 1GZPA 4LOFA 3PF1A 1AC0A 3QIWC 3TVMC 3BZEA 1ZHZA 2CGRL 3DKHA 5FM5O 5EZLB 5HGAB 1TQBC 2W07B 4IQHA 2UZXA 4YBHA 4Y4FD 1OCCB 4RRPA 1C7SA 1JRHI 1DVFC 1FVDB 4FCHA 5ACZA 2HZHA 4N3TA 4Y2DA 3BVTA 1GPOL 2YPLE 3OM3B 3PXLA 1SYSB 2Z8RA 1N0XH 1OGPA 1WD8A 3DMMD 1SOXA 4G7SB 4YEEA 5T3ZH 3WNKA 3ETTA 1K3IA 2IIJA 1M2VA 4I0PC 5J13C 1UOKA 1NQBA 1R5IA 4AZUA 3W9DA 4EBQL 1SBSL 5GRJH 1ZWIB 2VXSH 4GAJH 4M7LL 2HJFB 3LKRA 3MLWL 2UY6A 4NDMA 4OKVA 2YRZA 4WI2A 4HWZA 2K78A 2ADIA 3T9WA 2P48B 3REVA 1WAAA 1CFTA 3RWEB 3MRFB 4MNQE 3WSQH 4WHDA 3II2A 2BW5A 2XE1A 1VRSA 3KPRD 3MRLA 3M8OL 2NXYB 3D2TA 3MRCB 5DQ9B 3F7YB 1U3JA 3AREA 3L5IA 1XGQB 4OLZH 5E70A 4FNQA 3S34L 2C9QA 3WS3B 4PP2B 4AJVA 2IANB 3QRGL 3QUGA 3U2IA 1D5IH 4N68A 5JHLA 4O2CA 4E1TA 2IGTA 1CFVL 3QWRD 4E2OA 5KVFL 5KYWB 1FG2B 1HWWA 1BQLL 2VMCA 1HFUA 3U7YH 5IROD 4PEEA 4XNDA 4JFFA 4QNPF 4I5BA 5DEZA 1DE4B 2KZKA 1DSFL 4GSDH 3CZFB 4QTIL 2WTOA 3LKSA 4AKMA 4HYTB 3WOVA 5TISO 1H3PH 1QBMH 1SVBA 1NLDH 2AQ2A 1MQKH 2WWKO 3KM2A 4YN3A 2XIBA 2KS0A 4PVNA 4YOKA 3SEPA 1XMWA 2NY4C 3BT2L 4JG0L 4XXWA 5AB0A 4L8CB 1TTBA 1F45A 4K2UL 4UT9H 1YVLA 4L23A 3GPEA 5F0JB 3MV11 4PG9B 5DWUH 4J3OH 4QRRE 3GMRB 1K5WA 5ID1B 1E8ZA 5TDPB 3GXFA 1ZEAH 2VJ0A 5ANMB 4JFOA 1G9HA 5DQDH 2VH5H 1FAKT 5IB2B 2FEEL 3CUPA 3TO4B 3LK41 4LSHA 1NUNB 3CPLB 1AD9A 2QBWA 7TAAA 5EUOB 2XUWA 3CN4A 3LH8A 1IFRA 4V33A 3CMOL 4I77L 5E8PA 4DOHE 1B2WH 4MAYD 4GBXD 1XGTB 2V2WB 2CBTA 1AGFA 1MZYA 1S2EA 4HEME 3KPLB 1HT6A 4H8WH 3FUFA 1TCMA 2PW2B 3KPQA 4PV9B 4UM9D 5J0BA 4APXA 3UJTL 2PR9A 2WQRA 5A6LA 2VO5A 2BSRB 3HCVA 2HVBA 4FNTA 3MNMA 4JO1H 4IGBB 5MI0C 1KYOK 3FB5A 2XE2A 4RGOH 2ZXWB 35C8H 4HS6A 4M5YH 2BVQA 1CGXA 2NT0A 4IJTA 2Z92B 1KN4L 1UA6L 2RALA 4XO4A 2X2JA 2X10A 4OAWA 2JJWA 3C8KA 1ERNA 4CMMB 4Q58C 2QKSA 3EH5B 3X3FH 1N6QL 4M6NH 5E6IB 2JELL 2K4WA 1NEZB 2GYSA 3BX7C 4G9FE 5KZCD 3P4NB 3SYOA 5AVTB 1E3FA 4U3SA 3OC8A 3UEZA 1KJ2B 1QUNA 4FN0A 4Y5VA 3ZR5A 2IWKA 3QEQB 1O7VA 1A6ZB 2NXYC 3GC3A 2B4CL 3A6BL 3GMPA 4OFDA 1KXVC 4JQIH 1FBIL 4OCXL 4MMZB 3MNVB 5F0LB 1SHMA 4AK1A 1LO2H 5KSBF 2KZ1B 3Q8CA 3RIAK 4HC1A 1LNUA 4HKXA 3SGJC 2MHAA 1JI2A 1GZHC 1L9QA 4PB9H 2DMKA 1XSOA 3K5SA 4PJIB 5E99H 5IBLD 4EDWH 3QDMB 2WBJB 3STLB 3K2KA 2MRYA 4BEIA 2EC9U 3HN5A 5ABDE 4H1LG 2E74C 4EUPG 4AQ1A 4XB7A 3GKWL 4A2DA 1CT8A 3E6FB 3ARFB 5LCVA 4ABUA 3T24A 4E36A 4KRLB 5DHVB 1N10A 3EYSL 3QUKB 1YYMH 4XMLH 3VI4B 3KXFE 4Z5RA 2B1AH 4YDIL 3VACA 2DQJH 5CLXA 1BPLB 4PRNB 4IM8A 1IZKA 4E9SA 5IW6A 5D4HA 5F1NB 5LNDA 3E0GA 3HG2A 4UQ2B 1JPFB 1QNZL 1EMTH 1NAMA 1WFNA 1K5NA 5C07A 5IF0B 4I2XA 2B1OA 4R2GB 4MSWB 2K6ZA 1U91B 3TTYA 5FF6A 5DEJA 3PGFH 3TO4C 4JN1L 4Z23A 3U36A 2YC1A 4WJ5A 1EXUA 1GGTA 4N8CL 1DBAH 1ZVHA 1VB9A 4KKPA 2AV1A 3U4BH 2YPLD 2DPKA 4URKA 4L3EB 3GSVA 5GGSY 3QUHA 3U48A 3QRBA 5GS2D 4NRXA 4AKRB 2ARJQ 3QA3B 2XE5A 1DJIA 2BY2A 4PJ6A 3RWJB 2OMTB 2R23A 4BCZA 3DDGA 4XPGH 1GC1H 3IXAB 4B60A 4WW2A 2UWEB 2HFGH 3LD8B 3QCTH 1IU1A 4FP8H 4GNKB 5KG9A 4LGPB 2FX7H 1U92A 3BUBA 2VQ1A 3GTNA 2EKJA 3RL2A 5HYJA 1PY9A 3IVKB 4GRLA 4AH2B 4LKCA 5EC2A 3FCTA 1J9TA 2R7EA 5E6IC 4JRYD 5I19H 1XZ0A 4QXTB 1JSYA 2RCSL 3RTQB 1UZ6F 4Q9QL 1F5WA 3UEQA 2PXYB 4G6ML 2K0LA 4N5UA 2Z34A 4XNQA 1GGIL 1ROCA 1GKOA 2PMZA 5DJXB 2IQAA 2OJEB 2FYYB 4MMZC 1I8AA 3VNYA 3EJYC 2X6VA 2IOMA 5CR8A 1CDYA 2F7QA 1MPAH 2IH1B 4LLUB 5HGBB 4P48A 3DVGB 3VQMA 2J55A 