3QRCA

The crystal structure of ail, the attachment invasion locus protein of yersinia pestis, in complex with the heparin analogue sucrose octasulfate
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
157
structure length
153
Chain Sequence
b'MEGESSISIGYAQSRVKEDGYKLDKNPRGFNLKYRYEFNNDWGVIGSFAQTRRGFEESVLIDGDFKYYSVTAGPVFRINEYVSLYGLLGAGHGKAKFSSIFGQSESRSKTSLAYGAGLQFNPHPNFVIDASYEYSKLDDVKVGTWMLGAGYRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Attachment invasion locus protein
publication title Structural Insights into Ail-Mediated Adhesion in Yersinia pestis.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Cell invasion
total genus 40
structure length 153
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 3qrcA00
1G90A 1MM4A 2JMMA 2MNHA 1QJPA 1ORMA 1MM5A 2N2MA 2LHFA 1P4TA 1QJ9A 2X27X 1THQA 2F1TA 2N2LA 3GP6A 2M07A 4RLCA 3QRCA 2GE4A 2ERVA 3G7GA 2MHLA 1BXWA 3C5OA 4PUXA 1Q9FA 1QJ8A 2K0LA 2F1VA 3QRAA 1Q9GA 2M06A
chains in the Genus database with same CATH superfamily
4LSFA 4E1SA 1OPFA 1ZHZA 4AKRA 4F4BA 3PQUA 4AFKA 4QQ1A 1MM4A 2JMMA 2MNHA 2ZLDA 5E79O 3TZGA 3RBHA 1GFOA 4C4VA 3AA7B 2XMXA 2LHFA 1IZNB 2F1CX 3BS0A 4GHBA 4N58A 1GFQA 3EMNX 2Y0LA 2F1TA 4LSEA 5IYUA 2N2LA 2KZ7A 2R88A 2Y2XA 3NSGA 3GP6A 4AZLA 3DZMA 1ZHXA 5KAIO 3VY8X 2XE1A 5FVNA 3LK3B 1BXWA 2ZFGA 5EE2A 2Y0KA 2IWVA 5GV0A 1GFPA 2PRNA 4D64A 4AUIA 1E54A 4G75A 4B61A 5G38A 3VZWX 2XG6A 2X9KA 2XE5A 2F1VA 2IWWA 3T20A 3PRNA 3SY9A 2KC0A 3LK2A 4GCPA 3SZVA 3HW9A 5DL6A 3VZUX 4E1TA 2KZ7B 3FYXA 3VE1A 1T16A 4UB8O 4BUMX 5H2FO 3WI5A 2JQYA 1G90A 4AYNA 2PORA 3POUA 4FT6A 4AKMA 4FZLA 4KRAA 1QJPA 4C00A 4N74A 3T0SA 1GFNA 2FGRA 2YNKA 4O3ZA 1S5LO 1ZHTA 4D5UA 2Y0HA 4FOZA 3DWNA 5DL5A 3VE2A 2X27X 3AA0A 2KXPA 4Z3TA 3AA1A 5GTIO 2J4UP 4O3YA 2XE2A 2OMFA 3UU2A 4O4XA 6PRNA 3VY9X 4K3CA 2ERVA 4JCHA 2R8AA 4O4UA 4AKRB 2R4LA 4GCQA 3KZIO 4FESA 4KR4A 5B5EO 2R4OA 4RLBA 4K3BA 4AYEC 4N75A 3KVDD 1GFMA 3QRAA 4KR8A 3V8UA 4C4VB 1HXUA 4FZMA 4U9CA 4O49A 3PF1A 2M06A 3AA1B 4G76A 3A2SX 4IL6O 2XE3A 3AA6A 3PGSA 1BH3A 