3KVDD

Crystal structure of the neisseria meningitidis factor h binding protein, fhbp (gna1870) at 2.0 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
242
structure length
242
Chain Sequence
AGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Lipoprotein
publication title Structure of the uncomplexed Neisseria meningitidis factor H-binding protein fHbp (rLP2086).
pubmed doi rcsb
source organism Neisseria meningitidis
total genus 60
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 3kvdD02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3kvdD01
3HOEA 2KC0A 4O49A 4AYMC 3PQUA 3KVDD 3VE2A 4O3XB 2KDYA 2YPVA 4O4XA 3UAQA 4AYDC 4QQ1A 4AYID 4AYNA 5T5FA 4O3YA 2W80C 1YS5A 2Y7SA 4O4UA 4Z3TA 3HOLA 4O3ZA 4O3WA 4AYEC 4U9CA 2LFUA 5EE2A 2W81C 3PQSA 3V8UA 3VE1A
chains in the Genus database with same CATH superfamily
1GHFH 1AAJA 1BPVA 3QUXD 2VC2B 5EOQH 5F1SA 2B7DT 3EDKA 2L8AA 1OAZL 3OPUA 4ZDHB 4OAWA 4AYID 2LU5A 2EUZA 5DEFB 3DBSA 5FW7A 1OOAA 2XV3A 3LKSA 3VRJA 4U1SB 4CMHB 2AXGB 4H8VA 1T7YA 3TTSA 5MEPA 3F83A 1AR2A 4MFHA 3LZFL 4PJ8B 1SJMA 3LEVL 4U6XB 3K0WA 5KVDH 5FYJU 4L4TD 3TZVC 3HRZA 1RZJH 3WN5B 1C1EL 4R9HA 1HQ4A 3EUDA 3KWVA 4GP5B 4B9GA 3WHXB 1BPLB 3GMLB 3I6KA 3ZHDA 4KNUA 3D18A 4PBVC 3JWOL 1WE5A 2BSCA 4G1EB 1T0MB 4Y1AE 3C5SA 1FH2A 1BX2A 1IC1A 2FHCA 2VNCA 3A6CH 4G6AD 5ITFB 4B6ZA 4Y2DD 3ARYA 4MB4A 2C9SA 3T0DA 1KG0A 3MV01 4Y4FC 2BSTB 1Z1WA 2OJZH 1H3UA 2ZUUA 3RVXC 2ICCA 2YD3A 1FO0L 2CKBB 4HK3J 4WI3A 1CGTA 2P8PB 1C8QA 3GXUB 5LCVH 4WHCA 4CKVX 3U36A 2QSTA 5DJXA 2O6CA 1XSJA 3SGKA 2SEBA 2PABA 4NUMA 4DTGL 5GXBB 2QT6A 3DO4A 4TQIA 5BV7L 5DFAA 5IQLA 3DGGB 2BOBA 4E9TA 1K85A 4NJ9H 2ZJSL 4PUBH 3SDAA 2Q1EA 4OZFA 1KGYE 4OFQA 4ONGH 5E2TH 3DMMC 4GEIA 3UBXA 4MJIA 1ODUA 4EEEA 1QRND 1XB8A 2BW5A 4X6DF 1JFQL 1GS6X 1WBZB 4KK9D 2IWKA 1G0XA 2DLEA 4Y4KC 2DWEA 5HHPB 2WCPA 1R19A 4Z7QB 2QADD 5EOCL 1CZ8H 4QGTA 1AD9A 3LS4H 3LZNA 4XZ4A 4GIPD 3K4DA 5GZOA 4P46C 5I8EA 3LX9A 3O0LA 2CNYA 1HHGB 2H3NA 2WYIA 3LNFA 1T1ZB 3H55A 4A1RA 4MVBD 2VRAA 4ORGA 2LV4A 4HQQL 3DNKA 3SY0A 1G4MA 1DVFD 1NCAL 5CGYC 4OSUL 3BKYH 2CPCA 1LNUB 1EJOL 3GBML 3B34A 5IV2B 1NEPA 4KOCA 3RU8H 1EIBA 3AXLA 3GGWA 5F7KC 5K9JL 1PZUB 1PD6A 4PLNC 4JVUA 2M2DA 3QNYB 4G6FD 4G5ZH 4LASH 3QJVB 3OVUB 5DL6A 3HE7C 2XG5B 3LXAA 5FF6A 2IMMA 1AZCA 5GPRA 5GSVB 3AS1A 1ETB1 1UWEL 3MPCA 2UZXB 2XLLA 1IL1A 1GMEA 1XBDA 3WMPA 3DK0A 3FK3A 4I0PC 4B53A 4PBXA 1ZHWA 2AK4B 1FCCA 2NXYC 3V52L 3ZZSA 5JXEA 2P5ED 4WW2C 2X4PA 3HB3B 1HILB 4AZLA 5TGBA 3X13B 1WO2A 2BVUA 1EBPA 2IBGA 3QC6X 3SDCB 1OP5K 1P4LB 2OMVB 3MRBB 1HSBB 1RVFH 3N04A 5ANMB 4PG2C 1IBGH 4DKFL 4ISVA 4X7TB 3D3VE 4PTTA 4XMLL 2Q6WB 3UC0H 4IMKC 1D5BB 1D7CA 1UC6A 3UIYA 2WM0A 5GHWL 3ZTJH 5E9DA 1U6AL 1IIKA 2BSRA 2GY5A 2ATKA 4LBEB 4Z3GA 1G7QA 5C8JB 1FHNA 2H32B 3K8MA 5DLML 4YFLI 1FSKC 2CO6A 2DYPD 2KZBA 2YRBA 4JPKL 5EU7C 5F6HI 3VUAA 1WQVT 3A4DA 4R83A 5D7LD 5EC2A 3DUUA 3U1SH 2GIMA 4IOSD 3IWVA 1KTBA 5TE4H 5A40E 3WLBA 4QCIA 1JGDB 3VXMB 1IT9H 1NDMA 5J1TC 1AFVH 1BYOA 4UTBH 4AIXA 4PGJA 2WUBH 2YSSB 4IBWA 2JXMB 3RDTD 4AYBA 5KVEL 2IH3A 3FO1A 2W60B 5FW8A 3MYZA 3BT0A 4ZMVA 4KKLC 1N2RB 4TUUA 2P5WB 4X5WB 4EVNA 2CDGA 4JM2A 4KXDA 1IGCL 1KYUA 1U8CA 1MAKA 2F8IA 3LSOA 3U4BH 4JR9H 3QQDA 3F12A 2DMHA 3P2TA 4HYTB 2O4VA 4HXBH 5TH2B 3K7UA 3W57A 4OFYD 1ZOXA 4KJWD 2F19H 4PCSA 2EO9A 3BUYB 5DJ0B 4PJEB 2M83A 2APVA 3BEVA 4IEFA 4UM9A 4BFIB 1P5VB 1BBDH 2F58H 3NDZE 3QIUC 3OPZH 4ONFL 3F6JA 1JI1A 4J3OF 5IVNA 5FHAL 4AVJA 3RJDA 3TM6A 4WU5A 2OXHA 3ULVL 3LXUX 2ICEB 4L5FL 5J7CC 1QBBA 2HFGH 1XX9C 4Z7NE 5JQHC 3FKUS 4GG6F 4IOIA 2PPCA 2WWKO 4N6RB 1AIFB 5EV7A 2G9HB 2WQVA 3GLEA 4DSYA 3B2DC 1A6VL 1OSZB 3D2TA 4YX2H 2PXYC 3CPUA 3MNDA 2GBAA 5EDSA 2WO2B 4XVUC 3U0PB 1P7HL 2KUTA 3L5XL 5FW6A 3IMBA 3P3RA 5DK0A 2CIKA 4KVCH 3CXHJ 3FFDB 3GEFA 4EIGB 3K8KA 4WHYH 2LTQC 1ZMYA 3CBRA 3PE9A 4P9HH 3QFDB 4YVNA 3L3DA 1M9SA 4WI0B 3BVTA 5B7FA 3UIZA 5HYFA 1T2QL 2R23A 3S3BB 1JTTA 3GTVA 1J0YA 2OMTA 4DVRL 2CJUL 3SYSA 4HUUB 2Y7SA 4XMTA 5HYJA 5I66A 4HPOH 1OCWL 1G7HB 1RIUH 3I9PA 1AYRA 2EJ1A 1K8IB 2H8PB 5KVFH 4EI5D 4A6YA 5LUMA 2EDKA 2ERJC 1RUPH 1CICB 3IJSB 3UTTA 4Y4HC 1O7DC 3PHQA 2J72A 2IWGA 5GGVH 4C55A 4MD0A 4F80A 1OSEA 1UOWA 1QVOB 4ODBD 2ZUTA 1UQSB 3GSQB 3UU2A 2ZOKB 3H56A 5AALA 5AW4B 1SFHA 3GRWH 2CM5A 3DBXB 2H2PC 3H54A 3PJNA 3QCTL 1S78D 5LXGH 3VD9A 1BFVL 3L2LA 1WS8A 3VGAC 1MRCL 4D0DA 5ACZA 4CN4A 2E7BA 3DIDA 5IB1B 1IGJB 4JCHA 1TVHA 1C5CL 3L5WA 4BSWB 3DV6B 5HGDA 4CC1A 3MR9A 4RGOL 1QBLL 2A74C 1U42A 5D7EA 3GWJA 1LP9A 4Y9CA 4OV5A 2OQJA 3GXFA 5CSBA 4YHLL 3B7TA 4FXLA 5DF0A 1AQDA 5EOTA 1DE4B 4MLSA 3QUYA 3CHPA 1YNTF 2J4WH 1DQML 4WGWB 4U1HA 4FTVA 1T21A 1U8JB 3RIKA 5HHMB 2WQRA 3W9DA 4YN3A 5DZNA 4BFFA 4UILH 5IESL 5CD5C 3ZDXF 3GFUA 2DQCH 1ED3A 3VZTX 1WZKA 5CGBA 2R9HC 3PHOB 2WXPA 2P44B 3KGUA 4XT1C 1LE5B 1EDYA 1UD6A 1YEWA 2N01B 3QJXA 3SGDH 1CE6A 3VU1A 2BPBA 1E4XL 1A6UH 1NSNH 2TSAA 4APQB 1F00I 3JWDL 4XWGH 2B4CH 1E9QB 2NY0B 1X4YA 2YS4A 4GKZA 1HINH 4TVPE 4MJHA 2PO6B 5JHDB 4WKZA 5JPNA 3MGTA 4PW4A 2JCCA 1HOCB 4O2EA 2ED7A 1DL7L 3CHQA 4XO8A 3KH3A 4ONOA 4S1RH 4UQ3B 3AS2A 3EYOB 3CZFA 3D9AH 