3KVDD

Crystal structure of the neisseria meningitidis factor h binding protein, fhbp (gna1870) at 2.0 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
242
structure length
242
Chain Sequence
AGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the uncomplexed Neisseria meningitidis factor H-binding protein fHbp (rLP2086).
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Protein binding
molecule keywords Lipoprotein
total genus 60
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 3kvdD02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3kvdD01
4O3ZA 5EE2A 3VE2A 3PQSA 2Y7SA 4AYEC 4O4UA 4AYDC 1YS5A 3UAQA 3HOEA 4O3XB 4AYMC 4Z3TA 2KDYA 4AYNA 3VE1A 2LFUA 4O3YA 5T5FA 4O4XA 4AYID 2W80C 4O49A 2W81C 2KC0A 3PQUA 3V8UA 4O3WA 3KVDD 4QQ1A 4U9CA 2YPVA 3HOLA
chains in the Genus database with same CATH superfamily
2X7LB 1RK0A 1YNLL 5D5MF 2JKLA 3FFOA 2GTZA 5KSVB 5EU3A 4E41A 5GISL 1UYWH 4BV1A 4DVRH 5ADXK 1F58H 5AZ2L 1ZS2A 4R7DB 5IVXE 4L8BA 1MCPL 4PJAB 2UV3A 4K7FA 1YNTB 1JNNL 1JDDA 1WZMA 3CMOH 5EZIL 1UJTA 1F90L 4AKOA 2XACC 1LO0H 2J73A 1NSNL 1T3FB 1DJHA 1GGIH 2W9DH 4O2EB 2LHFA 4PRHD 2C3HA 3VXUB 3GWJA 1IFRA 3MKGA 1XF2B 5AFUK 3MLXL 4J3OG 2F74A 5BV7B 3DV4A 5TK2A 4EQ2A 3W9EB 1BEXA 2YPLE 1DQTA 1UXWB 1A1MA 1XIWA 1IAKA 1HCZA 3C2SA 4U2YA 2ZT9C 3F7KA 3D3VB 3RWIA 3VG9C 3NIGB 4HK3N 1DBKL 4D9QE 2Y2WA 3KS0J 5EC2B 1BXUA 4YX2L 4TNVF 3EYUH 3ZQWA 4YPGA 5AVVB 3UTZA 2D03H 2HAZA 2B59B 1M2VA 4ODXA 3RYMA 4AL8C 1O9ZA 1TZGH 2NT1A 4O4XA 3F5WB 3HI5L 4EBQL 4GO8A 3RVXC 5TISO 1HILA 1ICTA 4QHNA 4HG4K 5CF3A 2NW2A 2NNXA 4CSSA 1CFBA 2B4CH 3H9SE 4R2GB 3ZKSD 4WLCA 1DQJB 1JNLL 4XBEL 5DJXA 2J57A 3BESR 3L1GA 3MBWA 3QA3B 4MMZB 1XH1A 3UBGA 1KLUB 3G7GA 1NLBL 5L8KB 2NY1B 1PD0A 1G5GA 3OKOB 3OLEA 2YHGA 4IW4C 1E3FA 3FFCA 4GCPA 1H3UA 1WYJA 3JVGC 5F88A 4D0DA 3CX5J 3Q5TA 4Z7UE 1IGML 1BGXL 4JKLA 3TIDB 5EUKA 2X9YA 5CN3A 2NY6B 4TVPL 5F7NC 1JV2A 1DO5A 3CGTA 3DTUB 4RIRB 2R83A 4PJFF 4UTBH 3BKYL 1NPNA 5AB0A 1I1RA 3D09A 3WL9B 5KJ4A 4UQ2B 3D18A 4NX0A 5IMOB 5I15H 2GFBA 3RBHA 4TQ8A 2H1PL 4EDWL 2VDMH 3W39B 1JJUA 4HK0A 1E4HA 4OCNC 4OZGF 5I82A 1IO4C 2P43B 3EJZD 1OAQH 5G2NA 2P45B 1EVTC 1JZGA 2VQTA 3ULSA 2B9BA 3M17A 1S5IH 5F8RC 2W0LA 4PR5B 4KX8A 1IQDB 1KXVA 1LE5A 5EEUA 5ALBH 1IM9A 5B39B 4PBWD 1A9BB 4I85A 4QXUL 2HUHA 3DRQB 3GTNA 1M53A 1TQBC 2QR0A 3KYMA 4ZUSB 2HTKC 4GQ9L 4OZFB 1ZA6A 2ZCHL 1LP9A 1N2RA 3IXAA 1A1NA 3F12A 5ACZB 2X89A 4NZFA 3O6LL 2BVOB 1D5IH 3DUSB 4PJBA 1MIMH 3MBED 4RDBA 5I8CA 4DKTA 3HOEA 1QTPA 3MCYA 4JJ5A 3FJTA 1S2EA 4NGHH 3FT2B 1HIMH 3F3HA 1XD1A 3RQ3A 5CM1A 4TVPE 3GGWA 1P84J 1YVLA 4WVRA 1NGQL 5C0JA 1EXGA 4HWBL 2YD8A 3KLKA 3Q1SH 1ZHLB 4HF5L 4YQXH 5KG9B 3SYSA 4ANVA 4KQ3H 3GMQA 1QRND 3OC5A 3T1FA 2XTSA 4Y5VC 2MNHA 1A14H 3AG2B 2CK0L 2YPVL 2YWYA 1AQ8A 1WTGT 4S1RH 2FL5B 2X28A 3UJIL 1UWEH 5MI0B 5KN5B 2WQWA 4YDVA 4OZIF 4RFOL 5E8OB 4HJEA 3W0WA 5TQ2H 4Z8FL 3ETBF 4G7RB 4PJIF 3FC8A 1QD0A 2VXSH 4XPTL 2P9RA 1OPFA 3LKNB 5HDLA 2YFNA 5K9OA 5I23A 1TQTA 2VXTH 3GSQB 4G5ZH 4S1SH 3RWCA 3HG1D 5DMIH 3BVTA 2JJTC 3K71A 3CQQA 3MRNB 3TV3H 4PW4A 3L5XH 4G1MA 4JKNA 3AMKA 5I8OL 2A9NL 4JHAL 1NCNA 4P2OB 3B7YA 1KIUB 2IGFL 2OP4L 2EZ0D 4JHZA 3SKNB 1WHOA 2A0LC 3NZ8A 5B4MD 3ZVVA 1UA3A 2R59A 2VYRE 4L8DA 1A3ZA 5L9DH 5MEQA 2Q0ZX 5DLLA 3QZPA 3FT3A 2CLVA 3LH2L 4F7KA 5FK9B 5GRWA 2BPBA 4N0YH 4TTGA 3FU0A 4WI5A 1H6S1 1RY7B 3T2LA 3CUPB 4WFED 5EBMB 1RULL 2HT3D 4JG1L 4Q9RH 4QF1A 4DKEL 3MLVL 3Q2CA 1QLFB 3O41A 4Q0XL 4PJEE 5F72S 3L5WB 5IHZA 1HOCB 3RA7H 1N59B 3L3DA 2EC9U 1CR9L 3GMOB 5A16A 1UXSB 4LIQL 43CAB 4ELKA 4PJBF 2C3WA 2CBQA 1IARB 2E56A 5AAMC 2HH0H 2HYMA 2KQNA 2OR9H 2F68X 2Z7UA 4MXWH 3VDCA 4AUJA 1U91A 2XWCA 5KSAD 1CFVH 5I1IH 4MWFA 2XC8A 5C7XL 3M1CA 1E8XA 4Z0BL 1HE7A 5DEJA 2AEPH 4RGNB 4ZX5A 4EVNB 1AKJD 5F7MC 3KBEA 4FQ2L 4N0UA 4YHIB 2GSGB 5KVGE 4PD4K 3VFPA 3LXUX 1GRWA 1JFHA 3JWNH 2YRZA 4MZ3A 5DMKA 1AI1H 4Y1AB 5AYTA 1A7QH 1FHNA 2MH4A 4G6FD 2OXGB 5JIPA 2ZJSL 3TJHC 3WI5A 4HJTA 3IDJB 5CWSB 3AWGA 3WKMH 4ZNEE 4JE0A 4BHUA 4HBCH 1HEZA 3VZUX 1W91A 2WLIB 4PS7A 4WF7A 1A8JH 1KPUA 4E9TA 1NCBL 2LTQB 1WFJA 4PB0L 4YHOH 4HH9B 1IVLA 4N2NA 1SXSA 3IFNL 5DO2D 1IBDA 1EEYA 4UQEA 5AENA 1KFAL 8PRNA 2BIHA 2XA8L 3UEQA 3SE8L 2D7OA 3FAWA 3QDGE 4L05A 3X1FA 1I1AD 1JRHI 2AITA 3JWDL 1YEIL 5GJSL 3Q0HA 1MUJA 1M05B 5JPMB 4HUVA 2X4SA 1CD1A 1IBBA 4XCEB 1MCWM 3HN5A 3PXHA 3UBXG 4LSVL 2CMRH 3LZLA 4JFXA 4EKJA 1ED3B 4RFEB 1Z9SA 1LEIB 2QKIB 1ZIAA 3CX5K 2JCCA 4GT0A 4GW4B 1I8IB 1A0QH 1I1FA 2BSBA 5A3IC 4JN1L 1V3LA 3A2SX 4TL5A 1LQBC 4BFOA 4N8PA 5T3ZL 3DJ9A 4WKXA 4NNYB 4ELMA 2VLRB 5ITBH 1X5GA 1M1XB 2VDRB 5EO0B 4ZS6C 2YBRB 4N3UA 3D1MC 5EDXA 4AGLA 1UM6L 2NX5D 5MHSE 3LH8A 5A2JH 3LOWA 1MWOA 2V9UA 3Q7JA 1ZVSA 2KUTA 4YHPA 1GIGH 4UNIA 1E2WA 1QR1B 5E1AB 1JPEA 1L9OA 2KZKA 4NZDA 1YS5A 2XN9B 4HXBL 4DFIA 5FA3B 3FOLB 1N3NB 4FXKA 1FZMB 3QUZD 1IBYA 3QDMA 5DEFA 5IREA 4AE1A 4D3CL 2C4FU 2Q7YA 3JTYA 4K8RL 3GIVB 2F7QA 1S9XA 1JD7A 3RZCD 5T1DH 1OB0A 5EU6B 3WEOA 4NFCA 2L7JA 3DVNB 2WQAA 3TO4A 3Q05A 1OCOB 12E8L 3B7TA 1K5NA 1TQUA 2J1XA 3BZEB 2WVPA 2TRYA 3N41B 2Q86A 2R0WL 5IJVB 3TO2A 3VFRB 3UTTB 4W9JC 2BP3A 