1ZHWA 2K4TA 3AAAA 5DL7A 1T1LA 3AAEA 1HXXA 3PGUA 4PJ0O 3LK41 3SY7A 4LSIA 1MPFA 3BRZA 1MM5A 4AYID 1ZHYA 1H6S1 1P4TA 3SZDA 2WJRA 3K19A 2J1NA 2QTKA 2R4PA 3PORA 3LK2B 4UB6O 3NJTA 2M07A 4RLCA 3QRCA 2GE4A 3AA6B 2R4NA 4XNLA 3G7GA 5AFUK 2MHLA 4D65A 3UPGA 4GCSA 3AAAB 4N59A 4FRXA 3C5OA 4AYMC 4XNKA 1QJ8A 4JFBA 5T5FA 4CTDA 2ODJA 4FUVA 2AXTO 4RJWA 2Y7SA 2XTRA 4FMSA 5KAFO 1Q9GA 7PRNA 3AA0B 2KXPB 4PR7A 3POXA 4O3XB 3LK3A 1BT9A 5G3AA 2O4VA 4RL9A 5TISO 3PGRA 2FGQX 3VZTX 2WJQA 3JTYA 3WI4A 4RJXA 5D5DA 2R89A 2YPVA 3HOLA 4C69X 5ADXK 1ORMA 5PRNA 1PHOA 1PRNA 4FQEA 2N2MA 5JDPA 4GF4A 1YS5A 2KDYA 3SYBA 4FSOA 1QJ9A 3HWBA 4LSHA 5GTHO 1THQA 3JCUO 3A0BO 3T24A 3O0EA 3DA3A 5ADXL 3DWOX 2XTQA 3HOEA 3POQA 4FZNA 5G39A 5DL8A 1OSMA 3DA4A 3UAQA 4FRTA 4PUXA 5G26A 1HXTA 2W81C 3PQSA 3AAEB 1Q9FA 2K0LA 3AA7A 1IZNA 4O3WA 3SYSA 3LK42 4AYDC 2W80C 2LFUA 5AFUL 5B66O 8PRNA 3BRYA 4FSPA 2WVPA 3A0HO 3WU2O
chains in the Genus database with same CATH topology
4LSFA 4E1SA 1OPFA 1ZHZA 4AKRA 4F4BA 3PQUA 4AFKA 4QQ1A 1MM4A 2JMMA 2MNHA 2ZLDA 3TZGA 3RBHA 1GFOA 3AA7B 2XMXA 1IZNB 2LHFA 4GHBA 4N58A 1GFQA 3EMNX 2Y0LA 2F1TA 4LSEA 5IYUA 2N2LA 2KZ7A 2Y2XA 3NSGA 4AZLA 3GP6A 1ZHXA 3VY8X 2XE1A 5FVNA 3LK3B 1BXWA 2ZFGA 5EE2A 2Y0KA 5GV0A 1GFPA 2PRNA 4D64A 4AUIA 1E54A 4G75A 4B61A 3VZWX 2XG6A 2XE5A 2F1VA 3T20A 3PRNA 3SY9A 2KC0A 3LK2A 4GCPA 3SZVA 3HW9A 5DL6A 3VZUX 4E1TA 2KZ7B 3FYXA 3VE1A 4BUMX 3WI5A 1G90A 4AYNA 2PORA 3POUA 4FT6A 4AKMA 4FZLA 4KRAA 1QJPA 3T0SA 1GFNA 2FGRA 2YNKA 4O3ZA 1ZHTA 4D5UA 2Y0HA 4FOZA 5DL5A 3VE2A 2X27X 3AA0A 2KXPA 4Z3TA 3AA1A 2J4UP 4O3YA 2XE2A 2OMFA 3UU2A 4O4XA 6PRNA 3VY9X 2ERVA 4JCHA 4O4UA 4AKRB 4GCQA 4FESA 4KR4A 4RLBA 4AYEC 3KVDD 1GFMA 3QRAA 4KR8A 3V8UA 1HXUA 4FZMA 4U9CA 4O49A 2M06A 3AA1B 4G76A 3A2SX 2XE3A 3AA6A 1BH3A 1ZHWA 2K4TA 3AAAA 5DL7A 3AAEA 1HXXA 3LK41 3SY7A 4LSIA 1MPFA 4AYID 1MM5A 1ZHYA 1H6S1 1P4TA 3SZDA 3K19A 2J1NA 2QTKA 3PORA 3LK2B 2M07A 4RLCA 3QRCA 2GE4A 3AA6B 4XNLA 5AFUK 3G7GA 2MHLA 4D65A 3UPGA 4GCSA 3AAAB 4N59A 4FRXA 3C5OA 4AYMC 4XNKA 1QJ8A 4JFBA 5T5FA 2ODJA 4FUVA 