2PR4H 1E27A 4KGLA 3TCXA 4P2QE 1ULVA 1P4LB 3F01A 1PZ3A 3HKFA 4FQJH 2WBJC 4GXVH 2BJMH 1MNUL 1J1XH 3TC9A 1QHOA 4OSUL 4LRNL 4RMSA 3RHWK 1U8JB 4HUXB 3TBWB 1O6VA 1ZT7B 2YA1A 2XOTA 1MW0A 1JWSB 2OXHA 2VXQA 2G2NA 5AVRB 3SGEI 5C0BA 1KEGH 4BHUA 1NFDE 1UH4A 4N90E 1T16A 1BJ8A 3ZHKA 3NFNB 1HSBA 5IB4A 2WGXA 3MLSL 4NNXB 3LIZH 3QIUA 3I9IA 2J72A 4N2CA 4CN4A 4PVBA 3FAWA 2IAMB 5ERWB 2J6EA 4FC3E 1JHKH 2YN3A 1TNMA 4R2GC 5FHAL 4MD4B 2FR4A 5FYJL 2OL3B 2BSCA 2R2EB 3VNZA 2WLLB 4GW4A 2NYKA 4G8EB 3WEBA 2DEYX 1AGCB 3QPKA 4S1QL 3OX8B 4WRLA 4HIEA 3T0AA 3TO2B 1IB5A 3CAFA 3VD3A 7FABL 2V2TB 2BHZA 1BYPA 3ECBB 3W11C 4JGMA 5AVWB 1DO6A 3ELAT 1DSWA 2KZWA 4UQ9A 1T22A 2XETA 4RZCA 5TQ0L 1JPSH 2VLKA 2FATH 2XV3A 1VACA 2IANE 4NQDB 2ZXAA 3HW9A 2WNGA 5AQ0A 4G75A 4RAUB 3CVCA 4JM2F 3MXWH 2N3JA 2RFXA 2FT6A 3V8UA 1LP9F 2W9EH 4BXSV 3VSVA 1SDDA 3R18A 1E43A 1X5LA 4NCC2 3LD8C 3WIFA 4IRJA 3CX5K 1A9BA 1Y0LA 2CUAA 4OI8A 4K7FA 1PFOA 5H4YA 4Z3JA 3L4XA 5GS0L 4NBYB 1OGTB 2BNRB 1KGJA 4F7CB 3F3HA 1XCTB 2GB2A 4Y4HB 2N2LA 1XFPA 5CZXC 2IH9A 4MA3A 1VFBA 1QG3A 3RTQC 4QRPB 3FQ4A 5B7EA 4FQ1L 3FU5A 3J7HA 4M7JL 3MNWB 1WWAX 2K8QA 2J73A 2CGYA 2NY6C 3ESVF 3UOAB 3TVMD 3UTZA 4CC0A 5ANME 1HXMB 2ZUXA 1PEWA 4H13C 5ENWA 1PJWA 3SDYH 1WYJA 4LE8A 2VDMB 3B9KB 3E3QC 1QTPA 5D7HA 2K0RA 5AOIA 2WW8A 5LVEA 2ORBH 4AZ8A 2FB4L 1ET8A 3QUMH 4OZGB 3L13A 5DD5L 3A4DA 4S1RH 4RMUA 4OT1H 4A1RA 1R0AL 2APFA 3US9A 2ENJA 5BRZB 1XF4A 1IKNA 4B9ZA 1AG6A 4FHBD 3VFGH 4DGUA 2PYEB 2CK0L 4I0PD 4ZTOL 3SCMA 4EOWL 1BIIB 4RJXA 3T71A 3WFEH 1RLBA 2EADA 3OAUL 4O02L 4GAFB 4Z7AA 3MRQB 1HQ4B 3MRMB 3OB0H 4D0DA 4WZ9A 4GO6B 2NDFA 3APDA 4HFUH 4YPJA 5DZOA 4E42A 5H37A 4XNKA 4PV1C 2B15A 3BAKA 4M3KB 4LLVA 4L4JA 1I82A 1PRNA 4JPIB 2XPGA 4PPTA 2OMZA 3RZCD 1U6AL 4HJEA 3LH2L 5HHMD 2IAMC 2GSIB 4FFZA 3LPGA 3IGUA 1E28B 4FTVD 2ZF9A 3OF6A 2R0WH 3P77A 4HEPA 3IK2A 2VYRE 3VB9A 2D3LA 3VDBA 2MEJB 1S7SB 4QHLB 3HN3A 3FB7B 1LEGB 3FHAA 3QEQE 1XXFC 4YIQA 3M7FB 4I3GA 2ATPA 3CXHK 4HWUA 2VR5A 4OVVA 5GGVL 3NJXA 4PJFF 3CDGB 1LMIA 4F2EA 2WWOA 5EB9A 2XG6A 3BAWA 3T4YB 5DMIL 2BRRL 1OAYH 3EIFA 4LDEB 3PDOB 1IC7L 4TUKH 5E6UB 3ZE1B 5IHHA 5BPPA 3RGHA 3ZDXF 2JB5H 3FT3B 3S3CB 4KXAA 3WEMA 4PJIE 1KLGA 3VGEA 3G5XA 1OSPL 3G7GA 3QDME 4R97B 2H2SC 3DPBA 2E59A 3CFNA 4OLVL 3WKQA 3RIKA 2Z35B 4FG0A 3FT9A 1KXHA 1S3RA 1BLNB 2OMFA 1KSRA 2I9LA 4KROD 1UB5B 2NY4D 4KV5E 3D85A 4HX1A 1KEML 5HPOA 3JV6B 3INUH 2P8LB 1JWUB 1NAKH 1P1ZB 4MCNA 4MA1B 4Y4HC 5DJCB 1IM9A 1G1YA 4Q89A 2NY7H 3IU4L 3VI4E 5F44A 1K85A 2Z4QA 2ZYIA 1KXTA 1AJ7L 5FOBB 1U33A 1H6S1 4PGEB 1MFDL 2QSTA 2WXPA 3L16A 4P23A 2VDML 5J1AA 3T4AA 2E75C 4YXLH 4HKBA 4UB0H 4N6RB 3SE6A 4FSPA 4OCRH 3TX4A 3ARZA 3DK2A 3O3AB 1PY4A 4MD5A 2DQGH 3B9KC 4PJXF 4HALA 4P4KD 5D7EA 3NSGA 5FYJE 3GSNL 3WS6C 1P6FA 3PAUA 1RULH 5FCUH 5I15H 1RUPL 2AJVH 4XPFH 3NJIA 5K93A 1D6EB 3AZUA 3V52H 2FRGP 4LAQH 3VFNB 3IMBA 4Z0BH 2WVTA 3EFDL 4MXWH 4OTXH 1FZOA 4QOKB 1ZS8A 3UMNA 1U8NB 4FZNA 2NRDA 4N90D 5F9JB 4DP9X 1GZQB 4MCYA 3HC0A 1VGKB 1YEIH 1U8KB 3VXMA 2QQKL 5JPMB 4LSUH 4UIKL 3NZ8A 2MIZA 2DLIA 5KSUB 4JJOA 2GSGB 1MZZA 2AJYL 3BVVA 1YPZA 5D8JH 2G2PA 2XV6B 3H2PA 4W9GC 4KQ3H 4OF3A 3GMQA 1TJIL 4N8UA 4CADA 2B14A 4XMUA 3CLEL 3RGVB 3OR6B 3QQ9D 1PX3A 1CF8L 1Z5YD 3GSRB 1I1FB 1NWPA 4FMKA 1V3MA 4QGTA 2DJUA 4WI6A 3P3TA 3BZ4A 4A6YH 2GITA 3HZKA 1NKGA 1XH3A 2DM4A 4O2EB 