3KYOB 3QJHB 4IBUA 4NO5B 5CM1A 4M8VA 2WTRA 5FLUA 3VFNB 3KCPA 4GRWH 4HFWA 2UZIH 3FCGA 1FN4B 1H3XA 4IQHA 2WINB 3OAWA 1H6EA 4ZOBA 4FADA 4D8PA 4WO0A 2YD2A 5HI3C 4UB0L 1OD9A 2BSSB 2ZOOA 5E6RB 3SY6A 4HA1A 4NZTL 4FJ6A 3HC2A 1JE6A 3KZIO 1RD6A 3KLAB 4ZFZA 4AEIH 1DBJH 4NLAA 5D4IA 2FBOJ 5DJDB 3EO9L 1OAYH 3OJMB 2UXVA 5KVFE 2VH5L 5BS0B 2DWSA 5FUOL 2GJ6B 3FUNA 3GMMB 1CMOA 2XZAH 4DGWC 2HT4D 4LCVA 1JF1B 2FJHA 3AAZA 2ZAIA 1Y1DA 1WGOA 4NN7C 2WLZA 5LCVA 3ML9A 3REVB 3U25A 3KGTA 4F7EA 1F3RB 3NEEA 3BH4A 4JHAH 1CFNB 5I74B 2V3FA 3PWPA 4XMKL 2YOAA 3NJHA 4MJ4A 1RURL 5CCKL 4LOVA 5ISZE 3Q2WA 4LF3A 4D0CA 2HKHL 1ZV5A 3BESR 4PGBB 3TEUA 4Z7AA 4KKCD 3DETD 4M61B 3IDJB 1G87A 1HKFA 4ZPTB 2ITFA 5ELIA 4AQOA 1G84A 1FL5B 3VFUA 1I1AC 1OSPL 1KELH 2D31A 1XVSA 3NIGF 1UEYA 3P77B 1P1ZA 1KENH 3O6ML 4NP4L 3QRLA 5TDOA 5EO0A 3VXRD 3LPGA 1ILUA 3BH8B 3MBED 4DKDC 1FVCA 4P2YA 4LCYA 3GHPA 3GI9L 4OIFA 2H26A 3E8VA 5JR1L 4PGZA 2Y07H 1W72L 1FFQA 5F9OL 2O6EA 1IZNA 3NACH 1U8MA 1GMIA 1A9BA 1IGIL 4YZWA 1A7PH 4O49A 5SWQB 5BXFB 3F7KA 3AAAB 2FX7H 3NFNB 4KRNA 1GXEA 1TMQA 2PPAA 5MI0B 5JIDA 1IM9A 1IO4C 5DUPL 1SHXA 2R1WA 1Z6JT 2X4TA 3CDZA 2CO3A 4HD9A 2M8XA 4AGOA 2VMDA 3KLHC 2CLZA 4GQQA 2FL5B 4X6DB 3RX7A 4Y5XB 4RMUA 3DX7A 4BSJA 4MNQD 5D1XE 4RGNC 5DJ8A 1LXMA 4OIBA 1S9XB 1IFGA 4NNPL 3GBEA 3MV7A 5K1JA 1CXKA 3L13A 4HHWA 5F96H 5HGAA 4QNPF 3V8UA 4AL8H 2BWDA 2RHEA 1J05B 3N85L 4Z7QE 1P7QA 1FYTE 3T3MB 4S11A 3ZDYF 5J6HA 3BWAA 1TCMA 5JQ6L 4NN5B 2X3BA 5HYSB 5FYLD 3BT2H 1EPFA 4X6CF 2A83A 1S7UB 4GKLA 4GT7A 4DN4L 2Z4QA 3HVNA 1H19A 4HJEA 2YPLA 3VQ2C 4P3WA 4N28A 5DWUL 3FU9A 4FDWA 4POUB 2R2HB 5I1AB 1BXWA 4IU3B 1YC8A 5I1IH 3T6XA 3EDDA 2FD6L 5C0AE 4M7KL 2HG5B 2DWDA 5CP3H 1ZLEA 4XR8C 4C56B 1ROWA 2CR3A 5EN2A 1WD8A 3DHJA 3T2QA 5JHBA 3LN4B 4YAQB 5KSVA 3S8WA 2GW5A 4R0LB 9CGTA 4ENZA 5FC9A 2VABA 1XH2A 3AG4B 3X3FH 4GS7C 2XYBA 5ADOL 2WGNB 5DZAA 2WNGA 1AGFA 3D8MA 3LOWA 4GPVA 1R3HB 3CFTA 3K46A 4X50A 1UT1A 5IF0B 5ADPL 3BX7C 1N70A 1TEGA 4I8DA 2XA8L 1GGBH 1RZKL 1KNOB 2BNRB 3BSZL 2Z35A 3ECQA 3KYNA 1RJYA 1XH3A 2YAQA 2GUYA 2ZYHA 1S7RB 1NFDF 4MTMA 1G5GA 3FYEB 3VO0A 3ZZLA 3S34H 1YEIL 1TQSA 1YUKB 4PWHA 5DQDL 4DPBX 4DP5X 3GF8A 2UY7B 4HWBH 4YDKL 2C4XA 1A7QH 1IAMA 5DJCB 2FB4H 2NW3B 3P3UA 3QORB 5AVYB 1KYFA 1ZLUK 1XCTB 4ANXA 4HGKC 3QDJA 4JVWA 5HHQA 1XGTA 5EU6B 1TSHA 1KFGA 5AW9B 2EXYC 1KOAA 5HP5A 2I69A 3SYQA 1MIML 4OLYL 5EZPA 4HOZA 4WWKB 2Y7QB 1NMBH 3D0VA 4YFLF 2WB1A 4RMQA 4PJ6A 5D2NE 4E9WA 3S35H 1XR8B 3VDCA 3VXME 3N91A 3PRZA 1F90L 2CDEB 2QZQA 3RGVC 1JXDA 1F11B 1CK0H 2GJRA 5IOPA 4PLJD 3IDNA 3MRCA 3QHTC 4P23B 5T1KA 5GRUL 1HSAB 4DAGL 4QY8B 3IXTA 4WSKA 43CAA 2V2TA 4LRNL 2CHWA 2I60L 4I1PA 2PYEB 3FB5A 3STLA 4TNWF 1AR1B 3NIFF 4AK2A 4OVVA 1L9QA 2X9ZA 5IEHB 1RY7B 4H2AA 1VJSA 4Z7UF 4ORZC 3QCUL 4R6UA 3BQUB 1PLGH 1TITA 4PWFA 4JQIL 2FT8A 4FLHA 1KSRA 4PJEE 4F58H 2MCAA 4LSUL 3DJZA 1JZ2A 1KPVB 4NQCE 1S4IA 1IBHA 2P8MA 1EXUB 3BGMB 3WI9A 4GG6B 5C0JA 4LVHB 4CUCA 2XKNA 4UBDD 1FL6A 3MCG1 5D1QA 1EFXA 2WQ8A 3SY9A 2I27N 4GSXA 2EIJB 3GRWA 4AY0A 4OU3A 3UAEA 1KYOK 4R26L 2X27X 5D93C 4AENB 3BJLA 1SHSA 2NTFA 4OLZH 1U8PA 1WEJH 1J0JA 4HSQA 1ND0A 3HC0A 1DJSA 2N7BA 1E3ZA 3FDWA 4B27A 3GI8L 3MACH 3BIAX 4HC1H 4QXGH 1JN6A 3NPSC 3D2UA 1Q0YH 2VDQH 4YBHA 4E9LA 4L4TE 2RCSL 4OUOA 2F1TA 4ATWA 4B3VA 4JQVA 4MSWB 4AKRB 3EOBA 1OGAA 2DQJH 1G9MH 4Y19D 1U30A 2CXGA 1M2OA 1IGYB 3DIFB 1MAMH 2XVGA 3UABA 5DQJB 5A2BA 3L4WA 5C0EA 4G6ML 4D9LL 2NY6B 5G4MA 1NGQL 5D9SB 5IKCA 3GS7A 1G6RB 4FQXA 4K23H 1XF3A 3EOAA 3VG0H 1J5OH 3PORA 2LLLA 1P4BH 4P57A 2X5PA 3LN5B 2DAVA 3BZEB 3SN6N 1N7ML 1J7VR 4KMTH 4KZDL 5I8CA 1WFNA 5F72S 3T3PB 1MJ8H 1LO4H 4YNYA 1R3IH 1HXMA 4Y5YA 4MS8D 5BV7C 4R90H 2XTQA 3D85D 5F7DA 1UA6H 2DWYA 3B8SA 4AM0A 8FABA 5C0CB 4NDMB 3GNMH 1NCDL 1UJ3C 5JO5B 4N5UA 3IDXH 5DD5H 1KV3A 2AI0H 3GD1C 5FM5O 5D1XA 4PRIA 3MRPA 4WTQA 4OAWB 5BJTA 4N1EA 5DLLA 4FXGA 4M1DH 3SQBA 3SZDA 2OW7A 2J57A 5HXMA 1EUTA 2EDDA 5H94A 1KCRL 3LKSB 4YUEL 3VRJB 3MVSA 5DI8B 1YYLH 1MFCL 3ETTA 5MEPB 3AU0A 3KDPB 1KGXA 1QFWI 3N5AA 4D3CL 1S3KL 2OMYB 4J6RH 4YNYB 4KKAC 5HHME 3ALPA 2X2UA 4LQFL 3RA7H 3S4SA 3IN0A 1SM3L 2VZVA 3HRZB 2JJTA 2CO7B 2A1WL 1GS8A 5BW7A 3RE0A 1PQZB 4BELD 1V3JA 1HQ4B 3EUUA 3UP1A 5EU4A 4ALAC 3TCTA 4QLWA 2FGWH 1XZ0A 4RMRA 3MDJA 1KBWA 1NEZG 4KX9A 1MCOL 4HCRL 4LFHG 2XWEA 5C0AA 3TA4D 3U7YL 3ZUCA 3LAFA 4ZSOA 2O5XH 3C5SB 1BX2B 5J3HD 1W8NA 5LNEA 4TVUA 3SDXE 3GPEA 1WFMA 2XICA 3W39A 1G7IB 1IZJA 2F53D 5INDB 3JBG7 4P5SA 3P2BA 1J0ZA 3O3EA 3WEOA 3JT0A 2NSMA 3BZ5A 1HH6B 5C08D 1CLZL 1CGVA 2F54D 3MREA 3B2PA 4XMZA 4F24A 4BFEA 2ENSA 2VLRA 3EF7A 4OFPA 1DVQA 2SEBB 4HIEA 2PW1B 4JFFE 4ZOCA 4G7QB 4YIQB 3G5XA 3U79A 3ZKND 3QJSB 3BUDA 3F84A 3GSXB 5JLZA 2BOBB 3AT9A 1SXCA 1GOHA 1UACL 3SDAB 1ORQA 1FNLA 3NJKA 4Z7WF 4OZFB 2YGOA 5ICZA 4NERA 4UIKL 3UBXB 4MJIB 1BXXA 3ZYOA 3PXJA 3ZQXA 1A6TA 2DICA 5HHNA 2CLRB 3ECUA 4F7PA 2QQNH 3QULB 1SDAB 4HGWA 3REWA 1AD9B 1MPAH 1VADA 3WFDH 5CGMA 3TP4A 4Z95H 1YJDL 5CP7B 2ARJB 3OBAA 4FFZH 3WFCH 2MCG1 3D09A 2H3NB 2Z31D 1OPOA 3KNBA 4PY8I 4QWWD 3C09C 3I2CH 4YZFE 3S5LG 1R4XA 4ORGB 3SY0B 2VSMB 1WICA 3NSDA 3QCVH 5T33H 3MO1A 4Z3FA 1AXTH 4A7UA 