2XE2A

Molecular insights into clinically isolated ompc20 mutants and their role in multi-drug resistance
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
343
structure length
343
Chain Sequence
AEIYNKDGNKLDLYGKVDGLHYFSDNDSKDGDKTYMRLGFKGETQVTDQLTGYGQWEYQIQGNEPESDNSSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYDSDNFMQQRGNGFATYRNTDFFGLVDGLDFAVQYQGKNGSAHGEGMTTNGRDDVFEQNGDGVGGSITYNYEGFGIGAAVSSSKRTWDQNNTGLIGTGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNRFTRDAGINTDDIVALGLVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords OUTER MEMBRANE PORIN C
publication title Altered Antibiotic Transport in Ompc Mutants Isolated from a Series of Clinical Strains of Multi-Drug Resistant E. Coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 105
structure length 343
sequence length 343
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2xe2A00
3HWBA 1GFMA 3UPGA 4LSHA 1GFQA 4KR4A 2O4VA 8PRNA 3SY7A 2XE5A 3NSGA 3PORA 1PHOA 3VZTX 4GCQA 3O0EA 4D5UA 3SYBA 4D64A 7PRNA 4KRAA 3VY8X 4FRXA 3K19A 2ZFGA 3POQA 4KR8A 1HXUA 1BT9A 2J4UP 2XE1A 3POXA 1MPFA 4GCSA 2XE2A 1BH3A 4AUIA 2ZLDA 1HXXA 1PRNA 3SY9A 4RJXA 3FYXA 4FSOA 1E54A 4FOZA 4LSFA 2XE3A 3WI5A 2FGRA 4LSIA 2XG6A 6PRNA 4FMSA 1GFNA 2Y2XA 5FVNA 3T0SA 4D65A 2FGQX 5DL7A 3UU2A 5PRNA 2Y0KA 4GCPA 4LSEA 2PORA 2Y0HA 3PRNA 4RJWA 2Y0LA 2PRNA 5DL8A 5DL5A 3A2SX 2J1NA 1H6S1 3T20A 5DL6A 3T24A 3VY9X 5JDPA 4JFBA 3WI4A 2ODJA 1GFOA 1OSMA 1OPFA 4C69X 4FRTA 3JTYA 1GFPA 3HW9A 3EMNX 2QTKA 4FT6A 3SZVA 3VZUX 1HXTA 2OMFA 3SYSA 4FSPA 4BUMX 3SZDA 2K4TA 3POUA 3VZWX
chains in the Genus database with same CATH superfamily
3A0BO 3HWBA 1GFMA 2KZ7A 5EE2A 3UPGA 2M06A 4LSHA 1GFQA 5IYUA 2Y7SA 4C4VB 4O3ZA 3AA0A 3QRAA 1ZHTA 2X9KA 4KR4A 4O4UA 2O4VA 2XTRA 4K3BA 4PJ0O 3V8UA 8PRNA 3SY7A 2X27X 1IZNA 2YNKA 2JQYA 2XE5A 3LK3B 4QQ1A 3NSGA 3VE2A 4AKRA 4JCHA 3BRYA 3PORA 5D5DA 4E1SA 2MNHA 1PHOA 2LHFA 3VZTX 4FZMA 3O0EA 4GCQA 4D5UA 3KZIO 4PR7A 3SYBA 4D64A 7PRNA 4KRAA 3LK2A 2F1VA 4O3WA 2MHLA 4FUVA 3VY8X 4FRXA 1QJPA 2WJRA 2ZFGA 3DZMA 1Q9GA 3AA6A 3K19A 3POQA 4KR8A 3AA7A 1HXUA 3PF1A 1ZHWA 1BT9A 3KVDD 4K3CA 4N59A 4GF4A 4AYMC 4G76A 5B66O 2XE1A 3POXA 2J4UP 3LK42 1MPFA 4UB8O 2N2MA 3AA0B 4GCSA 4AYID 2XE2A 1G90A 4FESA 1T16A 1BH3A 1ZHXA 4AUIA 1MM5A 2ZLDA 2F1TA 3DA3A 3G7GA 1HXXA 