1VERA 4KI1A 1AKJA 2ATKA 3FPYA 1DQVA 1D2OA 1OGTB 1SLXA 4LSUL 5FHBH 4CW1B 1LE9B 4F57L 1CBVL 4FZEL 2X2JA 1ET7A 1NIDA 1CJYA 4F93B 3T6QC 1AS7A 2DTML 4JFDE 2NY6C 5DVOA 5JR1L 5JW4Q 5JDPA 1OT1A 4WKZB 1A4JB 1AOZA 2DM4A 3WN5C 3GQFA 2GUOB 1UJ3A 2J88L 1A6ZB 1QPPA 2GTWA 1SZNA 3C87A 4I0KA 5IMKB 4OZFG 3BW9A 4JZNA 5D4HA 1R34A 2EE0A 4B5ZA 5TK4A 2WZPD 3VJ6B 1XGPA 2XV2A 3KPSB 5EUOA 4JFFA 3KYNB 5IHLB 3PGUA 3T2QA 4AH2B 2MOGA 4HJIA 3LPGA 2AEIT 2WSKA 4W9KC 3TNNA 4RGOL 1WC7A 2YEZA 4IGBC 4OZGB 4DPCX 2ZXQA 4OJCA 1UZ6F 3VXRB 4R8WL 3BP7B 1R3JB 1DVFD 1KCVL 1TVHB 5L2KD 4HPYL 5DRXB 1XCTA 4JFSA 2OI9B 1KJ2B 2BVPB 2CU9A 3ML8A 2YZ8A 5GGUB 1FP5A 2NDFA 4HLZG 4ONOA 2WIMA 3HS8A 5DO2C 1MF2L 4Z3HA 1DBML 5I0WA 5TDPA 4A6YL 1TTGA 3VZTX 3ARTA 3PUCA 4CVUA 1HT6A 1Q38A 3LDBC 3MV9E 5C09E 3VXPB 5DC9B 4LCCC 5TF0A 3NSGA 3BO8A 1CB4A 1PBYA 1YYML 5CR1A 5JNYB 2BS71 2FQGA 1N8ZB 3SE4C 3B43A 4LCIL 1HQRA 4NN7C 2OFQA 4Z0XB 1AD9B 2GK0B 3MV7B 3K80A 3EMNX 2W07A 2L3BA 4KTEL 1PZ2A 3IXTA 1S8DB 3ME0A 4PPTA 4ATTA 4OZIB 3VY9X 3WEMA 4XN2A 4Q6IC 5GRYA 3VNYA 5GHWH 3DA0A 3FS9A 4LCCB 4PGZA 3BGMB 4FKKA 3CDGB 1BSIA 4GW5A 4KMQA 4XNAA 1Y18A 3ARDA 2JLPA 3V0EA 4WI4A 3MLRH 2EICA 3ARFD 4XMLH 1U93A 1FNHA 2HT4C 3Q1SL 4G8EB 4PSPA 3TU6A 1JE6A 5KZCD 3G5ZB 3ZRSA 1DVXA 3H7BB 1FZJB 3V5DB 2I25N 4XP1L 4KO6A 3E2HB 4ZXBC 2WQXA 3A4AA 3KR3L 5E6IB 5GSRA 4F3FB 5JXAH 3TBSA 2APWA 1OSEA 4L4VE 1KJ2A 3L4UA 5GISH 4OZHB 5DMKB 4NP4H 5KJRH 3SODB 2HX7A 2E7BA 3PABB 1SDDB 2APBA 4I2XB 3K91A 3D50A 3WE1A 4N6QA 1DVFB 3QZLA 3ZX1A 4XHQA 2O5ZH 2IGLA 5FW7A 5BRPA 5C0CD 3E2HC 2WXKA 5LCVH 3ZDZF 1HZKA 5GS0D 2Z34A 3TXAA 3ASWA 3T6XA 2PXYC 3VVVA 3ZDYB 4X6DB 4N2BA 2C5DC 3WFDH 2QQKH 3BSZL 2WW8A 1RK0B 4JQIL 4B53A 3TCTA 3PQUA 5F7DA 4X9BA 3GLEA 3QNXB 4WFGD 3L1FA 4XN5A 2JTDA 3BQUB 4JHUA 5ESAB 3RG1C 1HCFX 1NANH 3EFOA 4QHUA 4QXWA 3TM6A 1KBKA 3DV6B 4V1DA 1YO4A 4ZUTB 3CUPA 3RBGA 4YSAA 1E50A 5I1KL 4BZ1L 1IX2A 3H7BA 1TZGL 4HYTB 1UD6A 5E5LA 1ECZA 5JOFB 4X5RA 2CLVB 1PLCA 3B5TA 3ZKNC 3WO4B 3SGKC 3OHXB 4IRZH 1LO4L 4CNIB 3DX9B 1KB3A 4XP9H 3R8BB 2Y2XA 5CS7A 4FA6A 1WCBB 5AW6B 2G5RA 3H9SB 3GZPA 4P2OA 3CFCH 2Q8BL 4Y2NA 4TN9A 4BINA 1URZA 4QTIH 3V7MA 3Q5OA 1A02N 1RLBA 4HFWB 3LK2A 4FADA 4G9FA 4EEEA 2QHLA 4C58B 2WQUA 3QG6B 5F71A 3CSFA 3V5KB 2X38A 3ZIMA 2JB5H 5I1HL 4P4KA 1OLZA 5CHNB 3ZT7A 4Z0BH 4N87A 4B0MB 3VXMD 4M61A 4YHPB 5DFVC 1D6EB 4RMTA 3FQUB 2YOAA 3LSOA 4C8XA 2WINB 3LKRB 1DE4A 5HYJB 1Q0YH 3LIUA 2OBGA 5B4MC 4E9QA 2E3VA 1F56A 1EEUA 5DHYA 2DQDL 3PL6D 3LCYA 3ZZ1A 3GZQA 2WBJA 3WBDA 3KM2A 1G7QB 4X5XB 4P05A 2PO6C 1N3NA 1VPOL 3ROOB 3AA1B 5K93A 1XDTT 1ADQH 4B9YA 1VFBA 3O9WD 2WBWB 4P9HC 4AX3A 4ESKA 1JRHL 1QQDB 5D7HA 2J6WA 1IEBA 3FF8A 1KGWA 5E9DB 2DKSA 4ILDA 1LGVA 3HBZA 2EKJA 3K6FA 3L5WA 4D0CB 2BSDA 2XX1A 1ETB1 2X4SB 4FFTA 5KTEH 3DBXB 3G04B 4QNPE 3VE1A 5GGQH 4K2UH 2EDXA 2E8YA 3TNMB 1HIML 3WTVA 2OX5B 1WFUA 1NM9A 3HG2A 4K5NA 4E0RB 4GG6A 2HRGA 3M07A 4A1RA 4I18C 5BUGA 3CCHA 1K5NB 2R2HA 3NN8A 4HJUA 2NY1C 1OKEA 5EBLA 5F6IC 4M6AA 4WHTB 4ZOEA 3PXLA 2JCCB 3RGVD 1U9KA 1C9SA 1RZKL 1RL1A 1L7TH 4L8CA 4XMPL 1MFCL 4UAHA 1TZAA 3TYFB 3ARGD 1U58A 2F5AL 3U9PL 4LSEA 3Q6FB 5CUSL 4PRNA 2LVCA 1A14L 4LHUB 3RGVB 1CLCA 2RH0A 2DDQH 4HKBB 4R5TA 2AXGB 2VDPH 3O4OC 4EI5B 1CGUA 1RCYA 5TDOA 1GYCA 5HHMD 3BH8A 1JUFB 2QKIC 3RY5A 3IBOA 4TOYH 4YK4C 3VXRE 2FYYB 1X9QA 4DW2H 1TZHA 3LKPB 1HHJB 5J1AA 5ESVA 4QXGH 5CP3H 3TPKA 3VG9B 2YR3A 2RMNA 2OKMA 1E8YA 2NCMA 2F1VA 2HVJB 3QRLA 1WG3A 3BIKB 3PPEA 2X89D 3QUMA 1Y6MR 2HMIC 2OYPA 2ARWA 2DI7A 1SUJA 4HUXA 4PJDA 5MEOA 1PDKA 3OMAB 1RZJL 3BUTA 3IDNB 4RJWA 1MAKA 3DSNA 2EIMB 3NCMA 1D5RA 1ROCA 5CBEB 3EYFA 1I1YA 2JMRA 4M8VA 5HJ3A 1IT9H 3CZJA 4RLCA 1P6AB 2I7SA 3U36A 2CKBA 2ED9A 3S34H 1ERNA 3QQ9C 1DJYA 3DYPA 1U33A 4MMXA 2OPCA 2OTUA 2Z31C 5MERB 1OPGL 2YXVA 3X1BA 4M5ZH 1FC1A 4ZW3A 3PHOA 5GSVB 4EVNA 3UDWA 3O11B 1ONQB 5LNGA 5JPMA 4HUVB 3KPSD 4OF8A 2EVFA 1HYSD 1PJ9A 2XBZA 1U8NB 1SY6L 1HJCA 4LLMB 5T1KB 4ZOAA 3RRQA 1W8EA 1OTUC 3QW9A 2J5LC 4JRLA 4AYDC 1DQMH 4Y0GA 5FO7A 1XF1A 4FTVD 2ICWA 4RMVA 2IBZY 5C2BL 2GIXA 1NEZG 4H44C 4V11A 2J21A 4B9IA 4N8VA 5DHVH 4Z3FA 5MEOB 5MEND 2XTJB 2ZONA 1MWAA 5EBMA 3FZUC 3GSWB 3S37L 4GF4A 1RZ8B 4FE9A 2OS7A 2EXTA 5CJQL 3P0YL 1KF9B 2A6IB 2UUDH 2VR8A 3I9AA 1J1OL 4NM4L 3NJFA 5DWPA 5ICZA 2MNWA 3GJFB 5I8EA 2RQEA 3PGFH 3IGUA 2Y06L 4A6YH 3HPLA 5F21B 1QSVA 2WUCL 1U8LB 3QWRD 1PD1A 4UOZA 4OY9A 3U4KA 3H4FA 2ED6A 5L8JB 3BT2L 3CZUB 3IDIA 4ES9A 3VXTA 1PQZA 1S78D 1EFXA 5T3XE 4KJWD 2JJWA 4KJQC 4LCIH 4YZWA 4PVNA 4PRIE 4OCWL 1FLRH 2GJRA 2R4SH 4QQ1A 3HFFA 2VRQA 4IBYA 5C0GB 1FCCA 5I1CH 4NJAL 5KYWB 3OJDB 3DUSA 2NY5H 3FB7B 4WIQA 3VXQA 1G9EA 2QBWA 3FSVA 2FB4H 2PPAA 5IHZB 3C5JB 4XH2A 2Q2LA 4HS8L 2JLLA 2GCYB 4GUQA 2Y7OA 4Z1PA 1H8LA 3GMMA 2XBTA 4UV4L 3G04A 4NM8H 3CBKB 2IBZX 1FCGA 5I8KL 3TT1L 4N0FB 3JCUO 5KJRL 4FQLL 5M7QA 1LEGA 2BSRB 1BVNP 3D4GA 4MCZA 2ZXAA 4Z7NB 4OQTA 3EO9L 1OCWL 2YS4A 1SYVA 2IG2L 3W57A 5CD5D 3C2AH 3HRZC 1H3VA 1JDAA 1OE2A 3ERXA 2WQVA 3L4TA 3ZE2B 4YHLL 2CRMA 3WFBH 3SGEH 4JO4L 3HN3A 3ECVA 4G59C 4OI9A 3LK42 4Q9QL 4JKPL 1XGUA 2TAAA 4O3YA 4H13C 2BNRE 2EDLA 4PWIA 5AW1B 2OL3B 4MVBC 3BVDB 4ZMTA 