4IGBD 1UTDA 1COBA 2HH0H 3AXLB 3GGWB 5E7BA 5HI4C 4PIRF 3QJOA 2JKRM 4JRYD 3P73A 4EE2A 4P59H 3OLGA 1I53A 3EYSH 4ANWA 3VNZA 5I18H 4U1JB 3QJFA 4LMQE 4P2RD 2I32A 3NIGB 5B1JC 3TYGH 5LG6A 1MVYA 3QUXA 3GXPA 5KBLA 4UTAL 2IAMB 5IROD 1S46A 4DZBA 5I0XA 1GFMA 1CLVA 4LVNC 2X4PB 1MW3A 3VXSD 3LEYH 5I6MA 1MNUL 5B4MD 1LO2L 2KHAA 35C8H 3H2PA 4GAFB 2LHFA 1VDGA 2WVVA 5DVNA 2HJLB 4EZKA 4AT6B 5GZNC 3VQMA 3FB6A 1MI5D 3FQYA 3VQLA 4PTTB 4DERA 1JHTA 3ARFB 3DTUB 1JYWA 4L4TA 5F1NA 2VE6A 4U2YA 2X7LB 1ZVNA 2ATKB 3OKKA 1G7QB 1RU9L 5D7JC 2AQRA 5E6IA 1S5HA 1P84K 1OTTD 1GOFA 1DQDL 1Q0XH 5GGRB 4RMTA 1Q94A 3GB7B 3LS5H 3RWHA 4X6DE 2LFGA 3IU4L 2MOVA 3LHPL 3MODL 5T1MA 4J3WA 2FECI 2DRUA 4LESA 2AABH 4PJAA 2IH3B 1Y18B 4PRPD 3VAEA 1OP3H 3KVPA 2A0LD 2BP3A 5IJVA 4X6EB 4EVNB 2CDGB 4JM2B 1U8CB 3LSOB 5F6IC 4X6CB 2V7NA 2VAAA 4EQ3A 2AK1L 2EYRB 2FSDA 3QIBC 1ZHNB 1HU8A 2JI3A 3TO4C 5DZLA 5E99H 1FLRL 1K6QL 3MLRH 4OB5H 3BEVB 1MLCA 3K71A 1M3IA 5LBSL 1I7UB 5KANG 4PWGA 5C9KA 1T1XA 5F7LB 4NM4H 3UYPA 4X80L 3QG7L 1J0HA 1U8LA 2AJSH 4RRPA 3LIZH 1O7SA 2Y7NA 3ZSSA 2M07A 3EYUL 1XXDC 3BISA 3OKOA 1QRNA 4N90D 4UDTA 1GW0A 2Q2EB 3MLSL 4NKDA 4F7MA 3RZCD 2QMKA 2YMTA 3H85A 2O30A 2DBJA 3NN8A 4HJJL 2CRMA 5L4FA 2JLLA 3EJTA 3SE3A 3PY9A 4OQTL 1S9WB 2Y25A 3D50A 1OGSA 4MCMA 1HNFA 1TQCC 4MXQC 4PS7A 1K8DB 3KHOA 2XQ0A 3H4FA 1OAJA 5DK0B 2CIKB 5JTWA 3F3HA 3DO3A 3B9DA 3UX9B 4JKPL 1NFDB 1RZ7H 4YXLH 4A2FA 5J5EA 1KCUL 4QAWA 1DVFA 5B1AB 4DZ8A 1JNLH 3L3DB 3PJLA 4GXUM 4U3XA 3RTLA 1YEHH 5AWNL 4WI9A 5DJ6A 2BNRE 4GW1A 1JPGB 2BNQD 2OMTB 3ECVA 3VXUD 1QSFD 5E6YA 1W0VA 3JWDC 5HYJB 5I66B 1BFOA 1JHLL 4IRJC 4ILDA 4XH2A 3ATBA 1GJIA 1HHHA 4BZ1H 3K6NA 5F9JA 5BUPA 4H26A 3ZR5A 4A6YB 1BQHA 1EXGA 5CCHE 1Q9OA 4J8RB 3UTTB 4E1TA 3X12A 3FXIC 1A9EB 3FO9A 1AHWB 2VN7A 4MD0B 2YEVB 2W80C 3EH3B 4I9XA 1JGLL 1JYNA 1KMGA 2NQ3A 3WLWC 1E5CA 1RUQL 5JHLH 3D06A 3QDGE 4WU7A 5MERA 2YJQA 3VG9C 1A5FL 1MFAH 3ENEA 1MCWM 2P5EA 4D0DB 1KULA 4JREC 2QSCL 4E9XA 4I2XA 3QPKA 1TVHB 2HVKA 1ZLWK 3L5WB 4PWKA 2Y7MA 3HZVB 4XPHL 3GLAA 4CL7A 3OXRA 3PQSA 3BAWA 4HC1A 1LP9B 1BJ8A 4XXDB 5FYLH 1EAPA 1GAFH 4OV5B 3UAJD 3S36H 1DDHA 2APSA 1ZIBA 2OQJB 3CVHL 4XO4A 2E7DA 2FX9H 1P7BA 1XZWA 4DN3H 3NIFB 2X4NA 3DECA 5EOTB 2L3BA 3OC5A 3WTVA 3QUYB 3Q1EA 4Q2ZA 1PZ3A 3B4NA 4U1HB 5AFUL 4FTVB 4GXVL 1T21B 4JJOA 3D07A 5IVXF 5DL7A 2DYPA 4ANVA 4W9IC 5D7LA 1E3FA 1MRFH 1ED3B 2DYSB 4IOSA 1MH5A 2KLSA 4BK4A 1WK0A 3MBXL 4MXWH 3D33A 2WD0A 4NQDA 3W3BA 4JMXA 3RUGA 4GG6E 3HW7A 4Q9QH 3UH8A 1EMTH 1GC1H 3RDTA 5D96C 1FPTH 4TVPL 2HT3D 1TO4A 3Q9QA 1QKZH 4M3JA 4KXAA 4GO9A 3T0ED 1FORH 2C7UA 2YA1A 3MRKA 2J5LB 2HFTA 4GKZB 4OFYA 2HFGL 1T0OA 3BDYL 1AQMA 2CHXA 4I7ZC 1U8HA 2BFVH 5F88A 5I5JA 3MNVA 3STZA 1N64H 3MGTB 3UP6A 1F5WA 1ZHKA 4GQ9L 2JCCB 4O2EB 5GGUA 5I16A 1M4KA 5E7FA 3ZTCC 4WEBH 5JIQA 2X1PA 1E5BA 2F7OA 4G9FB 2R88A 3CZFB 1R33A 2XA3A 4MLIA 4FZMA 1JXJA 4YDIH 4OI7A 1F4YH 2WTRB 5AAWC 4B9IA 4HFWB 3ZKXC 5HDWA 4O3ZA 4H88H 4P2OC 3WHE1 2ZUWA 5CEZE 2JSFA 3N1GC 5B8CC 5C09B 4LEXL 5DR5L 3UZVA 2W95A 2VC2L 1ET5A 4OFVA 4ZFGH 1OLLA 4L9DA 1BREA 1JZJA 5BPPA 2XBDA 2GVYA 3OJ2C 3TX4A 1PG7X 3B3BA 4P49A 1PDKA 1NM4A 4BCXA 4HUCA 2FJHB 2Q76B 3AAZB 4EI5A 4B9CA 3NG5A 4ZOAA 1FFRA 1ZK5A 3L4TA 2BIIA 4IBQA 2CCWA 4Z7VA 4C4KT 3FT0A 3QEQD 3ULSA 4QLRA 4JPVL 3IPBA 4FP8H 2E6JA 3PWPB 1R3JA 3ZDXE 4XXWA 2P7TB 4LRIC 3AWEA 1PZCA 2PPDA 4Y5VA 3H9ZA 4N22A 1RZ8B 5E4AA 2YKKA 4LF3B 2BJMH 4X7FC 2IQAA 4D0CB 5LGJB 1UKTA 3LPPA 1R5VA 3UAQA 1JRHI 4KRAA 2GFBA 4DGIH 1HI6B 5F70A 2K8MA 7PRNA 4PRBB 3VFUB 4XNXL 3E1ZA 3RB5A 4AXWA 1FBIH 2AMGA 1P1ZB 1BLNA 1I4FA 1B0WA 1EHKB 3VI4A 5FXCH 5EO0B 5TDOB 4E0RA 5DJAB 1CS6A 5CS7A 2OMWB 3HUJA 4IIQB 1FVCB 2OMUB 2VRQA 1INDH 4FFZA 4LCYB 1CB4A 1YDPA 1NCJA 3BSHA 3C6LC 2YMXH 1SVCP 1TKWA 2OS7A 2CKBL 2MHAA 2NY1B 2Y24A 1GCYA 4AYMC 3UZQA 1IZNB 4YC2B 1TOXA 4XGZA 2HRPH 2NSQA 5HYQA 1IGMH 2ZZUT 2XQYA 1A6UL 1L9SA 2ZF9A 1A9BB 1DFBH 1NSNL 1RZKC 5E1GA 4BSVA 3X11A 3QDHA 1YPZA 4S2SB 3PWUA 5I6XC 2WIIA 4BQCA 1IM9B 1LQSR 1HT6A 1CFTA 1T7WA 3V5DA 4OI9A 4Q74A 2R1WB 3ASNB 5DJ2B 43C9A 4AQ8A 3GBNL 3BYTA 4BH7A 3MLTA 3MBWB 4L1LA 4D65A 3APFA 3FQ4A 2BIPA 4NQEB 3PL6D 4UINH 1PSKH 3DX7B 4R2GD 1HKLL 1T5WA 1A2YA 3ZW3A 2W9DL 1VGKA 3TJHD 3I74A 3QQ3A 4CU7A 4RDBA 1TETL 1ASPA 3SO5A 5HGAB 4K5LA 1N12A 1ZWIA 2W38A 3RX9A 1P7QB 1SOKA 4C57C 4WTWA 2R56H 4EOWH 5J6HB 4UAHA 5AD0A 3BWAB 3QJUB 5ID1B 2KQMA 4QI3A 2NY4C 2C3XA 3VGFA 5LGHH 3H9HB 3ZK0A 4JO8A 3TVMD 3FU3A 5HYSG 2A83B 1U91A 3L7EA 2LQRA 3PWLB 1BSIA 5CZXD 1AQKH 2R89A 1MHPL 4HD5A 5GGTL 1VEMA 2YPLB 5HJ3A 2FYYA 1DBJL 3A6BH 2XN9E 2MFNA 4HJSA 2EH8L 4YHPA 5A1AA 1PEWA 1RK1A 2DWDB 3QBTB 3HMXL 2YD6A 3CH8A 1VEOA 4HU2A 3V0AC 3IDYC 1T2JA 5IMOB 5KSVB 2XPGB 1BQLL 1O6SA 4WJG3 2VABB 2E7HA 3N0PB 1HH9A 3NA4A 1WITA 4RWHA 1E4JA 5K9QI 3NIGE 4FULA 4GRLD 3F62A 3VACA 4N2DA 3LNHA 4WZ9A 5I6KA 2WXMA 4JDEA 2XVLA 4KUZL 4AWJC 3ML8A 2UXTA 3JWNH 2Z35B 3KYNB 5D71L 4B9JA 1RJYB 1XH3B 2CHZA 1I3UA 5LBVA 5DSCB 1C16B 4MNGE 3QRGL 1BQRA 2XFXB 2X2JA 3VB8A 3O8XC 3VI3F 1EHLL 3HBZA 4F33A 1JP5A 2GK0A 3BE1L 1Z9NA 1Z5YD 3PS6A 2HWZH 4EZJA 4JCMA 3JV4A 5AVVB 3PG2A 4KRPB 2KYIA 2NT0A 3HVDA 3LIZA 