1PRNA 3AA1A 4AKRB 5E79O 3PQUA 2AXTO 4RJXA 3SY9A 3FYXA 4FQEA 4FSOA 1E54A 5H2FO 2LFUA 1S5LO 2KXPA 2R4LA 4FOZA 4LSFA 2R8AA 4RL9A 3GP6A 4Z3TA 4U9CA 4AZLA 1THQA 1QJ9A 1QJ8A 2XE3A 1ZHYA 2FGRA 4LSIA 3WI5A 2XG6A 4AYNA 6PRNA 3VE1A 2JMMA 3AA6B 3AAEB 4FMSA 1GFNA 4O3XB 2IWWA 4E1TA 4O3YA 3PGSA 3BRZA 5T5FA 4CTDA 2WJQA 3AAAA 4AYEC 5ADXL 2KZ7B 4B61A 4XNLA 5G26A 5ADXK 4RLCA 2Y2XA 2XTQA 2R4PA 4N75A 3PGRA 5FVNA 4N58A 3T0SA 4D65A 1Q9FA 2W81C 5G38A 2FGQX 3RBHA 3WU2O 2R88A 4C4VA 1IZNB 3DWNA 4PUXA 3TZGA 2N2LA 5TISO 5DL7A 4FZLA 4UB6O 5GTHO 3UU2A 5B5EO 4IL6O 2M07A 5PRNA 2Y0KA 2KC0A 1P4TA 2KDYA 4GCPA 3HOEA 2PORA 2K0LA 3LK41 4LSEA 4AFKA 2Y0HA 3PRNA 4FZNA 4RJWA 1ORMA 4XNKA 2WVPA 3HOLA 3LK2B 2GE4A 1ZHZA 3JCUO 5KAIO 3A0HO 2Y0LA 1BXWA 2PRNA 1YS5A 5DL5A 5DL8A 5KAFO 3AA7B 2XMXA 5GTIO 2IWVA 3A2SX 2J1NA 3C5OA 1H6S1 4N74A 3QRCA 4O49A 5DL6A 2R89A 3AAAB 4AKMA 3T20A 4GHBA 3T24A 3VY9X 5JDPA 4JFBA 3WI4A 2ODJA 3PQSA 1GFOA 3LK3A 2ERVA 4F4BA 1OSMA 1OPFA 3BS0A 4O4XA 3NJTA 1MM4A 5AFUL 4C69X 2YPVA 4FRTA 5AFUK 3JTYA 1GFPA 2F1CX 4C00A 4G75A 3AA1B 3EMNX 3HW9A 5GV0A 2QTKA 4FT6A 3SZVA 3VZUX 1HXTA 1T1LA 2W80C 2OMFA 3SYSA 4AYDC 4FSPA 2KXPB 5G39A 4BUMX 3SZDA 5G3AA 2K4TA 3PGUA 4RLBA 2R4OA 3POUA 3AAEA 3DWOX 3VZWX 3DA4A 3UAQA 2R4NA
chains in the Genus database with same CATH topology
3HWBA 1GFMA 2KZ7A 5EE2A 3UPGA 2M06A 4LSHA 1GFQA 5IYUA 2Y7SA 4O3ZA 3AA0A 3QRAA 1ZHTA 4KR4A 4O4UA 2O4VA 2XTRA 3V8UA 8PRNA 3SY7A 2X27X 1IZNA 2YNKA 2XE5A 3LK3B 4QQ1A 3NSGA 3VE2A 4AKRA 4JCHA 3PORA 5D5DA 4E1SA 2MNHA 1PHOA 2LHFA 3VZTX 4FZMA 3O0EA 4GCQA 4D5UA 3SYBA 4D64A 7PRNA 4KRAA 3LK2A 2F1VA 4O3WA 2MHLA 4FUVA 3VY8X 4FRXA 1QJPA 2ZFGA 3K19A 1Q9GA 3AA6A 3POQA 4KR8A 3AA7A 1HXUA 4AYMC 1ZHWA 1BT9A 3KVDD 4N59A 5GV0A 4GF4A 2J4UP 4G76A 2XE1A 3POXA 3LK42 1MPFA 2N2MA 3AA0B 4GCSA 4AYID 2XE2A 1G90A 4FESA 1BH3A 1ZHXA 4AUIA 1MM5A 2ZLDA 2F1TA 3DA3A 3G7GA 1HXXA 1PRNA 3AA1A 4AKRB 3PQUA 3SY9A 4RJXA 3FYXA 4FSOA 1E54A 2LFUA 2KXPA 4FOZA 4LSFA 4RL9A 4Z3TA 3GP6A 4U9CA 4AZLA 1THQA 1QJ9A 1QJ8A 2XE3A 1ZHYA 2FGRA 4LSIA 3WI5A 2XG6A 4AYNA 6PRNA 3VE1A 2JMMA 3AA6B 3AAEB 4FMSA 1GFNA 4O3XB 4E1TA 4O3YA 5T5FA 3AAAA 4AYEC 5ADXL 2KZ7B 4B61A 4XNLA 5G26A 5ADXK 4RLCA 2Y2XA 2XTQA 5FVNA 4N58A 3T0SA 4D65A 1Q9FA 2W81C 2FGQX 3RBHA 1IZNB 4PUXA 3TZGA 2N2LA 5DL7A 4FZLA 3UU2A 5PRNA 2M07A 2Y0KA 2KC0A 