3KVDD

Crystal structure of the neisseria meningitidis factor h binding protein, fhbp (gna1870) at 2.0 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
242
structure length
242
Chain Sequence
AGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein
publication title Structure of the uncomplexed Neisseria meningitidis factor H-binding protein fHbp (rLP2086).
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Protein binding
total genus 60
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 3kvdD02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3kvdD01
3HOLA 3VE1A 4O4XA 3V8UA 4O3YA 4QQ1A 3UAQA 1YS5A 4AYID 4O4UA 3PQSA 2W81C 2KDYA 4AYMC 2KC0A 2Y7SA 4O3XB 4AYDC 3PQUA 4O3WA 5T5FA 4AYEC 5EE2A 3HOEA 4U9CA 4O49A 4Z3TA 2LFUA 4O3ZA 2YPVA 2W80C 4AYNA 3KVDD 3VE2A
chains in the Genus database with same CATH superfamily
3QQ4A 5F1NA 3FF7A 4QJ4B 3NZ8B 3DOSB 3ARTA 1QJ9A 3VFWB 3VXSD 3WGVB 2Q86A 4FF9A 1GTNA 4R2GB 2HT4C 4KFZC 4XMKL 1XFPA 3O11A 1ZGLB 4M5TA 5DZAA 4PJDE 2HRLA 2R89A 1OP4A 2V8LA 4OLZH 4RA3A 3SO3B 4OM1L 3ZQWA 2EECA 1AKJA 2I85A 1O9WA 5DL5A 2UY6B 3TJEL 5HP5A 3PWVA 2XPZA 5GPRA 2BVTA 3WJJA 1QTPA 1DVFB 1FAIH 2ZT9C 1RZQA 5FW6A 1E9OB 1ZVHA 2NYKA 4PG9B 5IBUB 3SN6N 3U4EB 5IB5B 3B43A 4JO4L 4HC1H 3D05A 3TO4A 3QEGH 1PIGA 5FM5O 3BZFA 1NPUA 2G2PA 4DZBB 5C7XL 2MTAA 5D7IB 1YN6A 3QIUA 1IZNA 2ZXAA 4XCCH 3UYPA 3RL1B 4ZFFA 2XVKA 2UZXB 4KXZI 2R83A 4HIXL 4N22A 4N0FA 5CZKA 3C5JA 5EN2A 5LN4A 5DUPL 5ICZA 4TLKA 1G9MH 4HCGA 3ZTJG 4R84A 1X5IA 1F4XL 1FYTE 3DDFA 3NJHA 4KRLB 3IU4L 3L3JA 4DPBX 3BVNA 1DBJL 1EK3A 3MRGB 2HAZA 4QT5B 5J9PB 2DQHH 1L9QA 4JR9H 1UUSA 3ESPA 3WIIH 1IBYA 5LBSA 1DANT 2AC0A 4UQIM 2CJTA 4NNXB 3B83A 1NCOA 4QXTB 3GP6A 5IW1A 1J1OL 1PJWA 3C60B 2DQ6A 4G6KH 2JH2A 4P05A 5FYLE 5HHOA 5HJ3B 1MCWW 5A16B 5AB9A 3IEAA 4W9ZA 2OMYA 3L4TA 5EU3A 4UIKL 3U0WL 3LRSB 2G4EA 1AD0B 3GLAA 4ERSL 3LIZL 3IMBA 4IDJH 4LHJB 3HC2A 4GO9A 4P2OD 3VACA 1N19A 5LDUA 4M4PA 2FX9H 2XZCL 4JRLA 3MRRB 2JCCE 4HWBL 3QXAA 1MW0A 4G6FB 1EDQA 3K5RA 5EBMA 4P3CL 4PJEF 2VL5A 1RURL 1M57B 4JPWH 2UYLB 3PHQA 3ZKND 1URLA 4PWEA 4BRJA 3FHQA 2HP4A 2AVGA 1X5YA 1T7YA 4G9DB 4IJTA 5GGQL 5I30H 4Y4KD 5HHQB 4X8CA 3I6LD 3FRPB 5BW7C 2CR3A 2GK0B 3V4VB 2EVIA 4QRAA 4UT9A 5DSCA 3FU7B 3VXQA 2FWOB 4KKNA 2Q0ZX 1KBVA 1DSYA 1KPVA 4W9EC 3BKCL 4RGND 5CINL 3LKNB 4FTVE 2CO6A 2WLNA 3QUZD 1U92A 4UB8O 4H8QA 4JRYB 1JXKA 1FNGA 3KL0A 1BQSA 1N59B 3WFCH 1MDTA 2DYPD 4G42A 5FCUH 1QR4A 4XC1H 2BZCA 4PR7A 3POCA 1EFXA 2CK0L 1DQML 1UCBH 2X70B 4KK9D 4UIMA 1ZA6A 3TBSB 1UJ3C 1DVSA 3QCTL 3BPOC 4X6CA 3JYCA 1SJVA 1WD8A 1C8PA 4WLCA 4GCQA 3WEXA 5MEPA 4JG5A 5AVSB 5AVRB 3IFLH 4RNRA 3TJHD 1E90A 4A2HA 1AI1L 4N2HA 4F58H 4X50A 2P5EA 3U1SL 2R2HA 2DQTL 5CJBA 1N6VA 4IIZA 2Z92A 5G2NA 2ZZUT 2OMZB 4E41E 2ZSVA 2Z93B 5GRZA 5K59E 5KYUB 4G70B 3D30A 3FFCD 4FYQA 4Y1SA 1S7XA 3SY6A 1WS7A 2FL5A 1VESA 1DYZA 5BV7H 1G90A 4L37A 2GY7B 1NUGA 4QHUB 5CP3A 2WJ7A 3DGGB 3FH7A 2OMWB 2YFNA 2GT9B 3QJTB 5KYYB 4KQ3L 1R3LA 3FUIA 2Z34A 2Y1ZA 3A4EA 4LFHD 3ULSA 2F1CX 4LQ1A 5JIMA 2ZIDA 4GIAA 3T3MB 4PTUB 4FMSA 1FGNH 1QMUA 2AJUL 3ATFA 5CO1A 5B38G 4CILA 4EXKA 4NNYB 3RVWC 1B6DA 2PCFA 4JN2A 1C5CL 3I3EA 4ELKB 1IIIA 5F70A 1NBVH 4ZX6A 4IBLT 4EPSA 4PCTA 2YZ8A 4HCRL 4Y7MA 3NEXA 3VH8A 2W8CA 4LNVA 5ICXB 2YGOA 4PJIE 3O4OB 1OAUH 1KTDB 3EO0A 4A37A 4BHUI 4NKDA 1K4CA 4WWID 5E1GA 4YSTA 4NHCL 4M62H 1AZVA 3LV3B 4KDWA 2FUTA 1GZHC 4ZUVA 1ZHYA 5I1CL 1OPGL 3EH1A 1UM5L 4WAFA 4Q6IB 3RL2B 3GDBA 1FFOA 3QG7L 4L48A 5KS9E 1MAMH 5C0GB 3BS0A 4FLHA 2YA2A 3P9MA 3VQ1C 1NDGA 3JUZA 3ULUF 4NO2A 3D25A 4PJ5D 4P2YA 2H0JA 1ZHLB 1A22B 1ACCA 1DVUA 3LAFA 5BRPA 25C8H 5I6XB 3FSOA 3QRLA 1N4XH 1XWVA 4CSSA 4IBSA 4O2FB 1N18A 3WL9B 2F8VA 2YLKA 3NFPA 2IOMA 2OCCB 4QPEA 1BZ9A 1EA9C 4AEEA 1LO4L 5I1JH 1DO6A 1IM3A 1R5WB 5D4IA 4EIBA 5FHAH 4J39A 2ATKB 3IDGA 3TNNA 2YEZB 5LNEA 1DFXA 3TH2T 3U6RA 2Q9OA 5FW7A 3EO1B 4OFIA 2FECL 5D7LE 2NUTA 3WHXB 1YO4A 3K8MA 3MV8D 3W11D 3I3BA 3HG3A 4LCWE 1KF9B 4R6UA 4MJID 5A7BA 2SODB 3PWJB 4JFFD 1RZ8A 4AKRB 1K5NB 1ZTXH 4NC2B 4XBPA 2NXYC 3H85A 3RZWA 4FLOA 2VM3A 1DVYA 4J3XA 1LTXA 5FOBA 5I82A 1J5HA 5EOTB 4LSHA 2VLKA 4YR6B 5ICUA 4MVBD 4AGNA 2EE2A 4LSTH 3QWRD 1GZPA 3WNJA 2FR4A 2QVTA 5EF0A 3NSFA 1W80A 2OM5A 4BFEA 1W8OA 4JKMA 1LWRA 4P9ML 2NY6D 2VR6A 43CAB 3GBNL 2OXHB 1UM4H 1LP9A 4PJFB 1BD2E 4YSQA 4FFYA 4N9GB 5MENA 3F12B 4N24A 4B7LA 2XMXA 1X6NA 2G4GA 3FQWB 4PG2C 3MOAH 3PFUA 5L0QC 4A7GF 3VFGL 1S7RA 2F5AH 2PWGA 4KUZL 3VFUB 3VRLF 5AVYB 4UQ3A 1TTUA 3IDNA 4PS3A 2ZKXA 3D9AH 5A2AA 3I75A 2BP0A 4WGKA 2E7BA 1BLNB 4UV7L 1GGTA 4XPHL 3ZL4L 2H0FA 2V2XB 1S7VB 3VWKD 1T0NB 4CUCA 1MHPL 1KNOA 2UXTA 3PWPA 3LH9A 5KTEH 3UBXI 4YAQB 4GAFB 1U8PB 5ILTL 4TVPL 4CNIA 2A1WL 1M7DB 4X6DE 3V0AC 3ZXAC 1OP3K 4BJLA 4R26H 4XVTL 3SD5A 4C56D 2VDKL 3PABA 1JCKA 3M1BB 3TN0B 3SQBA 3O41B 1H3PH 1W0VB 2ZOKA 1R6VA 3N2JA 1U8OB 4KROC 1HZKA 4OFKA 1ZEAH 2EP6A 4ELMF 2WJRA 3RTQC 3BEVA 1C8QA 4YHPA 4WUUB 5B1JC 2CLZB 4HJGB 4PG2A 5FA4B 2D4DA 2MMXA 4GQ9H 4XWGL 1KDJA 4RETB 1FZKB 4NZUL 2KHAA 5DEFA 2YLHA 2WXLA 4U1SB 3HCVA 1V7ML 3GTTA 2F53D 1KJ2B 5I73B 5HXMA 1ZTMA 3D0VA 5C71A 1F13A 3VXUA 