4LLVB 1NIAA 5INCB 3IWUA 3QDJB 5HHQB 3JTSB 1XGTB 3T4YA 1H0DB 2Y07L 2X9YA 4Y19E 5EBLA 1JD9A 3L45A 5DEGA 1S7XA 1GFNA 3E2HB 3NACL 1PJ9A 4ES8A 2C9UA 1UWYA 3VXRA 5B66O 3MBEA 1KGCD 4MGXA 3D25A 4OCSL 4QNPE 1NOLA 4HT1H 5M7QA 3WI4A 4Y16C 5CCJA 5IOPB 4DVBA 3IDNB 3MRCB 3ZDYE 4MMYA 2GTZB 2Y1VA 4YJZL 2QVTA 4JN1L 2V2TB 2HXAA 4OTXL 4X6CE 3QZWB 4NPKA 4BWWA 5CJQH 5EFIA 4KVNL 3DTXA 1OY3B 4KJYA 3GKWH 3F5WA 4ZAKD 1I1YA 4ODUA 2DQHH 4CVXA 3HNVL 2ICES 2P8MB 3DDFA 4Z18A 4JHZA 3WKQA 5C0JB 2XKNB 2MEJB 4MNQA 2Z7YA 1YNTA 1FL6B 1EFXB 2DYRB 3W0WE 2D4FA 3WEBA 1S7TB 2E27L 3NK3A 1YO4A 1AMYA 2NTFB 1ET7A 4LDEB 1U8PB 3AM8C 3NZUA 5EZOH 1ND0B 3HC0B 1CFVH 4JFDE 4PHXA 3IFNH 2B39A 2R2EA 2X4QB 5DJZB 2QHLA 1WD9A 2BY3A 1PTZA 1KXTA 5E2UH 3D2UB 4BZ1L 4WFED 4LSVH 2IPTH 4R4FH 1NCBH 3KPNB 4MQTB 1T0PB 2C1OB 1NFDE 1FGVL 1OGAB 3TA3C 1DBAH 2BS71 2K3TA 5B39A 2QVIA 2NSXA 2WXKA 5FYKE 3M8OH 4IK6A 4Q6YA 1NAKH 5C0EB 3JVGC 3NCYP 4YO0A 5L4MA 1MFEH 1H3WM 1NBZA 3TWYA 2J8UF 3CK0H 5IKCB 4HEME 1FH5L 2DJSA 2XOTA 4FQXB 5AL8A 3EOAB 4K94L 1C7TA 3RPBA 3AZUA 1GGBL 4QGYA 4YL4A 5D1ZC 3U9WA 3QPXH 5LQBH 4I77H 3HKZA 4CW1A 4WI5A 1AXSA 2F53E 4P57B 4KI5C 3L1OH 3WTUA 5I8CB 1WIUA 2EP6A 2EAEA 2QTVA 2LT9A 3MA7A 3PABB 1QNIA 2BOCB 4Y5YB 2ZE0A 2RR3A 4GH7B 1E40A 5CWSA 5LLIC 5F7DB 4ZNCD 1XGPA 4AM0B 3N42B 3FHQA 5ID0A 1KYAA 2WLJA 3OHXA 4EBQH 1HCZA 3G5VB 4M48H 1QWNA 5K33A 4V1DD 2AEOA 1KWGA 4PRIB 2YXVA 3KL0A 3MRPB 3EKCA 3DPBB 5GGRY 1T83A 2QGDA 3CNKA 1BIIA 3QUMH 4YDMA 5EBGA 5BJTB 4WO4C 2EZ0D 1HE7A 3VWKD 2MPAL 1T0NA 4Z7UE 1EGJH 2OZ4A 3OMNB 3WUZA 4JRXD 5K9KA 1A7NH 3ZTNL 3X1NA 4JKNA 1MDAA 3FJTA 4BWTA 2EIBA 2NX5D 5KBNC 3QG6A 3IFPA 2EABA 1BBJA 4GRWB 4Z3EA 2W5PA 5AFAA 1MCPH 1F58L 2DQTH 3CH1B 1PY9A 4UV7H 5K1NA 2IF7A 1BJMA 4O02H 1OF2A 2Y0SA 1OGPA 2AJ3A 1XZ0B 2CR0A 2O61A 5I1EH 2JKLA 1DBBH 4ZSOB 3MLWH 3LK41 2H1LM 3MSPA 4LSIA 2PN5A 4P0DA 4UQIM 5T3ZE 4JGMA 3ABZA 3TZVD 1CIUA 1BMGA 4HJ0D 3W39B 5I75B 1EEYA 5FO8A 1HE8A 2IPUK 5F0MB 1IE4A 4ZMLA 3BGFB 3O3EB 3WJMB 1E5YA 2XACC 4R7XA 4U0QB 3BP6A 4GKNA 3MREB 1C5DA 1FF5A 2VLRB 3QC5X 3HE6D 5AVQB 1G1YA 4HIEB 4LSFA 1A4KA 3G5XB 4UOW0 4MCZB 5L0QC 3TONA 2F8XC 1KTJA 2NY5L 3A21A 5JLZB 4JM0A 3HW9A 3HLAA 3NZHL 3GXIA 3C8DA 1ORQB 4C54A 4NO0D 5ICZB 1B4JL 1TEFA 3OMZA 4Y4FD 2Q3XA 1ZT4A 3O9WC 1IFHH 1NMCB 4F92B 1FZJA 2EE3A 1A6TB 3UBXG 1A4AA 1MI5E 1BVNT 5HHNB 4F7PB 1CD8A 4LPCA 1K9TA 2CO1A 5H2FO 5E4EB 1Z5LB 3SPCA 3WFZA 5C0GB 4HGWB 1U8OA 5C09E 3REWB 4LCCC 1VADB 1J1XH 1HTYA 1XSIA 4NRZA 2ZSWA 5A2FA 3HI6L 4TTDD 2VMJA 4PREA 1SLXA 2CAKA 1SFDA 4WK2B 4GXUN 3ZZ1A 1JZ7A 2OK0H 3KNBB 3V4VH 3EFOA 4FA6A 4K0OA 1OE1A 2AKRA 4K3CA 4NKMA 4OY9A 1YG9A 3B2XA 2P1YA 3FTVA 2P5PA 2JQAA 3MO1B 4WJKB 2OFQA 1V7MH 1A1OA 2BDNH 4R8WH 5IB4B 4O3YA 3LRGA 4PPTA 4U1MA 5ITBH 3CZJA 1F1DA 4K3EL 1NICA 3MXVH 1LDPL 1MSPA 1IC4L 2NZ1A 3CVIL 4P46D 5I1LA 5KZCD 2JI2A 4BFNA 4Z78A 3CLWA 5L8KB 1DVTA 2YAOA 4DPAX 3TYFA 4ZW5A 3BLPX 1BXUA 1ZLSH 4A66A 4OT1L 4O9HH 3QJFB 3D85A 2Z0BA 1MJJA 3FFCD 2X0VA 3GMOA 5F21B 3HG3A 4N2LA 3B56A 2BOLA 4PVBA 1IKOP 3QEUB 1DN2A 4JCLA 1QQDA 3EF4A 3EYQC 5AZEL 5B1BB 4DZBB 5BRZD 2N1KA 4QRQA 4I3SL 1ZHYA 3LKQA 1JV2B 3PDDA 4N90E 4NZUH 3BVDB 2CD0A 3HE7D 5DD6B 3U30C 1G7LB 3QUHA 3DWTA 4PR7A 4MCYB 1NLDH 1U8QA 4G6KH 4MA7H 2APBA 4JG0L 3VE0A 4I0PD 1JHTB 3SKOB 2JKNA 2KI6A 2NXYD 2VE6B 5C0RL 2JNZA 3FSWA 3WO4C 5L9DH 5BQ7B 3OKKB 2NCMA 3P30H 2NXZC 5E6IB 4HAFA 1F45A 4JEGB 1S5HB 3K6IA 4Z7WE 2CWRA 2EXSA 2IANB 4I87A 1QSFE 2A4EA 3RWHB 3WIIH 4NQEE 2Z8RA 3IBOA 4PRNB 3WKPA 5T1MB 4JPQA 5FYKU 5AVXB 1W91A 4H2CA 4ELMA 3WUWB 2RJMA 4NGHL 5IJVB 2OTWA 5CBEA 2XT1B 2EE6A 2TRHA 5C08A 1YN6B 1A3RL 2DQGL 2F54A 3EXJA 2V7NB 2VAAB 3EJYD 1I1FA 2A9CA 3Q5OA 1UWFA 1GKOA 2JMRA 5AENA 2WPGA 3FTUA 3IJ8A 3L48A 4WWID 4ZG1A 2J88H 2WVTA 3CHOA 3KWWA 4APXA 4XZUB 1MLCB 3K71B 2ED6A 5D5DA 1T1XB 1SMOA 1K4DA 2B59A 3AGWA 3U6RA 4ATTA 2PWDA 1KY6A 1U8LB 4KKLD 1VACA 1X5XA 4U1NA 3MJ8A 4UDTB 4WFHD 3AT0A 4NKDB 1E6JH 1URLA 4F7MB 5I19H 12E8H 4FI7A 3PP3H 2VR9A 5DC9B 2QADB 3MJ9L 1TFHA 3EBIA 1JCKA 4QRSA 1OTUD 4PS4L 1D5MB 1ZTXL 1VFBA 3CGTA 3PGDB 3QIUD 4R4BB 1TZGL 3WN6A 2OXGA 3TV8A 5A6MA 4GAJL 4DZ8B 1DVFB 2YR3A 5I18L 1H6TA 4UOJA 1OW0A 4E5XG 2WIMA 2HJKA 5DJ6B 2HRHA 4GW1B 3WY3A 4NHUB 1IEBA 3BZFA 4BH8A 3RNKA 1I82A 4JRYA 2RQEA 1BFOB 3B83A 4AE1A 1HHHB 2DL9A 1A4CA 1TPXC 4H26B 4F91B 1BQHB 4YE4H 4ZMOA 3R4DA 4FQHA 2BP0A 1Q9OB 2XXMB 1KXVC 3X12B 4PYGA 3FO9B 1UD4A 3ARWA 2OX5B 5ENWB 4OGZA 1S7SA 4PB0L 3SGJC 2FR4A 1YECL 4P2RA 1UA7A 1LK3H 1M1XA 3QZMA 3UZEC 3S2AA 4A04A 4WU7B 3FOMB 4XBGA 1IBBA 2VISA 2VXQL 5IROA 1ZA6B 5ICYA 5CAYB 4FYTA 4D9QD 4CU6A 5LGKA 3VXSA 2HVKB 2V5TA 2XIDA 1MFUA 3KJ6L 3OXRB 4Y4HD 1IEAA 5DS8A 1I8MB 1EAPB 4L0ZA 3PV6A 1DDHB 5DO8A 5I76A 3HC4H 1T04A 1MI5A 1QBML 2X4NB 2ZYRA 2FH8A 3U7AA 2B9BA 5FKPA 1QZ1A 1OAKL 5CJXC 3UG5A 4Q2ZB 2D0FA 3VA6A 1A4JA 3ZQ9A 1YMHA 4X7SH 3X2QB 2AABL 2W88A 2AEQL 1BEYL 5D7LB 4EMZA 1MCBA 2X4SB 5DXWA 2P46B 5TD4A 1OZUA 1MH5B 2J43A 4NZRH 3SE9L 3MCKA 2RACA 3VFGL 2OI9B 4NQDB 4CMHC 2WJ5A 3DMMB 1SUJA 5E5UB 2VAJA 4PJ8C 3RDTB 2FWUA 3KPPB 3SE4C 1FAIL 4PRPA 5J12B 3D39A 5EC1A 4YXHL 3ZU8A 3WN5C 8CGTA 4RL9A 3QEQE 