4RJWA 2Y7SA 2XTRA 4FMSA 1Q9GA 7PRNA 3AA0B 2KXPB 3POXA 4O3XB 3LK3A 1BT9A 2O4VA 4RL9A 2FGQX 3VZTX 3JTYA 3WI4A 4RJXA 5D5DA 2YPVA 4C69X 3HOLA 5ADXK 1ORMA 5PRNA 1PHOA 1PRNA 2N2MA 5JDPA 4GF4A 1YS5A 2KDYA 3SYBA 4FSOA 1QJ9A 3HWBA 4LSHA 1THQA 3T24A 3O0EA 3DA3A 5ADXL 2XTQA 3HOEA 3POQA 4FZNA 5DL8A 1OSMA 3DA4A 3UAQA 4FRTA 4PUXA 5G26A 1HXTA 2W81C 3PQSA 3AAEB 1Q9FA 2K0LA 3AA7A 1IZNA 4O3WA 3SYSA 3LK42 4AYDC 2W80C 2LFUA 5AFUL 8PRNA 4FSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G90 A;  1MM4 A;  2JMM A;  2MNH A;  1QJP A;  1ORM A;  1MM5 A;  2N2M A;  2LHF A;  1P4T A;  1QJ9 A;  2X27 X;  1THQ A;  2F1T A;  2N2L A;  3GP6 A;  2M07 A;  4RLC A;  3QRC A;  2GE4 A;  2ERV A;  3G7G A;  2MHL A;  1BXW A;  3C5O A;  4PUX A;  1Q9F A;  1QJ8 A;  2K0L A;  2F1V A;  3QRA A;  1Q9G A;  2M06 A; 
#chains in the Genus database with same CATH topology
 4LSF A;  4E1S A;  1OPF A;  1ZHZ A;  4AKR A;  4F4B A;  3PQU A;  4AFK A;  4QQ1 A;  1MM4 A;  2JMM A;  2MNH A;  2ZLD A;  5E79 O;  3TZG A;  3RBH A;  1GFO A;  4C4V A;  3AA7 B;  2XMX A;  2LHF A;  1IZN B;  2F1C X;  3BS0 A;  4GHB A;  4N58 A;  1GFQ A;  3EMN X;  2Y0L A;  2F1T A;  4LSE A;  5IYU A;  2N2L A;  2KZ7 A;  2R88 A;  2Y2X A;  3NSG A;  3GP6 A;  4AZL A;  3DZM A;  1ZHX A;  5KAI O;  3VY8 X;  2XE1 A;  5FVN A;  3LK3 B;  1BXW A;  2ZFG A;  5EE2 A;  2Y0K A;  2IWV A;  5GV0 A;  1GFP A;  2PRN A;  4D64 A;  4AUI A;  1E54 A;  4G75 A;  4B61 A;  5G38 A;  3VZW X;  2XG6 A;  2X9K A;  2XE5 A;  2F1V A;  2IWW A;  3T20 A;  3PRN A;  3SY9 A;  2KC0 A;  3LK2 A;  4GCP A;  3SZV A;  3HW9 A;  5DL6 A;  3VZU X;  4E1T A;  2KZ7 B;  3FYX A;  3VE1 A;  1T16 A;  4UB8 O;  4BUM X;  5H2F O;  3WI5 A;  2JQY A;  1G90 A;  4AYN A;  2POR A;  3POU A;  4FT6 A;  4AKM A;  4FZL A;  4KRA A;  1QJP A;  4C00 A;  4N74 A;  3T0S A;  1GFN A;  2FGR A;  2YNK A;  4O3Z A;  1S5L O;  1ZHT A;  4D5U A;  2Y0H A;  4FOZ A;  3DWN A;  5DL5 A;  3VE2 A;  2X27 X;  3AA0 A;  2KXP A;  4Z3T A;  3AA1 A;  5GTI O;  2J4U P;  4O3Y A;  2XE2 A;  2OMF A;  3UU2 A;  4O4X A;  6PRN A;  3VY9 X;  4K3C A;  2ERV A;  