3ILQD 2MOVA 3MJWA 5B1CA 5E1AB 3QNYB 2NCMA 5IV2B 2XX1A 2X4PA 3MMEA 1MLCA 2DQIL 3AS1A 2BJML 2R4OA 1CL7I 3MXVL 2WUBH 2ENQA 1QQDB 4K2UH 3ARBA 4F2MA 4XMKH 2O6CA 3I6KA 1KTRL 2DM2A 3U46A 3VE0A 3L1FA 4OM1H 2VJ0A 1MJ7H 4ZO9A 4O02L 1QO3A 3ZMEA 3TJEH 4GUCA 1I7TB 2APWA 4XPTH 3H53A 3B8SA 3RTQA 4KQ0A 4TS6A 4D0DA 5B1JA 4JO4H 4ZSOE 5C07D 5E94B 1KULA 1O6SB 3DIFA 5C7XH 2AGJL 3EBIA 4N4YB 4RBPH 1EVTC 3GRWL 3Q8EA 3JTYA 5T3ZE 3HEIB 3QQ4B 5F1NB 4R4BA 3HMWL 3T0VA 4MAYD 3IE4A 3S34H 4DPAX 3SZ6A 2Q86B 4A2DA 1NCWL 1YC7A 1MNUH 3T4AC 3O11B 2UUDK 2CCLA 1F4XH 3PGRA 3F2LA 1D7CA 5ISZE 4TVPD 5INDA 1AKJB 4WDIA 3HLKA 4A6YA 2ZSWA 1BHGA 3PWVB 1BZEA 2WQUA 1NBCA 2VXVL 1LQBC 3UO1L 1S78D 1NCCH 4X6BA 1J1OH 5TGBA 1KUMA 3QVAA 3QCVH 3HG5A 4IS6A 4UIKH 3TO4B 5GHWL 2DOCA 2F7OA 1B3JA 1HWGB 3BZFB 4ERSH 3LIZH 3VD3A 3RVTD 2EDXA 1YN6B 4ENZA 2XVBA 2B1AH 1DQVA 3UYPB 4ZFFB 4N6RA 2NSMA 2QEJA 4N0FB 5EN2B 3C5JB 4IM8A 4UB0L 3VU1A 3NIGB 3PV6A 2UX7A 5ICZB 5L6YL 4UTAA 4HWBH 1KV7A 4GSUA 5F6IC 2B15A 3QR2A 4P3CH 4TLSA 1RURH 4FX5A 4M93B 3L3JB 3P3YA 3BVNB 5EZJA 5G3AA 4FNQA 5GGQH 4B95C 5GZNC 4BH7A 2H2PC 1IM9A 3QS2A 5A2KH 4I9XA 4XX1E 4OCWH 3T4AA 4GCSA 1MCPH 3DNKA 4NQCD 1TSRA 5IW1B 1M53A 5J4MA 4UTBA 5CINH 1T6BX 3GPSA 3D2UD 5HHOB 5EMYA 2OMYB 4KRMB 4FG6C 1TEGA 5DO8A 5EU3B 5C2UB 3W2DL 2XIBA 1PLGL 1M05A 4DP5X 3B2DC 3FUHA 3PAYA 3WNKA 2A2QT 1DQMH 1A21A 3RVVD 2MQ3A 1H3XA 4ODXA 2LU7A 3KPPA 3QCTH 4V1DD 3W38A 1C5BH 3IFPA 1JNJA 3HN3A 3DYPA 3Q01A 4B60A 1KELH 5EBMB 3QXAB 5D55A 3ETBF 4NQDD 1AI1H 4GQQA 2VL5B 5D1XD 3TV3L 2W81C 2PP9A 2Y36L 1Z0MA 3EYSL 3PHQB 4YSEA 3R1GL 4KKCD 5F0LB 1S8DA 4AJWA 1WCBA 4MS8C 5D6DC 3RWHA 2K7QA 3U1SH 3US0A 3TC9A 1T0MA 2DQTH 1J12A 1HEJC 1Q38A 5IB4B 3MRBA 3ZHDA 3QT2A 1G1CA 3VX0A 5DSCB 2WKOA 4XHJD 3VXQB 2QKIC 2DJ4A 3LJ3A 1OB1B 4XCYA 1KPVB 1R0AL 2CO6B 4QNPE 5GZNA 1U92B 4F93B 3KDPB 5E6RB 2Y5TA 3KLSA 1FNGB 4MLSA 4NYLA 1GFQA 3VRJA 4G42B 3BEWA 1IBDA 5ESAA 5A3IC 1UOLA 1EFXB 5F21B 4KQ3H 4UIMB 4MQ7A 1FLTX 1S46A 3V6FA 4X6CB 5KBNC 3WEXB 5MEPB 2C9RA 4PWJA 4APQD 1ORSA 2Z7UA 2VXSL 4RNRB 3B5GA 2D7OA 3FHAA 3S2CA 4OIAA 3VDBA 4DN3L 3KGRA 2P5EB 3C08L 2R2HB 1MDAA 2UWEA 2CKBH 2ZXDA 1C5CH 2Z92B 3WFBL 2ZSVB 4HCRH 5AW7B 5DJXA 2IH1A 3GXUB 3KJ6L 5DA4A 4FFWC 5C97A 4WEUD 1S7XB 5D6DA 2FL5B 5DFVD 4FQXC 4O3XB 1I7RA 3LPWA 3O2VL 3M17A 3QIWD 4L37B 5E8EA 3SHSA 4OF7A 5B38A 4H8WL 2QHLA 2QKIA 4NUGL 4I3RL 3WI9A 4L2LA 4X98A 1R3LB 5BO1H 1OPGH 2HSIA 1XDTT 3ULSB 4IJ3C 3H56A 3SCMD 2ZUQC 4KNUA 1ADQA 1CXFA 3E1F1 3VSTA 1DJIA 2P8MA 4AV4A 3L3DA 4FXGB 5E1QA 4ZBJA 1TCMA 1VB9A 4D9LL 4J23A 3EUUA 3BPOB 2PCFB 5JDJA 4JN2B 4EQ3A 5FYLH 3WMSA 2FEEI 3DMMD 3E80A 2GIXA 4AL8C 4JK0D 1DVZA 4UAHA 5EO9A 4X7SL 3VH8B 2VDNH 4Q74A 3ECBA 3EO0B 2KI6A 4NKDB 1QI4A 3WTVA 1BF8A 1K4CB 5LN8A 5FVNA 4AC2A 4OCNC 2G9KA 3QBTB 4BUGA 4EQ2A 2VIRA 2FWUA 1KGCE 3ECQA 4F7PA 3SDAC 2BNRA 2C9PA 4LE8A 3FDWA 5DL6A 5DLML 4N2GA 4POZD 1OLLA 4QUOA 3SE3C 1KXQA 5HHVL 5TE6L 4LBAA 4R4ND 4FQXA 1FFOB 5G38A 1AGEA 3B2PA 3W0WD 3HBPA 1GL4B 4WEBH 3NSJA 1CLOL 3M8OH 2O5XL 3EDJA 1RKRA 3P9MB 2OP4L 1NDGB 3OKOA 1KDIA 3D25B 5IHBA 1LEGA 4AVKA 1ODUA 2JIXA 2DWXA 4HQQL 4ZMPA 4U1KA 4ISVA 1JS4A 4XT1C 4BKLA 5GJSL 4DGWC 1VEMA 4PJGB 1ROCA 4AWJC 2ICWJ 5BOZG 2AHIA 3NFPB 4OCSL 3GBNH 4HIQA 1BZ9B 4QI3A 1AQ8A 2R4PA 2DIJA 1RAMA 1IM3B 4F7CA 3IDGB 3TNNB 1QRKA 2Z8WC 3N42F 4XO4A 1Q9LA 3VFGH 5B7FA 3U6RB 1EV2E 4KUZH 4WUKL 2PCPA 2VC2L 2MCMA 3DDGA 4YK4C 2CUHA 5LHDA 2NUTB 4LPTA 3F7VA 4UV7H 5I5IA 1R34A 3ZL4H 2QPEB 3QQ3A 3OVUB 2HFEA 2Y5QA 1VZGA 2NY2D 3GSNL 1SHXA 1RZ8B 3K6OA 3MBED 3SDAA 5LQBL 1FCCA 4XBPB 3SE3A 4AITA 1GRWA 1TO4A 1MHPH 3MI6A 1PZ5A 4RMUA 4D9QE 1YYLL 5FOBB 3H3BC 1AR1C 2VLKB 3L2NA 4GG8A 1JN6A 4OIFA 2YPLD 2NTSP 3KCPA 1H8LA 1GZPB 3LQAL 5AB0A 2FR4B 3SDCC 4KZDH 1EUUA 5ILTH 4TVPH 1L6ZA 5TK4A 2PO6D 3PXHA 4B9FA 2P8LA 3AREC 4FERA 1BM7A 3O9WC 1LP9B 4XVTH 5BS0A 3CN0A 5MENB 4TRPH 3RY6C 1V54B 4ZUSA 4LU5L 4P4KC 1S7RB 3MRDA 2VLJE 4UQ3B 3IDNB 2R2CA 5L4MA 3I75B 2BP0B 4JRXA 4KKBD 1UZGA 4PCSA 3WMQA 3WNNA 4GKSA 1NIBA 2J8UA 2GBAA 2WQWA 4XOBA 5J56B 1I9JL 1UOKA 5J6SA 4NZUH 5F9JA 4JBSA 1KNOB 3KPRD 3PWPB 4Y1AA 1AH1A 1CWVA 5IYUA 5TQ0L 1ZVSA 3A6BH 2ARJA 2OMBA 1DCEA 3CD4A 3N85L 4AIZA 5G4OA 2L8AA 4GSDH 1PLAA 2ADFL 3BWSA 4U7KA 5SWSD 4KV5E 3H0TA 5K69A 1QBML 2PTTA 2CH8A 4YEEA 2NXYB 4CNIB 3O4LD 3WXVL 3KPSD 2E9JA 1F02I 1C9SA 4KR4A 4OUUB 4ZX5A 4W9HC 2AKRA 3P1VA 3QHZL 4XNMA 3PABB 5DHVA 4XO3A 5BOPA 3MXVH 4L1BA 1THQA 3KVQA 3DJRA 3SDCA 3SQBB 2ZOKB 1SVZA 4GG6F 2YBRA 3NFSL 3K74B 3CZNA 5DO2D 3BDBA 5LLIC 4D7BA 4NKIL 3S36L 4QRTA 4JM2D 5F9WC 2ODJA 3AREA 3BEVB 4R97C 3O9WA 4YHPB 2KZBA 3VD0A 4S10A 4FYRA 1WIOA 4O02H 3RY6A 4LCYA 2BP8A 3AG2B 2HRPL 5L0QB 5F3HA 4P4KA 2KYIA 5EORL 3OR7A 2VO5A 1MW3A 3T4YA 2QBWA 3GMRA 4O5LL 4OFYA 5DEFB 5CJ5A 3WTSA 3UP6A 2YMXL 3HCVB 4JPSA 4N8CL 4PJ9D 4N5ED 4XN2A 3BGMA 3GJFH 3D0VB 2AQQA 1FNSL 1NANH 3K5SA 2FYYA 2AGJH 3VXUB 4I9WD 1BFVL 4H40A 4HCFA 4NKOA 5KSBF 2G30A 4ZMWA 2CJ3A 4W1TA 4X0KA 2X0VA 5DJZA 3MMEB 2X4PB 2F54E 1MLCB 3VXPA 4PW9A 2E75C 3GMMA 5L7XL 3NJKA 4KKRA 3OPUA 1NCWH 3A24A 3AMLA 4MB4A 3ARBB 4F2MB 2ED9A 4L1HA 1Q1JL 3I6KB 3KLKA 5G39A 4JQXC 