1A3RL 4HCRL 4NC1C 2X4QA 4TPRH 4DGWC 1BZ9A 4DFHA 3GS4A 5EIIB 3EXJA 4KY1L 4F4BA 3BPCB 2BOBA 4U4BA 5ILTH 5G39A 3VI3E 2V4LA 2QPSA 1CDJA 4NO2A 2CDGA 4PJGE 3GMNA 4F7EA 3GMQB 4GUOA 2HT4D 5T33H 2CO6B 2YLKA 2EIJB 3DX7B 5JHDD 2HLEB 4H1LA 5JLZA 4YIQA 2P7TB 3QWQB 1JNJA 3JV6A 4L37A 3B8YA 4KKCC 1UXMA 1CCZA 4FG4A 9PCYA 4NAMA 3QFGA 1IBGL 4M7LT 4HJJH 2CIKA 3T4AA 3KLHD 1OGAD 3FHEA 1QSZA 3SY7A 4F57H 1CBVH 2OXHB 4C55A 1WZAA 1T89C 2BRRL 3KXFB 4LGSB 4XCNB 3SE6A 1D9KD 1GW0A 1CTOA 2AC0A 2ZOTA 4Y4HB 3DWOX 3D3VD 3CFEB 3EOYG 4M5TA 1NAMH 4Q0XH 5F44A 3BUYB 1U92A 5IM7B 4JY5H 3FDWA 5BJTB 5BRZB 3S8GB 4RVBA 3GBNH 4HUUB 3CDCA 3OLIA 2LLNA 4X4MA 1YJDC 3ZE0B 4KUCF 1XT5A 4LBEB 2BZCA 2ZKMX 2HRPH 3GXTA 3KNBB 3RGBA 2IAMA 1TTAA 3BP4B 3EGXB 3HEIB 4MD5A 4NZ8A 4XP4H 3TVMA 1GOGA 1DZBA 4R84A 3CMGA 3MRDA 4TUKH 3BZDA 3TEXA 3CPLB 5MENA 2J55A 4NUGL 4OAWA 3HW9A 2YJQA 2O1AA 3BYYA 3RJQB 1YRKA 2BVYA 3LN9A 3W9DB 3G6JE 4JRXA 2VIRB 3U0WH 5E79O 3FTWA 1EMTH 3NH7L 1D5ZA 4KJWC 4NO0D 3MRPB 5F1IA 4MQXC 2QVMA 5ISZE 3UPAA 4YC2B 1MSPA 5AVQB 2XN9D 2GW5A 2VLMD 4QY8A 4LOUD 4QYAA 2X4OB 3LNGA 2XE1A 3P30L 3WDIA 5KTEL 4P2RB 1YY9D 3ZRFC 4BH8A 2V2TB 1QBML 2PPCA 5SWSA 3F6IA 3VWJA 2NY4D 4XGZA 4P9MH 1S7VA 1A7PH 2B1HH 5DHMC 4QYOB 3CVIL 1U93B 4HSAC 5IVXF 5J5EA 2B77A 4MCYA 4NCC2 4PJIE 4MDRA 1UD3A 5I16B 3NZUA 2CJUL 5IK3A 1AHWC 1JK9A 1N4XH 3EOAA 2J1WA 5FS5A 2FSEB 4M1CC 3U48A 4HSCX 5CLWA 3AG1B 4XP5L 4R6UA 4IRZA 2H2SD 4G42A 2XQYK 3CVHB 1RMFL 1HQRB 4YE0A 2ICWB 3H0TB 3L45A 4MS8D 4ZPTA 3RTQB 2X4RB 1UH4A 1FNSL 3L3OA 2Y36H 1JNHB 1NGQH 2V0AA 4U1LB 1SM3L 1RIHL 3F7QA 1BIIB 5I26A 1W72A 4JFZH 3MO1A 3LK3B 5CN1A 4XN1A 4FYQA 4ZZFA 5I24A 5GS3A 2NYZA 1Y6KR 4EI5C 3WKYA 3UTSE 4ZFFA 3GSWA 5ITBL 4KKAD 2VAAA 2XVLA 1RPQA 4LHUA 5F1SA 2QADD 4LU5L 1I9JH 1FGNH 1TT6A 2ICEA 3G6DL 2R4OA 1J0HA 4AYFB 5BQ7B 2M1KA 5FA4A 1BA9A 3NQKA 2UX6A 2YSSA 3QQNA 1K5WA 1V10A 6PRNA 5B39G 2WTRA 3FN0L 2NXYD 1XVSA 3ORJA 3QORD 1PX3A 2XJKA 7PAZA 1UH3A 1RK1A 4O2CB 1KWKA 3QYNA 2IGFH 2OP4H 1Y0LA 2EP6A 3NAAH 1U3HC 5EZLA 2PO6B 2EILB 3RVUD 4WAFA 4ECNA 3PJNA 4ETYA 1BYNA 3BUDA 2BIIA 1AKJB 3CZGA 3B5GA 5DJ2A 1PS3A 5DD5L 3Q2LA 2OK0L 5CSBA 4F7PB 5I2IA 3G6AB 3HAEH 4IK7A 4KXZI 4LVEA 2M06A 2MPAL 1EWHA 3KDMB 3MR9A 3S5YA 5FYJL 5EIIG 1KLGA 4E5XB 4PJFB 4JG1H 4BELD 3FKUS 4FZLA 3L4WA 2PTTA 3CZFA 3IN0A 1NBVH 2YD7A 4QRPA 2OMUA 3OTTA 1EDHA 5DD6B 4S0TD 3X14A 1OP4A 1S9XB 1ZA3A 5DZLA 4AVHA 3R06A 1TNNA 2OTPA 5INCA 3U7WH 3ZDZE 5D72H 3IFOB 2XZCL 1BLNA 2O26U 4KKBC 3WXVH 2ZP0T 4QTHA 4QWWD 1KYAA 5D9SA 2GIMA 4OLWL 3ARGC 3QUYC 3D05A 5HYJA 3V4VL 1KCSL 1NKGA 4NQVB 3V0AC 1CN4A 4KJYA 3WJMB 2PXYD 2DQDH 3Q9PA 3VXSB 4I9XA 1JGEB 3CFKA 4RGMC 2CGRH 4WI8A 3VCLB 2NNRA 2VZVA 4ONHB 4PJ8B 3VXMA 4JHVA 5DHEA 5B66O 3SDXF 1QSFA 1F4YL 4R0LA 4KVNH 5HVGB 3MZTA 4XOAA 1KIRB 4ENED 5GZOD 3OX8A 3HI6L 1YY9C 1U8QB 1PD6A 1NBZA 4KVCL 4MTMA 3FN9A 2EDBA 4U1NB 5AVSB 2V2XA 4RBPK 4MBOA 3D85B 2Z31A 1NIFA 1ACYH 4NJAH 1PCXA 1UATA 2Z93A 2N7BA 2Q5BA 3VWKA 2YGQA 3OHXC 4YNYB 4HVBA 4IKLA 3BFOA 3S35X 2C9VA 4GSRA 3ATDA 3L4ZA 4Q6YA 5CGMA 7FABH 2E7MA 3WTUA 1GMEA 1L6PA 3GMMB 1R5WA 4NLHA 1RZGA 1NMAH 4GP4B 3ZW3A 2G60L 2OMYB 1P1ZA 1UOKA 3EH1A 3BMWA 3QFDB 4FXTA 2XQBL 4HUCA 1GZHA 2JKJA 3GB7A 3NCYS 4HZ1A 4JUTA 4XH2B 1KYFA 1L7TL 2AK4E 4X4YA 4Z7NF 3EO9H 3QZMA 1FH5L 2FBRA 1A9EB 2VR6A 2H26A 3FQXA 5B22A 3MLTA 1M57B 3ULVL 2ADIA 3AREA 4XVOA 5CCKL 2E9JA 4P9HL 3WY1A 3WENA 5ENWB 2YK1H 1E7VA 3RUGE 2GFBB 2NZ1A 4XVSH 4A37A 1IGTA 5GGTH 5EEWA 3HE6C 4H8QA 4XNMB 4G8GE 3TZVD 2B20A 1ZGLB 3VFSB 1AFVL 1IAIH 1GL4B 2W59A 3AU1B 2KKQA 2PPDA 3NIFB 4AKRA 5DCCA 1U8LA 4UQ3A 5C07A 1FL3A 3NVQA 4J12A 2L04A 3GHPA 3NSFA 1YDPA 2VN3A 2WWMD 3JWOH 4Q7DA 1WHPA 5AALA 3ULVD 1PYWB 3ZYIA 1KOAA 3W1ZA 3DGDA 4KRMB 1X4YA 4WO4B 1R9FA 1KLUA 3GBEA 4LASH 1TENA 3V5DA 5T1JA 3T71A 3AAEA 4JG0L 3BQUA 1NFAA 3F7VB 3NJIA 1FL5A 1CUOA 1KJMA 2VDMB 1G9ML 3ARFA 3LMJL 3N42F 3AVEA 3ARDD 2DMGA 4YSOA 1ZWIB 3TURA 4PTTB 2W94A 4JDZA 3GP6A 3UTQA 5GS0L 1U8CB 3D9AH 2FEEL 3INUL 1JSYA 2VL5A 2CO3A 3H2QA 3U79A 5CIPB 3QG7H 1JMXA 4K8RH 1JN6A 1KYOK 3GMOA 3Q1EA 5H35B 2R29H 2EDNA 4XNQB 1Q72L 2VKWA 1YN7A 3EYOB 3QAZC 5KW9H 1NOLA 4RA3A 4ELMF 3SPVA 3ZGHA 5HHXH 1I3RA 4LEBA 1W0VA 5EO1B 5C3LD 5IV2A 3QI9D 4W4OA 5I75B 4FF9A 4RNRB 2ITEA 1JF6A 4GRWE 2J44A 4WI0A 1C8QA 2PUQT 5PAZA 2IQ9H 5ESAA 5TE7L 2VUOA 5AVUB 5DO8A 4WUUE 1IZNA 1V3MA 2OMNA 5FYLD 2CKBB 2CJ3A 4JREB 3QRBA 5HHVL 2H0EA 5E94A 3O0EA 2HPTA 4X5WB 1T1XA 4KRPC 4AQEB 5IBUB 4HIEA 3T2OA 1EEQA 1NAKH 2EC9T 3GSQA 1U8MB 2AJSL 3QUXD 3PGFL 3BS0A 3HA0A 4GFTB 3NZSA 2VM3A 4HOMA 2DTSA 2WUCH 4MMYB 4PJ5D 3LS5L 3MLYH 3DO7A 2OR7A 1QEWA 5J6HB 1NEPA 2WCPA 1J8HA 3QXWA 2P5EA 3V0HA 1N8ZA 5KS9F 2EACA 1RPKA 3MLUH 2BERA 4NFBA 1AO7A 3A24A 2N7SA 4XO9A 2VDLH 3IM1A 1OB1B 2C3XA 3C09C 3Q8BA 3MXWL 3N43F 4MA3A 3WNPA 2YUVA 3A22A 3FOMB 5FDWA 2H3XC 5ECJE 2VDOB 1T4KB 4DEPC 2QTEA 3FXIC 3UGUA 5KYUA 5HBBA 2ZWSA 4ADGA 3PWPB 5E95B 3KGRA 1JK9B 2BHYA 2PYEE 1VGKA 3UABA 2QL1A 1LO3H 2Y25A 2LR4A 1ITCA 4JJ5B 5C86A 4WO4C 3UH8A 5KANI 4BZ2L 1OIOA 4TKWA 1SEQH 3V6OC 1NDGB 1Q0XL 4NKDA 5C08D 1OAXH 2J7LA 4RAVB 5CN2A 1QFHA 3H42L 4JQVC 4OW6A 2X6CA 