4I5BA 3K2IA 4HIQA 1PKOA 3SDDD 4HLJA 5JNYB 2YRZA 5CD5D 5DD1L 4ZYKB 3HAEH 1SNRA 2L7JA 3HG2A 3MRKB 4N86A 4N8VG 3UCRA 3MRQA 3EJUA 3H6AA 1I9IL 4G6JH 1U8HB 5F88B 3MNVB 3ET9F 3QUMA 4HULB 1ZHKB 2IMNA 2J8UB 1DQIA 5I16B 4OD3H 4E68A 2H3KA 3B2VL 4M3KB 1G6RL 2ZX6A 4TLSA 2D3VA 4WV1A 1CD9B 5H4YA 5CILL 3RQ3A 3QXTA 2GBTA 4NFBA 2FZ3A 3B8YA 1SJVA 1U9KA 4ZNEE 3BAEH 3RZCA 4GLRH 1KFAH 3BUBA 1DANU 5CEZL 1OARL 3WIFA 1FNAA 2X6CA 4KROB 4D2NA 3WOVA 4NI3A 4PCTA 4LEOA 2E7CA 1K5WA 3UERA 1NPJA 2JKJA 1O75A 2X9XA 4NWUL 3FTWA 1J5DA 2P4AB 4O02A 4WTZA 3S88H 1O0VA 4L8SB 2WXQA 1XDTT 3ALXA 3H9SD 4DKTA 4BD4A 2K4WA 2VXSL 1FNSL 1OXYA 2AJUL 1N3NA 2OM5A 4MD4B 3UTOA 3SBRA 2BNQA 2EINB 3L4UA 4FLQA 3R8BB 3VXUA 4ODSH 1QSFA 5FWRA 1EH9A 2OL3A 2VZTA 1PDKB 1ZIAA 1IGFL 2B15A 3HR5A 1Q0EA 4UI2A 4EI5B 1ZXQA 4LCUA 5HI3D 2EEXA 4AEEA 4OF5A 5FO7A 5A2KH 5GS1A 3O0EA 4Z7VB 5IVXE 2VXUH 4PJ5D 1U8NB 3ULSB 3DA4A 2EXWD 2XNAA 3DXAE 1R3JB 5T5NG 3LN9A 3QQ4B 3IJYA 1B88A 2WWMD 4ECNA 1HEZA 2BWQA 2IQAB 4FQ1L 1R5VB 2GFBB 2NY2D 4PY7A 4E42A 4UQEA 3S3PA 4PJDF 1ZT7A 4Y9FA 3UPRA 1QABA 1LEKA 3IFLL 2Y0HA 3C2AH 3UAJA 4AXWB 4PSRA 2EIKB 2QV4A 1BLNB 3VI4B 4E0RB 4NEHB 4P07A 3OAYK 5GGVY 1UUNA 5IY5B 1QMUA 1AXIB 2I85A 1UM4H 5T1DH 1AKJA 2FH6A 3TIDA 1KGJA 1YDPB 2ZG2A 1JMXA 2Y72A 4R7DA 3V4VA 4M8UA 2MHAB 4XTRC 2E9IA 3H3PL 3UZQB 3HB3C 1HNGA 1ZHBA 5HGHB 3SDCC 1I1AD 1AZVA 1A0QH 3KVQA 3A4AA 3CXFA 3V4PH 3X11B 5I1DA 4MZRA 5CZVL 4GI6A 1YPZB 1HHKA 4OJYA 1UZGA 2XZCL 1S8DA 3WDHA 5DDHA 3V5DB 2VIRA 1VENA 43C9B 2GITB 4BFJA 4BH7B 3MLTB 4PSPA 4JFHD 2QZ5A 2BHYA 3GMRA 4LQ1A 3GSVB 4M6NL 3VM5A 2AZUA 1Q1JH 3R7QA 4Y2LA 4CADA 3QQ3B 4O2CA 2P3YA 3E0GA 3T0EA 2P8LA 1KTDB 4KUCF 1U41A 4KJQD 3BP4A 3MRFB 1ZWIB 4OCWL 3KYMA 5A2LH 1ACYH 2X70A 2PP7A 2LFUA 2I7SA 5AD0B 4FQLH 1K2DA 1N0XH 3NRPA 4S1QL 1U3NA 2X87A 4J3XA 1HYRC 1FRGH 1J0KA 5DYOA 1U91B 3L7EB 5AAPA 1KTCA 4QHKI 3GXNA 4U1GB 3QUGA 5IOKA 3DX6A 1TJGL 2VDOH 3ZE1F 1AYOA 2FYYB 4FYRA 4Q9CA 4D7BA 3ZTJG 1IKFH 3T2LA 4EJ1C 4YHPB 3ELQA 1RK1B 4DK3A 2JWYA 2BRRH 1DO6A 2GABA 4HXAL 1YEEL 4AG4H 1LILA 3ULUF 2B0SL 3MRHA 2V37A 4NBYB 4RBPH 4BEIA 1GSMA 1J1PH 1KN2L 2WOYA 4X6BA 2VDLB 2A3TA 1HH9B 4UZUA 2D3JA 2ICEC 3Q06A 1BQUA 1J9SA 2DM4A 4XPTL 2UWEA 3O6LH 3FRUA 4YLQT 2ZYIA 1ONQB 4FP8L 3BD3A 4JE0A 1VF5C 4NRYB 3FH7A 4XP1L 3WJLC 3MZTA 1NCGA 1A65A 3B9KA 3I50H 4ERSH 2B8OT 1XCWA 2AEPH 3BEWA 3DX1A 3FTXA 3IE9A 2Y06H 3V4UL 3U7WH 3FN3A 1KLGB 3GS0A 3WXVL 3D12B 4EN2A 1MCFA 5KJ7E 4YR6A 3DSFL 3FHEA 1O9VA 2IGTA 3GMQA 4JPIA 4RAUA 3A6OA 4A67A 1VA9A 3IETA 2DOCA 3DVIA 2V3EA 4F33B 3NH7H 2GK0B 4LLDA 2MNUA 2ZCHL 2LU7A 4TQ8A 4N9GB 2Z93A 3CHXA 5IHLB 1MCDA 1M7UA 4L2YA 1QSED 1CURA 4WFEE 2AJZA 3RKDD 5CEXA 4E36A 2ORBH 2GE4A 4LAQH 4ZMNA 3LEXA 4Q6IA 3RTQD 5D7SL 1H6FA 1CICC 1V3KA 3ATDA 5I6PA 2X0UA 5DEGB 5JXAL 1S7XB 3CPLA 4PRHD 1EUUA 4J27A 2K7PA 2IANE 3RFRA 2LU4A 3Q1SL 3VXRB 4K94C 5I9QB 5BRPA 5I6NA 4NUGL 5L7XL 3D25B 2FWOB 4G3YH 2WO4A 4CVZA 2X4UB 2BLFA 4CA4A 3RL1A 1A66A 2FX8H 3SB3A 4DVBB 1QFUL 3L9EA 4B9FA 2A6KA 3SD5A 5EZJA 2ITDA 1OAXL 4WHYG 2EICA 5JPMA 4LCWD 1NCTA 3HNTL 1HEHC 5LVEA 4U6TA 1NCWL 3WTYA 3JYCA 2DLHA 3HS0A 5EFIB 2KZKA 4CRPA 1YYMH 3ZL4H 5J1SC 4GLRI 2VZOA 3WKMH 3AW5A 3F5WB 4U49A 4AKPA 4BZYA 4RFOL 4GSRA 3JZ7A 1VPOH 4V1DE 1OHZA 4MNQB 3ZRSA 5JDSA 5C7XL 5IFHL 3HC3L 3RY6C 1JGVH 5FUZH 1S2EA 3QXAB 4GIAA 2LFEA 4S10A 5IBUB 2AJYH 1U3ZA 4JRXE 4QHMA 5FDYA 3NPZB 5K9OA 4OD2A 3QRAA 2NYYC 3Q43A 3SYPA 1B3JA 1KXTB 1A22B 2R0WL 3MV9E 4WK0B 4J4PD 5FYKL 3WIHH 1Z32X 1LMKA 3C87A 4E1SA 3HCVA 3Q2NA 2PWEA 3TVMA 4APQC 3SE8L 6FABH 1F2XK 1KGWA 5KTEL 3ZE2B 5KBKA 3BPCA 2A9ML 4IRZH 2NY0C 1ZRUA 3KLLA 2X3AA 5MEQA 1U36A 2AV7A 2EC9U 4MDJA 4YFDB 2BERA 4K3JH 4XVSH 2B2XL 2WSKA 3VI3E 1OHQA 2FO1A 2PO6C 3P11H 4NO2A 1NBZB 2N3JA 5E9NA 5HDQL 3KL5A 3WGVB 1EAJA 4RNRB 1FG2B 3U4EA 4JHWH 2G5RA 4EDWL 4K7PL 1I3VA 5A6LA 4ZQKA 3MLPA 1HYSC 1XL4A 2VTFA 1MOEA 4H8UA 4CW1B 1AXSB 2K6WA 1Q72L 4KY2A 4LSTH 3CSYA 1DJZA 1JWMA 3DUSA 4N8CH 3L3OA 3L4XA 2VDML 3LRMA 3TBSA 4M1GH 3TEYA 4GRLA 3AGVA 4ZX3A 3WD5H 5DD3L 4CN1A 2NY5C 2WV3A 1DQLH 1XGPB 3GSWA 3SIKA 4LSRH 5ID0B 3NTCL 2H1PL 1BXVA 1KC5H 3OHXB 4XC3L 4DEUA 4NKQB 3VFVA 2R7EA 4M5SA 4RMWA 2KC0A 3HAEA 3CX5J 3U9PL 3SPGA 1JGUH 1MZYA 3S37L 4ENEC 4HPYL 5DMIH 5IM7A 1BIIB 3I02B 1M05A 3SGEI 1ZPUA 3DYOA 5H4ZA 5CU5A 4GG8A 1ML0A 3I6SA 1T0NB 3DTDA 1KCVL 2IVFC 5D7KD 2GSGB 2R4SH 5FGCB 1NFIB 2YRPA 5DUML 5EIVA 4FQ2L 2FQEA 1AACA 5GIRA 2BXZA 4XN1A 5GTIO 2R0ZH 4MD5A 4FQJH 1BAGA 1BBJB 3K80A 2F1BA 5FAAA 3ILQD 2BO0A 3S4SG 5J57B 5J11B 5HJBA 3ES6B 2G2RB 3LK3A 4IJ3B 5E2VH 1EQWA 5I74C 3LQAL 4OZIA 2BHUA 3GRBA 5K39B 2H5UA 4MB1A 2P49B 4NAQA 4AYGA 1KGIA 2AJ3B 1DSFL 3VD2A 2HRGA 1BIHA 5EZIL 3NJTA 5T3ZL 2ZD0A 3CZKA 4FQIH 1CFMA 3OB0H 2EXTA 3H53A 3TV3L 1WWWX 3IK2A 2FO4B 2WB7A 3O0RL 3SKUD 5CMAB 4D7PA 2X44D 1ACZA 5SX5H 3AS0A 1EEYB 3C8KA 3LNIA 5FO8B 4KXZI 1NCCH 3UFIA 4MJ5A 5AOLA 4PJBF 1M3JA 3BP6B 4JG1L 4GKNB 1NBCA 1C5DB 5AW5B 5CLZA 4ZAKA 1NEUA 3MKGA 2J8UE 1G7MA 3OJDA 5IJBC 3MRMA 4X9GA 1GTFA 1A4KB 2YFNA 5I28A 3K2UH 2J1XA 5GJTH 1ZA3A 4NUQA 1AIZA 4X7DC 2FSEA 4GKOA 2IPTL 1DBKH 4XCCH 1L9RA 2QV2A 4HWEL 1QBAA 4JO2H 1QUNA 