3VYNA 4XNXH 1WP6A 4LT7A 3IXTB 3SODB 1CGSH 4C00A 2FVNA 2DKSA 4PGJA 4KOBA 3QORD 1JNJA 4PS8A 1BVKB 3DLQR 1HKLH 4H20L 4TXVB 3IDMA 3PS6A 1L6XA 3S97C 2XT1B 4XMZA 5ESQA 1B6DA 1MFCH 2NR6C 3FPYA 3WNOA 4ZQTA 4P5TB 2RAMA 4HCRA 1M6OA 1MEXH 1U8MB 2K7QA 2BIMA 5DZJA 3TZVA 3V5HB 2VC2B 4CSTA 3DX1A 1LXMA 4MA1C 4B41A 4KQ4L 2C9AA 2WJRA 2BDNL 1KCSL 3IN0A 2FJHA 3CH1B 5D6DC 3M6DA 3WIIL 1T89A 4KHXH 3TO4D 1I7UB 5IREA 1FG9C 4EAEA 4HG4J 4B97A 4M6OL 1ZPUA 1FN4A 1KC5L 2HJLA 2EE6A 2R4SH 4OCYL 4UT6L 4X6DB 5E56A 3ZIMA 2EVIA 3T2NL 3DA4A 4R3SB 3Q6GH 2WXNA 5HYSB 3BFOA 3IPFA 5EU5B 2EAEA 4DUXA 2AEPH 5EC1B 3ZLQC 2FAUA 2Z4TA 3G7TA 4XP9H 1ZHKB 3FO9B 4ZMWA 3ZY7A 2P9RA 3AU0A 5AVXB 3ULVF 5I16B 1P7QA 4UU9A 1KB9K 4NQDE 3C2SA 4LSQH 1E67A 1ED3A 4CNIA 2CO1A 1AZRA 3QR2A 4OW6A 4BUGA 1CYGA 2RHEA 3VX1A 4OQ1A 4NUPA 3UBHA 3E6HA 1PAZA 1AI1L 1UCBH 4Z7UB 1ZANH 3B2MA 4U3HA 1M56B 3NFPB 5JPMC 5DWPA 4NYLB 2DF3A 2JTYA 1ETZA 3VFPA 5EA0H 3WN6A 1VFAB 3EGXB 4A67A 4HS3A 5E6ID 3V9EA 2G9HB 4BH7A 4FD0A 1XR8B 2BNRE 4HJ0C 5TJWK 3CBJB 1A1NA 5DRWA 1A9EB 4JRXA 2BY0A 3VD5A 4IOIB 3LSOB 4WWNA 2Y4SA 4QRPE 3TPUA 2APVA 5CO1A 3P73B 2FGWL 4MQ7A 3RGVC 3P3YA 4X5WA 4HKZA 4APQB 3FF7A 2NY0B 3DSFL 4LU5H 4UIMA 3GJEA 5E2VH 5HI3D 1VJSA 4BV1A 2OZ4A 3RWHB 4ELMB 3RFZB 4IBSA 4PGDB 1CICA 3C5XA 3HAEH 2CGRH 3MMEB 1ZHNA 1BF8A 1KIQB 4FQ2L 5C0GA 2WBJD 1YUKB 2CJSA 4OZGE 1AE6L 3K81A 1MHPL 1YEGL 3D6GA 5K39B 3D4CA 4OZHF 1MCHA 1QAWA 4L9LB 1E90A 3DX9A 5BRZE 3BI9X 3EOBB 1GPOH 4GCPA 1U3NA 1NDTA 2PYEE 4P5TC 3NK3A 4IEFA 5GRZA 5FHBL 3HPJB 1T7WA 3VRIA 3VGHA 5DMJB 3RKDD 1GZPB 3VXSD 4JFHE 2IVFC 3BZEB 2QQQA 3T8VA 1SBSH 3ZHNA 4EBQH 5CS7A 5BS0A 1B4TA 2WC7A 3EO1A 3K0WA 3Q8BA 4GUOA 5HDBB 1F11A 4M7LH 4G9DA 1YYLL 1ICTA 1J9CT 2F54B 3MLWH 5IMOA 3PXHA 4LL4A 5D7LA 5I8OL 3KL3A 4XXDA 4AY0A 1WK0A 3A47A 5FGCE 5ACZB 4Y2DB 1E4XI 2PO6A 2WP3O 3ABGA 2AXTO 1GFMA 1AR1B 3WJJA 2F08A 3KPSD 2BVTA 5IP4A 3KEHA 3OGCB 3MREB 4J4PA 4MZRA 5FFOA 3JSSA 1M2VB 1IAKA 3M8OH 4ZK8A 1KBKA 3NDYE 1AH1A 3ETBF 1R5IB 4L3ED 3W9DB 4MMYA 4J6RL 3L9YA 5B66O 3S34H 1ITCA 1MH5A 3LKRB 3QRGH 3WE6A 2UY6B 2YFNA 4NDMB 3CU1A 1I8IB 4AQAA 1MRCL 3ZE1E 4HWZB 2ADIB 3O0EA 5DZPA 4U6VL 1CFVH 1JDDA 1OTTC 5KVFH 3REVB 3G6JF 1BQLH 1CFTB 2EDHA 3JV5A 4LPCA 1HOEA 3CN2A 3S8GB 3GF8A 2BP3A 4PJCA 5DVLA 5AL8A 1KDJA 1KFAL 2DEWX 3MRLB 1GYVA 3T77B 2EDDA 5CMAA 3IGLA 4LPTA 1DSFH 4PTUB 4YJZL 4QTIH 5CZXD 4GMSL 4GKSA 3DUUB 5F21B 4PJAF 4RMBA 3LH9A 3RTQD 1GOGA 4QQ1A 5L9DL 4N8VG 5DS1A 3BT2H 3NACH 4JG0H 1XGZA 4O2CB 2CDFB 1ZVYA 1MG3C 3KDMA 4K2UH 2NY6D 1QFUL 4YZFE 3G6DL 3D12B 1NOFA 1T66D 2X1OA 4JFFB 2R69A 4QHUA 4DP8X 2MPAL 4JY4A 1WFIA 2XWEA 1X4YA 5F97E 4APQC 4TRPL 3B2XA 2GSMB 2NY0C 2YXWA 2MFNA 4N87A 1I75A 2X0UA 3EADA 1MW1A 2QPEB 3RFZC 3LKSB 5CZKA 2MJWA 3X11B 3GZQA 2ED7A 1RP9A 3O8XC 3ORJA 1CDHA 3CMOH 5FPIA 4I77H 4XBMA 2BZ7A 4KFZC 5L7XL 3LNDA 1YNTA 4L9LC 1UOWA 1UA7A 1GFNA 1JTOA 3MRNB 4QKTA 4XVUC 5E9NA 3WKML 5FS5A 3RVXD 2R1WA 3WNPA 4P07A 4GW5B 3UJTH 1FYTE 3BLBA 1QSEE 1P1VA 3CUPB 4PRAA 1CGVA 1TQCB 3CDCA 5M94B 3SKMA 3RUGB 4RL9A 1W72A 2VDKL 3SOBL 1KN4H 1UA6H 3QR0A 4WFGE 5E8PB 3O6LL 4XAWL 3BUQA 3FN9A 4HIXL 1LO3L 4UMGA 1UWFA 2V5YA 2H9GA 2NZIA 4DPCX 5T3XE 5DK3A 1N6QH 1AGFB 4Y2DC 1HH6A 3F6IA 2JELH 4N28A 1XL4A 2X12A 1YO4A 1AR1C 3KPQB 4APXB 3SKUD 4G1MA 4I9WE 4QRAA 5C0NC 2B4CH 1S46A 3A6BH 1HX0A 