4JCH A;  2R8A A;  4O4U A;  4AKR B;  2R4L A;  4GCQ A;  3KZI O;  4FES A;  4KR4 A;  5B5E O;  2R4O A;  4RLB A;  4K3B A;  4AYE C;  4N75 A;  3KVD D;  1GFM A;  3QRA A;  4KR8 A;  3V8U A;  4C4V B;  1HXU A;  4FZM A;  4U9C A;  4O49 A;  3PF1 A;  2M06 A;  3AA1 B;  4G76 A;  3A2S X;  4IL6 O;  2XE3 A;  3AA6 A;  3PGS A;  1BH3 A;  1ZHW A;  2K4T A;  3AAA A;  5DL7 A;  1T1L A;  3AAE A;  1HXX A;  3PGU A;  4PJ0 O;  3LK4 1;  3SY7 A;  4LSI A;  1MPF A;  3BRZ A;  1MM5 A;  4AYI D;  1ZHY A;  1H6S 1;  1P4T A;  3SZD A;  2WJR A;  3K19 A;  2J1N A;  2QTK A;  2R4P A;  3POR A;  3LK2 B;  4UB6 O;  3NJT A;  2M07 A;  4RLC A;  3QRC A;  2GE4 A;  3AA6 B;  2R4N A;  4XNL A;  3G7G A;  5AFU K;  2MHL A;  4D65 A;  3UPG A;  4GCS A;  3AAA B;  4N59 A;  4FRX A;  3C5O A;  4AYM C;  4XNK A;  1QJ8 A;  4JFB A;  5T5F A;  4CTD A;  2ODJ A;  4FUV A;  2AXT O;  4RJW A;  2Y7S A;  2XTR A;  4FMS A;  5KAF O;  1Q9G A;  7PRN A;  3AA0 B;  2KXP B;  4PR7 A;  3POX A;  4O3X B;  3LK3 A;  1BT9 A;  5G3A A;  2O4V A;  4RL9 A;  5TIS O;  3PGR A;  2FGQ X;  3VZT X;  2WJQ A;  3JTY A;  3WI4 A;  4RJX A;  5D5D A;  2R89 A;  2YPV A;  3HOL A;  4C69 X;  5ADX K;  1ORM A;  5PRN A;  1PHO A;  1PRN A;  4FQE A;  2N2M A;  5JDP A;  4GF4 A;  1YS5 A;  2KDY A;  3SYB A;  4FSO A;  1QJ9 A;  3HWB A;  4LSH A;  5GTH O;  1THQ A;  3JCU O;  3A0B O;  3T24 A;  3O0E A;  3DA3 A;  5ADX L;  3DWO X;  2XTQ A;  3HOE A;  3POQ A;  4FZN A;  5G39 A;  5DL8 A;  1OSM A;  3DA4 A;  3UAQ A;  4FRT A;  4PUX A;  5G26 A;  1HXT A;  2W81 C;  3PQS A;  3AAE B;  1Q9F A;  2K0L A;  3AA7 A;  1IZN A;  4O3W A;  3SYS A;  3LK4 2;  4AYD C;  2W80 C;  2LFU A;  5AFU L;  5B66 O;  8PRN A;  3BRY A;  4FSP A;  2WVP A;  3A0H O;  3WU2 O; 
#chains in the Genus database with same CATH homology