2WMPA 3U46B 3VE0B 1WJ3A 1FPTH 3RWIA 3Q9QA 1XSKA 2MNHA 2XI9A 4G76A 1CD1A 3BP5A 4J8RA 4ALAL 4KDTA 4W4NA 1QO3B 4C4UA 3GIVA 3FU9A 4KROB 1KYUA 3U2SA 4OD1L 3BPCA 2ODHA 3SQOL 3O45A 4XVUD 5C0BD 2XU9A 3UO1H 5IW3A 5J1SC 3RTQB 3H3PL 3H4HA 2DF3A 2RFXA 1U95A 1NFDF 5DS1A 4D0DB 1QLEL 1HSBA 1WHOA 4XE5B 4FABL 3DIFB 2XTJC 3E9TA 2PTUA 2H1XA 1AG0A 4OZFB 1BZDA 4LKXA 2WLJA 2DQGL 4R4BB 4UB0H 5I19L 3TA3D 3MRCA 5L6YH 4LLDA 5IOPA 5C08E 1F4AA 4FZMA 1OM9A 3DURA 1I1YA 4JPKL 3VD1A 3BC9A 4O49A 2ZXWB 5JMOC 1QSEA 5INDB 4WDIB 3V7AE 4A6YB 2ZSWB 3QDAA 3BRYA 1L7IH 2VDRB 5C09E 5AQ0A 4LIQL 1F56A 1E3FA 4JQXA 4B0MM 4PRPA 4Y19A 4X6BB 1RVFL 3BMWA 3RVXC 5TGBB 3SPVA 4TULL 5E8NA 1VLXA 4IS6B 1ZT4A 4TTDD 5SWZD 1U3HD 2KERA 1JWMA 1EWHA 3W2DH 1PLGH 3ZDXF 3E6FA 3CLEL 1F2XK 1KB9K 2QQQA 4LLUA 5K1VA 1V7NL 2MKLC 4GAYA 1RJCA 2E27H 1YMME 4FTDA 4A7SA 4MJHA 2IANE 2ERVA 2OMFA 4N6RB 3STZA 1Y1UA 4GEIA 3U2JA 4HBCH 4KVNL 2D0GA 5KYNA 1HAUA 3PV6B 3EOTH 2RA1A 4NFCA 4EJ1C 1QPPA 1FUNA 3KEHA 3TV3H 2JTDA 2Y36H 3B3IA 2OA9A 2VKXA 1H8SA 5DMGC 4RBPK 2IBZY 5EZJB 3T77A 1UB6A 4BH7B 1NQBA 1SDYA 3N44F 4G8GA 3CLFL 1A6UL 1IM9B 4OJDH 5EHFA 3TZGA 4J3OD 3LPGA 3T4AB 2H32B 5EEUA 3IMUA 2Y7SA 3OKDA 1K2DA 2AAVA 4HLEA 3BAJA 1R0AH 3CN4A 4G6ML 3S96A 3Q8AA 4UBDC 2AV7A 2R69L 2FD6L 1T5KA 1UWGH 1M05B 1NL0L 1DANU 3DGDA 2F2HA 4AYNA 2NMSA 4QXGL 4YL9A 3LK41 3EJJX 1KPUA 4Z78A 5B22A 2PPEA 3KPPB 5CMAA 3W9EA 3IFPB 4ZTPL 4JHVA 1V3JA 1C7TA 3D0AA 4PUXA 1GVIA 4L3ED 3VXMD 1QUPA 4H0LC 4ZW7A 4WI9A 3MVSA 1D5BA 3MLRH 5E2VL 4KK5C 5SX5K 5EF1A 4W9IC 4D8OA 4GP4B 1S8DB 1WCBB 3RWHB 1UKTA 3C08H 1ASQA 1T0MB 2YOCA 1PZCA 3Q8FA 3WFBH 1S9VA 3MRBB 1CGXA 5F6IB 5AVQB 1FRGL 2NYZA 3UIZA 3NP3A 3KJ6H 4XCYB 4LOVA 1TMCB 4IBVA 1PW3A 2Y5TB 3O2VH 1P4TA 4NYLB 2R4RH 2CA3A 1HQRA 2AJXH 3BEWB 3P54A 3D18A 3QISA 5ESAB 5HYJE 4I3RH 2WWNA 3PGCA 4MQ7B 1Q8MA 3AC0A 3ML8A 2IWEA 3V6FB 2F08A 2QTVA 3D33A 5DD5L 4C55A 2BCKA 3WKPA 2I24N 1ORSB 1QW9A 1BVNT 2XX0A 4IMLA 4ZMAT 2VB5A 3MJ7A 3QP3A 1FYHB 3OKMA 4MNGE 3WIAA 3L3OC 4D9LH 2JQAA 4A7UA 5GGSY 4KRNA 2UWEB 4K9EL 5BPPA 4MJ2A 1HKLL 4PRAA 2QSTA 1M7UA 5GXBB 4O4UA 1T16A 2DWYA 4YDJA 1KB5A 3BESR 1MI5A 1K3ZA 2IH1B 5DJXB 4B3VA 4C4KT 5CD5D 3BVVA 1V5JA 4OI8A 4MNQA 4GSQA 1PX4A 3E7JA 1I7RB 4W93A 3M17B 4KXCA 2VH5L 5E8EB 5B38B 5C0DA 1R24A 3TXAA 5A2LH 2QKIB 3HHSA 5IT2H 3G9AB 3ZDWA 5DLMH 4EDWH 4X98B 5HHVH 3QIBD 1LO3L 1FF5A 3JV5A 2MCG1 5D4QA 5FGCE 3II3A 3RAJH 2P8MB 3WD5L 3LNIA 1CLOH 3L3DB 2O5XH 3LIUA 4QKXB 4QTHA 1GMIA 3KM1A 3BOVA 4L5FE 4MX7A 1NUDA 3JWDC 4TN9A 2WLHA 5AYUH 3IF1A 4PJAA 5EZOL 4HQQH 5DMIL 2BNQA 5DMKA 4P9HL 5EO9B 4ZFZA 5GJSH 3G6AA 3INUL 3L3OA 1U6AH 3TESA 3ECBB 1QX1A 1HNYA 4OCSH 4XVJH 2IGLA 4U3HA 1D5RA 3ZZSA 1AANA 5INCA 2VIRB 2N56A 4F7PB 2J72A 2BNRB 3I85A 3HG2A 3OG4B 4FNLH 3FRUA 4LSDA 4N90D 3EBAA 3RDTC 4E5XG 5CF3A 2JV6A 4FQXB 5E9DA 1AGEB 4GH7B 5T3XL 1B3IA 3PWUA 5DK3A 5TQ2L 4AQ8C 4HOMA 3QC6X 5CGMA 1MWAA 4QDGA 3IJ8A 2R2BA 3NCMA 1UD8A 2FTAA 5J1AA 5LQBH 3QFJA 2XQYG 4TOYL 1ZPLA 2AEWA 2XZAL 2VZOA 3OKOB 4U0RC 3UTSD 1YYLH 3K6IA 4IJ3B 3OLGA 2O5ZH 3P2BA 4H2AA 1LEGB 2A4EA 2ZUQB 1L9MA 4J5VA 2JIXB 2IBBA 4U1KB 4ISVB 2D0HA 2IG2L 1T0OA 3LQAH 4BKLB 3M6DA 5D7KE 1GFOA 2ZUXA 4HLZG 5DQDL 5IWLC 4NCDA 3M86A 3WTYA 1RD6A 1BZ7A 4HF5L 5BJTA 3U7YL 3MYZA 2Y2XA 2VCOA 3LYRA 2H0PA 4F7CB 4Z7VA 4DP6X 1QEWA 1YECL 4EBQH 5JHDB 5DGQA 3OTTA 1R19A 1Q9LB 3PHOA 2ETWA 1CFSA 3OWRA 5IUSA 2PCPB 2YUVA 5GRUL 3HPLA 5JZ7C 3VUAA 2YQBA 3MUUA 1E4HA 5J5EA 3O6LL 3F7VB 3VZTX 3BSGA 4PJHF 2KLRA 2CPUA 2Y6SC 1ZK5A 2KDGA 3QQ3B 2HFEB 1WYJA 3P11L 3SDAB 1I9JH 4L1SA 3RDTA 3FUKA 1PZ5B 5ABDE 1DCLA 2ZX8A 5TQ0H 5LWYL 1W0YT 4RDQF 2BS8A 4GG8B 1JN6B 4AQ8A 3KCPB 4ZODA 1XQ4A 2BIHA 1QBMH 2DAVA 3VD5A 3WXVH 4GXFA 2P8LB 3LEXA 4AE1A 1KGYE 4NI3A 5HDLA 5BS0B 4ZW8A 3QHZH 4B50A 4ZW5A 4EIGB 4L1TA 5I8OH 4ZUSB 4Z3IA 2W91A 3TNMA 4ZX3A 1FFRA 3QDJE 3NFSH 5IWLA 5D2LF 3MRDB 2ZTBA 5LXGL 4JRXB 1P1ZA 4QTIL 2RIKA 1TSHA 1AMYA 3V4VL 4GKSB 2J8UB 3CFKA 1ZHBA 1WEJL 3ARFC 3QEQA 2W88A 5EORH 1FNLA 1BFTA 2CDFA 1BEYL 2V7NA 4R2GD 4YK4B 3I9PA 5F9JB 4Y1AB 1U91A 2YMXH 1ZVSB 4N8CH 2ARJB 5EUOF 4AIZB 5IFHL 4OBRA 2D73A 2MIZA 1NDTA 3GXDA 4N2OA 5FW8A 2OYPA 5B3NA 2X4SA 5HHNA 3QNZA 2PTTB 4PJ8C 3NPSC 4MHHI 4EI5C 1BFVH 3CN2A 1DVFD 3L2MA 1WAEA 2AKRB 4J3OH 4EI0A 1AR1B 4XNMB 3QJVB 3QSKB 2BXZA 5DHVB 5DZNA 3RIKA 3UBXG 1R9FA 5G55A 3NT0A 2GBUA 2OXGA 4OSUL 2UY7A 3SDCB 4IBUA 2OSYA 2V9QA 5CU5A 3UBFA 2YBRB 1CDCA 2YAOA 1Q1JH 1YJDH 2X42A 4PV9A 1J88A 4QRTB 3GXFA 3WLBA 3AREB 5DUJA 3ILPA 3O9WB 4YFLI 5AW3B 4ALAH 2BINA 4LCYB 2BP8B 3IDYC 5IHUH 5F3HB 4F1ZA 3K46A 4P4KB 4B5ZA 2I27N 3OR7B 3HRPA 5IBLC 4OD1H 5D7JC 3T4YB 5KVGL 3GMRB 3X1EA 3H3PH 3SGEI 3AWEA 5GS2D 2MEJB 3L4WA 2ITEA 1G7HA 1QLEH 2HTLC 3BGMB 2X7LA 2QLVB 4FABH 3ARFA 2PWEA 2FYYB 1G1OA 1F6LL 4NKOB 1OE3A 4ZOEA 1AYOA 3KWVA 4X0KB 5DJZB 1YY9C 2BSEA 2YJQA 3C60D 2DQGH 3VXPB 4M6AA 2J6WA 2O4EA 4NO5A 5I19H 5AYQA 3GMMB 4S1DC 2WW8A 3VI4A 4Z7WB 2X2YA 1B4LA 1TQSA 5TDPA 4EI5A 3NFNA 1JTTA 2WMPB 1OAKL 5JR1L 3AQYA 4JPKH 3OHXC 3RWIB 3DRQA 4J8RB 1AHKA 1CD1B 3BP5B 3DJZA 2Y22A 5A6IA 1AIFA 4AYDC 4QEGA 3GIVB 4PJ6A 5B1KA 4LIQH 4KUCF 2R0LH 1F86A 3U2SB 3BPCB 