1W8NA 2IXQB 3WXWH 2XPZA 2N7AA 2AJVL 4KROB 1X5IA 5LWYL 3TA3A 5LAXA 3GYRA 5DD1L 4M93B 3ZRCC 4E9WA 3UJJH 3D39A 4B50A 3WUWB 3BCDA 2GE4A 2VKXA 1AGBB 4MRBA 5HGHB 4MNQD 5D1ZI 5E1IA 4KK9C 2C3GA 4PJDF 2CG9X 2G4EA 2VM4A 4IIQB 4X6EB 4B9JA 4PLNC 4JPKL 5CCGE 3N44F 2VITB 5L8LB 3EKCA 1T04A 3T0EE 1ZGLM 1M1XA 2NCEA 4MZ2A 2W60B 1QI3A 2NSMA 3P1VA 2RCSH 2AKRA 3ISYA 4UTAL 1WA2X 1G0XA 3R19A 5ESQA 2N0MA 1T22B 4FNUA 3ZZQA 5GGRA 1AJ7H 3L13A 3HE6B 1JF5A 5FM5M 4AL8H 2WGXA 4MJID 5JHDA 1CE1L 4P2AA 1A47A 2O6DA 3FL7A 3WELA 3MLSL 4PMEA 3DA4A 4N26A 2ORBL 4P5TB 1AHMA 3L3KB 4W4OC 4NWTL 5FM8A 3SD5A 1FYHB 4F2ME 2APFA 1N18A 3DJTA 3DOSA 2DLGA 5C6TL 3RU8L 3TIDA 4GAGH 5HDQL 5EF2A 4JY4B 5KSUB 1TJHL 5D2NC 3ZPDA 2AMUA 2XTJE 5HHPA 4R26H 1CQYA 5I1JL 3DHJA 4S1DD 4ZFZA 2WJRA 4UMSA 4KVPA 5ANMB 4PJ8D 3K8LA 2ATKB 4LCCA 5G4NA 2IJ0C 3TO2B 2QFPA 3VFRA 1Q9LB 2BRRH 4TVUA 1EHLH 3STZB 5JZ7C 5CILH 1R3HA 1AZZC 5SWSE 2WXLA 3BWSA 4FFZL 2O61B 3AFLA 3AT0A 4ALAL 3B7RL 3QRFM 2P52A 2OMVA 4OZ4A 1GFQA 3P77B 3GRBA 2MNJB 1T66C 2VQ1B 3ML9A 4KDTA 2J72A 1CF8H 4AZLA 4N2FA 3IGKA 4H1LB 4MA3B 3QUXC 2WXRA 3NSCA 4JL1A 5DFTA 2HT2D 1E9QA 1SY6H 5I75C 1ZK5A 4GW1B 3IMVA 4R96A 1UGKA 1OSZA 2G9HB 3I9GL 4A2GA 3RWGA 4TUKL 2EYSA 2Y07L 2Y22A 2VN4A 5EN3A 1UFGA 1LYQA 4MS8C 3KXFD 3WN5A 1JPSL 2X4QB 3HOLA 3APDA 4BZ1A 4E9LA 3SO5A 3N9GH 1C7TA 4XVJL 1VZHA 4X8JA 4BWTA 2CLZB 3CMOL 3MC0A 2OSLA 2OSXA 2IDCA 3AW5A 3T4YA 1BM3L 3MCKB 4XRCA 2A9DA 3DYMA 2ADJA 4JQIA 3UTQB 1NCDH 2FBOJ 4A63A 3MV8D 2UXTA 3L08A 2PP9A 2NY0B 2PWFA 2QSQA 3PLYA 4PP1D 3C5XA 1MHHB 3TJHD 5IP4A 4NAJA 4OCSH 5D7LA 1TQBB 1K3IA 3M45A 1LWJA 3DVGB 2UX7A 3CVDA 1W0VB 5FWQA 4L4TA 1OTSD 1XGYL 5F89B 2C4XA 3MQIA 1OTUD 1O7DE 3U1SH 3VWKC 2CGZA 1EGJA 3VFTA 1MLCA 2JB6B 1RJYB 1WE5A 4ACTA 1UWGH 3RWEA 2YD2A 1JHKH 3MRRA 1ZV5A 4FMKA 4YDIL 4FJYA 4JANB 5KYUB 3MOBH 4JM2B 1QATA 1KTBA 1DJZA 2VSDA 3QXUA 5D2LE 3TWCL 3E8VA 3WFEL 1OOAA 5EZOH 4J1UB 3B9DA 4YFLF 2WLLB 5EORL 4PJHF 4PJGA 3EUDA 1X5JA 1FH2A 1U8IB 3DHUA 4I77L 1QA9A 4R0LC 5AOJA 1HK6A 1TTBA 3B3IA 4LVHB 3VXSE 1SM3H 5IJKA 1C08A 4IKNA 3G6JB 2AJXH 4BFBD 1FFRA 1LQSR 3LS4L 4GRWH 4JFZL 2YLHA 3CLEL 4APQB 2WP3O 2XZQL 4HT1L 1VEMA 5GJTH 3MV01 5EWIH 3ZGIA 3VXOA 5AVTB 3RWJB 5I9QB 2WJ5A 3TP4A 2IG2H 4M7ZC 3QBTB 3UJTL 5HDRA 1N6UA 1C16B 4QF1B 1AYRA 1J1PH 4DPBX 5B3JE 1RUQH 1G9NC 3RDTA 4QGTA 5A3ID 3KH4A 3UPGA 1BOGA 2R56L 2ZXBA 4LASL 5EU4A 4UQ3B 5ADOH 3DVGA 4AIZA 3IEAA 1XHHA 3MV8B 1HDMB 3O4OB 4JFEA 4HHAB 4WFHD 5T1KD 1A3RH 4Z3GA 4HPHA 3GO1L 4P4RB 2YRBA 3F65A 4R90H 5I73B 2JCCF 1OL0A 2CGYA 1J87A 4WEBL 3NZ8B 2YN3A 3SIKA 3VFOA 3G5XB 4WJ5B 3OWRA 5GZNA 4XPFH 4P57A 1XTLA 3O8XB 1IZJA 4ODVL 5KVGH 4ZOCA 3TBYA 3EADA 1RZJH 4PJBB 1H0DB 3QCTL 2W8CA 4QRQB 2FX8L 3QUHA 3VMNA 1A1NB 4F7TB 3LRLA 3UP6A 2BIQA 3KPPA 4I5BA 4Q97A 4UZUA 4Y9EA 5DFVD 2NYYD 2F0CA 4UZGA 1WD9A 4KJPD 2J5WA 4RAVA 2AMGA 4L5FE 5FM5O 5LG6A 1D5BA 1ZHKA 3JWNC 3PRNA 1OARH 2IPKA 5KYNA 5DVKA 3BZEA 3D0LB 4JDZB 3GSXA 4LGPB 4XVTL 1WPCA 2D9CA 4ISVA 1MAJA 3FCUB 5E24E 3FU7B 3H9YA 2BJML 4PWHA 3A0BO 1E8WA 4ABUA 4HSQA 4ZOBA 1MJUH 5INCB 1ITBB 4I0CC 2WWNA 1G1YA 4YSQA 3MV8A 1PSKL 4FNQA 3GHBH 1VEOA 4Y2DA 3BD3A 1MW2A 4NSKB 4RCAA 5ENWA 1T20A 3MCLL 2BXYA 3WNOA 1WZ1L 4KPHH 4RIRA 1G4MA 2CGRL 4TM9A 1BG1A 3LSOB 5D5ME 4CDGC 1OGAB 1CGWA 3CJJA 3S5LA 1N5YH 4OT1L 5C07B 1JTPA 3O4LD 4YDVB 4LAQH 1HAWA 3FSOA 5TQ2L 4MNHB 4Z8FH 4Z7NE 2KDYA 4PV1C 4HPOH 2OMWB 4Q56A 4QHLB 3K8KA 4K0OA 4HOWA 2G9KA 5E2WL 4QTHB 5T3ZD 1FAKT 3AG3B 4JQXC 1FG2B 4LVOC 1LE5B 3FN3A 2VC2L 3U2SB 1IRAY 4U33A 2DQCH 1A9EA 4DF9A 2ZCHH 3HN8A 3HR5A 2GY5A 3JXAA 4JRYB 1UA6L 4XNYH 1WWCA 1JGLL 4FS0A 3VSUA 4YE4H 4J8RA 3O41B 3EHBC 3ZE1B 3SO3C 3MRJB 4JFVA 2WLMA 4NQCD 1HU8A 3BD5A 2DBLH 2BVOA 1AXSB 3RL2B 1IL1A 2GABA 2O6PA 3BJLA 1S3KL 3P4OA 5EB9A 3EH4B 1O7SA 4AMKL 5FDYA 3G08A 1QI4A 5FPIA 4K5MA 4PY7A 5EOQL 3S36H 3DTDA 1MREH 4X99B 2ITFA 2Z31B 3PREA 2A9CA 3TTYA 4JPKH 5DA4A 4KHTH 3ARGB 1EH9A 1NIEA 3IMSA 4AG4L 3ILQD 1KY7A 2V8MA 4HXAL 3T0SA 4P5MA 1G90A 1CFVL 2Q7AA 3NCWA 4X8JB 1R5IA 2F7IA 3VE0B 1NDGA 3HKZA 1ADWA 4KRNA 1TF4A 1B4RA 2ZXCA 2H32H 2H47C 2EVJA 3OKMA 5KUMA 3Q8FA 1KG0A 1OD7A 3EOTH 4AM0Q 4TLTA 1T21A 4TLUA 4QHKJ 3UX9B 4EUPH 1ND0A 1NWPA 2WPGA 2OXGA 2UZXB 3IDMA 2Z31D 3MLWL 3KPRD 4Y1AA 4JDEB 2R89A 3SPHA 2I9TA 3T3MB 1INQA 3FOMA 5D2NB 3P9LA 5D1ZB 3TT3L 4X5QA 2HKFH 4GUPA 5E9DD 1FSKC 4MX7A 3RU8H 2BP5M 4KNSA 3LMJH 1AQDB 4FABH 3KW8A 4KZDL 5A6LA 3AXLA 3VXNB 4LU5H 4PLKD 2PCXA 3KZ8A 4WY7H 4UI2A 1IGTB 5E6ZA 3O9WB 1BJMA 5ILTL 2DWXA 4F8TA 3QIBD 3DVIA 3MOAL 1I53A 3T4AC 3E1ZA 2E74C 4N0CC 3PWVB 1SGKA 3QPXH 1DSFL 1MFDH 3CD4A 5C6PB 2OQJB 5TGBB 4ZYKA 1P2CB 4JM2A 4A7GA 3HZ3A 3LDBB 1T0NB 1FFPB 4AKMA 4XPHH 1K2DB 3QEUA 3UTOA 1XEDA 1YSOA 1K4CB 2XOTA 4QNPF 3F12B 5D93C 5ACZA 3OJVC 5DRNB 2O6FA 3MREA 3CX2A 4K3JH 5IFAL 5JOFA 1Z7JA 5JHLL 1HS6A 4JY4A 5KSUA 2QDVA 1OD9A 2P8PA 3ECWA 3RB7A 1XH3A 2V8LA 3DGCR 4ZO7A 2OK0H 2DM7A 2IAMB 3BP4A 4GAJH 4UM9A 1IAKB 1JK8B 4FHKA 4MJ2A 1T4WA 2VAJA 1L9TA 2TSAA 2XWTB 5IVZB 3RWFA 4AVJA 1W72B 4PJ8C 1OQXA 1QSEB 2P4AB 1CTNA 5C0ND 1AGCA 4XZUA 2XPGA 3QDJA 3VQMA 4F2MA 3U0PA 1YEFL 1JWUA 3LNEA 4UTBL 1F02I 3TNNB 