3H0TA 5IG7B 1ZT4B 3FO0L 3EO1A 1FZJB 5MI0C 2OBGA 5J4MA 1CXIA 3QEHB 4JHBA 2AGJL 1YEJL 1DTUA 4WHDA 4DKEL 3H7BB 4G9DA 3T4AA 4AIZA 4TN9A 4Y5XC 3GHBH 4NRZB 2ZSWB 3O3UN 1I9JL 3U48A 3QPXL 4RETB 3IRPX 4G8IB 5DZ9A 4IM8A 1CR9H 2AQTA 3EFOB 4KHTH 4G83A 1HWWA 3GPSA 2C4FU 1JWSA 4JY4A 1JXGA 1DANT 3PJSA 2A73A 3MLVH 3P2DA 3WE6A 3FN0L 1A1OB 2ADGB 1J9RA 1O9ZA 4U1MB 4MQXC 5D1ZI 4NN5C 1ZLVH 3V4PA 3D69A 3JTYA 4OJFL 1P53A 3MGAA 3JV6A 3BJ91 2LGNA 1CIDA 4NQSA 3RWDA 2UVEA 2VDNB 4F57L 2BIQA 5I1LB 4L9LA 2DLFL 1NANI 1X3DA 5EU7E 5FLVA 3TYFB 1RJLA 1WIOA 3II1A 4W4OC 1LEGA 1WTLA 4PJDB 4WFGE 1IILE 3GJFK 1LD9A 5HTSA 5C0FB 5E00B 5AKVA 4H7VA 5J0BA 3GMOB 2HMID 3B5HA 3KBFA 3O3DB 4V1DA 4QRQB 4DP9X 3LKQB 4R0LC 3CD4A 2VDPB 2HT2C 3VWKA 4WFHE 2FIRT 5DVPA 1YN7A 5DZPA 2F1VA 1L3NA 4AQAA 3NCBB 3DRQB 4JRXA 3FQUB 4H20H 1ZHLA 1U8QB 4C83A 1HL8A 2H41A 1L9TA 3VE0B 2UX7A 4F9PA 2NX5A 3VA2C 5TE7H 2DQEL 3ULVD 5DVKA 2E8ZA 4QR7A 1EK3A 4XNQA 5AKSA 1SOXA 1TIUA 1CL7L 2ZWLT 4P5TA 2ZKHH 1HJCA 3TIEB 1HC1A 3O11A 4XP4L 1T3FA 3VI3A 2HFEB 1RIVL 1UKQA 3FSVA 2XETA 2OR9L 3QORC 4BGDA 2DQDH 5E1AB 3UTSB 2Z7WA 4F7TA 2VCOA 3TZVA 1QFPA 4ELMB 3LY6A 2VQ1A 4JDTL 4WWKC 3Q6FA 5C0DB 2OTWB 5SWSD 5CBEB 5PCYA 1G4RA 1L9MA 2F54B 3EHBB 5C08B 5CUSH 1QLRA 1I1FB 2WXIA 1I1CA 2FATL 1L0YA 4CSSA 5IJKC 4OGXL 2WP3T 3HE6A 3TWCL 3ZL1A 2QVFB 1U3HD 4DKAA 3TCLA 5MHSE 4DF9A 4P23C 1PZBA 3OQ3B 1AOZA 4QTIH 3X14A 2M06A 4GCQA 1K4DB 2EO7A 1N19A 4N75A 3SJVB 3GXMA 3U6RB 2EACA 4WQOA 1AR1C 1O7DE 1RUAL 1Z3GH 3CN2A 4NO0A 2AFNA 4X5RA 3FH8A 4U1NB 3MJ8B 4RRPG 4J3OC 1TTFA 3BQUC 2PLTA 3FT2A 5IYUA 4ZUTA 1EZSA 1I7RA 2EDQA 3BKML 2CNZA 4FG6C 2W9LA 5FGBC 4JZJA 1WAAF 4P3CH 3DX0A 4H5SA 4PJFF 3PPSA 4LVHC 4QRSB 1AO7E 2DPKA 3B3IA 5HPMA 1VFBB 2OW6A 3IGLA 2OXGB 3BN9D 3HRPA 1EO8L 1SLWA 3P9MA 4F2MA 1BZQK 1KEGH 2YGQA 1TJIH 4RZKA 2ZKYA 3WSQL 1F0LA 2IWWA 4HKJA 4L3CA 3DX3A 1NUGA 2Y2TA 1MWAA 1IEBB 2X0WA 4BH8B 3NABH 4LKCA 3RNKB 4JRYB 2OMXA 1H3PL 1XEUA 4G82A 4TUOA 3S35X 1XF1A 1DEDA 4FMFA 1GZHC 1MEXH 1O6TA 5AG8A 2BP0B 1Y0LA 4JO3L 3VXTB 4AZ8A 4HZ1A 1BQHG 5HDBF 1G1OA 1FZOB 1QJ8A 1F4XH 4B61A 2HG0A 1WJ3A 2FR4B 4F2EA 3UTZA 1W0YT 1W15A 2NY6C 2ADJA 4P2RB 3FFCA 4H13C 3TT1L 3WEAA 1T7XA 1M1XB 3AQZA 3RY4A 3GK8H 3JVFC 2VISB 3HBGA 2J44A 4H8WH 3ARSA 3R1GH 4KK6C 4IRJD 5BRZA 2ZXWB 3VXSB 1G5AA 1E0OB 3OKDA 1IKNC 1G90A 3RWJA 3NQKA 4F1SA 2NMSA 1TR7A 3HHMA 4F5CA 3D6GA 1EO5A 3ESVF 5T5FL 3HE7A 4GAGL 1KCSL 2R8SL 2F7RA 2LU3A 4N5EC 3WIHA 5I76B 1XH0A 5HHVH 1NMAL 3OX8A 3VFOB 4FABL 4AUJA 3WNJA 3PNWA 1E67A 1S5IL 4LPWA 5EORH 5FKPB 3QE5A 3WLWD 4IRZA 4N0FA 3VY8X 4C47A 4G59C 4WW2A 1YMMB 3V6BR 1A4JB 1U93B 2LVEA 4MZ2A 3CAFA 4NN6B 2ROYA 4LHUD 1GR7A 3GBLA 2PTUA 4QRPA 2A9NH 2BP8B 4U7MA 4PJ7F 4XP5L 4PRDB 2OMNA 4RA0C 5IGXL 3EH5B 5A16A 4AJ0A 1X5HA 5DT1H 3L16A 1K3IA 2B5IB 3II2A 1N6QL 3MCKB 4KI1A 3MLZH 3OF6D 4W4NA 2Z4TA 4F8LA 3KLDA 1SEQL 2YD5A 4KO6A 1A3ZA 4AE0A 3WENA 4GUCA 4U9CA 4IMKA 9PCYA 1EDHA 2KERA 1QLEH 1WCBB 4QXTA 3SKNA 5TPWL 2QQLH 4PRPB 3HRZC 5E56A 4TUKH 3FCUB 2YRLA 3D39B 5EC1B 3BVNB 3C75A 1BGXL 3KD4A 1E4WL 3MROB 4I5BB 1JNNL 3F7VB 1NQBA 3QHZH 4JZOA 3NSXA 4LEEA 4OZHA 5AYUL 5EF3A 3C8HA 5C07B 4XMXA 4X0NA 4QOKD 25C8H 3V95A 5DS2A 5F1OB 2Q8AL 4XVTH 1S6NA 4BQ8A 3MOBL 8PAZA 2HTLD 2W94A 2W9EH 2A99A 4WV1B 1F3DH 1YHPA 4DP7X 4NHCL 5E08H 3LMJL 3NSCA 1S9KC 1AZRA 3K1KC 1OQXA 2FZ3B 1MFBH 3WNIA 4UV4H 1XMEB 2XN0A 2EKSA 2YZ1A 3L08A 2H6PA 5K1VA 5L4JA 3FTGA 2ZPKL 4R5VA 2YPVH 4KTEL 4NI6A 4XPAH 5F97E 4LEOB 5KJRL 4RISL 4K3DH 3VFPA 3I85A 5HD8C 5FM5M 1KPRA 1OE2A 2UXFA 3S9DB 3QIUA 2X6AA 2CXKA 3I3DA 3UBHA 4DQOH 5I1JL 5L2KB 2LVCA 3SDAC 3K6OA 5GGSB 4WUUD 1ZTMA 5BZWA 2EC9T 1N3NB 4KFZC 5E8PB 2CRZA 5C3LD 4QRAA 3ECWA 3LV3A 2BNQB 4LU5L 3RVVC 1XGYL 3W2DH 1XR9A 2XE5A 2OL3B 3AQYA 4AJWA 1UWXH 3BP5A 4HKZA 1YC7A 4OCRL 2ITCA 1WZAA 4L37A 4TQEL 4F8NA 4PBDA 1GOGA 4TSBL 3W5NA 4P2OD 4LCUB 1DBML 1MG2C 2HVJB 5EUKB 4HISA 2K70A 5FO7B 4ONHA 2VDRH 4P9ML 3VGHA 3QI9A 1P69B 2IH1A 5EEUA 2FTAA 3V4LA 5C2BL 1MRDH 1CC3A 1GFOA 4ZT1A 1HEJC 2GIXA 4AOFA 4MS6A 4HJGA 1MW2A 2ZWNA 3IJYB 5BRQA 1UCTA 1R46A 3QDMD 1C7SA 1HEZB 2Y5TB 3O6FD 4M8QA 1TVBA 2PETA 3N43B 1SVZA 3AC0A 5EEVA 4PY7B 4KQ0A 4O2FA 4RGNE 3FW6A 4XN8A 5HJDA 1B6UA 4EZLA 1JDAA 2FE0A 2IG2L 3UPRB 1LEKB 3RNQA 4TLKA 3M1BB 5GISH 3O4OB 4PJHF 1T4KA 2YWYA 3NIDB 1E43A 3B7RL 3ZKQD 5EUOA 3FC8A 1AKJB 1ZJAA 3C5JA 3MRNB 3OXSB 3TIDB 1NBVL 3L95A 4PJBB 3SQRA 2O5YL 4R7DB 5TE6L 3V4VB 3LZFH 3KPRE 2IAMC 3J7HA 4PJXA 3LEVH 2V9UA 1LL1A 2IWVA 1T5KA 1ZHBB 3WAKA 4ZTPL 1C1EH 4N0UB 3UTQA 2XQYG 2EECA 4FQCL 3Q3GA 2BVEA 3QXVA 3OSVA 4XNMA 4B96A 3D4YA 2CGRL 3JWOH 3PGFL 2YD9A 4NUPA 5KJ4A 2VIRB 4PJIF 3BIKA 2WLHA 3O2VL 3HS8A 4PV8B 3ARFC 2XZQL 3M88A 3GMRB 3G6JF 5KW9L 5E8DL 4Z23A 4LSSL 5JYLA 3AG2B 4AKMA 2V7HA 2YK1L 4CADB 3SDDA 2VERN 4GW4A 4O2CB 3T0EB 3LZOA 1DN0B 2P8LB 4JDVA 1FO0H 1ZT1B 3BP4B 3PFQA 4G8GD 5DO2C 1KGUA 4PGCA 3KYMB 4RLBA 2X70B 1SN0A 2FAUA 2AMUA 1K2DB 2VLKD 5GGQL 4DTGH 1RJZA 5BV7H 5KS9F 3QIWD 3HI5L 5BOJA 5DYOB 3KEHA 2ZJSH 5CSZA 1X4XA 4JM2C 4U3CA 5IHUL 3DARA 1M1SA 3WEMA 4PVNA 1CGWA 4KITB 4YXKL 1QFWL 2OJEA 1JFQH 3H3KA 4N0CC 1CF1A 2ZUSA 4KNSA 3KM1A 