3DX3A 3K4AA 3ILEA 3O45B 3R19A 4G6FD 1RVFH 3D07A 1SLXA 4NRXA 5F9WB 4HH8A 4R97B 5E2UH 1YEFL 4TULH 2RFXB 1DN2A 1U95B 3BSHA 4M6ML 2AAAA 1HSBB 1ASOA 4N1HB 1V7NH 2R1YA 5DWPA 5D7JA 1UA6L 1JPGA 2RH0A 1EHXA 3H6JA 4LKXB 2C9SA 3KS0J 3KHOA 4KVNH 4XP4L 3CUPA 5FGRA 3ZIYA 4JRYD 5EEXA 2HLFC 2C9QA 4NQXA 1RERA 3FO1A 1WBZA 4LLDB 6TAAA 1UFUA 3GJFK 1D5XA 1J5DA 3HOEA 3C12A 3DURB 1I1YB 2X1PA 5AOKA 4KNQA 2XXCB 4I0KA 5CD3A 4LARL 3R7QA 1QSEB 3KBHE 4NPJA 3CLFH 1A6UH 2Q7YA 4YHZL 3O6FC 3CFBB 4HUCA 4KKZA 1NGZA 4PRPB 1F18A 1HCZA 4Y19B 2XYBA 3MYJA 3OHXA 3SPVB 3SGKC 4PSRA 5E8NB 3WI5A 5EPMA 2R69H 4C69X 1ZT4B 2FD6H 1JF1A 4XCFL 3GHBH 3K0YA 1JWMB 2MSPA 1NL0H 3E6FB 1OWWA 4LLUB 4GAYB 4QXGH 2DMCA 2V6HA 3X3GL 2X6MA 3QK0A 4AT6A 1G9NC 1GJWA 3STZB 4HVBA 1YPZE 4ZTPH 1HL9A 3AXLA 3D7PA 1JNNH 2XTJB 5K1JA 1QBLL 5E2VH 4ENED 2EDMA 3C5XA 1CK0L 3AA0A 4UDUA 2X10A 3B3IB 4P0DA 5CIPA 2WKGA 3SPGA 3HI6L 3T77B 1UB6B 3CHQA 3VSUA 2WB7A 2WSKA 4G8GB 4BFIA 2LLGA 3N41B 3WIHA 2K6WA 1FRGH 4F91B 5T1KA 4BINA 3HS9A 3OKDB 1K2DB 3POQA 4JY4A 5SV3A 2WKLA 3S96B 1MF2H 4KY1L 1DUZA 2FRGP 4UQDA 2AV7B 5ESQA 4YX2H 2DI8A 1VIWA 3S36X 6PAZA 1G6RA 2FIKA 4WY7H 1E4XL 2EE9A 2OX5A 3O6FA 3NP4A 1U93A 5PAZA 2ZYSA 1KPUB 4U1MA 3WNLA 4Z78B 4Q2ZA 4TUUA 3BRZA 5CMAB 3W9EB 3SGKA 1ZJAA 3S35L 1FIEA 2VLRA 4KXAA 4OZGF 2A9BA 2HPOA 5FAAA 1ZCRA 2E0PA 3GSUA 1D5BB 3MLZH 3NJGA 3WJMA 2I9LA 5GRJL 3TEYA 1JK8A 5I17A 3TASA 2WVVA 4K9EH 1HKLH 5IVNA 2C3VA 2MOGA 1S9VB 3BUYB 2BOCA 2FLRT 1YEIL 4UZUA 5JHAA 4LLVA 1IC1A 2FVNA 3K19A 5JUEL 1BDYA 4AM0A 4YGVA 3X12A 4DO5A 3KZIO 3CX5K 3S3CB 1Q4NX 3ISWA 3GRGA 3MOQA 4K71C 3O6KL 1HQRB 4P46C 3OHMB 2BVQA 4HZ1A 3D18B 2LFEA 4HZAA 1UEMA 3PGCB 1OM3L 1UWEL 1NGWA 4WENB 1TPXC 4I3GA 1BCIA 5EEWA 1OV8A 5HVGB 3IFNL 5DQJA 1D5IL 2Y0HA 1LO3H 1E6OL 3NEOA 3T2NL 2BCKB 4CBPA 4ZS7L 5IQ9A 4YZFE 3ZVVA 5FEBA 5BMFL 5IHZA 3WD5H 4IMLB 2CO3A 3MJ7B 3OKMB 5JQ6L 4OCYL 4GRWB 1GXEA 4FZ8L 4GP5B 3QEHA 2FO8A 4LOUC 2XY1A 5EZOH 1P5UB 4PRAB 1KJ2L 4QOKA 1OSMA 1CZ8L 4JE0A 4PRIA 4YDJB 1CBVL 1IAII 1KB5B 1MI5B 2XFXB 3BUTA 4PWIA 3HG1E 1IQWL 3ALWA 4MNQB 4WGWB 4DHLA 4LOEA 4GAJL 2A77H 1A66A 5C0DB 1R24B 3NZSA 1M71A 4FT6A 3EHBC 3HHSB 5E4IA 4DKEH 1KCWA 5B4MC 1UH3A 4MJ4A 5D5MA 1ZLEA 5DF0A 3DSFL 3ULVL 2ZF8A 1JP5A 5T3XH 2EKSA 4P46A 5TQ2H 1AXSA 1GA2A 2FBOJ 2Z1PA 3BCFA 4QTHB 4HWEL 5JXAL 4TOYH 4U1GC 4PMEA 4CMHC 4HJSA 1UH2A 2LVEA 4MX7B 2O72A 3IF1B 4PJAB 3MLYL 2C7FA 2DJSA 4I18C 2BNQB 2PWFA 5DMKB 3T6QC 4KZEL 1CE1L 4ZFZB 1ULVA 3G6AB 2BZDA 4RRPG 4WTQA 3L3OB 3ZDYF 4E5XA 4MZ3A 4BSJA 3HA0A 5AW2B 1NOAA 1JRHL 2NUPA 4BHUA 5DL7A 1NBQA 5IY5B 3U7YH 4BDVA 2N7SA 2QLYA 4FQCL 2FO4A 2Z64C 5INCB 3ILDA 2XQYA 4PWFA 2EXWD 2FK9A 4YS4A 3V10A 1NUNB 3FRUB 1HOCA 2IF7A 3EO9L 4XN7A 4LGRB 3SPCA 5E9DB 1X5LA 3O6LH 4JPVL 4OZIF 2BWQA 1WWAX 2OTUA 2EIEA 1MWAB 4CBZA 3P11H 1JWUA 2R2BB 2WSDA 4XNUL 5J1AB 3QFJB 1CF8H 1H3WM 4HK3N 5FO9A 1TCRA 1E0OB 4WI7A 3TN0D 1R17A 4FI8A 3MJ9A 2BERA 3ESVF 5LWYH 3FFOA 4KX8A 5D71L 1GW0A 4HUKB 4WIQA 4Y2NA 5KN5A 4JKKA 4WUUD 4G43A 4XC3L 3BT2L 1RJLA 4LSSH 4CVXA 5E8DL 1OT2A 3UFIA 4HETA 2NYYD 3RPIA 3JT0A 1BZ7B 5BJTB 3DHMA 1RZPA 5E4EC 3S7GA 4LCIL 2FX7L 4I18A 4O51A 1IB5A 1R3HA 1QUNA 4Z7VB 3LKPA 1I8KA 1QEWB 1T7ZA 1QJ8A 5D9SA 3ABKB 3PHOB 3TEZA 3GMPA 1KZQA 4TNVK 1CFSB 4AGPA 1NC2A 3HPLB 3JV4A 1EQWA 2YA0A 5LXGH 4MQTB 4YZWA 4QTIH 4D3CL 5LBSL 1ODAA 1RJZB 5FUZL 3V4VH 2HZHA 3JV0A 2FBJL 2XPGA 4PWHA 1L9NA 1WEJH 1UWFA 4FXTA 3RDTB 1BEYH 5DGRA 1VAHA 3BH8A 5IFHH 3I6SA 1QBAA 2X41A 3ULVD 2G3MA 4UQ2A 1ZK9A 3AAZA 4U0RB 3UG3A 2GI0A 1HXMA 4MA3A 3CMGA 3LEXB 4PJ0O 4HS6A 4BSWA 5I8EA 3B2UD 1Z9MA 2FUQA 1LK3L 2V37A 1FIGH 3ESMA 1JBJA 4GJTB 3TNMB 1E2VA 4OSUH 4U05A 3D51A 5E4AA 5LGJA 3WDHA 3SGJC 3MFGB 5EA0H 5DC2A 1DDTA 1HT6A 4L8CA 2OSLA 1OZUA 2XV6B 1P1ZB 3BUPA 5HVWA 1A2YB 1CDIA 4N0CC 4P07A 4UT9L 3CFKB 1PGRB 1ZHBB 3IBEA 3A6CL 4LHUB 3QEQB 5IQNA 5KW9L 1N2RA 2MQCA 5IVZB 3NCWA 2CDFB 2V7NB 3S9DB 4FQJL 3F64A 3DX9A 1U91B 1SVBA 4LSPL 4F33A 3UBXA 1DVQA 1JHTA 4KTDH 5ADOH 1WISA 4KKLC 1F90H 2IMMA 1AKJD 1IEBA 2X4SB 3GS4A 2R8AA 3QNZB 4M03A 5HHNB 1R47A 3CVBA 4OJFL 5EZIH 2W07A 3KVPA 1EAQA 3AA7A 4POUB 2GIMA 4UOZA 4QHNB 3HUJF 3QJZA 2OXGB 2UY7B 2B0SL 2BRQA 3TO4D 1QSFE 4XAKD 4PV9B 2OK0L 1AZNA 1FL5A 1OAKH 3WLBB 5JR1H 3ILPB 4G7QB 3D50A 2NT0A 2Z8RA 3QIUD 4HYTB 2C9VA 2VDQB 4KNSA 4LHQB 4ZTEA 4B53A 5KAFO 4UV4L 1IZKA 4OF5A 3SGJA 3CVIL 3AA6A 1ED3A 5TH2A 1QNIA 4Y2OA 4F2FA 4BIKA 1YEFH 3DVIA 4MA8H 4Z7NE 2EINB 5J0BA 1G7HB 4N68A 1MIEL 2X7LB 5TJWK 3MRNA 3ZRCC 3ARFB 1NLBL 4DGUA 3QEUA 3DC0A 4JFZH 3WELA 2HT4D 1UA6H 1ZOXA 4OI9A 5I66A 3OMIB 2P9RA 2ZG1A 1QD0A 3SZVA 1PKQE 2AQ2A 4XI5C 4G83A 2P8PB 5HHOD 4NO5B 4XP4H 4GXUM 2DMGA 5EBLA 3U1QA 1MFAL 3VI4B 1OTSC 3TEWA 1JIBA 1T1LA 1CURA 5TDPB 4EI5B 3NPSB 4AI7A 1GC1C 3NFNB 4DTGH 1WF5A 1HTYA 4KNTA 3RVUC 5JXEC 5C0CE 1KGJA 3DRQB 1BZOA 1PCSA 1OVZA 4LARH 4R90L 4W4OC 2GJ6E 4LMQE 1AIFB 3VM5A 4P57A 4YHZH 2WLMA 5J12B 5DJCB 3ZQ9A 4FD0A 3RGHA 4NRXB 4PJEE 4R7VA 5EOCL 2O6PA 2XVGA 3TT3L 1OAZL 3QH3B 3IDYB 3T0SA 3LZNA 4HKXA 4P49A 2R1YB 5D7JB 1JPGB 3X3GH 2C3XA 2PKDA 4CKVX 7PCYA 4AUIA 1FE8L 1MCWM 1SMOA 3CUPB 4H4NA 4ZMQA 1HS6A 4NQXB 