4IIZA 2AJSH 3JVGA 3U7WL 2CD0A 2C9XA 1NICA 2W9EH 4NEHB 4P04A 4A68A 3GSNH 2W60A 5KVEH 1OM3L 3KPQA 5AAWA 4QR7A 3L7EA 2IVFC 2ZQKA 3LKNA 4FQCH 3EDDA 3FQ4A 2X6BA 5EU3B 1L0PA 3TZGA 4RJXA 5JZ7D 5D1QB 1T2QL 3BH9B 3NFNA 2HT2C 4JY6B 4L9LA 1FYTE 2N2MA 1SNRA 3HW7A 3NFSL 4TSAH 3RUGF 3SY0A 4OB5L 3ARFB 4UUJB 1Q1PA 1VRSA 3U7AA 3EHBD 3B2PA 2IXQA 4KDWA 2Y4SA 3SE3A 2H9GA 4X4XA 4XN4A 4GQ9H 1S9WA 4R3SA 4UU9A 5EOCJ 4ABVA 4YBLB 5MP6H 2Q86B 1KCKA 5IJVA 2F8VA 1QBBA 2ZXGA 4FP8H 1BVLA 4RMSA 4FNLH 2FSEA 3QS3A 4OZ4B 5I76A 1D5IL 4JPQA 3BGMA 1ZHBB 4NNPH 3UZEA 2BNRB 2MQ3A 5BRZE 4X6BA 4E5XA 4P46C 5JXED 2CCVA 4CN1A 4O58H 5EZOL 4XCFH 1OB1A 2ZOWA 3ZE2F 5K9KB 3HZYB 5FB8A 3G6JF 5E00B 1XV8A 1I31A 2BRQA 4HF5H 2XU9A 4J3XA 4YS4A 2VXQH 4W6YB 1ACCA 3I6SA 5SV3A 3QJFA 3SJVA 4BBWA 3X3GL 1WGOA 3RVXD 1U36A 4DVBB 4CMHC 1B4TA 3DRQA 4O02B 1AIFB 1GJWA 1KIQA 2Z7ZA 4UM9D 2BSRA 3BPOB 4MCZB 25C8H 2JJSA 5K1VA 2NTSP 2GSIB 3BN3B 4FX5A 5CLXA 2J88H 4ZUWB 3U2IA 2YBRA 4HFUH 1U8MA 4EOWL 4ZMLA 4JPWH 4NCDA 2VIRA 1JG9A 1Z9MA 1BD2E 4U6HA 1F4AA 4HMCA 4OH2A 1WTLA 2MJWA 3HC3L 3ZQXA 4HH8A 4ERSL 3V0FA 4Y19D 3SE9H 4QTFA 1L7IL 2NQCA 5AWNH 4HS3A 1R3KB 1H5BA 2IDUA 3EF7A 2EE2A 2X87A 4UBDD 3TZVA 3IFLH 4FQXD 3QCVL 2V2XB 4UOW0 4QRTA 2UY7B 4X6BB 3FRPB 2J6EA 1BP3B 2AANA 2AJ3B 1P0SE 3UG4A 1YECH 1EX0A 4PGCB 4WFFE 5JPMC 1PQZB 5K9JL 1BZ7B 1JFQL 1S5HB 3CFJB 4UQBA 1KYOJ 4IK6A 4RFNC 3DTXB 4JZJA 5DJYB 4NUJB 1JPTL 2EDJA 2ZCLL 3QUGA 2ATPA 3Q43A 4NT6B 4RBPH 2W65A 4U0RB 5H35A 4HWNA 1RZPA 1LDSA 2ZUQC 1FL6A 2ARJQ 4HA1A 4X2UA 3BUBA 5EBWA 4BUGA 2WO3B 4I1PA 2CDFB 4KAQL 4OD2A 4P3CH 5HVHB 4F7MB 3POUA 4PJ7E 2KXPA 3MSPA 5HYJD 3JYBA 2CZNA 4LK4A 4E9SA 5DURB 2VJ8A 3SQBA 3WD5H 4ETQA 1ESOA 2D03L 4TRPH 2DTMH 4Y9FA 1ZV9A 3GRGA 2BOLA 2IDTA 4OM1L 4X6DE 5DD6A 2Q8AH 2J8UA 4JR9L 4ZTOL 1VDGA 5SWSB 4AENA 4MASA 3F8UB 3T3PF 5L7XL 3UPRB 1GGBH 4KR8A 3EH2A 3IJ7A 1RLWA 2KZ7A 3SDCC 3AS1A 4JFYA 3ZKMC 2IWEA 2WNWA 4Q58C 4PGBB 2P5EB 4JFUA 2ESVB 1KLFA 4CVXA 2JKIS 4CRPA 5EIIA 1DL7L 4X6DF 5A6IA 1F1AA 4XVJH 3DRTA 4AEHH 4XC1H 2RIKA 5B3SB 1SJHB 2DLFL 2XIIA 5HDOA 2BSTB 5TPWH 3NRFA 1D7BA 2X05A 1U6AL 5EO0A 1LDPH 4OFYA 1H6FA 3B7UX 1OCCB 3WKML 3WS6A 4Y2OA 2ZYSA 4JRXB 5G26A 1CIDA 1YNTA 3F83A 4WTZG 4D8PA 4I3SH 3K46A 3ULUH 4DO6A 2Z91A 4E41B 1K4CA 3KGTA 2H1PH 2NNFA 4FTDA 3SYCA 4JRYA 3WFHA 3KE0A 2FWLB 2YWZA 4JQIH 4TL4A 5HJ3B 1YYMH 1JGLH 3HHSB 3RZWA 1LM8V 2FYVA 2WLJA 5INDB 1KFAH 3BWUC 1FG2A 3UYPA 2OMYA 3HR6A 1OGSA 2VQ4A 1WA1X 1TIUA 2VDRH 3TGXA 5F7EL 4FJ6A 2DBLL 2EXSA 5B1JA 3D0AA 2ZX6A 1OXYA 1Q9FA 2R23A 4JK0D 4AEEA 3GRWH 1S3KH 4OLVL 1FJ1A 2F15A 32C2B 3KBFA 3KPMB 3P0VH 1Y1UA 5KSAA 5C0CB 3RIAF 3ZHFA 1FPTH 4XBPB 3RTQD 2DD8L 4XVUC 4FESA 4C4KO 3TEWA 1TSHA 5T5FL 2J1KA 3IPBA 4AIEA 4LMQI 5ICYB 2DL9A 2PR4H 5F1NB 3RTQA 1T20B 3P40A 4X6CF 5M94B 2XWBA 4KJPC 3GHEL 2DQUH 4GP8B 1Z5LB 4WRLA 4X7DC 3ZTNH 1CD8A 2AEQH 1DFBH 1EJFA 1IBHA 5MI0C 2IV8A 4IHOB 3HFMH 4BGDA 4OZHF 2WAHA 3ZO0A 1NL0L 2BOCB 1R3LA 2QELA 2WGNB 3OR6B 1E0OB 1HN1A 4IOSA 3ILPA 5F2FA 1EJOL 2FJFA 4BFIB 4WZ9A 4FXGC 3R1GH 4NO3A 5KN5A 1F2XK 3QCUH 5L2KA 4NAQA 2R39A 5DQDL 1SF5A 5DRWB 4PTUB 1JZ6A 4NO3B 5KANG 1CLYH 3B9KC 3L3HA 4GBXB 1P4TA 4YXHL 5I19H 2A74C 2H6OA 1A3QA 2EUWA 2HVKA 2ALAA 5DJ6A 1QBLL 2IFFL 1I4FB 4M6OH 3ZHDA 5D7SL 2IO5A 3T3PB 3EO1A 4ZO9A 4KI5C 4M1GH 2PWHA 4POZC 2H0PA 5B7MA 3TS8A 4GS7C 5IEHA 3MUGB 3QPXL 1D2PA 3GINA 2KBGA 2Y1YA 1N6QL 4GLRI 2D3JA 1EERB 2R9HD 3KS0H 5I5MA 4ADIA 1E5CA 5IESL 2L8AA 4JAMB 3HPJA 3AA0A 3HR5B 5AW8B 3WGUB 3MBEC 4AQ1A 3PPSA 3V6ZA 4DO4A 2X41A 4UMGA 4YL4A 5D5DA 2RFXB 1T7XA 5B7EA 4G6FB 3RDTD 3SJVE 2K7QA 2RACA 5F3BA 4XAWH 5E2UL 5I1AB 4NENB 4Y1AD 4PV9A 5CZXD 2OI9C 3QDGA 4OJFL 3W56A 1CFMA 1SBSH 4AQ8A 1ZSHA 1S7XB 4JZOB 1DEEA 4K2UL 4HHGA 1A9BA 2D0FA 3ZBMA 3FUDA 5F3BB 1H6TA 1N5AA 1I3UA 2IAMD 4EQ3A 1I8LA 1WCQA 2KL6A 1WIPA 3C5JA 2VLKE 5DZNA 1WBXA 4YNYA 2IWKA 5BRZA 4RWYL 2FDBP 3HAEA 4PS8A 3PF1A 1OGPA 1UB6A 3NMEA 4N28A 3RLSA 3VUAA 3WEBA 3QIWB 5CGYC 4XBEH 4ZW5A 3U9PH 2YUXA 5HHQB 1MVUB 3WDJA 1EXHA 5C92A 2W9EL 4HEPA 5EOTA 3CXHK 5I1LA 2AXGA 2ETWA 2F2HA 4GKSA 1X5HA 2EXYC 1UVQB 4QRRB 1G94A 4LVNB 4JB9L 5GGSY 2DYPA 1LVEA 4U0QB 5C9JB 4GPVA 3DOIA 2DIAA 1HHJA 3ZDWA 5IB2B 2FR4A 2HN7A 2RAMA 1GR7A 2CCLA 5FUCC 4H40A 5EZPA 2HJFB 2W5PA 3CAFA 4HEME 4HMDA 3VQ1C 2XFXB 3DO3A 1RZ7L 3DPDA 1YA5A 1P7BA 1JWMA 3B1UA 5E2WH 1ZLWK 1FYTB 3KJ4B 3C6LC 1I8LC 3H0TA 3CXDL 5JIHA 4Z3JA 2ICWI 3GMNB 1JP5A 1S4IA 3M86A 4DKAA 3KD4A 2EYTA 2J2ZA 4HCFA 5F7YC 4UUJA 5ECGA 1C12B 2ZYIA 3K6DA 4GJTB 4IRJA 2A7BA 3KVDD 2CXKA 1UZGA 3CN3A 4RL9A 4Q6IA 3RVWD 4OGAC 4GRMB 1H9VA 3L2LA 3OBAA 3ZKQD 3EG9B 1X5MA 4KTEH 4YHNA 4YSSA 2CDFA 4OD2B 4X50A 4AZ8B 3ULVC 4XX1G 3CZEA 4O58L 4JO1H 4LOUC 4RSVA 4DH2A 1G9NL 1HINL 1SHMA 3TLRA 5EO9A 3J2PA 2AGJL 5LGJA 1BDYA 1H3XA 3KWVA 4X42A 4BH8B 1PZDA 3NZHH 4AW4A 1XGYH 2IEPA 4RDQG 1MPAL 2IMMA 5F0MB 4NIKB 4BFNA 4CSZA 2FRGP 2QZQA 1O6SB 1QYGL 3WFZA 1D5MB 2H6PB 1E4KC 2N56A 5KS9E 4MKTA 3GXNA 2ED7A 1KMGA 5BVPL 1XF3A 2AJVH 1R1CA 3X13A 3BVNA 1ILUA 3KGUA 3WY3A 1ASPA 1Z9NA 4K9EL 4AUUA 4BFKA 3LX9A 1JI2A 3D2UA 3J8F7 4Z76A 1B0GB 1DVQA 4N1EA 2LQRA 4R4ND 3K2UH 4IU2A 