3QRCA

The crystal structure of ail, the attachment invasion locus protein of yersinia pestis, in complex with the heparin analogue sucrose octasulfate
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
157
structure length
153
Chain Sequence
MEGESSISIGYAQSRVKEDGYKLDKNPRGFNLKYRYEFNNDWGVIGSFAQTRRGFEESVLIDGDFKYYSVTAGPVFRINEYVSLYGLLGAGHGKAKFSSIFGQSESRSKTSLAYGAGLQFNPHPNFVIDASYEYSKLDDVKVGTWMLGAGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Attachment invasion locus protein
publication title Structural Insights into Ail-Mediated Adhesion in Yersinia pestis.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Cell invasion
total genus 40
structure length 153
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 3qrcA00
1Q9GA 1QJ8A 2M07A 2GE4A 1G90A 2M06A 2MHLA 1QJPA 1MM5A 2ERVA 1Q9FA 2N2LA 3QRCA 2X27X 1BXWA 3G7GA 1QJ9A 1ORMA 2JMMA 2F1VA 3GP6A 2N2MA 4RLCA 1MM4A 1THQA 2MNHA 2K0LA 2F1TA 3C5OA 4PUXA 2LHFA 3QRAA 1P4TA
chains in the Genus database with same CATH superfamily
2X9KA 4KRAA 2AXTO 2GE4A 4GF4A 2M06A 3PORA 4FZLA 4JFBA 5TISO 1MM5A 4FT6A 2ERVA 3QRCA 1ZHWA 4AKRA 3KZIO 2K4TA 1BXWA 2W80C 1YS5A 1HXXA 1T1LA 3AAAA 1OSMA 2R4NA 4N59A 3WI5A 5GV0A 3AA7B 4FZNA 4N75A 3BRZA 4AUIA 5G39A 3PGRA 1MM4A 5DL6A 2W81C 3VZTX 2MNHA 4N58A 4B61A 3AA1B 4O3XB 2IWVA 3EMNX 1GFPA 2FGRA 3BRYA 2LHFA 3UAQA 4QQ1A 2XTQA 3VE2A 5KAIO 3WU2O 3PRNA 2KDYA 2XG6A 3AA6B 3AA7A 5DL5A 5JDPA 5FVNA 2QTKA 4UB8O 5PRNA 4FRTA 3AA0B 4GCPA 5B66O 5H2FO 5G3AA 3UPGA 3SYBA 2M07A 4E1SA 4LSIA 3LK2B 5AFUK 3KVDD 4FOZA 3DZMA 4D65A 2R89A 5G26A 1HXTA 3SZDA 3WI4A 4KR8A 2X27X 1OPFA 2WVPA 2XE1A 2Y2XA 3AA6A 3HOEA 3JTYA 4RL9A 3VE1A 1QJ9A 3K19A 4U9CA 1ORMA 4AYEC 4C69X 4D64A 3AA0A 2YNKA 3HW9A 3DWOX 3TZGA 3VY8X 2Y0LA 3LK3A 4FMSA 4E1TA 2XE2A 3LK2A 4FESA 3HWBA 4K3CA 3PGSA 2IWWA 2K0LA 4PR7A 2J1NA 2ODJA 4FRXA 5EE2A 4AYID 1ZHTA 2KC0A 4C4VB 3C5OA 5DL7A 2KZ7B 5B5EO 6PRNA 