5IFAL 5EOCH 2XWXA 1RK7A 4NYLA 3ZDZB 5KSAB 3ZT6A 1IFRA 3EYVB 2WBJD 3MRHB 3HBQA 5KYYA 1OGTA 3H9SA 5DTFB 2AJXH 1ORMA 4I4WA 4X6BB 1N4XL 4PJDE 4FOZA 4HQQH 2ZFGA 1H9DA 1II4E 1H8NA 1NCAH 2UWEB 4OSUH 4AQEA 1SQ2N 4JJ5B 4Q14A 4J5VA 4L0YA 2Q3ZA 3GBMH 3KXFD 3KWXA 3TO2B 3Q6GL 3QPQC 2YAFA 3E38A 1WFOA 2ZOLA 3F6IA 3B9KB 3GLDA 3BEWB 5K9JH 4YHOL 4X4ZA 2PP9A 1ZSDA 3L9RA 3EW3B 4WW1A 3VSUA 4EQ2A 4YR6B 1AY1H 1ZEAL 4JPIB 4PJ5A 4RAUB 1QNZL 3IETB 3N6YA 4FYQA 4W6YB 3WS3B 3HG4A 1UWEH 3MCLL 4I0CC 3AQXA 4FRTA 1CGSL 3FBKA 3MRGA 1JPSL 2J12B 5CEXB 1EANA 5DU7A 3CTTA 3V7AE 3V52H 1IBYA 2N56A 2ZX7A 4HUXA 4Q6IB 4FMKA 4LSEA 3P40A 3ARVA 4WAFA 1ZS8A 1BEXA 1AHWC 1SMAA 3PP4L 3AY4A 4L3ED 5LAXA 1X4ZA 4GT0A 1PD1A 3A22A 2VR7A 3B2UC 1BQ5A 4XPGL 3UTSE 4JO4L 4XNKA 4BUHA 1G9NC 1A64A 4M7ZC 1TF4A 4XMLH 3P3SA 5JOFA 1G43A 5GHWH 4X8JA 5EZJB 1U6AH 5DRWA 5LO7A 5JPMB 5HVWA 3T2OA 2R83A 1I1AA 3DROB 5DLMH 4J7RA 4G7YL 4JPKH 3C2SA 2YN3A 3NSJA 1MM5A 1YNKL 3HS0B 1MY5A 4W9JC 4ZFFA 4XAWL 3OC8A 4X0KA 3ZE1E 1BECA 1OLZA 4WSGA 1S7VA 3W37A 3QUYC 3DI2B 1RLWA 4J2XA 4OBSA 5FR3A 3GSNB 4Z9KB 1DJYA 5KVEH 3P02A 3KHQA 5KAQF 3PQYE 3PYCA 3ULUE 4PRAA 2NZ9D 1BD2E 1MVUB 2CSPA 5LHDA 5B8CB 4ODXA 2J1YA 1IGCH 2QSVA 4K15A 5IZ7A 3VD0A 4Z76A 2E59A 5F0LB 5GS0C 5A6IA 2HCZX 2XWDA 5K9OB 5FFLA 3V6ZA 4U6VL 4AV4A 3IKCA 5I17A 4OD2B 3FCBA 5SX4H 1MCJA 1CFSA 1UD3A 1N5YL 1I8KB 2HX7A 4XN9A 3LQAC 3HCVB 4ONFH 3TVMB 3MRJA 2LLGA 5FHAH 3VFRA 4ACPA 3V8OA 3QAZB 2LW3A 4PW3A 3ULVH 3A0HO 3AU1A 4L5FH 5B39G 3S5LA 2AV7B 5MEQB 4MDJB 3HPJA 2J5LC 5BO1L 4NO2B 1NLBL 3V0FA 1K5NA 2CGZA 4ODHL 2WLYA 2YXFA 4J3VA 5AZUA 1SJEA 5KANI 5JPNC 1A6VH 5AQ0A 4B0MB 2WCSA 2WYTA 5DVMA 3U4EB 3UG3A 4A2LA 15C8L 4X7EC 4X5XB 1SF5A 3S36X 4Y1AD 3CXHK 5I8KL 3L5XH 3GQFA 1A6AB 3WNOA 4FFVC 4MAZA 3NSGA 3CSYB 1SGKA 2O6DA 3DUSB 3L3IA 5F89B 5I1CL 3S3JA 5CHNA 3L3OB 1WZ1L 2BVOA 2PCXA 3TBSB 2H4EA 4GRLB 1BMZA 4OIIL 1AI1L 1LWHA 1TG8A 1T2QH 3MYJB 4QHUA 4RQQA 3LKPB 4HOWA 3GSWB 4DVRH 2YXMA 1ACXA 2CJUH 2ZWKA 4HMDA 2VM9A 3ZL2A 2G9KA 1OCWH 4LAJH 2R7EB 3QT2A 1MDTA 4PR5A 5D7IF 3HAEB 4PHZA 2WSDA 4XHJC 4XCYA 2ORBL 2Y23A 1AHKA 5IM7B 3FAXA 1M05B 2ENJA 4LSPL 4NWTL 4KI5D 4YDZA 1G9HA 4CN6A 3RJQB 2DQMA 1DYZA 5HY9A 2ZUXA 2G3XA 2FBJL 5DHVH 1RUKL 3G7GA 2ICWA 4GQRA 4LOFA 3WFBL 1BM3L 1QSEA 3RPKA 3WTXA 4Z0XA 3QCTH 1YMME 1AZBA 1R5WA 2Z92A 1BFVH 3FTSA 1MRCH 5GIRB 3RTQA 3U0WL 2EVHA 2XTSA 4KQ3L 4UNIA 3EBAA 1C5CH 3RGBA 5EO9A 4O3XB 2X6BA 4PRHA 4RGOH 2YPVA 1QBLH 5K5YA 3GUTA 3W11C 2X9WA 4PUXA 1G7PA 1HCYA 1RHHA 4OZIB 4JB9L 4YHLH 5KVGE 3G9AB 3MX0A 4CAGA 2WQWA 1OL0A 4FD0A 3ILEA 1DJHA 1UM5L 2HKFL 1CBJA 4JPWL 5IQ7L 1DQMH 4M7LL 1OE3A 4LCWA 5H35A 3BIBX 5F9DC 1P0SE 2WXOA 2QPSA 3C8KB 4X7CC 5HDRA 2WXNA 2AW2A 2CJTA 1K4CA 2KZWA 1E6OL 3E8UL 2XFGB 2ZKMX 3DUHA 1F41A 5HGBA 4J6IA 2G4GA 4KZEH 3EFFA 4IIQC 4XP6L 2FVNA 2B3IA 4ZAKB 4K71B 4CSTA 3OJDB 4NJAL 2JIXD 3MRMB 1DCEA 2R1YA 3BAYA 4AUUA 2NY1C 1PX3A 2PWHA 3SZ6A 4KY1L 1ZA3B 1WFJA 1E4XH 3LKNA 4YC2C 2QLYA 1PKQE 2ADIA 2ILLA 4X42A 2JKTM 2VZ3A 3JWDH 3WY1A 1MCNA 1QUNB 3TBTA 2A6JB 3EO1B 3MOQA 5PRNA 1A1MA 3B6SB 4DPCX 4D64A 1JV5A 4AYFB 2JFCA 4AX3A 1U0QA 4G9DB 2X53A 1BFSA 1XF4A 1D5XB 4J4PA 4OFDA 3T4AB 4AIZB 2AVFA 3QJQB 4WY7L 1RZIA 4W9GC 5IK3B 3FCSA 1R5IB 1DL7H 1F3JB 5CR1A 4O3WA 2BVYA 4YFEA 2C3GA 4YSQA 3VYOA 4MQ7A 5IHHA 1V27A 4X4MA 2Y9RT 4GAYA 1JWSB 5E23A 1CDBA 1J5CA 3O9WD 1FHGA 3PJSB 1AH1A 1ZY9A 3U46B 2BM3A 2XVBA 3M1CA 1NGYA 1P4IL 4ZS6D 3RVTC 3WD5L 1EV2E 5I5RA 3VTTA 3CVDA 4H1LH 1YNLL 3D69B 2NUPA 2FLMA 3I9IA 4NQSB 4UB0H 4ZS7L 1PS3A 3RWDB 2X38A 3UC2A 4DH2A 3JV5A 3HPLB 4NZTH 5C71A 2GEQA 1R6VA 4L9LB 4ZW3A 5SWSE 1OP9A 1HFUA 4IHOB 4AI7A 1NDGA 3WL9A 2KLTA 1RJLB 1RQ5A 4PJCF 2MTAA 3EO9H 1LEGB 2JB5L 4YWGL 2WTOA 1GGCL 1G1CA 2VH5H 6CGTA 5HSFA 1LD9B 4HEPA 4L1SA 5FUOH 2FIKB 2XBTA 3DYMA 2HP4A 1NCOA 5L88L 1KIUA 5KAIO 5LWYL 1FO0A 1KB5L 5I1KL 2HTKD 2ZXCA 2NT1A 4GUPB 3PHAA 2G5UA 1ESOA 3MNZB 4ZX5A 1YEGL 5HGGS 3VWKB 5C6TL 2IXQB 5IBLC 4P2QE 4XMKH 4AQAB 4A7VA 4PJBE 5MEND 1RURH 1TU2A 1ZHLB 2WZ0A 1A3LL 4C83B 2HKHH 1JPTL 2QPFA 2TRYA 4YH6A 1LDSA 3IF1A 4PJIB 4N0UE 1RZFL 1OSPH 4P5TB 5E1HB 3O11B 3IDGA 4O4YL 3G6JB 4YGVA 3O6MH 2X6UA 3BD5A 4NP4H 4UT6L 2CZNA 2YGNA 5CLWA 5KEZA 2X1WL 4UIMA 4KRPC 4XCFL 3ZRCC 3GI9H 4JY6A 4ZZFA 5JR1H 1XD0A 1YY8A 2F74A 4AVKA 1W72H 4F7TB 3FO2A 4RIRA 5F9OH 3AA7A 5ALCL 1MNNA 3D4GA 2VQ1B 2GC4C 2R69L 1IGIH 3E2HC 2X42A 3FSOA 3MV8E 3Q2VA 5KS9B 1KCLA 1TLMA 3KW8A 2V5YA 3LQMA 4OM0L 3U2JA 5FECA 5EEZA 1NIDA 1WGVA 1F56A 2JVUA 1THQA 1P6AB 3HBPA 3HE6B 4WLCA 5DUPH 5HHXL 3ARPA 3CC5A 3O4LE 5GGSY 3CSBA 4JFEA 4KPHL 4P9HC 4AIOA 2IDCA 3X14B 1BZOA 2VR5A 5I2IA 2ZUQB 4NNPH 1Z9OA 4W70A 5SWZE 3V79C 1KUMA 2PTTA 3F2LA 4NO0B 2CGYA 1JUFA 2HLFC 4GJTB 3KW7A 1D5IL 2V5RA 4XOAA 2NNXA 3FT2B 1I7RB 3N85H 2VKXA 4OF7A 1P84J 2VDLL 2NR6C 4JZJB 3FULA 1JRHL 1KPUA 1ZANL 5DHDA 4H5SB 1KXQA 4GFXA 3B3IB 1N18A 3U0TB 5HPMB 3NBNA 3RWFB 1W80A 5EZLA 4DN4H 1DHKA 1F4WL 2D0GA 2IGFL 3IMWA 2G2PA 4F2MB 4G8EA 3ATFA 3TJPA 1M42A 5DWUH 1DR9A 4HKJB 4L3CB 6PCYA 1MWAB 2FD6H 3F58L 4IK7A 2CUIA 1F4HA 4M7KH 1SZNA 2HYMA 4LKCB 4OF3A 3U1PA 2OMXB 3A4EA 4TUOB 2CH8A 2DKSA 5IK3A 