1OK8A 3FB5B 3VRJB 3X12A 4HS6B 5F70A 4HU2A 3KZ8A 1FBIH 4OCXH 2BVQB 3KPOA 2G3NA 2M2DA 3RYMA 3C8KB 5DR5L 4FXKC 3LK2A 4MX7A 3IGFA 2WY3B 2XPYA 2QADC 2AW2A 3G9AB 3WHE1 3U4EA 1KLFA 3CIQA 2WSKA 3SD2A 5IQNA 3M88A 4UILL 4U3SB 4Y5VB 1QUNB 1NKRA 3GKWH 1NUFA 1WFTA 3MSPA 4IRZL 4L8SB 2ALWA 3AY4A 3GMPB 1XF5A 2IWGA 3IMTA 4Y4HD 1GCFA 3EYSH 1K4CA 3DO4A 2H1XA 1ZGLM 4KAQH 4HKXB 2MHAB 4YDIH 4YC2B 3D3VA 5E5UB 4PFEA 5FUOH 5E9DB 3B7SA 2Z7UA 1QNZH 4N0YL 2CHWA 3FU3A 2VKWA 1QP1A 1DBML 4AQ1B 3F12A 4ZUWB 4DT2A 1JVOA 2Z7WA 4KWUA 1JZDC 3RVUC 3BE1L 4JN1H 1N3NA 4JN2A 4C4BA 1HU8A 2GI7A 4N8CH 4PRBA 1HK6A 2L7UA 4ZW7A 1QBBA 5I1KL 2HFEA 2XN0A 4Z5RB 2P45B 1KACB 1NCOA 3HG1D 3HZMA 4IOFC 1WAEA 2Q7YA 1YJDL 4XMKL 1WCBA 4YUEL 4G6JL 1NCCL 2KUTA 4M6AA 1NAMB 3O3UN 1K5NB 5DS8A 5C07B 3HBQA 2ZKHL 4JFSA 5KWYC 1F2XK 2VUYA 2X0VA 3MNDA 3PWPA 4S1SL 2VOTA 3B9EA 2YC1B 1TQCC 4FQEA 2BNQA 3HE6D 3L9BA 4WJ5B 3U36B 4PS4L 5ITFA 1EXUB 5E8OA 2Y5QA 1UH3A 2N7BA 4GRWB 4PG2C 5DF0A 4LHQB 1EBPA 2AV1B 3B3BA 3O6ML 1GS6X 1E2ZA 3QDJA 4RSYA 1EZLA 1TYJA 4B3VA 4F4BA 4X7DC 5KVDL 1T21A 2RCSH 2VR7A 3P0VL 2B3RA 4Q9QH 2YPKA 3AROA 2FLBT 4ZJ9A 1N8ZA 1NMCB 1XCQB 4G6MH 4KZCA 5CD5C 4MS8C 1RUAH 1FO0B 2IQ9H 4MA8L 1GGIH 5L4JA 5MEOB 3B3IA 3I3EA 1JV5A 1BQUA 4G7QB 2ZCHL 1U92B 3RL2B 2VQ1B 4ELME 2JJTC 2JKLA 3Q13A 4GRLB 4L29B 1FE8L 4LKCB 2MHLA 2VZTA 5EG6C 1HWHB 5INCB 2R7EB 5JOPE 2F68X 3VFMA 1O7SA 2NR6D 3KBHE 2WQSA 4KMQA 3LB6C 4E5XB 1DUYA 3BMWA 4ENZA 1MNUH 2X27X 3B2VL 2YOCA 4Y5VC 5I2IA 4XNQB 5G4MA 4OSUH 4TOYH 2ZWKA 4L8SC 4LRNH 1DQLL 2DICA 2IQAB 5IEKA 2AQNA 3JXAA 3ETSA 3QSKB 1G7JA 4A55A 2DY2A 2MTPA 4TQPA 4MWFA 1XAKA 2JQYA 1NM4A 4YC2C 2LE9A 1P4IL 4PRIA 5HDBE 4DKEL 1E27B 3BYYA 3MLSH 4I4WA 2GK0A 4PRPA 5ALCL 4MMXA 3U2SA 4M93B 5LCVL 3W5NA 1BLIA 1LDSA 3KPNA 4WNQA 2AXGB 3H0TA 1UQSA 3F7VA 4AQ1C 5FHAH 3SE8L 5FYJH 4X9YA 1WBYA 3VMPA 5EPMA 4NO3A 1TFHA 4PRDA 5GZOA 4S1QH 1LQBC 3HRZA 2FHBA 2OXHB 4FI6A 2C1PA 4A2HA 2EEFA 4MJID 3RI5K 7FABH 5M95B 2DL2A 1XB6A 2ZKMX 2TSAA 3ARTA 1HSBB 2G5BB 2MTAA 4AVJA 1LMKA 2OMBA 5TQ0H 1GJUA 3B7YA 4QOKD 3KJ6L 5IB4B 3N41F 5B1JC 4I88A 2ED9A 3QIUB 2AJUL 2F61A 3H3BC 4U6HA 2F7OA 3NZUA 3M1BA 3BW9A 2XTJB 1WAAE 3NIFB 2FR4B 4GW4B 5AVYB 1FNSL 1HE8A 5T33L 3SJVA 2IV9A 4ZW3A 4QXGH 3DOSB 5GS0H 1GXEA 1G9ML 4YLCA 3H9YA 4PHZA 5AZ2L 5LBSA 4RZCB 2VLKB 1BEXA 3LX9A 4XO5A 1BX2A 3I74A 2NUTA 1FGNL 2X4TA 4I9WD 2N0KA 3RGVD 3Q06A 4BE6A 3RWGA 3ABZA 2Y7LA 1C16A 3W9EB 4FQ1H 5B7MA 1NMCC 4QD2E 4M7JH 2EE2A 3GEFA 1JGVL 3HNTL 1SDDB 1F3JB 2IMMA 5LQBL 1I1AA 4JFFE 5T1DL 4D9LL 3M45A 5TD4A 3WIFB 4ABWA 4IRJB 1P4UA 4J6IA 1A9BB 1T7VA 1Y0LB 5DHMC 2JWYA 3MUGA 3Q43A 5D2NA 4DK5A 1EAQA 2B2XL 3I6GB 3WO4B 1S7UA 1GH7A 3RJQB 2FB4H 2J12B 4GRLC 5DD5H 4FA8A 2MNJB 2ZCLL 4MA3B 1VFBB 4U3XA 1R0AH 1EHXA 5KVGL 4N1HB 4P5TD 4RDBA 1GTNA 3BUYA 5GGRA 1T3FB 2QGCA 3NCYS 4PLOB 1HXKA 2CK0H 5I5JA 4ZTOH 4EOWH 3APMA 3UTZB 4AUIA 3GIVB 3PAVA 3OAUH 1OY3B 4O02H 3VMOA 5ENWB 5CGYC 1UC6A 2OLDA 3MJWA 3OLIA 4FJYA 4HLZH 1UD3A 2HRGA 5C9KA 2Q3XA 2UXVA 1PEZA 1T04A 4AZ8B 5C7ZA 1RJYA 1J8KA 4G7YL 3RUGE 8CGTA 1OQXA 1JOIA 5T1LA 1EIBA 2X4PB 2SEBA 2WUCL 5AVVB 4M93C 1XF4B 1U6AH 3LH2H 4M1CC 4K07A 1BREA 2JJSC 3KYOA 3SCMB 4CILA 2QLVB 4LQFL 3QEUA 2GY7B 5GJSL 2O26U 1HJBC 4P3DA 4Q6KA 4EN3A 4KZEL 4Q2ZA 4ANWA 4XGZA 1T6BX 5GGVH 4D0DB 5C0JA 5BOZG 4U1NA 2HTLC 5INDB 