5AWNL 4KQ3L 4A39A 2DMKA 4O2FB 4JRXE 2FCBA 2WV3A 4YSUA 3F01A 3MV7E 5E51A 3U46A 3BPNC 4CU6A 1IC5H 3FO2A 2ZKXA 4OUUB 4KKLC 4U3CA 3VVWA 2CHZA 5ABAA 2PRNA 1NDTA 2A9AA 2VXUH 1U2HA 4N2DA 3BZ5A 3GSRB 1CFQB 3K2KA 4KNQA 4UB6O 3K6NA 4NQDE 2E4FA 4WEBH 4X4XB 4ODTH 4BKSC 4HXBH 3OAWA 3L5XL 3FB5A 4JRWA 3EGDB 4OGYH 3CIAA 3S5ZA 4BRVA 4PJXA 1T1YA 2OZ4L 1SEBB 4BQ9A 3D2TA 3LEYL 3MROB 1BF5A 4YHKH 1JZJA 1S7SA 3BPLC 3N40P 1T7VA 4MAYA 5ANME 2R4LA 3KEDA 1BZDA 5E08H 1YEDA 2BK8A 3QPQD 4HS6A 3ARUA 5G55A 4I9WD 1NMCB 1V5JA 3MV7A 4GAJL 1DP0A 5IG7B 4IKKA 1MCKA 4Z3TA 1QACA 4F15C 5HVHC 3LRSA 3Q8AA 4FTVA 4AOFA 4NJ9L 3V4UL 5AW3B 3SDDB 3D39D 3DPBB 4TUUA 3TA3D 1ZLSH 4EN2A 1I8KA 4ZS6D 1MI5D 4MDIA 1J8RA 3ILEA 3APMA 1RD6A 3V4PB 1CF1A 3I2CL 4NBZB 1NOFA 1JTTA 4F2EA 3TZVB 2JJUA 2P5WE 2MHAB 1XH3B 2LU7A 3JV4B 1BF2A 1MAML 4OSUH 3TBTB 2Y7MA 4LQFL 4ODHL 5BV7L 1HXMB 1FIGH 3VW3H 4Z7UA 4JFPA 4YFEA 5IW6A 1R0AL 4L18A 1C5BL 4YR6B 3RVWC 4IBVA 4H2CA 4GB9A 5IY5B 1JRHH 3DWTA 1DO6A 5FDWB 4M6ML 4OJDH 3EXLA 2GHZA 1D6EA 3U30B 5T33L 3C6LB 3QJFB 3SJVB 1WAAF 3U9UA 3L3JA 4MD4B 1GSMA 1NC2B 3FTVA 3V4PL 5FYJE 4IBQA 1MCQA 4GRWB 4NUMA 4CBPA 2PWDA 3BH9A 3C5OA 1FPTL 1TCRA 1YG9A 2HX9A 4YHOL 5AUMA 2O5NA 4P5TC 5FKPB 2WLLA 4ENZA 4DPRA 4R5VA 1KIPA 5T5FH 1QSEE 1M2OA 3D85D 4O4YL 3T4AB 3U7YL 2W07B 4B61A 1CD9B 5HSFA 3DVNA 4S1QL 4LLVA 4OCXH 4QDGA 3GSUA 4AT6A 4IMLB 4HKBA 3P69A 4YXKL 4YDZA 4UDTB 1AZUA 3GBLA 7PCYA 1B2WH 1UT1A 1IGCH 2XPGB 3QDJB 5BS0D 1EJOH 2FEEI 2QPFA 3CXHJ 3LH9A 4B97A 4JPWL 1QUNB 2GBAA 3O2WH 1PIGA 1SQMA 5EU6E 4B7LA 3T24A 2HRPL 1QFPA 4K7PL 4X6EA 5D1XC 1S7WA 2ZG3A 2NY2B 1RQ5A 4ODWB 4AG4H 4YZFF 3CLEH 1SBBA 3TC9A 1BV8A 2VZ1A 3DETD 3HUJF 2C7FA 3QFJE 1E3XA 1CDGA 3T4YB 1M9SA 3OMNB 2BS9A 1GMIA 4Z7VA 2YRLA 5E9AA 5LDSA 4G80B 2IANB 3SDDC 2CCWA 1SXCA 3VFUA 4NRYA 3BW9B 2JKWA 4XAKE 4AQOA 2C9UA 2OCJA 1KUMA 2H3KA 5CD3A 2MEJB 3G5XA 4WCYL 1KTDA 1IEAA 4DGVL 3LZRA 5IEKB 2EEXA 5F97E 1SLUA 1ZWIA 3H2WA 3PWPA 2YEQA 1AO7E 2R51A 1D6VH 2B16A 1XGTA 4ZFOB 2DMHA 2ZKHH 4FABL 4XCCL 4AGNA 1OEZW 2DWEB 4XXWC 2Y1AA 2R0KL 4TV3A 5CU5A 4K7PY 4RFNB 1IBGH 4DGUA 1AXSA 5E8DH 2I9LB 4J6RL 3RL2A 4DIXA 1JZ4A 2E46A 4HOXA 2K4AA 3N42B 5FA3A 3RE0A 5BUPA 1QJPA 1J5IA 3D08A 5F7KC 3F7PC 1W6WA 5GIRA 4MJIA 4O9HH 1HCVA 1YY8A 3Q8EA 3LIZA 2RGSA 4NQEA 1HFUA 3DX8B 3QIUB 1DBBH 4RISH 4FKEA 3OXSB 3IS0X 4AFKA 3SN6N 5L0QB 5DTFB 4C56E 5L6YL 4TNGA 1P4IH 5MEPA 4KTYA 5HI3D 4HV8A 1KTLA 3AS0A 1XB8A 4W81A 1F4HA 3K8MA 4JKWA 3VE0A 1QZNA 1L9QA 2B2XH 4ZK8A 1T83A 4Y2DB 4ANUA 3QHFL 2Z7WA 4GRLA 3UTSB 4OUOA 3ZLQC 1SMAA 3HE7C 2IPTL 4BUQA 4MNHA 4ELKB 2K0LA 4TNEA 4QRRD 3T08A 2FYYA 3QC5X 1MJ8H 1XF3B 2WOBA 3GHBL 4MQSB 4Y5VA 3QWRA 3L3IA 3FQ2A 3DUUA 1KV7A 4PS3A 1P4LB 4PSRA 4PUBH 4YZFE 5CCHE 1F41A 4BE6A 3VXRA 2PP7A 3HE7B 3QUMH 3FUMA 5C09A 3SZKC 3KLAB 3WTTA 4PRIB 2VZTA 3M88A 4N2OA 2OJEB 4PJ7B 5ADPL 1KB5B 5CEYA 2VITA 1IGFH 1FN4A 2ZSVB 1PG7L 3LRGA 2DQFA 2D8KA 3A0OA 4OF3A 4G6MH 3SDYL 1DJIA 2RTTA 5KS9B 3IJSB 1HHKA 4PWGA 4UYQA 1HE8A 4BKLA 2LLLA 5C2UB 1YMMA 3WN6A 1HYRC 2XWXA 4NHCH 3WFCH 4DEUA 4TNFA 4GSDH 3LQAC 3CFIC 2DKUA 4PJGF 5MP6L 1S7TB 1AE6H 1VSCA 4N2AA 5FO2A 1TJMA 1IC1A 5DJAA 1CG9A 3RAJH 4RMWA 4C59B 4FZ8H 4ZFGH 2NYKA 4OCRL 1ZKAA 4FFWD 4A7QA 1E6JL 3I6KA 5J3HD 3OR7B 4I7ZC 4PTUA 4PJHB 5DZ9A 5MERA 2AABL 4AK1A 1L5GA 1Z1WA 1CFTA 3QXAA 1INEL 2WZ0A 2MSPA 3F64A 4D7BA 2AQQA 2JVUA 3K6IA 4NN6C 4QRPD 4TMPA 3CZLA 4L2YA 1ZGLA 3CE1A 3FT9A 1N26A 3S6CA 3L5JA 4IMLA 1OO2A 4XMPH 4FNSA 3WXVL 4Q9QH 5CKAA 3BUPA 4J3UA 1CLYL 3V0WL 1SPDA 3DNKA 3KPOB 4PU2A 4NNXB 1Q1JH 3RWJA 1KT2A 4DERA 2IFFH 5DTFA 3IU3A 4K8RC 1FBIH 2CXGA 2HLAA 4C56B 5J6HA 5DUJA 3TN0D 1KT2B 3TONA 2ZKWA 1NCAH 1RIUH 1GY2A 3U9UB 5PCYA 1DEEB 1A6VH 4F9PA 5D7KD 1GYUA 1RZFL 2E0PA 4XNLA 4X0KA 4P23C 4JVUA 4OBSA 2X88A 5JIDA 5B39A 4G8IB 2RBLA 1CFSA 2FZ3A 1Y07A 4YR6A 3GM8A 4WJ5A 4JGJA 3ZT6A 3UC0L 1UUSA 1VFMA 4N2IA 3QHZL 1SYSA 3OKNA 2BVUA 5HXMA 2IH8A 2WVVB 1KTDB 4UT9L 2BY2A 1N7ML 5HPMA 4YH6A 1N0XH 5GGVY 4FL4B 5DD5H 2EE6A 5EFIA 1S78C 1ZHKB 3TTSA 1DSWA 1SOSA 4J28A 5KOMC 1WP6A 1AACA 2QPEB 2CHWA 1XIWC 2WXOA 4FFVD 1MVYA 3NSJA 2ZWLT 1M05A 3V0IA 4EI6A 1IM3A 3V4VB 1I8KB 2WNKA 3TX4A 1A4JA 4K3JL 4B9CA 5IFAH 5D2LB 3FU6A 3BKJH 2YQ2A 2Y5TB 3S9DB 1OSZB 2APVA 3SDDA 5E2JA 1VFOA 1JPFA 1HKLL 5F96L 3O2VL 5H2BA 4OF7A 4QJ4B 2F7OA 4XN7A 1WVZA 3B2DC 4K73A 4FRXA 1J5OL 3KCWA 3ZSTA 4UM8A 5GGVL 4PCYA 4JFEB 1DVFA 5BV7H 3S4SA 4NDMA 2E6JA 3EH3B 2V9TA 4CC0A 5HGBA 1J8HE 1I85A 3VB8A 4G5AA 1R3IL 2XV3A 5DK2A 4B3EA 1S46A 3I6LE 1JS4A 4FKHA 4JFDB 5AOIA 3SGJA 4KVCH 4J4PC 5IHBA 3IDXH 2DY2A 5IBTH 3VD1A 1YYLL 5KG9A 1CLOH 4L0YA 5D4IA 3QUZA 4P2RA 1ACYL 3CFTA 2YPLB 2EUXA 4N8CL 5GGSB 4BSVB 3LAFA 1Q4NX 3HS0B 4LRNH 4S0SD 3QIBA 2X4OA 4GQRA 2LOEA 1ZA6B 4H20L 2D0HA 3GPEA 4RSYA 5ANHA 4TNWF 4M9PA 1VESA 4P4KD 2V5RA 1KTLB 4QRTB 2D73A 3ME0B 3DMMB 4N2EA 5IMLA 2G60H 3J07A 1KB5A 4XXCA 1Q9OA 4ZZKA 3KL0A 3LD8C 1NMBL 3PWNA 4BRJA 2GT9B 1JGUL 2B59A 1QI5A 3IXAB 4AUYA 3TIEA 2HMID 3EOBB 3FFDB 4U2ZA 1R6VA 2QR0B 5HYQB 1TQVA 1F3DH 2DD8H 2P5WB 1BQHG 3F62A 4R5XA 2X42A 2XIDA 2YN5A 3BPLB 3Q5YA 5HDBE 4K4KA 4N0CD 5TF1H 2XIBA 4V1DD 4K9EH 1CWVA 