1P4TA 2KDYA 4GCPA 3HOEA 2PORA 2K0LA 3LK41 4LSEA 4AFKA 2Y0HA 3PRNA 4FZNA 4RJWA 1ORMA 4XNKA 3HOLA 3LK2B 2GE4A 1ZHZA 2Y0LA 1BXWA 2PRNA 1YS5A 5DL5A 5DL8A 3AA7B 2XMXA 3A2SX 3C5OA 2J1NA 4O49A 1H6S1 4AKMA 3QRCA 3T20A 5DL6A 3AAAB 4GHBA 3T24A 3VY9X 5JDPA 4JFBA 3WI4A 2ODJA 3PQSA 1GFOA 3LK3A 2ERVA 4F4BA 1OSMA 1OPFA 4O4XA 1MM4A 5AFUL 4C69X 2YPVA 4FRTA 5AFUK 3JTYA 1GFPA 4G75A 3AA1B 3EMNX 3HW9A 2QTKA 4FT6A 3SZVA 3VZUX 1HXTA 2W80C 2OMFA 3SYSA 4AYDC 4FSPA 2KXPB 4BUMX 3SZDA 2K4TA 4RLBA 3POUA 3AAEA 3VZWX 3DA4A 3UAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HWB A;  1GFM A;  3UPG A;  4LSH A;  1GFQ A;  4KR4 A;  2O4V A;  8PRN A;  3SY7 A;  2XE5 A;  3NSG A;  3POR A;  1PHO A;  3VZT X;  4GCQ A;  3O0E A;  4D5U A;  3SYB A;  4D64 A;  7PRN A;  4KRA A;  3VY8 X;  4FRX A;  3K19 A;  2ZFG A;  3POQ A;  4KR8 A;  1HXU A;  1BT9 A;  2J4U P;  2XE1 A;  3POX A;  1MPF A;  4GCS A;  2XE2 A;  1BH3 A;  4AUI A;  2ZLD A;  1HXX A;  1PRN A;  3SY9 A;  4RJX A;  3FYX A;  4FSO A;  1E54 A;  4FOZ A;  4LSF A;  2XE3 A;  3WI5 A;  2FGR A;  4LSI A;  2XG6 A;  6PRN A;  4FMS A;  1GFN A;  2Y2X A;  5FVN A;  3T0S A;  4D65 A;  2FGQ X;  5DL7 A;  3UU2 A;  5PRN A;  2Y0K A;  4GCP A;  4LSE A;  2POR A;  2Y0H A;  3PRN A;  4RJW A;  2Y0L A;  2PRN A;  5DL8 A;  5DL5 A;  3A2S X;  2J1N A;  1H6S 1;  3T20 A;  5DL6 A;  3T24 A;  3VY9 X;  5JDP A;  4JFB A;  3WI4 A;  2ODJ A;  1GFO A;  1OSM A;  1OPF A;  4C69 X;  4FRT A;  3JTY A;  1GFP A;  3HW9 A;  3EMN X;  2QTK A;  4FT6 A;  3SZV A;  3VZU X;  1HXT A;  2OMF A;  3SYS A;  4FSP A;  4BUM X;  3SZD A;  2K4T A;  3POU A;  3VZW X; 
#chains in the Genus database with same CATH topology
 3A0B O;  3HWB A;  1GFM A;  2KZ7 A;  5EE2 A;  3UPG A;  2M06 A;  4LSH A;  1GFQ A;  5IYU A;  2Y7S A;  4C4V B;  4O3Z A;  3AA0 A;  3QRA A;  1ZHT A;  2X9K A;  4KR4 A;  4O4U A;  2O4V A;  2XTR A;  4K3B A;  4PJ0 O;  3V8U A;  8PRN A;  3SY7 A;  2X27 X;  1IZN A;  2YNK A;  2JQY A;  2XE5 A;  3LK3 B;  4QQ1 A;  3NSG A;  3VE2 A;  4AKR A;  4JCH A;  3BRY A;  3POR A;  5D5D A;  4E1S A;  2MNH A;  1PHO A;  2LHF A;  3VZT X;  4FZM A;  3O0E A;  4GCQ A;  4D5U A;  3KZI O;  4PR7 A;  3SYB A;  4D64 A;  7PRN A;  4KRA A;  3LK2 A;  2F1V A;  4O3W A;  2MHL A;  4FUV A;  3VY8 X;  4FRX A;  1QJP A;  2WJR A;  2ZFG A;  3DZM A;  1Q9G A;  3AA6 A;  3K19 A;  3POQ A;  4KR8 