3RKPA 4D9RE 1Z6JT 4LLVB 2BRRH 5DMIH 1BG1A 1IC7H 2XPGB 3QIUC 2DDQL 4B3EA 3HOGA 3KBFA 2OMZB 3WTSA 4YFLI 3EYQD 5HXMA 2YRLA 4EDXA 3GTVA 5CFHA 5FW8A 3S5LA 5C0EA 2XTJC 3K1DA 1Z0MA 1DVXA 1OSPH 4QHMA 2IXQA 1IBBA 3U0WL 1BD2B 4NZUL 4OLVH 5JHDD 3MFFA 2O6EA 4P2RD 1P7KB 1OALA 3B34A 3JWOC 4ZFZA 2ATPB 3IDXH 1ZT1A 2WQ8A 3GINA 4X50A 4L37B 5GZNA 1YNKL 1FFRA 3IU4H 3W5MA 4FFYA 3FB6B 5KBKA 3FS9A 1AJ7H 1KLGB 2P42B 3ML8A 5GRWA 1N0LA 3ZZLA 1MFDH 3G5XB 1B0RB 3U7AA 1M7IA 3DPBB 4AJYV 2CRIA 4OFYA 3S48A 3QO0A 5DJ2B 5HY9A 8PAZA 1NEZG 1A9VA 4IRJC 5E8NA 3LS5L 3O8XD 2WXFA 2I9LB 1T6VN 4ZI8A 2UX6A 3D85B 3WO4C 1P53A 1WBZA 4HX1B 1VEMA 4P49A 4IBQA 3W38A 3VRLF 3VFSA 2WO4A 3U1SH 3GSNH 2FECI 1RUPH 2Z4QB 2H41A 2X40A 1KXTB 3GMOA 1D7CA 3US0A 1IC4L 2AQ3A 1DQVA 2FQEA 3EFDH 3HFFA 4JZNB 3ILPA 4P23B 3T3PB 4K23L 1OAZL 3Q5TA 4YLQT 3T4AB 5J1AB 5JOFA 5C07E 4HKBB 3KGRA 4I2XE 4OGYL 5F72S 4N8PA 3HHMA 2DTML 1PMYA 2NCMA 1UGKA 2OX5A 4MD5B 3QAZB 2F54D 2QQKH 1IAIL 1E6OL 3HC4L 4LP5A 3EF4A 3IYLW 4O3XB 4Y9CA 4O3WA 2Z65C 2X2YA 1CDBA 5MERA 3BDBA 4Y2DD 1MAML 2AJYH 4N58A 5I0XA 3CDYA 1AR1D 2FJGA 4JY5L 1XGUA 1IKNC 1OL0A 2H32A 2G3MA 5AG9A 1FZOB 5C0ND 3SCMC 2Y0SA 1MRFL 1CTNA 4OZFG 1ZHXA 1HXUA 2CKBA 2FIKA 3GZPA 2OV0A 4BK4A 3RWIB 3FK3A 3CLEH 1OV8A 1BECA 4MCYB 1H3VA 1CF8H 3HC0B 4H1LH 4N0CC 3SPIA 3X1GA 1SJEA 4Q74A 4EUPH 1MY7A 3VXMB 3JYCA 3TBTA 2ZT9C 3CMGA 3NZ8B 5FLVA 2J8UA 1PYWA 1UWXK 2L7QA 2V5MA 2QADD 4FFZL 5HYJE 1XX9C 1YPZB 4FZ8L 3FFOA 4BFOA 1YY8A 5ESAA 1AFVL 4H20H 1EAJA 3GMQB 2DQMA 2WLIA 1W16A 1A4BA 1X5KA 3CHOA 3UPGA 1SJHB 4PWJA 3SPCA 2EQDA 5JQIB 1YLBB 4CADB 1YN7A 2A6JA 3L2LA 1V55B 3SE3C 5JA9A 1KCUL 1AHMA 2VLRD 4XAKE 3QH3A 3N44B 2XACC 2F8XC 3BZ4B 2Z31A 3IDUA 3QI9A 3HZKB 1E4XL 1XH3B 3CVHL 5C0AA 1VLXA 4Y19B 5DC0A 5GSVA 4CU6A 4KQ4H 1W0VA 2BDNH 2AQTA 5AW6B 1KCSH 4NRYA 3DX6A 4XNZB 2WJ5A 4F9LA 2WVUA 3WIIH 4AEFA 3MYJA 2OMWA 3QC5X 3IDMB 3RVUD 3PY9A 1DQIA 4MJ2A 5ESQB 4Z9KB 2H8PA 3SSGA 4FKEA 4M6OH 1KC5H 4OCYH 3WMSA 4Q56A 4UT6H 1HDMA 4OUUA 4B95C 3T2NH 1EJ6A 4IOFD 4AXWA 3TZVB 5HJ3A 4N9OB 3SPVA 2V3FA 1MCNA 5C0BE 1R5WA 3Q1SL 3BD4A 5GGQL 3IBOA 5JIMA 5D9SB 4N0FA 2WVPA 3UGXA 4KUCF 1BQSA 4Z7QB 3Q2NA 1NIDA 2FJHB 4X8CA 1H9DA 3WFZA 2P80D 3BFQG 2EE0A 5IMMA 4P23C 1SHXA 3S37X 3T4AC 2A38A 4N2IA 5L0QB 2D9CA 3IDIB 3V4PL 4B9YA 1B0GA 3NIFE 4AYFA 4POZC 1AI1H 1FN4B 2HJLB 1JFHA 2UXTA 4J3VA 4PV8B 1RZIA 4ZXBB 3QAZC 2DWTA 2GQHA 4E9TA 2HKFL 4M8QA 1YEEL 1Z9NA 3EYVA 4U7MA 3S36L 3OD3A 1ZHWA 3CDZB 5DJ0A 1SVCP 2AAVA 1RZ8A 1F02I 2YD4A 3O3DA 4XVJL 5D71L 3GNML 3V6ZA 3S9DB 3O2DH 4TTGA 3NABL 2VLKE 3AY2A 1P7QB 2CWRA 2MKWA 3DDFA 4UU9B 2J44A 2R1YA 3KD4A 1L4IA 4MS8D 2VISA 4ZMAT 1PCSA 1ED3B 3AS0A 5C6WH 4U9CA 1VZGA 3OWRA 2W0LA 3RJDA 3E6HB 4X4XA 4FLQA 1KV3A 1RL1A 1NBCA 1U2YA 1BAGA 3DSFH 3SBWC 3WFCL 1VEOA 1U93B 1ETZB 3VFPB 2ZWYA 4F1SA 5IQ9B 4HS3B 4BH7B 3GI8L 4FQ2H 4KDTA 3U25A 3LB6D 3OHXA 4HIHA 4R7NA 5DRWB 1AE6H 5K59F 4JRXB 3TLRA 1MHPH 1YEGH 2QDVA 2WO2B 3A6CL 3IWUA 1A2YA 1U41A 3C60B 1CFBA 2ICWA 3TPUB 5IHLB 2YGQA 3LHAA 1MQ8A 2CIKA 2VLMD 3JYBA 3H56A 2V7NA 3P3SA 5GTIO 4MQ7B 4DPBX 3ABLB 2J6WA 3HG0A 4MDIA 4X5WB 5FHBH 3BN9C 1PAMA 3RIFK 3SZ6A 2OR9H 4UIMB 3GJEB 4TLKA 4HJSA 1ORSA 5E9DD 3NOIA 5I8EA 1T5XA 5C0GB 3DUSA 2CR0A 4DEPB 3UL4A 1YYLH 2QL1A 2Y6TE 2PP8A 3GBDA 4QTFA 4XNZC 5C08A 1P7HL 4BQ6A 3EOTL 5I8OH 1Z9LA 3WGUB 