2WNGA 3FO1B 1WBZB 2F19H 1D5XB 3LZQA 5FC9A 1EFXD 3V8OA 2NW2A 3MGAA 3HI6H 4NN6C 5CD3B 3ULUC 1U9KA 4EN3C 1OLZA 4IKIA 3CVHA 2Q7YB 1XZWA 5BUGA 5AKTA 1NGZB 2JCCF 3II2A 1SBBA 4NRZA 5JXEA 1YYCA 4JFVA 3MYJB 3C9NA 4UF7C 1I9IL 3OHXB 3Q2VA 4WCYL 2EADA 4W4OA 5EPMB 4TMPA 3S5YA 3IDUA 4B97A 3SYAA 2P5ED 1CFBA 1JF1B 5C0EA 4FL4C 1KV3A 2DKUA 1AAJA 3FB8A 3JWNE 1PEZA 4NQQA 3DA4A 5B7EA 1JPFA 4AT6B 3AA1A 4FFZH 4WK2B 1AD9A 5HDBE 4DP7X 1F1AA 3NVQA 3S35H 3ZYIA 3MC0A 1U2YA 3AXLB 4WFFD 4PS8A 2HJKA 4N2LA 4J7RA 2LVCA 4RMWA 5K9QI 4ICWA 3FQXA 1TLMA 3OMNB 4UDUB 3AA0B 5GRJH 1KEML 5CIPB 4DP8X 3IGKA 2FJHA 2WIMA 3PHSA 3ZUCA 1JZIA 1DQDL 3OWEA 1L0PA 1OOWA 2BVUA 4IRZA 4Z0XA 3E8UH 1FA4A 3IVKA 1TO5A 1B9ZA 1Q0EA 1TYEB 4JY4B 3KWTA 3ARRA 5J13C 3EADA 4EKJA 4J2XA 1DUZB 4LPVA 5TDNA 5ESQB 4EN3A 4YHKL 3LN9A 4FFYL 1G6RB 2FIKB 4F4BA 1F0LA 3TBWA 3O6KH 4XP9H 2OX5B 3O6FB 2NY5C 3V8UA 1U93B 5J7CC 5K59F 1OM3H 1UWEH 4U1MB 4Q2ZB 4NUPA 4GFTB 4UQ9A 1VENA 4UZGA 5CJXC 1MRCL 4BE6A 1J1PL 3IFNH 5C0IA 1D5IH 3T2NH 5DA0B 2VLRB 1SDAB 5BMFH 3RY5A 1I4FA 1NA8A 1Q90A 1P84J 5ECGA 3GSUB 5LBGA 3WJMB 3VXRA 5JQ6H 3Q2WA 2I9LB 1YNKH 4OCYH 3ASWA 1JK8B 4JG9A 2LW3A 4Z7OE 2NNCA 3NCJH 4ADGA 5BQDA 1KJ2H 1DLFL 3HKZA 2C3VB 3CBRA 5ITBH 1FWXA 2X0WA 3KAAA 5I15L 1CBVH 4P3DA 2BOCB 3MLXL 5BZXA 4LLVB 4B9IA 3B7RL 4AM0B 1IQWH 4YGVB 3X12B 1BM3L 2PPFA 4R4FL 1UWXK 3QXWA 4KKAC 1EEUA 4N0YH 3I74A 2BVQB 2IAMC 4IOSA 2OS7A 2ZPKL 1NGWB 3BDXA 3GXIA 1Q0XL 4HS8L 3WAKA 3DSFH 5GGRY 3RVWD 4NWTH 4PJIF 3SE4C 5DQJB 3ULVH 4OZHF 1LXMA 2EVJA 2H41A 4PJCE 4M5ZH 2C4XA 4YHOH 5IQ9B 1QR1A 5IHZB 2YSSA 2Q20A 3A47A 1CGSL 3NJLA 4A7GA 5JXAH 2EH8L 2X38A 3WNMA 3QEHB 4F20A 5CJXA 1UA7A 3T8XA 1FBIL 4L23A 1FZOA 4QOKB 4PRIB 2HTKC 4BQ9A 2BXYA 5K9OA 4KZEH 3EFDL 5KS9F 5DQ9A 4PS7A 1VFAA 4OJYA 1JRHH 1PSKH 1F42A 4OUOA 1Z9OA 4IHOA 3GB7A 2NY6C 4Y4HC 1IBZA 2AEPL 2VLKD 4UINL 1M71B 3WY4A 2FATL 4OLYL 6PCYA 1KZYA 2BFVL 5IOPB 5D5MB 3L8QA 3TFKC 1U8JA 3EO9H 4HJ1A 4M3HA 1GFNA 3DWNA 4ILDA 1IGML 4PYGA 1F4YH 3U9PL 1PG7L 4K71B 1KOAA 2EKSB 1AXSB 4RRPA 2VO8A 5MEND 2DLHA 2IAMA 2NX5A 2XIIA 4XNUH 4YSSA 3IDMB 5L4IA 4LAJH 1TPXB 2G5RA 3FULA 5CEZL 3SE4A 3VGHA 1L9SA 3VRLE 3KPOA 3KYAA 4KI5C 3S0PA 1NWPA 4I88A 1XO8A 3QUXC 1GMEA 5CEYA 4XC3H 3BT2H 1ML0A 2APTA 5AVUB 5E8DH 4E5XB 4CVUA 1S7SA 1IX2A 2NUPB 3CHPA 4V33A 3SYCA 4LCIH 4BDVB 2FX7H 3PWPD 4QF1A 2ORBL 3GSVA 2FO4B 1NCJA 4LRIC 1ECYA 5DJAA 3LOWA 2AXFA 3FUNA 3MCG1 4NQEA 1HOCB 1JZFA 1EH9A 2NXYD 1E3XA 2RJMA 1JHKH 5CFAA 2AERT 4G75A 3AITA 4QGYA 5LBSH 1MCKA 4A6YL 4Y4HA 2OTUB 1Z9SA 2VDRL 5AKRA 1HHGA 1BMZA 4P2RA 4WI8A 3EHBB 4B9CA 1JWUB 2XYCA 3GZOA 1KACB 4BK8A 5FO9B 4OLWH 1TCRB 1OCRB 3U2IA 3BE1L 4U33A 2VERA 3NDYE 4ELME 1EIBA 5KN5B 2CRZA 3PGFL 5FF6A 3IMRA 5KOVC 3NSDA 4G43B 2ZWZA 3S35X 1DBBH 1TJGH 1RJLB 2PYEE 4CJ0A 3CSGA 4CVXB 4U1GB 1ONQA 3EH5B 5M95B 3RPIB 4CMHB 3MLPA 1QRNA 1T21A 4E2OA 1F3DH 3GXTA 3MU3A 4IRSC 2DQUL 3CFQA 1R3IH 3APDA 1KCUL 2XWRA 3CAFA 3QUXA 4I18B 1R3HB 1QUNB 2WGNB 4H1LH 3LKPB 4GEJA 1I8KB 4O51B 5C3IA 4UTAL 5D9SB 5DHXB 3QXDA 3L6FA 1RULH 3GMPB 1UATA 4FI6A 1NC2B 2H4EA 3PG2A 5F7DA 3VXUD 4F8LA 2AABL 2EAEA 2IGTA 3JV4B 1U8HA 4RCAA 2FQDA 1SLUA 1KPRA 2WLZA 4X6DF 4HH9A 5F97E 5T3ZD 1TQCC 2VXQH 3CHXA 2HX7A 3ESUF 1NEUA 1CLYH 2B2XL 4LRIA 4UT9H 5EU6A 3UGXA 2XPGB 2NY1B 5KW9H 1AP2A 2EUXA 2EVGA 2AXJA 4UTBL 1KSRA 4FQJH 1UA3A 4FYTA 3BH8B 5ISZD 4KGJA 3EJPA 1ZV5A 2F9BT 2VN4A 1RIVL 1JYNA 2L04A 4ODTL 2ED6A 3BVTA 3RTLA 3C6LC 4XN5A 3VGAC 2FB4L 4UQ2B 3AAZB 3GNML 3PE9A 2XN2A 3GO1H 5AOLA 4OGYL 2CPCA 4KROD 1FG9C 1HXMB 4HS6B 4BSWB 2B5IC 2WXNA 1QRNE 3OKLA 4P2QE 2Y3AA 5I8EB 4JZJC 4Q9QL 3RTQD 3LVTA 2WTOA 2OI9C 3ET9F 3AUWB 2WSPA 3H7LA 2P80A 2CA4A 2B0SH 4WHDA 5LGJB 2OW7A 4PJ7B 3KJ4C 3T0BA 4L8CB 1I9RH 1LMKA 2OSLB 2OK0H 1A47A 5E4EB 3WUWG 4IRSA 2OR9H 1GZQA 3ZU8A 2L7QA 1BJ1H 2EJ1A 1OT1A 3T6VA 3T6XA 3PDDA 1GIGH 1N2RB 1Z3RA 4ICXA 1C08A 1T83C 5D1QC 3DX9B 1JMXA 4FG2A 4H44C 2AJZA 1WWWX 4Q9RL 3DTXA 2RBLA 2WJ5A 3UBXB 5CP3H 4F33B 1JHTB 1PBYA 1NUFA 3PAZA 2P5WA 4NZRH 3RILA 3NABL 4J1UA 1IEBB 5L2KE 2M83A 4PRHE 1OP5K 3N91A 2W07B 2GYSA 4L9DA 3F6IA 4OCRH 3SDXA 1O7VA 3AA7B 4OGAC 1DJZA 1MFAH 1ZY9A 3C6LA 4P23C 4IOFC 3SBPA 3OJDA 5IR1B 3KLHC 5E4OA 4FNTA 1HL8A 1T5WA 3QHTC 4B6ZA 1ZANL 1FL5B 4H8VA 4BUMX 4MHHG 4R90H 4JZJA 1JGEA 3UAJC 3S88H 1BXXA 4NXSA 3MUJA 4MDIA 2HG5B 4PGZA 4RLBA 1JYXA 4MAYA 1I75A 1KTLA 2DD8L 3LXBA 5HGDA 1DJYA 4AFKA 3AA6B 2AQ3A 1ED3B 5TH2B 2ZAHA 4Y2OB 3AG1B 3N1GC 5EOCH 1OGAA 3Q43A 5AW1B 4YFDB 3V0WL 3FU8A 1OAZH 2ZWNA 4XBMA 4P5TC 1J9TA 3MRNB 3JZYA 1X4ZA 3QEUB 5L88L 1IM9D 5I5JA 2LTQC 4AMKH 2A0LC 1T83A 5D1QA 1Z9LA 5I66B 3LB6C 1C5DA 3B2XA 5ACLA 3MV9E 1EVUA 4LRNL 1ADQL 1NIFA 1Z6JT 4ODBD 4MDJA 1A3RL 1FE8H 5EBLB 5FFGA 1ADWA 3BJ91 2P4AB 5J57B 1HN1A 3H9SA 3GLZA 4ZW6A 4F8PA 2YGVA 4DEPC 3NIFE 3KYMA 3IPEA 3UTTE 1NH6A 1A64A 2MH4A 2Y2TA 1PLCA 4P23A 1G7PA 1JUFA 3PJNA 4W9FC 4P57B 2UXVA 1KFAL 1Z0NA 4NZFA 1HWHB 4DP1X 1GY1A 1I9IH 2G0LA 3NACL 5LCVH 4ATTA 4WCYH 1ESOA 2F74A 3V7MA 3UAJA 4JPIA 1MFVA 4HUNB 2BOLA 4HKXB 4MAUL 2BRRL 3ELQA 1VFMA 2MJWA 3SYOA 4A04A 2IOIA 2WPGA 4X8JA 4NQCA 1GPOL 3GSWA 2XG5A 2IADA 5GZND 4P5TA 