 4LSF A;  4E1S A;  1OPF A;  1ZHZ A;  4AKR A;  4F4B A;  3PQU A;  4AFK A;  4QQ1 A;  1MM4 A;  2JMM A;  2MNH A;  2ZLD A;  3TZG A;  3RBH A;  1GFO A;  3AA7 B;  2XMX A;  1IZN B;  2LHF A;  4GHB A;  4N58 A;  1GFQ A;  3EMN X;  2Y0L A;  2F1T A;  4LSE A;  5IYU A;  2N2L A;  2KZ7 A;  2Y2X A;  3NSG A;  4AZL A;  3GP6 A;  1ZHX A;  3VY8 X;  2XE1 A;  5FVN A;  3LK3 B;  1BXW A;  2ZFG A;  5EE2 A;  2Y0K A;  5GV0 A;  1GFP A;  2PRN A;  4D64 A;  4AUI A;  1E54 A;  4G75 A;  4B61 A;  3VZW X;  2XG6 A;  2XE5 A;  2F1V A;  3T20 A;  3PRN A;  3SY9 A;  2KC0 A;  3LK2 A;  4GCP A;  3SZV A;  3HW9 A;  5DL6 A;  3VZU X;  4E1T A;  2KZ7 B;  3FYX A;  3VE1 A;  4BUM X;  3WI5 A;  1G90 A;  4AYN A;  2POR A;  3POU A;  4FT6 A;  4AKM A;  4FZL A;  4KRA A;  1QJP A;  3T0S A;  1GFN A;  2FGR A;  2YNK A;  4O3Z A;  1ZHT A;  4D5U A;  2Y0H A;  4FOZ A;  5DL5 A;  3VE2 A;  2X27 X;  3AA0 A;  2KXP A;  4Z3T A;  3AA1 A;  2J4U P;  4O3Y A;  2XE2 A;  2OMF A;  3UU2 A;  4O4X A;  6PRN A;  3VY9 X;  2ERV A;  4JCH A;  4O4U A;  4AKR B;  4GCQ A;  4FES A;  4KR4 A;  4RLB A;  4AYE C;  3KVD D;  1GFM A;  3QRA A;  4KR8 A;  3V8U A;  1HXU A;  4FZM A;  4U9C A;  4O49 A;  2M06 A;  3AA1 B;  4G76 A;  3A2S X;  2XE3 A;  3AA6 A;  1BH3 A;  1ZHW A;  2K4T A;  3AAA A;  5DL7 A;  3AAE A;  1HXX A;  3LK4 1;  3SY7 A;  4LSI A;  1MPF A;  4AYI D;  1MM5 A;  1ZHY A;  1H6S 1;  1P4T A;  3SZD A;  3K19 A;  2J1N A;  2QTK A;  3POR A;  3LK2 B;  2M07 A;  4RLC A;  3QRC A;  2GE4 A;  3AA6 B;  4XNL A;  5AFU K;  3G7G A;  2MHL A;  4D65 A;  3UPG A;  4GCS A;  3AAA B;  4N59 A;  4FRX A;  3C5O A;  4AYM C;  4XNK A;  1QJ8 A;  4JFB A;  5T5F A;  2ODJ A;  4FUV A;  4RJW A;  2Y7S A;  2XTR A;  4FMS A;  1Q9G A;  7PRN A;  3AA0 B;  2KXP B;  3POX A;  4O3X B;  3LK3 A;  1BT9 A;  2O4V A;  4RL9 A;  2FGQ X;  3VZT X;  3JTY A;  3WI4 A;  4RJX A;  5D5D A;  2YPV A;  4C69 X;  3HOL A;  5ADX K;  1ORM A;  5PRN A;  1PHO A;  1PRN A;  2N2M A;  5JDP A;  4GF4 A;  1YS5 A;  2KDY A;  3SYB A;  4FSO A;  1QJ9 A;  3HWB A;  4LSH A;  1THQ A;  3T24 A;  3O0E A;  3DA3 A;  5ADX L;  2XTQ A;  3HOE A;  3POQ A;  4FZN A;  5DL8 A;  1OSM A;  3DA4 A;  3UAQ A;  4FRT A;  4PUX A;  5G26 A;  1HXT A;  2W81 C;  3PQS A;  3AAE B;  1Q9F A;  2K0L A;  3AA7 A;  1IZN A;  4O3W A;  3SYS A;  3LK4 2;  4AYD C;  2W80 C;  2LFU A;  5AFU L;  8PRN A;  4FSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...