4MFHA 3S35X 5FO9A 1KB5L 3FN0L 3DX9B 3ILDA 3QC6X 4QCIB 4HBCL 1DVQA 1Z7JA 3HE7A 1BVLA 1CQKA 4IEFB 5JIKA 2XWDA 1JDCA 3FTZA 3VRIB 2VLJA 4LL9A 4H2AA 5TTRA 3TZVC 3DO7A 3NCMA 1UD5A 4GLRI 4J6RH 2PCXA 1E3ZA 5EN2A 4F7PB 3EO1B 5DQJA 4AM0B 3SDCA 1F11B 1C5BL 4YHLL 1IAOA 3FUMA 5C07D 3T2PA 4CAGA 3QE5A 5D7LB 5IMOB 1MRCH 1QLEB 2NLJA 5I5IA 2WKOF 2OJ1A 3ZE2B 4U6VH 1MAJA 4B50A 3I75B 4ANXA 5L0QC 4AT6B 4JDZA 5FM8A 5AYQA 3OKKA 4FRWA 3TEWA 4ZXBC 2R59A 3FH5A 2C3HA 1HILA 1Z3GL 1IAKB 5E03A 4X4ZA 1UASA 1R3IL 3NZHL 4H25B 4MMYB 2R8SL 1SEBB 4GMSH 5DK0A 1YRKA 4YHIA 4ODWA 1XZWA 1KJVA 5BV7B 1MH5B 3TCLA 5L9DH 1U9KA 3VCLA 4PJ0O 3IDGA 2C4XA 4DVRL 3BKML 2Y2YA 1MNNA 1ETA1 2X1QA 1QFUH 5DVKA 3H42L 3G6DH 4WKZA 3FYIB 2B39A 4PJCB 2MPAH 2WZPD 3WNIA 3MJ6A 1NIFA 5JIHA 1HYSC 2VDRH 5E4AA 4TRPH 1TTUA 2FLMA 5CMAB 5C7XL 2YQ2A 4U0QB 1TU2A 4KK6D 4AX3A 4HIPA 5C0CD 5KEZA 4L4TA 3MLPA 3SQBB 1ESOA 2UY7A 4KJYA 4LHUA 1AQKL 1IV8A 1D5ZA 3UTQA 4LCVA 4HUUB 4GKZA 4K5MA 3T3ME 5BMFL 1INEL 1KTCA 4XAKD 1C08A 2DLHA 3C60C 3EO0B 3WKMH 3NGBB 3MACL 2R4NA 5CGYD 3VMNA 5CCKL 2CUIA 3DARA 3T3PE 3JVFC 4QF1A 4N1CA 1N19A 5SWSB 1OANA 4YBQC 2CLZB 1RCYA 1FH5L 3CFEA 4KI5C 2YJQA 4NKIH 5F7MC 3KG5A 5ANHA 1JPEA 4G6KL 2VDKH 4HZAA 2ZUTA 3SOBH 1JK8A 3F6JA 2PORA 4LPUA 4M1CD 3O6LH 4P06A 4XAWH 5C8JA 4HIXH 1LO3H 1G6RL 3G6AA 3FHQA 1YNTB 3CZGA 3GRBA 4N2HA 1UTDA 1CTMA 4NC0B 4F9PA 2R1WB 4Y89A 1SYVA 5I8CA 2C26A 4Z7VA 1J0JA 4PRAB 3SPJA 2G4GA 2HTLD 3C6SB 2H0JA 4HHGA 4D2NA 2ZOKA 15C8L 3VXME 4AGOA 1JL8A 3SKMB 4ODVL 1W72B 2FO4A 3T0VA 2D7MA 4JPSA 1BJMA 3ZDYF 2XTJD 3QXDA 5DR5H 2H9GB 1MW3A 5ALBL 1PQZB 1YPZE 4P9HC 3SGEH 3RTLA 3FTGA 3MRKB 3WJJC 3HI5L 4UILH 1Q9FA 4AVHA 3DOHA 1QUPA 1IKOP 1IGFL 1I9IL 1MXGA 2XVKA 4EPSA 5CD3A 1G9EA 4IRZH 4RGNB 1P4TA 4ZFOB 3PG2A 3X12B 1IBZA 3QK0A 1N6VA 3KL0A 3A4EA 5DJDA 3KPOB 3GSUB 5BV7C 4P59L 2A6IA 4NUMA 4C55A 3WV0A 3LK2B 2XG5A 3LS4L 4MX7B 4NHUA 4C4VB 4OLXL 1ANUA 1TNNA 4U1LA 3HI1B 3U4EB 4PJ9A 4N0YH 3RFRA 1DBMH 3K6OA 2PRNA 2CXGA 3AG2B 3TEYA 1LYQA 3BE1H 3AG1B 3VZWX 4JCWA 1XF5B 2EXYD 4RMTA 1OLLA 2H26A 3TU6A 1GOHA 1K4CB 4GS7B 1HCYA 5I1KH 4TL5A 3UC0L 3D3VB 5B3JE 1YJDH 4XMKH 3EBHA 4QI3A 4L3FA 3K7UA 4YUEH 4G6JH 2EXWD 4HWBL 4HXAL 4Z7QE 1NC4A 3GXIA 1NCCH 3NGBC 4UCFA 3VGBA 2GK2A 1LEIA 1X6LA 3S8WA 3OTTA 3F12B 3ZL1A 2ZKHH 1OGAA 2FEJA 3P4MB 4I13B 2PCPA 4LMQI 4KITB 1IBGH 2WNWA 3CHQA 4NRZA 1CUOA 3H53A 4S1SH 1MHHA 1I3GL 2DW5A 4PS4H 4PRBB 5HHOA 1KGYE 1OPFA 1A6PA 3HB3D 5GIRA 4PJ7A 3O6MH 3HS9A 3P4OA 2HFEB 3HZMB 4NERA 1H6UA 2H6PA 4QAWA 5KYUA 2Q7YB 4K9JA 2PWGA 1LD9B 1NANH 1WCBB 2X89D 4K3JL 4NAQA 2B9AA 1AVAA 4OU3A 5KVDH 2WXGA 5IMLA 4N0CD 5DS8B 2GIMA 4YDJA 2R4OA 5FOJA 3NIGF 4MA8H 2A2QT 3PWPB 2UZIL 4JKMA 2BNQB 4NWUL 5AW5B 3W39B 4B9PA 1YUHB 2ZCHH 3CSPA 4NPJA 3UC2A 3N40F 3V4VA 5FDWA 1I8MA 4BUHA 3EGDB 2MQCA 4L5FE 3QDJB 3CFCL 5HYSG 2K4TA 2Z9TA 1FE8H 1BD2D 1T21B 4JRXE 1HI6A 3VXNB 2YPKB 3W0WA 2EH8L 2X53A 3D2UA 4FEIA 2X4UA 1N8ZB 3B2VH 1CGWA 1SHWA 5CKAA 1UM4L 4C83A 2HMIC 3D25A 1XO8A 1GYWA 4KGJA 3TESA 4RGNC 5IJDC 3H9SA 2R89A 1DQLH 1JV5B 2Q3ZA 3QYNA 4GB9A 3C08L 1ZV5A 3HR5A 3KYKL 3O6KL 4I8DA 4J23A 1OWRM 1RZJL 3NMEA 4UTAA 5LHDA 3ZZ1A 1P4IH 3VFMB 1HH9B 4MJHA 4EIZC 1TO5A 5ALCH 3ASOB 4OF7A 3LQAC 3CQPA 1DUYB 1NSNL 4UAOB 5L4MA 5I2IB 4WK2B 3SE8H 1Z5HA 2PTVA 3AY4C 2YUWA 1KWKA 1FFOA 1EJOL 4FZLA 4L9DA 