A;  3AA7 A;  1HXU A;  3PF1 A;  1ZHW A;  1BT9 A;  3KVD D;  4K3C A;  4N59 A;  4GF4 A;  4AYM C;  4G76 A;  5B66 O;  2XE1 A;  3POX A;  2J4U P;  3LK4 2;  1MPF A;  4UB8 O;  2N2M A;  3AA0 B;  4GCS A;  4AYI D;  2XE2 A;  1G90 A;  4FES A;  1T16 A;  1BH3 A;  1ZHX A;  4AUI A;  1MM5 A;  2ZLD A;  2F1T A;  3DA3 A;  3G7G A;  1HXX A;  1PRN A;  3AA1 A;  4AKR B;  5E79 O;  3PQU A;  2AXT O;  4RJX A;  3SY9 A;  3FYX A;  4FQE A;  4FSO A;  1E54 A;  5H2F O;  2LFU A;  1S5L O;  2KXP A;  2R4L A;  4FOZ A;  4LSF A;  2R8A A;  4RL9 A;  3GP6 A;  4Z3T A;  4U9C A;  4AZL A;  1THQ A;  1QJ9 A;  1QJ8 A;  2XE3 A;  1ZHY A;  2FGR A;  4LSI A;  3WI5 A;  2XG6 A;  4AYN A;  6PRN A;  3VE1 A;  2JMM A;  3AA6 B;  3AAE B;  4FMS A;  1GFN A;  4O3X B;  2IWW A;  4E1T A;  4O3Y A;  3PGS A;  3BRZ A;  5T5F A;  4CTD A;  2WJQ A;  3AAA A;  4AYE C;  5ADX L;  2KZ7 B;  4B61 A;  4XNL A;  5G26 A;  5ADX K;  4RLC A;  2Y2X A;  2XTQ A;  2R4P A;  4N75 A;  3PGR A;  5FVN A;  4N58 A;  3T0S A;  4D65 A;  1Q9F A;  2W81 C;  5G38 A;  2FGQ X;  3RBH A;  3WU2 O;  2R88 A;  4C4V A;  1IZN B;  3DWN A;  4PUX A;  3TZG A;  2N2L A;  5TIS O;  5DL7 A;  4FZL A;  4UB6 O;  5GTH O;  3UU2 A;  5B5E O;  4IL6 O;  2M07 A;  5PRN A;  2Y0K A;  2KC0 A;  1P4T A;  2KDY A;  4GCP A;  3HOE A;  2POR A;  2K0L A;  3LK4 1;  4LSE A;  4AFK A;  2Y0H A;  3PRN A;  4FZN A;  4RJW A;  1ORM A;  4XNK A;  2WVP A;  3HOL A;  3LK2 B;  2GE4 A;  1ZHZ A;  3JCU O;  5KAI O;  3A0H O;  2Y0L A;  1BXW A;  2PRN A;  1YS5 A;  5DL5 A;  5DL8 A;  5KAF O;  3AA7 B;  2XMX A;  5GTI O;  2IWV A;  3A2S X;  2J1N A;  3C5O A;  1H6S 1;  4N74 A;  3QRC A;  4O49 A;  5DL6 A;  2R89 A;  3AAA B;  4AKM A;  3T20 A;  4GHB A;  3T24 A;  3VY9 X;  5JDP A;  4JFB A;  3WI4 A;  2ODJ A;  3PQS A;  1GFO A;  3LK3 A;  2ERV A;  4F4B A;  1OSM A;  1OPF A;  3BS0 A;  4O4X A;  3NJT A;  1MM4 A;  5AFU L;  4C69 X;  2YPV A;  4FRT A;  5AFU K;  3JTY A;  1GFP A;  2F1C X;  4C00 A;  4G75 A;  3AA1 B;  3EMN X;  3HW9 A;  5GV0 A;  2QTK A;  4FT6 A;  3SZV A;  3VZU X;  1HXT A;  1T1L A;  2W80 C;  2OMF A;  3SYS A;  4AYD C;  4FSP A;  2KXP B;  5G39 A;  4BUM X;  3SZD A;  5G3A A;  2K4T A;  3PGU A;  4RLB A;  2R4O A;  3POU A;  3AAE A;  3DWO X;  3VZW X;  3DA4 A;  3UAQ A;  2R4N A; 
#chains in the Genus database with same CATH homology