5CKAA 4TNVF 3VGEA 1A8JH 2H2PD 2C4FT 5GRXG 1E27A 4FJ6A 4MGXA 1SBSL 3E3QC 5K5YA 3W5MA 5C0RL 2H1PL 3AWFA 2NW2B 1KEMH 2TAAA 3BAWA 4ODSL 3MA7A 1EEYA 1H6EA 3QDMA 2Q3ZA 3CVHB 4FG6D 1NPNA 5EIIG 1KIUA 3NN8B 1INQA 1NANI 4CVWA 3EZJB 3PJLA 2KDYA 4NRZB 3C9NB 5FLUA 3DA3A 4X6EA 4AL8L 2XWEA 4JFQA 3C2SA 4YHKH 1U33A 3BKML 3TFBA 1X9RA 4M8RA 5C0EB 3G7TA 3FB8B 2E6JA 3HFML 1W6LA 4N59A 3NOIA 2H9GA 2JKSA 4H13C 4PD4K 4RGOH 3V0JA 2N2MA 1JPFB 3AA1B 1MREH 1AD9B 1MRCH 1J1PH 4N8PA 1DBAH 4MS8D 1O7DC 1NGXA 4QNPF 4HU8A 1OARH 2HJKB 1X4YA 4BYHA 2I07A 1Z5LA 3FQXB 2FT8A 2H3XC 5EBGA 1ZV2A 2FJHB 5F7UA 1PKOA 4F8OA 2QPUA 2ZCKH 3BAYA 1ET7A 4G9FE 3K0WA 1PHOA 4M8UA 4JG1L 3NSCA 4UILH 4Z0XB 2FO1A 3TX4A 1A65A 4QHLA 5I15H 3F00A 3IVKB 3MLXH 1JGUL 2W80C 5A3ID 1AS8A 1MCEA 5KJRL 2WBXA 3L5XL 3Q8BA 1DLHA 5AOZA 2DQMA 5TE4L 1BM3H 3MRPA 3G5VA 1B0GA 4FC3E 4NN6B 4LSRL 5DVMA 5TDNB 1ZHKA 2MPAL 4EN3B 4QRPA 5C2BL 3CGTA 3TBWB 1G9HA 4IRJC 3LS5L 1E50A 2JI2A 4AG4L 3QUHA 4YE4L 2V17L 4I87A 3U4BL 3H9ZA 1Q0XH 4HS8H 3T2LA 5C0IB 4D2NA 1TFHA 1DR9A 4ZMNA 1EEZA 4JEGB 5FYKL 4FL4B 3C5SA 1I4FB 3BN9C 2X4UA 3MV7A 3MRHA 4X99A 5KOMC 3VXOA 4TYUA 3VXRB 5DMYA 1L4IA 2EH8H 1IUZA 2RB8A 2BNRD 2YR3A 2XA3A 3AQXA 3KPLA 4FFWD 3DV4A 5AOIA 4WWKC 1RUML 4FQXD 4NAQA 2F18A 1M2OA 1RH8A 4HSQA 4P3DB 3EFDH 5FGBC 2WQXA 3HS0C 1BBJA 3RLSA 3VMNA 4F27A 4URKA 4N2NA 3WTTA 3D39E 1RZGA 1MW1A 4ZTOL 1KIRB 2X40A 5B8CC 3LNGA 4PWGA 4QRPE 3UTPE 2AEPH 2E86A 2JIXD 4JFPA 4UINH 3VG9C 4B41A 5F93C 1ORQB 3UAEA 2FATH 4OLYH 4AK1A 2BFVH 2YA1A 5J13B 3ZMRA 2ZE0A 5CHNA 5TFSH 4FJZA 2YRBA 4ZRGA 4G3YL 1FFQA 2VDLB 3NZHL 4QTFA 4X0NA 2MCAA 3U9PH 1PG7H 5GGSA 4YMPA 4IRJA 4NQSA 1QR1B 2YSSB 4OLXH 2XE1A 4RDQG 3QQDB 5FUOH 4OQ1A 4Q6KA 2O93L 3QB7C 1QFUL 4ZD3L 5CEZH 3T8XB 1B4TA 4J6RL 4X7TA 1FZOB 2A6JA 2XWBA 3O81A 3JWOC 4HULB 5K9OB 2BY0A 3VRIA 3MKGA 4PJXA 2WD0A 2ZKWA 5DQ9B 3SDAD 4OZFH 4WI3A 3WN5C 1VFAB 2D3NA 4NT6A 4N2IA 4RFOL 4U1LA 3W39A 5ACZA 2YC1A 4WWKA 3BFQG 5MHSE 1JZ2A 3M1CA 4X8XA 3QRFM 4HFUL 4IHOB 3GB7B 5JIIA 1OY3B 5H2BA 1JD7A 4RESB 2IQ9L 1TZ8A 3FUDA 5FGBA 1GKEA 3HS0A 3BXNA 4XPFH 3T2QA 1AO7E 4N0UE 3E2HC 3DXAE 1U8JB 1E67A 4H26A 4N5UA 3QJFA 5I0DA 4YC2C 4BZ1A 3POHA 5F89A 4A6YH 5B8CA 2WHVA 2VDRH 5BS0D 1TF4A 4OAWA 2IAMB 2NX5B 1QA9A 4L4VA 4YVNA 2W59A 1GGCL 4Q52A 5TD4A 1EEQA 4D7PA 2DQJL 1KC5L 4GG6A 3ZE0E 2LFUA 3SGDI 1L7TL 4YFEA 2ZF9A 2X89A 4Z95L 1YN7A 2XN9A 3BE1H 5KVEL 4L29A 3KPOB 4EN2A 3QQ9C 3MNZA 3NRFA 4YDZA 3ZTJH 2P24A 2VZSA 2ZKYA 3PGFH 4JRXD 5CEYB 5KWYC 3BVUA 4TL4A 5FYKD 3NMEA 1CI5A 4FQIL 1S7SB 1E30A 1EJOL 1UM6L 5FECA 3QO1A 3IDXL 3V6BR 2BDNH 5BVPL 4WU7A 4QF1B 4Y1AD 1KCUH 2VN5A 3GSVB 1QFWL 4PUBL 3PNWA 4KU1A 3S37H 3U4AA 5DJAB 3QC5X 2AXFB 2MCPL 3WN5A 3FUJA 4NQEB 7FABH 1EJ8A 2AABH 4TLTA 1K72A 4X4YA 4D65A 5KSBA 2GTQA 3O8XC 2NY6B 4Y4HB 4G7SB 2B2XH 1Z9SB 1AR1D 1HHGB 4P2RB 2H32H 3VNZA 1ZA3A 4IU3A 4HALA 1X5XA 3SDCD 4M6NH 2J1YA 4UTBH 3ES6A 1EUTA 3DLQR 3H42H 1WH0A 4FMFA 2Y69B 4Y9GA 4JREC 2J3SA 3ARED 4AQEA 1DHKA 3O9WD 2XA8L 5FF6B 3PGUA 2UZIL 4ODTH 3EG9B 2X27X 2FB4H 5CN2A 1ONQB 5EFIA 1WAAE 1JXGA 1YNTF 1YEKL 4DSYA 3GMLA 1QRNB 1T21B 4P4KD 4HEPG 5G5DA 5DFTA 3UC0L 2CR6A 4OFYD 2J8HA 4Q9QH 3MNVA 3QUXB 3ZE2F 3ML9A 3WCYA 4GS7C 4OLUH 2AEOA 3QXDB 2E9WA 3L6FB 3LRMA 5F7DB 4KV5F 4NQUA 2XBTA 3EF4A 1U8HB 1OIOA 3P4LA 4NFDA 3KLLA 1KPRB 4FEMA 4HH9B 2Q8BH 2ED8A 5E7FA 2WZ0A 3U1PA 3AABA 5I28A 5DDHA 5EU6B 1P7KA 1AP2B 2OBGA 3WDJA 4JL2A 2YN3A 3F62A 2L7EA 2E76C 3CU7A 3FT9A 3DARA 4Q9RH 3O8XA 3VB8A 3VA6A 1BH3A 1XAKA 4MXQC 2YD3A 2FZ3A 3D1MC 1BJ1J 1HNGA 3NABH 1EX0A 2BLFA 4DKTA 3WUWA 2QQKL 2FDBP 3NA9L 4PQXA 2HFTA 2OLDA 3OKLB 4HIJA 4Z7IA 4HJUA 4M00A 1BSIA 4P59L 1J5CA 5GJTH 4NJAH 5DWUL 3RKDC 1NFDE 1A7PL 3TV8A 3BT0A 4ZOBA 3ZY7A 3MTRA 5HDQL 2X1WL 1ZANH 4M7LH 4IRSB 1XD1A 1GZQB 5IOKA 1J8SA 3F05A 4G7VL 3WJLC 4ADIA 3LXAA 3IETA 4NN5C 3D3VE 3VSQA 4ZMYA 3T8MA 2DLIA 1KJ3L 2VMCA 2DIAA 2DD8H 4ONOA 4ZNEA 1C08B 1JL8A 2F7QA 2K4AA 2JE8A 4XN1A 3PQYE 1UD5A 3EOAA 3IXTA 2AJZB 4G1EA 3DTXB 1TQCB 3WEOA 3V6OE 2P5WB 3K1DA 3OM3B 1QSED 1MJ8L 1PG7X 4J1UB 5KVDL 5L88H 3LVEA 1B88A 4W68A 4DOHB 2Z35A 4PRPD 3SDXB 4Y19D 4HPYL 3UU2A 2GEQA 5EOCJ 2QPSA 4XB8A 9PCYA 3IDJA 3C6LB 1BT9A 3VGAB 3OJDB 4TQIA 4UNUA 3ZDXE 3CDGA 2YS4A 1T5WB 2A6IA 4Q9BA 2B5IB 4JZJB 1F1DA 5D7HA 1JGEB 2R51A 4JCWA 4CSZA 3RY4A 3K3QA 4NB7A 1KB5L 4MDIB 3C2AH 4MAYB 1KGWA 1KTLB 5EU5A 5HGDB 4HCIA 3KJ4B 2XTJD 5K39A 4JB9L 1QATA 2F1AA 2JNZA 3FTWA 3EJTA 5DHEA 3NACH 4WHTA 1OGAB 3CSYA 4HUMB 5AYTA 3WJLA 2RACA 3RURA 1MZYA 2ZP0T 4ODVH 4MAUH 4PB9L 1BVOA 4G8GD 2FLBT 1M42A 2KKQA 5D1QB 1A7RL 2VW6A 3V8CA 2ZONA 1MCLA 2MWCA 4Z3HA 1C5DB 2KL6A 1Y6NR 1URIA 2B77A 2DLEA 4MDJB 4JFDA 2CCWA 2V2WA 2ZOWA 3ARQA 1RZKC 3H9SB 1SBSH 4PVMA 3S3SA 1WPCA 5C0RH 1SMDA 2H1PH 1T1WA 5FYJE 4DESA 5JW4N 4ODSH 5BRZA 3T3PE 2EEFA 4Q7DA 3KYMB 3RVXD 5IJKA 4KH2A 4XNZC 4P23B 1G7PB 1JUFB 5I18H 1VADA 2HKAA 3WTWA 3BLPX 3L7EA 4L1DA 1CD9B 1FN4A 5DRXA 2QTKA 1SY6A 2ESVE 5EN3A 4D94A 3EW3B 4ABUA 3WTXA 2F74B 1LEKA 4N8VG 4JPIB 5J6GA 1XXDC 1N68A 3SY0A 2CRMA 5ICYA 3QNXA 2ZWKA 4QJ3B 2YAHA 4U0QB 3VFOA 3GKZA 1IKNC 3CZGA 2WTRA 2F61A 3DHUA 4X8JB 5IHHA 2CR0A 4NQCB 