4Y5VB 1JYNA 2HJLA 2KLRA 3VSTA 1J10A 3MJ8A 4JFXB 2DQUL 3NCYP 2HG0A 5ES4B 3MNVA 2F8XC 1A6AB 3WMPA 2NY3C 3WIHL 4AV5A 1E7UA 1QABA 5JOPE 5BO1L 3BISA 4ORGB 3LKSB 1G0YR 4G80A 3C6LD 3DDGA 1E65A 1TDQA 4PJIA 2UVFA 4QJ3B 5K9OB 2OJZH 2UZIH 4BK5C 2ZZUT 2XXGA 4K3CA 5IMKA 1MW3A 5IW3A 2FH6A 5T3XL 3CLFH 2VC2B 4EDWH 2X7LA 3QEQE 1G0DA 4LEOA 3FCTA 5CSZA 2D7TH 1NZRA 4M03A 1GC1H 3EUUA 4MLIA 4XWOD 3KW7A 2FL5A 1QBLH 3PDOB 2BY1A 3V7AE 2EIZA 4L3ED 4R96B 2XVBA 1REIA 5I6OA 5G38A 3IFLL 4UIMA 5D1XD 4OI8A 3MRKB 1EO7A 3NRPA 1Z9LA 4ZX6A 1G87A 2PXYB 3II2A 4N8UA 2V2TA 4NO2B 5BW7C 1W0WB 3OAYH 4S0HA 4G8AC 1GY1A 3C09B 4QXUH 5KVDE 1QKZH 1E5BA 3N55A 4MA8L 2WLHA 4RRPG 3NFNB 5IESH 3Q3GA 2IANE 3SDXE 4NKOA 1K8IB 4ODXB 4IOIA 3U1QA 3AWFA 2N2LA 2WCSA 3QR1A 2QHRL 5AW2B 4N68A 1I1AA 4NJ9H 5DI8A 5HY9B 5I2IB 2WN2A 1IAOB 1X7TA 2JK5A 5DZJA 1R33A 2XT1B 2CPUA 2XXCB 1DQQB 4G1EA 2GB2A 5DFWH 2EDKA 4XPAL 4I8DA 2VRAA 4R7DA 1EHXA 4Z7OB 3DURB 4M7KH 1T1XB 2VDNB 4FHJA 4XBMA 3UJJL 2TRHA 3OKEB 3MLZH 3QDME 4CC1A 4S10A 1U2CA 2ERJB 5ALCL 4Z7AA 5IVZA 4JO2H 4GI8A 1NAKL 1HXUA 1ZEAL 3TVMB 5D1XB 4OVUA 4XNKA 1PLGH 2F54A 2EDRA 5E9NA 1QLEL 5EU5B 4Y2LA 3ZU8A 2QT6A 5HGGS 3VFGL 2CK0H 2YPVH 3ZMRA 4YC2C 1DHKA 4WUKL 1NFDE 5D7JB 3UJIH 4OZIE 4XMXA 3QK0A 4P59L 4X7CC 4D0BB 1T22A 3S88H 4XC1L 2FJGB 2XPYA 1PZUB 2E27H 1SJEB 4E9XA 1OT4A 3GJFK 4R4BA 4P2CG 2WOYA 1ZXKA 4G2AA 1E4KA 4X6FA 3LPWA 3GTTA 5AKRA 1MW1A 3GS0A 3MXWH 3K6SB 3D25B 3DSFH 1KC5L 1N64L 1I7ZA 5CD5C 3AT8A 2I26N 3NIDE 3KWUA 2CO7B 3G5YB 3KM1A 4UAOB 1G6VK 1PG7W 4JHAH 4Y9BA 4L5FL 1QSFB 2GC7C 1K6QL 1MHPL 3CC1A 3IPEA 3TJEH 1HXKA 2JCWA 2H0FA 3DX7A 3KCPA 1AXTL 4E41D 4URKA 4BFRA 3C6SB 4PQXA 2WBXA 2QVFB 1WBYB 3C8HA 2C9PA 4U3SB 1TZIA 4XCYA 3US0A 4LQ1A 5CILL 4OQTH 4WENB 1RUKH 1JZHA 2EINB 4WK0B 5BQDA 4AQAB 5CSZB 2Z4TA 3ULUD 4K71B 4LKXB 1G9NH 3S4SG 1R4XA 1FE8H 1MFEL 3P0VL 4L3CA 1M2VB 3LKQA 1YEJL 4EN3A 3GDCA 3VFNA 4WGWB 1UACH 2EDHA 3FCGA 4LPTA 2KZ1B 2P28B 4AV0A 1YNTF 2UYLB 4OF5A 4ZMXA 1A7BA 5E94B 2V17H 4BUHA 3X13B 3NIDF 4QRSA 5HGDB 3D4ZA 1ZTXL 5CJBA 4Z7IA 5A7EA 2G0KA 5GTHO 2DV6A 5AYUL 3H53A 3UTPE 5I6LA 5I1IL 4HIQA 4Z7WE 1E6OH 3F84A 1G6RH 2FUQA 3HJ0A 5A2AA 4JMNA 2XVKA 3AQZA 4RH4A 1NC4B 3FU5A 2JIXA 3K1DA 2FWUA 2AQNA 5DQDH 3JTSA 4CVWA 1LLAA 2K1MA 2VDOH 1RZFH 2ZXWB 4LEXL 4P2QD 2VN6A 5E23A 1DEDA 4ZQTA 2DI9A 4EDXB 1OP5H 4JFHD 3VXUE 1TJHH 5I18L 4XN8A 3C5SA 5L2JA 1T2JA 2OJEA 4BCXA 5ID1A 2HJKB 3TOPA 4N3TA 5HI5D 4CL7A 4L2LA 3DSNB 1MJ7H 1T0OA 2ZYRA 4ZYKB 4PJXB 5TGBA 1HHGA 1UZ8A 1XF5B 4A66A 4DEWA 2W81C 4HUXB 3MV11 4PJDB 5DJZA 1JWSA 5EOCH 4ZTPH 4F58L 4Y2OB 4W93A 3NFPA 2KMWA 2D9QB 3FT4B 1QTSA 3HI5H 1JPST 3MBEA 4FQXB 5D6DA 2E5EA 1RAMA 1PYWA 1WS8A 2OMWA 4P5KA 2GG1A 4HUWB 3VX0A 1JCKA 1LNUA 2D0GA 2VLRE 3M1BA 1YQVL 3V0DA 3VYOA 3E6FB 1JHKL 4MJ6B 5EU7E 4Y19B 3VI3B 1D7FA 1OAUL 1M71B 4QXTA 2YIHA 3AT9A 4PJEF 2VL5B 2FQEA 5J1TC 4K8RD 2WKGA 3MVSA 1AD0A 2ZICA 3C75A 4HU8A 1NOAA 3H54A 5F1KC 2DF3A 3QHFH 4N90D 3AU0A 4HCGA 2PABA 3ROLA 3RL1B 3REWB 3NJXA 4ANXA 4PRNB 3E0GA 4G42B 2ZUYA 3D2UB 2B1OA 3HC0A 3WE6A 3LZNA 3N40F 3T77B 2DQJL 3A5VA 3RL1A 1WISA 4K3GA 1U0QA 4JN1H 3UBHA 1J0ZA 4HT1H 1JV5A 2YMXH 3KYAA 4KOBA 4KKAC 3VM7A 2HT3C 3ZL4L 1JGVL 1T16A 3QXDA 2XFXA 2GJJA 2HX8A 3P4NA 5EPMA 3UYRL 4KV5E 5D2LA 4HULB 1JHTA 3LKOB 4W1TA 5F7LB 1CLZL 1BZ9B 3Q6GL 5G4OA 5KAQF 5FYKL 1LEKB 1CICD 3PFQA 3DTXA 1AZRA 4JZJB 5DJYA 4OFDA 1AXIB 4F9LC 3RTQC 4QRQA 5D2NE 5GS1B 2ZNWA 4YAQA 4G6ML 1MCPH 1CXFA 5JORB 4LHQB 3ZKXB 3ARPA 2VE6B 3IJEB 1CBJA 4F2FA 2F1CX 1EZVX 1T1WB 4YHNB 4YO0B 3SKOA 4RZCB 2XYCA 1JZIA 3EHBB 3GIZL 1CI3M 1N68A 2DAVA 1I1YB 4NCC1 4Z76B 1PZAA 3MLXH 1KZYA 5GGTA 3POCA 3EBGA 3IDNA 1N5AB 1YEGH 5B1JC 4PHZA 2APTA 3ARFC 4OZFA 3I6GB 3GEWB 3L2NA 4RGNC 4LVOB 3DO4A 4B3VA 3VD5A 3K2IA 2EEDA 4NLAA 3RFZC 1TO5A 3DUHA 2P8MA 4F5CE 1A6WL 4PV8B 3MRIA 1A7OL 1RURH 4O02A 3OKEA 1MQ8A 4XVTH 3P3RA 1E2ZA 4HKJB 5GRVK 2DIJA 3AY2A 1P5UA 1NFKA 5JTWA 4CA4A 3KPOA 3WIIL 4OIBA 1RJLA 2FQDA 1THQA 3WS6C 4A2HA 2QTKA 2X4RA 3T0VA 2AJUH 3PGRA 3F2LA 3QG6A 4UV7L 3UBFA 2FGZA 3FCSB 1UWEL 3LZOA 1ZS8B 5DYOA 4F33B 3HZMB 3N3EA 2Y36L 3O2WL 2OMXB 3AAAB 3PYCA 3VI3A 3UZQA 1NGYA 1A66A 1SJEA 1N5YL 4GBXA 4U1LA 3VA2C 3HOGA 2WVUA 3WJMA 4HPOL 5DDHA 4A6YB 2R7EB 5C3IA 4JFED 4KHXL 4ZUUB 5FM4A 5F7HA 2XWJB 1L0XA 5ERWA 4F7EB 4O2CA 1IC5L 1MF2H 3UC0H 4U4IA 5CBAA 1MDTA 3FFCE 3UTTD 2YQ3A 5INDA 3ZL1A 4F7TA 2O6CA 4AJ0A 4AQ1B 5H37A 4I89A 2VW6A 3MRCB 2P5ED 3CHSA 3OL2A 1MCLA 3L7EB 3BDXA 2QHRH 3SCMD 2AVGA 4Q2ZB 5J13B 4QKTA 5AL0A 1SJMA 3EGSA 2W95A 5C0CA 4LPCA 4DP7X 5IQ7L 3D3VA 1KCRH 1SXZA 2BFVH 5LXVA 1N2RB 2RR3A 4TQIA 4A2MA 4PLKC 2OR8A 3R0MA 4BQBA 1MCCA 3ZDYE 4M7ZB 5IWLA 3C8KB 4WWPA 4MXWL 4QRFA 1ID5I 5ABZA 1TJGH 4M8QA 5I74C 1J5OH 3ISRA 4WW2A 4OJYA 3AA6B 4L4TD 2BVEA 5T1LA 3M17B 1M42A 4P99A 2NRDA 3UAQA 3BUYA 4APQA 4JGNA 4R7VA 2FX9L 2PYFA 2V2WA 1CICC 4Q8BA 4QUOA 4H7VA 4MVBD 8FABB 1T0MA 4B96A 3FU3A 4YQXL 2JJSC 5DC0A 5DC2A 3ZSSA 5C0AA 5F7WC 3A47A 1KCSH 3ABZA 3MLWH 4QT5B 4OTXH 4XB3A 1VADB 1L9MA 4FEMA 4U1KA 2YD3A 3PV6B 1ZHZA 4HBCL 4LVHC 3VWJB 4ALAC 4JO3H 5FYKU 4UT6L 3S3PA 4CMMA 1MCEA 1AZBA 2P8LB 2MHLA 1I7TA 