4JQVC 5KZCB 3DX9A 1JPFA 2R27A 1KBGL 4G7VL 4AZ8B 1RZGB 4ZXBD 2H9GB 1E4HA 5EB9A 2B1OA 5ADOH 4S0HA 1FFTB 4OZGA 3UTZB 2ADJB 3LK42 2PCPA 2FNWA 3FFCB 1N5AA 1Z0NA 3G04A 4H8QA 5ADPH 3FUDA 4FQXC 4LLWB 2XA8H 1RZKH 2Z1KA 3KPSD 4R7VA 3R4RA 4TVPD 3BSZH 3QRFM 1JXFA 2KPWA 1IAII 1GYAA 1D7FA 5D4JA 5BRZB 4M7JL 1XAUA 3VGDA 4U7KA 1PKQA 1NCHA 3OKDB 3RWJB 2A6DA 2RD0A 3ZKSD 4JFZL 1HHJB 1YEIH 1QAWA 1NL0L 5FK9A 5DQDH 3GJFB 4CKQA 2WZPD 4G72B 1AHMA 1XGZA 4Y5YC 4YDKH 4GUOA 3OX8B 2XBZA 2VO5A 3TH2T 5T1LD 3PNWB 4V2CB 4DP2X 3M45A 1BZ7A 1PLAA 2B4CC 3BAKA 3IMRA 4I1NB 4N0FB 4Y9BA 3W9EA 2UYLA 4OCYL 3HG1B 1DO5A 2YLKA 3OJVC 3BPNC 1MIMH 4OLYH 1EJ8A 4FNLL 1OAUL 3ILDA 4QRPB 5L8JB 3VGGA 4P5MA 5A16B 2XZZA 4U7SA 1F90H 3DKHA 4P06A 4L1DA 4HH9B 3L3GB 4N26A 2RGSA 4QT5A 1OCCB 4NNXA 5BUGA 1FE8L 1T89C 4QRRB 2DKMA 4HF5L 1WAAE 3SKNB 4QXTB 4AC4A 5L8LB 2DKUA 4WF7A 5GRUH 2CBOA 4DAGH 4PJFE 1KCBA 1CO1A 1XSKA 5DS1A 5EPMA 4LRNH 1R3KA 2I60H 5BW7C 3UXFA 4JFWA 1CDGA 4WHTA 3QZOA 2EDLA 5I0WA 5KYUA 1BG1A 3BP7A 3FAWA 4JZOB 5DRXB 4OZHB 3QCUH 3GLZA 3OKMB 4JQIH 1GZQB 1XSOA 1U3HA 2QGCA 2VDKB 4YHML 4LSUH 2E0PA 3QWOA 1K72A 4IDJL 4DHLA 1FAKT 4FXKA 3JTBA 4KR4A 1U4FA 1AS7A 4ZX4A 5ISZD 4RLCA 4LCIL 1CTNA 5DHVA 5I75C 5KSBA 3DO7A 1CF8L 4IJTA 3BGFC 4QXVA 4R26H 1M6UA 5HDBE 2D2OA 7PAZA 4QD2E 3QB7C 4KX8A 3SOBL 2G5BA 1QD0A 2H6PB 3GSUA 1LWJA 4HS3B 2K9FB 1NTDA 3GI8H 4IRSA 2FQDA 3T6ZA 1OB0A 4J12A 5E5MA 2EDHA 1KPRB 1DP0A 2RCSH 1SXBA 2WK2A 4FNPA 4WJ5A 5EU5A 5F93C 3T65B 3VYNA 1KIQA 1R24B 2YMOA 4WTZG 3TEWA 2N1TE 4MNHA 5EWIL 3PFUA 5BZWB 4X83A 3E80A 1NMCC 5BQDA 4G6MH 4D9LH 4ZODA 1NGQH 5F7BA 2JI1A 2EDWA 1YRKA 4R97B 1XR9B 4ZUUB 2EIMB 5G38A 5E4EC 3QNZA 2CA4A 4HKZB 3FRPG 1E2ZA 4KAQL 2ITCB 3CN3A 1FJ1A 2YKLL 4G71B 1KBKA 2OZ4L 4HW6A 5HHOB 4MRCA 1N7MH 4XI5C 2WWKT 3QI9B 4UMSA 4KZDH 2IH1B 4G8GE 1BWMA 4PJ7E 1ADWA 2ZXGA 4HJGB 2V0AA 4N2FA 3JXAA 1NCDH 5JDJA 3MRIA 4M8QB 4IRJA 3M07A 4EAEA 2UY6B 1FYTD 2CUHA 4P5KA 4FG4A 4UB6O 4F37F 1XV8A 2CMRL 3CLEL 4O2FB 4BA8A 1UXSA 4HCIA 4J3TA 5FVNA 4XXCA 3M17B 1KCRH 4YUEH 3PWJA 2I26N 3KMDA 1ETZA 1MFCH 3C5JB 5FOJA 7TAAA 2P9RA 3L95B 4YDVA 4D3CH 2ATPB 4JFQA 1S3KH 5D6CA 4AKOA 1KLFA 4Y2OA 1ZCRA 4PJXB 1BVKA 2ODHA 3FU5A 3L1FA 4LQFH 1N26A 1SM3H 1JZIA 1TQWA 1HZKA 1Q9KA 3CFUA 4LHUA 1SDDA 5EF1A 3L5JA 2IALA 1HESA 3UTQB 2RALA 4BK5A 3IT8D 4H1LA 2KS0A 3Q3GB 2AJVL 1D7DA 1WT5A 4XNMB 3PWNA 3OF6A 1KDIA 1IE5A 1MCOH 3DURB 4HCRH 4Y7OC 3U7YH 1V10A 3WFEL 4UT7L 3E6FA 3ZJAA 3COOA 4W9EC 4XTRD 1WFIA 1Y6NR 5LG1A 4FKHA 5KBMA 4XPFL 3BHBA 4IIZA 5FCSH 2V7HB 3VVVA 2JKSA 4G11A 4JS7A 4GW4B 4RSVA 3SDDB 5E6IC 2NDFA 3SDCD 3VD5A 1X5ZA 3CIQA 3EJCA 4JDVB 1CLZH 2ENYA 4QOKA 4PGCB 1PCXA 3UAAA 2A4CA 4U1IA 1SN5A 4XPAL 5TQ0L 1I1RA 1RJZB 2WWNA 1XMWA 2MJWA 2Q7AA 3QWNA 5C86A 2VXTL 4KO9A 2XXFA 1UACH 5CSZB 1CYWA 4UIKH 4XOCA 1IAOA 1KJVA 4LARL 2VDNL 3N0AA 5EIIA 3O3AA 1PPIA 1GGIL 2VLJE 5BOZG 2O5ZL 3LRHA 4C00A 4NM8L 1GY2A 2PF6A 3VXMD 5F9AC 3Q8BA 3WJJC 2D73A 1YEKL 2FEEL 2B08A 2P52A 2VXVL 4EF3A 4NIKB 4AJYV 1YJDH 2VLME 4AH2A 1KJ2A 2C5DC 2G60L 6PRNA 3H6JA 3GDCA 3H9SB 4WUUA 5IMLA 2QPDB 3TNMB 2JB6A 4I4WB 3QUZD 1WHPA 4NCC1 3UDWA 3V0WL 1FUNA 2BW4A 3V6FA 2HVBA 2MOQA 1W72A 4AQEB 5I82A 4G43A 4PJHE 3APNA 1WRFA 1A6WL 5KVMC 2VDPL 2QADC 2ZOLB 5D2LA 3SE3C 3TBYA 2BC4B 1I9RH 1ZK9A 4P2OA 5IW1A 3WTSA 1Y1UA 1IUZA 2WC7A 1DLFL 1ZSDB 1X5MA 4MASA 4NQCD 3L9RB 5DC2A 1D6VL 4WW1B 5IQ9A 1KB9J 3HNSL 2JJSA 5J9PA 3TFBA 1S7WA 5I15L 2F7PA 4MVBC 4XCEA 5CBAA 4PJ5B 1KEML 1DVFC 1YLBB 3SSGA 3OR6A 2Q9OA 5CN3A 4XWOD 1PL3A 3WXWL 2P42B 3DA0A 2WLNA 5GISL 1EX0A 3QDMA 2O93L 1NC4B 5D5MA 3O6FA 3MRGB 4PJIE 3K6FA 1KYDA 4JFPB 4PS8A 2XTLA 2RQ8A 4UTAH 1LEIA 2R0LL 3O2WL 2NY2B 1ORSA 3CIAA 1XCXA 3WY2A 1BF8A 1VFAB 4HUXB 1RLBA 1AE6L 3G6JE 4TVSa 3OV6A 1ZGLA 1SJHA 3U4AA 2VZ1A 1MNUH 5LAXB 2ODIA 1LO2H 4KK8D 3FTZA 3VJ6A 1MQ8A 5EF2A 5DMKB 1TZOA 2BNUA 2YC1A 1NEZB 4X98A 4OLWL 3SKMA 4FFYL 1SJXA 3GC3A 3WIAA 3FB8B 1U58B 2KMWA 5DRWB 5E03A 4AC2A 3CSTA 4U6HA 1TYEB 5KS9E 3FT4A 1RU9H 1JD7A 1CICD 4NC1E 2GJZA 4ZUWB 4XNDA 4HKBB 1RFDL 1B2WL 1R17A 4ZFFB 3ESPA 1DQDH 3TN0B 4RAVA 4AKQA 4AVIA 3IU4H 1WIPA 3LHPH 3MODH 3ULUL 2L0DA 4N1HB 3BFWA 1WFUA 3FUIA 3PF2A 4L4VB 4XC1L 1Z9SA 4UQ9A 5CEYB 3MLUL 2VN4A 3VRIA 1TTAA 4PRAB 3JSSA 3FQNA 1UXWA 4KI5E 3BSZA 2VMEA 5ABZA 4G8GA 1ZHTA 4Z76B 1GA2A 2R0KL 2AK1H 3BCDA 2OI9C 1JXKA 2DMGA 2BINA 3IKCB 1CFSB 2VLKA 1FLRH 2DTML 3BZDA 4NKIL 4E2OA 1K6QH 3RDTC 2FLRT 5CLYA 5LBSH 3QIWA 1SRDA 4JJHA 5J12C 1L0PA 4X80H 3QG7H 5HHMD 1MFMA 2QSQA 2W07A 3IYLW 1ZD6A 3CQFA 1JZDC 4M6OL 3EYUH 2AJXL 3S5LB 2OLDA 3HPJB 2CUAA 3MLSH 1CI5A 1NUNB 3T3MF 1PG7W 4HBCL 2NY3D 1K5NB 3RL2A 1BF5A 3P3TA 4HJJH 4KJWC 1SJEB 1V8HA 2NYYD 4OQTH 4N6QA 4PG9A 3A5VA 4BXVA 1UKSA 4U05A 2WBJA 3ZX1A 4E9RA 1KBBA 4TNEA 1YAZA 5ALBL 4ALAL 3MUHL 4H0GA 1M7IA 1A1NB 4APQD 5M95B 1ETA1 3LCYA 2ICWJ 1F3DJ 5DK3A 2GBUA 4JKPH 5JOPE 3C6SA 1OPGH 3O3BA 5CHNB 1KCUH 3RLSA 5DFTA 2BVOB 1AY1L 3S6CA 1QLEB 2ZSVB 3KXFA 3NFSL 5AWNH 4QHUB 4X6FA 1MHEB 4KROC 4KDVA 3HFML 2D2CC 2CU9A 2J5WA 2GY7B 1IQWL 1CPUA 4PJGF 1CDHA 1JHLH 3MFFA 3TJEL 2WKOA 2WAHA 1HXYB 4PR5B 4JFFD 4L1HA 4XCYB 4QTHA 5JIPA 1HYSD 2F1AA