3VXOA 3MV9A 4TF4A 1G7JB 4GS7C 4MWFB 1JP5A 4PIBA 1QJPA 3FULA 3CK0L 4KK8C 5BS0E 5C71A 3UROR 2E9BA 1ZLEA 2EACA 4HD9A 3KJ6H 1Q1JL 4I4WB 3VZTX 4PP1C 4MLSA 2GK0B 2WN3A 5D7LE 3D18A 4WNQB 3KPNB 3ZE2E 1HCVA 3F7VB 3MJ9L 1A7NL 1AHWA 1WBYB 2C4FU 5EPMB 4PRDB 1FNSH 3PQSA 1WWBX 3HRZB 5T33H 2IDFA 3TASA 2C1PB 2H6UA 2XJLA 3MGAA 4U1MA 1QX1A 1GHFL 4PCTA 3MLYH 1G6VK 1G9MH 5AKTA 1TCRA 5AZ2H 3PHSA 1SOSA 3GS7A 4NENA 4F8TA 4WO0A 4NQEA 3OWEA 1PIGA 2MNHA 4GI8A 1O7DC 2XXGA 3JT2A 6PRNA 1JNHA 1FGNH 1TQWA 3MC0A 5F9DC 2EUZA 1IRAY 1ZV2A 3BW9B 3FQTA 3M1BB 4PSRA 4Y0GA 4MTMA 3HNTH 2IPKA 1JGVH 3QRCA 3TTSA 2ITCA 4M5TA 4UV4H 3RP1A 5LQBH 1JERA 5T1DH 4PJCE 4D9LH 5MHSD 3PWNA 2XKUA 1TFPA 1K9TA 4RAHA 2P5EA 4ZO9A 2DIBA 1XSJA 2Z3FA 4WU5A 3SJVB 4ZZKA 5IW1A 3CZLA 3QCUL 5C2BH 2B2XH 3KPMA 3NQIA 1FZKA 3R4DA 4JO2L 3M07A 4UUJA 5HSFA 2KBGA 1BX2B 4X5QA 4DVBA 5JIIA 2ZCLH 2X4TB 2C3VB 5KVGH 3Q8EA 3RWGB 4WQOA 3BCFA 1C16B 1IKFL 3VFUA 4DPAX 3FDWA 3T5WA 5L2KA 2ZYSA 1OOAA 1EZUA 2Y2TA 2JLLA 4Y19D 1FIEA 4G2AA 5D2NB 4WJG3 5SWSE 1TEFA 4LSRL 4TLUA 3LN9A 2XG4B 2LFUA 1SPDA 1MFNA 4N85A 4NKDA 4G7YH 2A9CA 1R1CA 1NFIB 3K91A 4C56A 4A7UA 2UUDK 6PCYA 4HUMB 2WUCH 5TK2A 1ML0A 3S2CA 1LL1A 2ZCKL 3BUYB 5GGRB 2P7TA 3NCJL 2O1AA 5F3HB 3TZVD 2ZUQB 5DZAA 5E2WH 5J4MA 4LQFH 2YAEA 4DUVA 1OD9A 3NJVA 5GJSH 2P5WA 2YAFA 1O6SA 2V7HA 4P4RA 1OSMA 4KZEH 1GL4B 1F4YL 1Q94A 1T20A 1T04B 2F1BA 3FO0L 2YA0A 5D70L 4PGBA 4AMKL 4PRHA 4S2SA 5JMOC 1VZIA 3PQYD 2SEBB 2DDQH 2EYTA 3C6LA 3ESOA 1BFSA 1I9EA 3K6IA 4CMHB 5HI5C 3AU1A 2APBA 3HJEA 3BAYA 3DVNB 4XMPL 1PW3A 2H4EA 3U0WH 2DWSA 4NZUH 3QEUB 4OCLC 3HRZC 1BJ1H 3H2QA 4IBLT 3G5ZA 4WENB 3VH8A 4EN3B 4WI4A 4Q2ZB 4RGNE 4XGZB 1JF1A 5C0JB 4Y2LA 1TUPA 4U1NB 4UBDC 3V5DA 1PKOA 2XBZA 2X2IA 3FONA 4JFTA 5EU6B 1YNKH 4H0IA 4HCFA 4TQ8A 2Y72A 5C9JA 1JYWA 3S0PA 3S5LB 1N12A 5C0EB 1HYSD 1HZKA 4V1DA 3O6FD 1F58L 1WD9A 4QHMB 2IXQB 5IVXF 1CC3A 3MFFB 1XCWA 2YS4A 1D9KC 4JM2A 3KWUA 3WFHA 1F56A 1TZHA 3OJMB 4ZFZB 1CI5A 4OLUL 2NQCA 1N18A 1ZHTA 2CIIA 2F5AL 3IU3A 3C60D 4NLHA 4OJFL 4R90L 5DS2A 3D3VE 3T0XA 1IC4H 4HULB 4OJDH 5DCCA 1IEBB 4F7KA 1M7IB 5IJVA 3AAZA 4K23H 2Z91B 2APSA 2BSTA 2NPLX 2YR3A 3QO0B 4KI5D 2FHCA 4FFVC 5HY9B 4OGYH 3LZQA 5HPMA 3SIKA 4TUJA 5E2TH 2DTMH 2ZD0A 5D2NC 3BDYL 4WHCA 4POUB 4QR7A 3H4HA 1FSKC 1KY6A 4YO0A 3H3PL 2O5ZL 1IAIH 1E6OH 3HC4H 3JTBA 4UT9A 4IHBA 5G5DA 5JIQA 4PJGF 3REWB 2QJDA 3VFSB 1MAMH 1UKTA 5FDYA 4F37F 1I8LA 2XZAL 4HUCA 2FZ3A 2BP0A 3SDXF 5D1QA 4JY5H 3GMOB 5DZ9A 1UCTA 3HI6L 1U8CA 3ILPB 4GEIA 4P5SA 2W9DL 5I0WA 1MRFH 2ZUQC 4JQVC 5JOFB 3L7FB 1TSRA 1E5ZA 1HSAA 4PY7A 1CLYL 4NI3A 3AMKA 4MJ5A 5H37H 3PWPE 2AABL 2OX5B 1J7VR 2HB0A 2BNQE 3Q44A 4LB8A 2X3CA 4WW1A 3OMZA 1SLXA 1UOVA 1IGML 5EFIA 1R9FA 3QDJE 4AC4A 3LK42 3G5WA 4FZ8H 2FJGB 1XGUB 3WU2O 4CMHC 2H32B 2CDGA 3QRAA 1AFVH 4QRFA 3TA3B 4JHZA 4QJ3B 3QEHA 5AW0B 5EZJA 4BJLA 2CKBB 2FIKB 1NA8A 1X5XA 3V55A 4AGNA 5ICXA 1KCUH 2CA4A 3EHBB 1SJEB 1QSFA 3TBTB 1GYUA 1ZLUH 2J8UB 1E4XH 1PYWB 1EEUA 1QLFB 3CVHH 3D34A 2GBVA 1QRND 1Q0YH 4JPVL 1URIA 5I1AA 3WHE0 1DYZA 2E47A 3QJTB 1YY8B 5ESAB 4EQ3A 3LTVA 4NQCD 3CVBA 2WLIB 4WKXA 4KRNA 2XX1A 3G04A 4JQIA 1DJWA 2QSCL 1WS8A 1EZVX 4MJ4A 5DHDA 2A6JB 5AVSB 1PLCA 5SWQA 4FFTA 1ZLVK 2VRQA 2I25N 2GUYA 3F7RA 3QH3B 2XQYG 4FFYL 1A25A 3QI9B 3AS1A 3R06B 4B9FA 5AYTA 4YL9A 2EDFA 3Q1SH 5GZNC 3FUHA 