3ABZA 3GSWB 1ZHXA 5DMGD 2XG5B 5EIIA 3ISYA 3HZ3A 4P5TB 3ZKXC 1MWAL 2CGZA 4D9RD 3GTVA 3V4UL 2LTQB 1E27B 1VGKA 3S8GB 1MSPA 1OL0A 2VZ1A 4M1CC 1CGTA 1RI8A 4QQ1A 1Y07A 1JVLA 3CFNA 4OZ4A 3MA7B 3C5ZC 1EEYB 4HLJA 2OJEA 4UBDD 5IQLA 1T6WA 3QDMB 2WQAA 5M94B 1SYSA 3NYKA 2XN1A 4JG1H 2TSAA 1KIUB 3KWWA 1INQB 4K4KA 1JPSL 1T04A 2WINA 4LCUA 1JI2A 5KJRH 3L5XH 3JWDL 2Q76A 2WO4A 3L9EA 4DEPB 2XWCA 4X42A 1NMCC 3ARDC 4X6EB 4LSRH 4JFQB 2MPAH 2HJFA 1TTGA 2IO5A 5C2BH 1KBKA 3VTTA 5IROC 2H9GB 4YE4H 2V17H 1OW0C 3HFFA 3U4BH 1Z3GL 3N04A 1MI5D 3IS0X 3PF2A 2DN7A 2ZOLA 3AGWA 4KK5D 2AANA 2XSKA 1WITA 2J12B 4YQXH 1NGXB 2VMDA 4MNQD 2LAGB 4ZQTA 4BCXA 1D3CA 3L13A 1YLBB 1SF5A 4XMPL 1G7JA 4JMNA 2I07B 1Z5LB 4EI6A 1IKNA 3J07A 1NCNA 3NSGA 1EANA 2CQVA 2BVEA 2FWLB 4AQAA 4FXKC 1RUMH 3QAZC 3QJOA 2P43B 1HH9A 5ITFA 3UCQA 4WVRA 4IU2A 5JOPE 4NHUA 2CJSA 4WJKB 3TT1L 1G9MC 1B0WA 4M61A 4QHMA 5FB8A 1DLHB 5K9QG 2XKNA 3FO0L 3APNA 2CDEA 1B0GB 3C5ZA 3G5VB 1ZE3C 3FOLA 3MRPB 1ZHKB 2WB1A 3C87A 4ZTOH 4QRPB 5DHVH 4ZI8A 4LNRA 4B61A 1NFIA 5J6HA 2NQDA 5HHPA 5JYMA 1DL7H 1GGYA 2BNQD 3PXJA 1ACYH 1HXTA 5HYQA 3KE0A 4KX9A 1Q72L 3ARDA 1AG6A 2EE3A 3NZHH 4XOCA 2C34A 1EEZB 3JUYA 1WA1X 1A4CA 3C5SB 4RFNC 2DBJA 3MV7B 2X4UB 4I2XE 3MRHB 1NBYA 4NBZB 4UOQA 4X99B 5IROA 1XSIA 2XQBL 4GKNA 1OW0A 4JM4L 3VXOB 5GQBA 2WWKT 2AK4E 3N42B 1JGVH 1QFUH 4YLCA 3DKHA 1NEPA 2WV3A 2Z1KA 3KPLB 4TNEA 3BQUC 4ZD3H 3DV4B 2BCMA 1KCRL 4A1RA 4IBZA 4WTWA 5DUML 5E9DD 4LL9A 4WF7A 2EDTA 5IP4A 1A0QL 1BBJB 3QFJD 1RZGB 4DW2L 4FXKA 4PGJA 2FJUB 2HXAA 3A5VA 1EGJA 3ASOB 1TFPA 2OSXA 2PWDA 3MGTA 3EYOA 4L4TA 5H8DA 4JFPB 3Q06A 2WN2A 1DSFL 2Y2YA 3AU0A 5CHNB 1IAOA 1E2WA 4ETQA 1LDPH 2VDQL 1PY4A 5AD0A 1AXTL 1W72A 5GGSB 4IRJB 4NQSB 4JUSA 3KLDA 3MZGB 3P2TA 4JFTA 1GGCH 1MCBA 3DX0A 3QDJD 2DQJH 1KC5H 1ZRUA 1T1ZA 3BI9X 3VY9X 1HVXA 2RCSL 5D2LA 3G6DL 5KVEH 4Z95H 2BP3A 4X7TB 2AW2A 3P3SA 3MKKA 4NI6A 3QPQC 3BAEH 2A6JB 2XWBB 3ARVA 3BIKA 4N25A 4NC0B 4ZFQA 5DVPA 5FDWA 3CMOL 4PJHE 3GXPA 5HY9A 3L5IA 4PJXB 4TVUA 1UM6H 4G5AA 1CDBA 1FNEA 4NT6B 3BQUA 5ACZB 4U1LB 3W39B 5D72L 2YC1B 4WWKB 3RDTD 3A21A 5SV4A 3BIBX 5EUOA 2D7TL 5H2BB 4LASL 4PUBH 3BAIA 3QJHA 3RG1C 3F3HA 3HS0B 1CFNA 4L4TE 4RMQA 3BXNB 3MBXL 2MCPH 4JFEE 2XFGB 4K3GA 3BP6A 4H26B 3QJFB 4YHML 3KH3A 5BV7C 2C9AA 5B8CB 2DQFA 3LN4A 5F89B 2YXWA 2Y0KA 4OAWB 4NGHL 5I1DA 4K3EL 3TBVA 3VG9B 4L4VB 1QA9B 1T80A 3ZOAA 4F80A 3V9FA 3U25A 1DE4A 2KPWA 3VI3F 3D0LA 3NGBC 4MA7L 3VFSA 5J06A 4GG6B 1TYRA 4M43L 1YN7B 2XN9B 4L29B 3QWOA 3KGTA 2ZXCA 3AAEA 3MNZB 2P24B 1NOFA 1FZJA 2XA8H 2Z9TA 2UZIH 3L4VA 5IUCA 3DWOX 3G6JA 2FHFA 1YEKH 3QEQD 4X80L 3QO1B 5FECB 2N59A 3HJ0A 4WU7B 1BG9A 5H94A 5JZ7D 3Q0HA 1E5AA 1CR9H 3PNWB 3CZLA 4JDEA 2Y6SD 1LO2L 1LL1A 3SE8L 1URZA 4A7QA 3WN5B 2YRPA 4X4YB 4X5QA 5KSBB 3KXFA 1HXXA 4CC4C 4E0RA 4MQXC 3AQDA 4L18A 1ZKAA 1PY9A 1ZA3B 4IU3B 4RX4A 4BWUA 4HEPA 1UHVA 2AMGA 3E2HB 3ES6B 4WI5A 3US9A 4AK2A 4YC2B 4AC4A 2LHFA 3VFNA 1ZIAA 1SHWA 3FAXA 4AQEB 2QVKA 4KRAA 2FYVA 4CADA 2VZTA 4I0PC 3BIAX 4YNYA 5EFIB 2QQKH 1QFPA 3DZMA 3GMLB 1XF5A 1HEHC 2AP2A 5G5DB 3N1MC 1TTCA 1FLRL 5D5DA 2ZQKA 3F8UB 5F7AA 2N7BA 1A6AA 2VSCA 3ZT5A 4FA7B 5K9JL 4E68A 1UT1A 3MNVB 4P59H 2F1EA 3S48A 2J8OA 2KT6A 3B9VA 3B37A 5DWUH 3BAXA 1A7PH 1CFTA 2XG4A 4K3CA 3ARFD 2Z4TA 5AKVA 4FNPA 5HDQH 4ONFL 4W6YB 1KWGA 3CC5A 3TTYA 3WY1A 1EZLA 1CQKA 2BSED 3WIHL 2CHNA 5DDHB 3UPRA 1P7KB 4G5ZL 5BZDA 3TYFA 3CC1A 3AG3B 4LEXL 2BC4A 2D03L 4H8PA 4XMUA 1ETZA 1WFJA 7PRNA 4PJ8D 4XHQA 4GKZA 2EILB 2IALA 4EI5D 4IKNA 2VQ4A 3DRTA 3O8XB 4WK0B 4CC4A 1G6RL 5C6TL 2FZ3B 5ALBL 1K6QL 2PABA 4H7VA 5KVDH 4HJJL 4FZEL 3WUWB 2JF1A 1RZ7L 4DFIA 4U49A 4HIJB 4HPYH 4JREB 4KBPA 3GF8A 1UKSA 4I0PA 5CR8A 4BQCA 4JMXA 1HESA 3MBWA 4IEFA 3GDCA 1G9NL 5IBLD 2OZ4A 2WYIA 5D7JD 4NNPL 2E5EA 4XO8A 4C8XA 3Q5TA 3HJEA 2CU9A 4GS7B 1RUQL 2IJ0C 2HTLD 1N5AA 3K1KC 4L1LA 2PCXA 4YIQA 4OJEH 4BQ6A 2OV0A 4B9YA 4CAGA 4JB9H 3L4YA 4BCYA 3EOAB 3IXTB 2PR9A 2GSIA 4G1EB 1BBDL 3BN3B 4K8RH 1ETA1 1YY9D 4LO9A 3VJ6A 2O26U 3N44B 3MRQA 4PP1C 4S1DD 4LKCA 1A7RH 4HAFA 2Q7AA 4TXVB 1MCOH 2Z35B 5IQ7L 5DFAA 3RGVC 4LPYA 2V5TA 4UMGA 3S6CA 3K72A 2J1ZA 3IDJB 1RJYA 3CNKA 5J3HC 5DJ0A 3CDGB 4K3DL 2A6IB 3G3LA 1S2EA 3TURA 1OOAA 1D7FA 2L3BA 1GYCA 3DHJA 5T5FA 3KYNA 2K6YA 4GAAA 4PIBA 4DZ8A 1UXSA 4OZGA 2IOOA 5EU5B 5K39B 3RWEA 5LGKA 2OQJA 5JA8B 4WHTB 1BQLH 3EBHA 1IT9L 3OJMB 4M02A 3KG5A 5CLXA 2E7CA 1HHJA 1M3JA 4NN5B 4YDKL 5J11C 1TVBA 3NCYS 2ARJQ 3KL3A 5CLZA 1B2YA 2HLFD 4HD5A 3QXVA 4QRRA 1OP9A 3CXHK 5T1KD 4WI4A 3I9AA 3SDDC 1EAPA 1YEJL 5AEAA 1MWAH 4JFDB 4HOXA 2Z65C 4HSAC 4IDLA 2MNUA 2O6DA 3V4UH 2V2WB 5IEKA 3F5WA 3O6FD 1XGUA 2G5BA 1T1WB 4HMDA 4V11A 1KTCA 3OGOE 4N8VA 4XODA 3TONA 1ZTXE 5BRZB 5JMRA 3RGVA 1CT8A 4XPAH 1SXCA 3VXSE 1YPZF 1QZNA 1VADB 4G7YL 1KYDA 2VLRD 3L7EB 5DRXB 1FN4B 1FDLL 1JPSH 1BQUA 1K8DA 4F8QA 2WO3B 1RZJC 2QVFB 3JWDH 4FNSA 1IBHA 3ENEA 1LEKB 2Y1VA 4KTEH 5J6GB 3SY0B 3SJVA 5ICYB 5I1GL 2A3TA 1QTYT 3QNXB 4TL5A 3BYTA 1T20A 3T0EC 1FNFA 3VFOB 2VRAA 1Z3GH 2WTRB 3OLEA 1HKFA 4HP5A 5EIIB 4PR5A 5EH1A 3QRCA 1YY8A 3DI2B 2B39A 5F71A 3G08A 1VGKB 4NBYB 3NESA 3HG4A 1BGXL 4R7NB 4Q9CA 5A2IH 3PWLA 2ZKHH 