5HTSA 3WSQH 4QKXB 2F8IA 5E99L 3VXPA 4YHML 1BQRA 1HAUA 2CBPA 1OP9A 5E1HB 3P11H 2XA8H 1I7ZB 5SX5H 2CDGB 2E7CA 2XXFA 3EFOB 5AZEH 4UNUA 3UZEC 4JPIA 2B15A 5DJDA 4NUQA 2E59A 4MAYD 3VFVA 2R2HB 4RX4D 4KQ0A 4LNRA 7FABL 3TIEB 2VTFA 2H2PC 4GSQA 4KXCA 5C0BD 1AG6A 1UACL 1G7PA 5C07D 3STBA 2R69A 3MNWA 2V9RA 3T0WA 3R0NA 1ROWA 1YEKL 3BVNB 2V17L 1XGPB 4LKCB 4ZFGL 1SMOA 1NCWL 3V4LA 4EZJA 1GS6X 1SN0A 1EO8H 1UD4A 4CADB 1B3JA 5J1SC 2GUOA 1A0QL 3QQDB 3W11C 1ML0A 3ATEA 4U1GB 5I9QC 1UTDA 4WK2B 5DD0H 3LHPH 3R18A 3V6OE 2VMDA 2ESVA 1S7WB 5IR1B 1ZJAA 2VDQL 2FD6L 3QQDA 4TLSA 3TWYA 2CHXA 3P4OB 3O11A 4DUVA 2BH0A 1QRNB 4JFYB 4HKZA 5IB3B 2QSTA 3AAZB 1RZIB 1IGYB 1XXFC 2VDOL 2BWIA 1KGYE 3I74A 5I1DA 1G7JB 2DOCA 4KI5D 5I71B 3JUYA 4D9LH 4L8BB 2A2QT 3PL6A 3ZR5A 4AC4A 2RCSL 2VQUA 5AOKA 4NKOB 2GAZA 4OD3L 2ZUSA 3F05A 5B38B 2EVHA 5HI4C 1RUPH 5DJDB 4CC4A 5CBEA 1AHWA 1WZKA 2B4CC 3SQRA 1CFSB 2FZ3B 3KG5A 1S8DA 3QB7C 4R7NA 4BFFA 1NCHA 2G2NA 3FYEB 2PW1B 1M3JA 4G6AC 3LRHA 3C6SA 3DA3A 1YN6A 4EIUA 3CFNA 3Q8CA 4MRCA 2H9GB 5C0RH 1X5XA 1BAGA 1JF1B 4MLSA 3NJJA 1MFAL 4FSPA 5I8OH 1HESA 5HP5A 5B8CA 4ZXBB 1QR1A 3GI8L 4F91B 3P3UA 4RGNE 5K9KA 2FTAA 5DUMH 1QP1A 2JKRM 4MA7H 3FO0L 4J3VA 5CGTA 3S36X 4DWHA 5GS0H 1UB5B 4J6RH 1UADC 3VGEA 1HWHB 4P2OD 2H1LM 3FCSA 3E3QC 3UO1L 5I17A 2HFGL 4PJ5A 3QEGL 2PCPA 4KR4A 1E4WL 2EE3A 2K9FB 3QIWA 4HIEB 3V95A 1PSKH 4G8GA 5AKSA 3ULUC 2VDKB 4PG2C 4F1SA 3JV4A 2GBUA 3OKNB 5AYQA 1WBXB 4K55A 1IKNC 2LAAA 3CCHB 4N0FA 1CFTB 5EBLB 1IQWH 2MCPH 2Q7NA 4Z7UF 5HJDA 2GSIA 1JMZA 3NIGE 1OM3H 4YVUA 4PCTA 1NM4A 1IKNA 4ZXBD 1F6LL 2DWTA 3BKCL 5IIEA 1HTYA 5D71H 1ACZA 5JA9A 3U6XS 3ZE0E 3BH4A 5D55A 1GS8A 4PRDB 5GGVH 2J8UE 5IFJB 1NGWA 1KJ3L 1DVUA 1PVHA 5FCSH 1J9QA 3SDCB 5E2TH 4KROC 1XCQA 4ZFQA 5IF0A 3QJXA 3OJ2C 4WWKA 4M93C 3HUJA 4TNVK 3I3DA 1G7IA 3U6RB 4NNXA 4U1HB 5CEYB 4ADJA 2ZWNA 2VDML 3S96B 3QORA 1EHNA 3CV5A 1SHXA 1C5CL 2UY6B 4FP8L 4ZW6A 3TFKD 3DI3B 2CO2A 4BCYA 5B8CC 2YA1A 3SDXB 1FZMA 1AGDB 1O5DT 2DQIL 5GHWL 2GCYA 4E5XG 4L3AA 2OTUB 1YC8A 3FYIB 3X12A 4GG8B 4KAQH 3TH3T 3CPUA 4D3CH 1IFGA 5D6CB 4ZSOA 3FB7A 1MLBA 2FEDD 1A7OH 1RURL 3QI9A 4AXWB 5JW3H 3QPKA 2X27X 5FAAA 3T77A 4N74A 1KCLA 4C83B 2F53D 1XGQB 3GXDA 4Y7OC 2GJ6A 1C08B 3KR3H 3DXAE 1BEYL 1RK7A 3ILDA 4P2RD 2X4UB 2E75C 3ARBD 3N1MC 4NSKA 4OZGE 4AGPA 1B4JH 5DF0A 2WY3B 4JMXA 5EORH 2EVIA 1OP3H 4LHJB 3T09A 3FO9A 4Z95H 2IH3A 1EXUB 1J9CT 4F2MB 2Y24A 3OXSA 1F18A 5AQ0A 2VABA 1UKSA 5KYXA 2I9TB 1ZXQA 2QVIA 1T0PB 2X9XA 2WXHA 4NYLB 3SE9L 1DN0B 4NI6A 2WNGA 5GGUA 2QKSA 4X83A 3D52A 4GRWF 3SKMA 4Y2DC 4YLCA 1HCYA 3RHWF 4WV1A 4FYRA 3VZWX 1HH9B 3AS2A 3RGVC 3UAJC 3UG5A 1A3LL 1B9ZA 4KKCD 3CQPA 2DWEA 1HHGB 1XF5A 4WNQB 4UAOC 5L88H 2FO8A 3A23A 2F54D 3LB6C 5CMAA 4JFFD 4E9VA 2WJ7A 5KVFE 4ZFOA 4XNQA 1JYXA 3EZJB 2DYSB 3WFHB 4LCWD 1JZ2A 1GGYA 1MFDL 3O6KL 3BAJA 4E0RA 2CR3A 1A9VA 1X5KA 4ZODA 2AI0L 1MM4A 3ROOA 4PTTA 3C60D 5C6TH 3QUMB 1XR9A 3M46A 2XTRA 3OPZH 4MJ4A 3W0WD 3POXA 2AJZA 1T1LA 1LK3L 4UT9H 3PHOB 3P2BA 4DAGH 5E9DA 4HC1L 2ATAA 1HH6A 2GVYA 3PHAA 3QZWB 4HS8H 3QO1B 3DX8A 3ALXA 2K6ZA 4M43L 5CLZA 4D94A 5D7EA 2DQHH 2A77H 5CZVL 1I8MB 4O3XB 5I1EH 5CP7A 3PDDA 2F9BT 4LSUH 3S4SB 4FQLH 2BNUA 2FIRT 1LHZA 3HC0B 4QAWA 3TV8A 1PNCA 2Z1KA 3B3IB 5DK0B 2PTTB 4QRPB 1U91B 3BIKA 2R1YA 4FLRA 2G3MA 3CIQA 5CZXC 2J1ZA 1UKQA 2KZWA 5F9AC 3SOBH 1MJJA 4NC1E 3QXAB 4YHLH 3I9GH 5DRZB 1AQMA 1FIEA 3ZMEA 4ATWA 1I3GH 4JKPH 4KXBA 2MQGA 4WU7A 2BW5A 5B1AB 4MYWB 4AIOA 1T2QH 1FUNA 2OTWB 5ADXL 3BDBA 4Z7VB 3PP4L 1OGAA 1OT2A 5IWLC 2CRIA 4AYID 4XNUL 4LAQL 3ZZLA 2FWSA 4AEFA 4QD2E 1YMMB 4YHZH 3QULB 4NQCA 1ZT1B 3QAQA 4QMEA 1IM9B 4QRBA 3MKKA 1YHPA 3KJ6L 3UAEA 1I7UA 1CGSL 4WW1B 2BXZA 3B4NA 2XQYA 3AA1A 5KYXB 4ZMZA 4LSFA 2PCFA 1FO0L 4MXVE 3B2UC 2NPLX 4JDVA 3MJGX 1RKRA 1Z0NA 4H20H 1NCBH 4P4RA 3V52L 3TBVB 4D0BA 3QWOB 2Y5QA 2PCPB 3OLDA 4FEIA 3FQYA 3QRGH 4X5PA 1S9KC 1YEKH 4PJ5B 2LGNA 3A6OA 4M7LL 3QJUB 1H6UA 4IS6A 1H15B 5CJOH 1H8OA 2J3SA 5C0FA 1HI6B 3FQRB 3U0TA 2XQ0A 4FG6D 4U1SB 2MTAA 1UB5A 4D0CA 1JGUH 3O4LA 4ICXA 3WUWA 2M83A 3FQUA 3FQWA 5I30L 2IC2A 2IALB 1XGRB 3MLRL 5BZXA 3JVFC 5F9OH 5IT2L 4GW1A 3QGVA 4YLBA 2OV0A 3T1FB 4WHCA 5SWZD 4LOFA 4NN5B 1DZ0A 3NCCB 4PS4L 2IADA 4UOJA 1DCLA 1VJSA 5J06A 2PN5A 4U7SA 3I50L 4C4KT 5FYLH 2KC0A 3K6OA 4PG9A 4QXGL 3V6BR 1G6RL 2V7NA 1UCTA 1G1OA 5D7SH 3ASNB 1A2YA 1T80A 1A64A 4L8SA 3VAEA 3HMXA 3LKRA 3ULUF 4RAHA 1LP9E 2CLRB 3NIFF 1AGDA 3EJYD 2JTYA 2UZPA 2J5LB 3PQYD 3FK3A 4KQ4L 3C60C 3CLFL 3S3BB 2FQFA 2ESVD 4RWHA 1CICB 3VQ2C 2RB8A 4DUWA 1RU9H 2VW7A 5E4AA 5HHPB 5J12C 5AVZB 2QV4A 3L3JB 4MD4A 3S7GA 1GTFA 1MRCH 4KFMA 5D70H 5DUBA 5JHBA 4QY8B 3BMVA 4PJHE 1IB5A 3N43B 4U7KA 1TITA 4UQCA 3ZTJH 4PRPE 3GT6A 1UEYA 3ARBA 5D2LF 2L4OA 3WY4A 4F37F 2W0FB 1FNFA 4ODVH 5C0AD 4EUPA 3VFOB 1QMUA 3C60B 2CUMA 5C0BA 1ADQL 2X9KA 3BLPX 4XTRC 1PZSA 3UIZA 4HAKA 4NQXA 5IHUL 1GYVA 1HQ4A 4PRBB 1GS7A 1TJIH 1WAPA 5LNDA 1A4CA 2WBJC 4YSPA 1U3YA 3BWZA 4JFFB 3BZFA 3HLAA 2VLJA 4W9IC 1RERA 4KKBD 3ZO9A 1GJIA 1QRNA 4J3OC 5JXEC 2ODIA 1PPIA 3ESVF 3FBQA 3POQA 5FHBL 3VDBA 3DRTB 2IDFA 4HUUA 4JM4H 3QUYB 1E9QB 1IKOP 5FGCB 5DK3A 3D39B 4PGBA 5GRJL 4NIYE