4YGVA 5GSVB 5GGQH 1T2QH 1TKWA 2NQ3A 1W0VB 3QFDB 2FDBP 2MCMA 2IPUG 4PRIE 1MG2C 3JWNC 4QRUA 4ORZC 3UMTA 1CPUA 3CBRA 4PRPE 5DHYA 3MYJB 2OMWB 4S0TD 5SWSD 5KBDA 3A4AA 3BLKA 1SXNA 1KYOJ 1ORQB 1BDYA 4BINA 2H8PB 3E38A 4IU2A 4RFOL 1HOCA 2K70A 2BO0A 4QHNA 3V4PH 4LCWA 4E5XG 4B6ZA 1HDMB 4OUUB 3L81A 1KCVL 1QFHA 3OC5A 4AXWB 2YSSA 1YEEH 5HJ3B 4NZTL 3S36H 5D7SL 4YR6A 5CGTA 1R5WB 4WNSA 4ZFGL 4JFZL 1WZKA 1R75A 4XVJH 3EYOA 5D71H 4N0FB 3GNMH 1G94A 2Z6FA 4PJXA 1IZNA 3NABH 2PPAA 1GR7A 5I1EL 4KNUA 5A40E 5IQMA 5IMMB 4F8PA 4F92B 2NTFA 5DZNA 2ZAIA 1UURA 4AYFB 4X98A 1QFWI 4XOBA 1RZIB 5KS9F 4GPVA 1GGUA 3WFCH 4M8QB 5LGKA 2K4AA 3IGKA 1TQTA 2HX8A 3EYVB 1OSEA 4QRSB 3SJVE 3VFVB 4AGMA 3F62A 2JB6A 2OQJA 5DJ0B 4NO2A 1B2YA 1RZ8B 3O3DB 4YE0A 3GI8H 4MA7L 2YD0A 3MRPA 4BSVA 2EH7L 3PFQA 3L4ZA 3QNXA 4FA6A 2V5SA 1RKRA 2IPTH 2R1YB 1KPRA 2VISB 2CBMA 3QPQC 3A6CH 5D5MA 3TA3C 3WUWA 1Z9SA 2BSBA 4RH4A 3BH8A 3CQQA 1G4RA 2BOCB 2BZCA 4E68A 3ULVD 1DZBA 2GCYA 4OH2A 3MGTB 4X4XB 3TN0A 3EHBC 1HJCA 1LO4L 1AOZA 5FYKD 4AYMC 5D2NE 3S88L 1OP4A 5F7EL 3CIAA 3VQ2C 4ELKA 1OLZA 4R7NB 3L7EA 1UM5L 1X3DA 3EOAA 3EOTH 2Q20A 1KB5H 4PS3A 1A2YB 2ICWB 2ZOTA 4YHNA 4HBCH 5LG1A 3VTTA 4J8QA 2IDUA 2DYPA 2V7NB 4M48L 4P2OD 3WIHH 4YZWA 1G7LA 2R1XA 2JQMA 4W4OC 3V2AR 1IVTA 3DC0A 3EDFA 4M3HA 4KK8D 1WHOA 2AV7A 3QI9C 4HPYL 2ERJB 5CEZD 1ORSB 5FLUA 5I30L 3OXSA 1T5XB 1RIHL 2ZKWA 2JQAA 1HAWA 1RD6A 4U05A 3ZKNC 5KAQG 1C5BH 5D6CA 4Z7NB 1RZGA 1AS7A 5C08B 1QTSA 4F9LC 3BIAX 1BJ1J 2WXHA 3SDAA 5FO9B 4NZ8A 2CBQA 4NPKA 3HE7B 4FYRA 1B4JL 1BVLB 1TVDA 2D2CC 3ECUA 4O51B 3SGKA 4KXCA 1G4MA 1F86A 1ZKAA 4DGYL 1Z3GH 2X6MA 2VLJB 2NW3A 4MBRA 4B5EA 5D1XA 1R3IH 1ZDSA 3NZHH 2R8SH 3PNWA 3W37A 5EN2B 3HMWL 5DQJB 2VSKB 3GSQA 2DEXX 4KTEL 1A4CA 4EIUA 2NLJB 4UM8A 1T4KA 3BKMH 3UAAA 4DVRH 4XPHL 2X05A 3H42H 3I6LD 4BZ1L 2J4UP 1A7RL 5I75C 4BD4A 4JDZB 1BAFL 4ZMLA 4ZS7L 1HILB 3PPSA 3EFOA 3K71A 1NDGA 1EHKB 5C7XH 1AXSA 1I1RA 3FTSA 1YMHA 5BQDA 5A7BA 2HLFD 3LMJL 1IM3A 4NEHB 4YHIB 1QEWA 4ODWB 3KCWA 5DRNA 1KJVB 3P69A 3TCLB 3KBEA 1CD0A 3VQ1C 2MWCA 4KR8A 3E7JA 3QQ4B 1ID2A 1TLKA 3AA7A 4KX8A 4DQOL 4F7MA 3UAJA 5BMFH 1INEH 2EDEA 1U21A 1WT5A 4K71B 1XIWA 2P8MB 3MACH 2JIXD 4WKZB 2KLRA 1NUGA 4XT1C 5CCKH 3QJHA 4FLHA 1JGEA 1W6LA 1GJIA 2BSED 1A6AA 3F7PC 1FH5H 1TU2B 3LNEA 5LGJA 4W81A 2E7BA 4G6KH 4W1TA 4L4TB 5BW7A 4OF0A 3FF8A 2UY7B 1HXXA 2O61B 2OMNA 2VAAA 4GKZB 3DI2B 3H3KA 1G6RH 2D0GA 5ELIA 1C08B 4YPGB 5EUKA 2R9HC 2LVEA 1EVUA 4QF1B 3QUMA 1UADC 4OZHA 4HMDA 1OP3K 1BFVL 3GUTA 3PWUA 3FRPG 3BVXA 4B96A 2ERJC 2W95A 4WO4A 15C8H 2BY1A 2YGPA 2CA3A 4ODVH 2ICCA 4J5VA 3FQRA 2VM9A 5HI5D 3TFKC 5C8JB 5CN2A 3II3A 4ZUVA 3G6AB 5ALBH 3ZE0E 4YHYC 4FRXA 1VENA 4K3CA 3CX5J 1SYVB 2WYZA 4IKJA 3UO8B 5I8CB 2AMGA 3HI5H 4KRPD 4Z7VB 1IGFH 4U1GB 5C09D 1I9IH 5I71B 5FGRA 3WTWA 2EIMB 3KLKA 3BSZL 1EWHA 3NPSC 4Z0XB 4HK0B 1N68A 4OCNC 4TSBL 2ZOKB 3KNBA 1SOQA 4G82A 2J8UE 2FO4B 2Y9RT 3NRPA 4P59H 3QXDB 1L5GA 3B9DA 3LS4H 4WSKA 4PLJC 4F8LA 2OMUA 4OLXH 3X3GL 3FQNB 2NQDA 5EEYA 4IKNA 3FTGB 2O5YL 4G5ZL 1D9KD 1JG9A 3PABA 2XWCA 4ALAC 3PGUA 4OIIL 2LU7A 5CD3B 4ZSOA 1R5VA 4P99A 4NCDA 4BM7A 5KVEL 1JGIA 2NY5C 4NKQB 5DVOA 1RJCA 1G9NC 3GB7A 5JQ6L 1E4JA 1JNLL 2KKQA 2Q76B 1RURL 3O41A 4WFHD 2V0AA 5C0AE 4C59B 4A37A 2A6IB 2O4VA 2WNXA 3IPBA 3JZYA 4PJHF 1Q9GA 3UC0H 2XG5B 4WJKB 4FESA 4PJAA 4HWBH