 3HWB A;  1GFM A;  2KZ7 A;  5EE2 A;  3UPG A;  2M06 A;  4LSH A;  1GFQ A;  5IYU A;  2Y7S A;  4O3Z A;  3AA0 A;  3QRA A;  1ZHT A;  4KR4 A;  4O4U A;  2O4V A;  2XTR A;  3V8U A;  8PRN A;  3SY7 A;  2X27 X;  1IZN A;  2YNK A;  2XE5 A;  3LK3 B;  4QQ1 A;  3NSG A;  3VE2 A;  4AKR A;  4JCH A;  3POR A;  5D5D A;  4E1S A;  2MNH A;  1PHO A;  2LHF A;  3VZT X;  4FZM A;  3O0E A;  4GCQ A;  4D5U A;  3SYB A;  4D64 A;  7PRN A;  4KRA A;  3LK2 A;  2F1V A;  4O3W A;  2MHL A;  4FUV A;  3VY8 X;  4FRX A;  1QJP A;  2ZFG A;  3K19 A;  1Q9G A;  3AA6 A;  3POQ A;  4KR8 A;  3AA7 A;  1HXU A;  4AYM C;  1ZHW A;  1BT9 A;  3KVD D;  4N59 A;  5GV0 A;  4GF4 A;  2J4U P;  4G76 A;  2XE1 A;  3POX A;  3LK4 2;  1MPF A;  2N2M A;  3AA0 B;  4GCS A;  4AYI D;  2XE2 A;  1G90 A;  4FES A;  1BH3 A;  1ZHX A;  4AUI A;  1MM5 A;  2ZLD A;  2F1T A;  3DA3 A;  3G7G A;  1HXX A;  1PRN A;  3AA1 A;  4AKR B;  3PQU A;  3SY9 A;  4RJX A;  3FYX A;  4FSO A;  1E54 A;  2LFU A;  2KXP A;  4FOZ A;  4LSF A;  4RL9 A;  4Z3T A;  3GP6 A;  4U9C A;  4AZL A;  1THQ A;  1QJ9 A;  1QJ8 A;  2XE3 A;  1ZHY A;  2FGR A;  4LSI A;  3WI5 A;  2XG6 A;  4AYN A;  6PRN A;  3VE1 A;  2JMM A;  3AA6 B;  3AAE B;  4FMS A;  1GFN A;  4O3X B;  4E1T A;  4O3Y A;  5T5F A;  3AAA A;  4AYE C;  5ADX L;  2KZ7 B;  4B61 A;  4XNL A;  5G26 A;  5ADX K;  4RLC A;  2Y2X A;  2XTQ A;  5FVN A;  4N58 A;  3T0S A;  4D65 A;  1Q9F A;  2W81 C;  2FGQ X;  3RBH A;  1IZN B;  4PUX A;  3TZG A;  2N2L A;  5DL7 A;  4FZL A;  3UU2 A;  5PRN A;  2M07 A;  2Y0K A;  2KC0 A;  1P4T A;  2KDY A;  4GCP A;  3HOE A;  2POR A;  2K0L A;  3LK4 1;  4LSE A;  4AFK A;  2Y0H A;  3PRN A;  4FZN A;  4RJW A;  1ORM A;  4XNK A;  3HOL A;  3LK2 B;  2GE4 A;  1ZHZ A;  2Y0L A;  1BXW A;  2PRN A;  1YS5 A;  5DL5 A;  5DL8 A;  3AA7 B;  2XMX A;  3A2S X;  3C5O A;  2J1N A;  4O49 A;  1H6S 1;  4AKM A;  3QRC A;  3T20 A;  5DL6 A;  3AAA B;  4GHB A;  3T24 A;  3VY9 X;  5JDP A;  4JFB A;  3WI4 A;  2ODJ A;  3PQS A;  1GFO A;  3LK3 A;  2ERV A;  4F4B A;  1OSM A;  1OPF A;  4O4X A;  1MM4 A;  5AFU L;  4C69 X;  2YPV A;  4FRT A;  5AFU K;  3JTY A;  1GFP A;  4G75 A;  3AA1 B;  3EMN X;  3HW9 A;  2QTK A;  4FT6 A;  3SZV A;  3VZU X;  1HXT A;  2W80 C;  2OMF A;  3SYS A;  4AYD C;  4FSP A;  2KXP B;  4BUM X;  3SZD A;  2K4T A;  4RLB A;  3POU A;  3AAE A;  3VZW X;  3DA4 A;  3UAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...