5DCCA 3MJ9L 2J4UP 3PQSA 1ASPA 1U58A 2AK1L 2ZX5A 4OZ4B 1HOEA 3NIGF 2OJEB 5E03A 3SDDA 3ZR6A 4Q4IA 3RWGA 1AZRA 2HLAA 3LKRA 1SYSB 4X4MA 4DEWA 3L95A 3KWWB 1FO0A 3WKML 4Z0BH 1E54A 1T04B 2WINB 1M1XA 3ZE1E 4LCUB 2PXYC 2ZWLT 3GSOA 2VW4A 4OD2A 3FUFA 8FABA 3HLAA 2Q76B 2YXFA 4FKKA 4JQVC 3FO0H 1T5XA 4XNZB 2HJFB 4HEME 1KBGL 1U8NA 3LK42 2IPTL 2ZP9A 4QOKD 4RVBA 2WQ8A 1KMGA 4PRID 2X9KA 1QHQA 2ZOLB 1Q72H 2GTWA 2HUHA 1L0YA 4N2KA 5JHLH 2X4QA 1J9SA 1LWHA 2IDTA 1NCAL 1G7JB 2ZUYA 3T0EA 2XQBH 1BAFL 3REVA 5IB3A 4JM4H 4C83A 4EI6B 1LHZA 2QPDB 1YEEL 2OMVA 1DP0A 4AQAB 5C8JA 2J57A 1KCRH 2EYTA 5ELIA 2XV3A 1HH9B 5ITFB 1MQ8A 5D1ZC 3TP4A 5DUMH 3ZKXB 4OZIA 4IU2B 3N0AA 4KAQL 1TZAA 4YZFF 2MOQA 3PHAA 4NHUB 3OQRA 4P46D 3UO8B 8PAZA 2R8SL 1A0QH 4M61B 4QHMB 3RIAF 5FB8B 1I8MA 5HI5C 5CKGA 1N10A 2XKNB 2D7NA 2CDEB 1GSMA 3PS6A 1A25A 3FOLB 4DW2H 3I6LE 1U8KA 4OVUA 4GKLA 1NFIB 1WUNT 5J6HB 2EEDA 4NUQA 1GGBL 2R0WH 5HHPB 3S5ZA 2PXYA 1J0ZA 4L3AA 3B7UX 1DSFH 2IVFC 3LMJL 4M7JL 4RGNE 4JQVA 3ZDYE 1NMCB 3ARDB 4H20H 5DEJA 2VDQH 3LK3A 4LOUD 3LKQA 1IGYA 1NBYB 1CU4H 1FQ9C 4GKNB 3IMWA 4BELD 3LZFH 5GGUA 3G6DH 5E6ZA 2A9NL 5DHMC 4X5LA 1GCFA 4K3HA 4YDIH 5D93C 3CMOH 4WHCA 1JHLL 4LLQA 3TS8A 5IVXF 2ZJSL 2X6VA 1KYOJ 3EHBD 4NP4L 1B0IA 2NOYA 5B4MD 5D72H 4FXKB 2UV3A 3QAZB 4HIEA 4C59B 5KZCB 3FN0L 2C1PA 2APSA 3MGTB 3EYOB 4CGTA 4LASH 1AQDA 1TITA 4KJWC 3FFCE 3WEBA 3MBXH 2VYRE 1CD0A 1WFNA 1IAOB 1GTFA 1UURA 2ZUUA 4ETQB 2I32A 3EJYC 4YHMH 1J9QA 3QPXL 3KW7A 1W72B 4POYA 5E23A 4FEIA 3CPLB 4JQIA 4NGHH 4K3EH 5KSAC 3ME0A 2E59A 4YBHA 4MA7H 3WFDL 1T1ZB 2KBGA 5D2LB 4AVHA 5DS2A 2I25N 4M43H 3FQYA 4EUPG 4LSIA 1NC2D 4O58L 1CVSC 5L4FA 2QSQA 3IRCA 3BIKB 4RFNB 4GI8A 4AKPA 5FDWB 1TZHA 1J8HA 4U6HA 5HY9B 2DI7A 5F8RC 4Z3JA 3FTSA 4O2CA 4TUKL 5CAYB 1FNEB 3BQUB 2GJJA 3L7FA 1UOWA 5JW4R 2QGEA 1A1OA 3FU6A 1CL7L 4MD4A 5EUOB 5HGHA 1KXHA 3VWJC 2XG6A 1OE1A 4QWWC 5GGTA 3QJHB 4RJXA 2J6EH 1UD6A 3GMNA 3SE8H 1CFNB 4K0OA 3DX8B 1II4E 2B08A 4J3WA 3H4FA 3BP6B 4W6XB 4PMFA 1VF5C 1UG9A 2WXJA 4Z7QB 1IKOP 3IKCA 5I2IA 2D3VA 2DQFB 3LN4B 4OGZA 1I3UA 1J0KA 5I1DB 3TBVB 3HUJA 2W38A 2DIEA 1DE4B 3VFSB 4DPCX 3D0LB 3FT3A 3BSZA 1J5OL 5DJ8A 1H15A 3F7QA 3A0HO 3FFDA 4U4IA 3QWOB 5DRWB 4PV1C 3AAEB 4ZZFA 1L5GA 3ZYOA 1FZJB 1QLRA 5KVFL 2EDRA 5KSAA 1NBZA 2QDVA 4ZQKA 4S1SL 3G6JB 3I3DA 4EAEA 3VQ2C 1ZDSA 2WN3A 1PYWA 1FLRH 2A7BA 4PJ5E 5H94B 3W81A 3A2SX 1OQOA 4PJDA 5K9JH 3J8F7 3NH7L 1I7ZA 1KB3A 4F7TA 2H2SC 4JDEB 1RUKH 2JKIS 4V2CB 4PJGF 1P4BH 2WAHA 3DPBA 1S9XA 1E9PA 2X88A 5CIPH 3FQ1A 4ONFH 3PPSA 5C0JA 2XCMC 3KXFB 2I60L 2VXUH 2CKBA 3IM1A 3CVHL 3VWJA 4E0RB 2NY0C 1ZLVH 1WA0X 3WIHH 2H1LM 2A6KA 4G5ZH 4LESA 1GC1L 1I53A 2P3YA 3GZQA 3DGCR 2ADIA 2D03H 3BD5A 3L3GA 4K73A 4XMZA 5ADXL 3MV8E 5C6TH 3VFNB 1G6RH 3WE6B 5C0CD 4BH8A 4DPRA 1WGVA 4CADB 5A6MA 4RAUA 4JFFE 4X5PA 1K6QH 1UOVA 4HHAA 5ALBH 4LXFA 4YNYB 3NGBB 4FZEH 3CH8A 1KLUA 1RZ7H 1XF5B 4MZRA 3UTZA 2IH9A 5A7EA 4MJ6A 1FYTA 1THAA 3TEUA 1A6AB 4AJVA 5KUKA 3HAEG 3KBEA 2MHAA 5EDXA 3BZDA 4N0CD 3AY2A 4QRBA 1CFTB 2XG4B 4E1SA 2ZYRA 4WNJA 1CXEA 1G9NH 1AVAA 2DQCH 3BKJL 1BEXA 1VPOL 4NNPH 3CC5B 4OLVL 2IV8A 2E7LC 4YLQT 4JHZA 2X6AA 3N1FC 5HHXL 2OW6A 1FAKT 1RUQH 4IRZL 1L3NA 3UPRB 2CJUL 5BZDB 3GFUA 4KKLD 4TQ8A 3TYFB 2BC4B 2HRGA 1ETZB 3PLYA 4M1DL 12E8L 4GKZB 2IALB 3ULUL 3DRTB 4XX1G 4XRCA 3S3PA 1IZJA 1E28A 2KLTA 3KYOA 4K7FA 3VFTA 3ZUNC 1AY1L 2ENSA 2HLEB 1RZFH 2JB5L 2JCCA 4KK6C 1DQJA 5EZLA 5DZJA 2N0MA 4ZAKC 5IQ7H 1F3JA 5GS3A 4AQOA 1EZVX 5H37H 1IILE 3OMAB 4I0PB 4Z7NF 1MQKL 2ZUVA 5KUMA 3ZBMA 3MBWB 2FEDC 1JSYA 4IEFB 4LVOC 5IJBC 4YLBA 3VXTA 3O2DA 1D7DA 2M07A 2R88A 4NM8L 1EHNA 2VGLM 4B5EA 4FUVA 4C56E 4L8SC 1N9PA 2X9YA 1NCTA 1AFVL 4FTVA 4I1RA 2B3IA 1N5AB 3V0VA 1A02N 1CLVA 4YIQB 4RMBA 1BLIA 3RU8H 3MR9A 4X4XA 4FSOA 2GSIB 1ZLSL 4XI5D 3HS8A 4NO3A 5D6CA 1IT9H 2E7LA 3JTTA 3IN2A 2VOTA 4RZCA 3VJ6B 2ALWA 1R5VA 4CTDA 3MRQB 1XL4A 2FX8H 2IMNA 1IGJA 1OTSD 4LKCB 4BFBD 1HH6B 1UUNA 2D2OA 2VDLL 5JXED 2F53E 4QIRA 3RVUD 3KL5A 2IFGA 2WVTA 5J89A 1JF5A 2NY5L 3FKUS 3K72B 5HDOA 4JL1A 4ZOAA 2VMFA 1RJYB 1F4WL 1LE9A 5DJ0B 1F6AA 2BIIA 4FA8A 1RLBA 4E41A 3F83A 1WZ1L 1IC4L 3GPEA 4ZAKA 1Q0YL 2WK2A 2ZXQA 1K85A 3KYNB 1WT5C 4G7YH 4DZ8B 8CGTA 1UXSB 3LEVL 4FFTA 4MMZC 4OZGB 4Y8DC 4AVIA 3RWEB 3N40P 3DETC 2NNAA 2OQJB 2P28B 3RWJA 1G0DA 2AQNA 1JGLH 3D4ZA 4L8SA 4OM0L 3M45A 1OEZW 1HHJB 5CCHE 4XNYH 2DJUA 1TVBB 2QT6A 4ETYA 4UNVA 5I1GH 4YDMA 4L0PB 1AXIB 4GBXC 5TISO 5DFWH 2ZOUA 4QRRB 2JKXA 4KQ4H 2CIKA 4EZMA 1CC3A 4G2AA 1I8LC 1UJTA 5A2CA 3OAZH 4PLJC 2JELH 3ZR5A 1EAPB 1KGXA 5C07E 3TF4A 3ULUD 2EDLA 4EN3D 3B5HA 4FN0A 4BFJA 2XE2A 1TZGL 1G5GA 4FS0A 5IEKB 1BGXH 3F5WB 5GS1C 1XGUB 2G5BB 3II1A 3S3JA 5I1EH 3MJ9H 4JKWA 1X5MA 3RGVB 2AK1H 4PJIA 3RWDA 5F9OL 2FEEL 2K8MA 1BG1A 1CT8B 1MRFL 4OZHA 2VL4A 5HDBF 1O5PA 3EJQA 3UBGA 3UYOD 5A2JH 2NCEA 1MJUL 1OAQL 4R0LC 5D8JL 4D0CA 4OQTA 1K8DB 4NCC1 5D2NE 3T09A 1JNLL 5BW7A 2XDHA 4TVPE 3VXRD 2QSCL 3AJ7A 1QVOA 3DPDA 2OJ1A 4E9RA 3SJVB 1WT5A 2E9GA 3VCLA 1OSPL 1BF5A 4MMZA 1T20B 3KLAA 1AC6A 1GSKA 5KS9A 1GR7A 4A68A 1UJ3A 1UZ6F 2VR7A 2WO2B 4PR5B 4O02A 5IHWA 4AYFA 5J11B 1YY8B 1NCAH 2DIBA 2IC2A 3FCTA 3G08B