3NSGA 4AKMA 8PRNA 5ADXK 5G38A 2R88A 5DL8A 4BUMX 3PQSA 1PRNA 1ZHXA 1QJ8A 1IZNB 2XTRA 5IYUA 3AA1A 3DA3A 1GFQA 1H6S1 2MHLA 3A0BO 3DA4A 1QJPA 1G90A 4C4VA 2KZ7A 1Q9FA 5AFUL 1BT9A 2XE3A 2ZFGA 3POQA 2KXPB 2O4VA 4JCHA 4O49A 2WJRA 5D5DA 4LSEA 3SY7A 4RJXA 3T0SA 2F1CX 3VY9X 1E54A 4FSOA 4O3WA 2JMMA 2F1VA 3A2SX 3GP6A 4FUVA 2N2MA 5GTIO 3SYSA 1IZNA 1ZHZA 7PRNA 2XMXA 1BH3A 3PGUA 4FQEA 3SZVA 2J4UP 4LSFA 3PQUA 4GHBA 3T20A 1GFOA 4PJ0O 2F1TA 4K3BA 3POXA 2KXPA 3PF1A 4AZLA 5KAFO 3VZWX 4XNKA 2Y7SA 3FYXA 3LK42 2LFUA 3QRAA 4AYDC 2YPVA 3DWNA 2WJQA 2ZLDA 3NJTA 4XNLA 3AAEB 5ADXL 1P4TA 1PHOA 2Y0KA 4G75A 4UB6O 1Q9GA 3VZUX 4AFKA 2FGQX 2Y0HA 1HXUA 3BS0A 4O4UA 4D5UA 2OMFA 5GTHO 1T16A 1GFMA 2XE5A 2N2LA 4IL6O 4AYNA 3A0HO 1S5LO 3G7GA 3RBHA 2PORA 4O3ZA 3V8UA 1MPFA 2R4PA 3AAEA 4KR4A 4F4BA 2R4OA 4RJWA 2JQYA 3O0EA 4O3YA 4RLCA 4GCQA 4O4XA 4C00A 1THQA 4LSHA 1ZHYA 3UU2A 2R8AA 4Z3TA 1GFNA 5E79O 2PRNA 3LK41 4AYMC 4PUXA 4FZMA 3HOLA 3JCUO 4AKRB 3T24A 4CTDA 4FSPA 4G76A 5T5FA 2R4LA 3AAAB 4GCSA 4N74A 4RLBA 3SY9A 3POUA 3LK3B
chains in the Genus database with same CATH topology
4KRAA 2GE4A 4GF4A 2M06A 3PORA 4FZLA 4JFBA 1MM5A 4FT6A 2ERVA 3QRCA 1ZHWA 4AKRA 2K4TA 1BXWA 2W80C 1YS5A 1HXXA 3AAAA 4N59A 1OSMA 3WI5A 5GV0A 3AA7B 4FZNA 4AUIA 5DL6A 1MM4A 3VZTX 2W81C 4B61A 2MNHA 4N58A 3AA1B 4O3XB 3EMNX 1GFPA 2FGRA 2LHFA 3UAQA 4QQ1A 2XTQA 3VE2A 3PRNA 2KDYA 2XG6A 3AA6B 3AA7A 5DL5A 5JDPA 5FVNA 2QTKA 5PRNA 4FRTA 3AA0B 4GCPA 3UPGA 3SYBA 2M07A 4E1SA 4LSIA 3LK2B 5AFUK 3KVDD 4FOZA 4D65A 5G26A 1HXTA 3SZDA 3WI4A 4KR8A 2X27X 1OPFA 2XE1A 2Y2XA 3AA6A 3HOEA 3JTYA 4RL9A 3VE1A 4AYEC 1QJ9A 3K19A 4U9CA 1ORMA 4C69X 4D64A 3AA0A 2YNKA 3HW9A 3VY8X 3TZGA 2Y0LA 3LK3A 4FMSA 4E1TA 2XE2A 3LK2A 4FESA 3HWBA 2K0LA 2J1NA 2ODJA 4FRXA 5EE2A 4AYID 1ZHTA 2KC0A 3C5OA 5DL7A 2KZ7B 6PRNA 3NSGA 4AKMA 8PRNA 5ADXK 5DL8A 4BUMX 3PQSA 1PRNA 1ZHXA 1QJ8A 1IZNB 2XTRA 5IYUA 3AA1A 3DA3A 1GFQA 1H6S1 2MHLA 3DA4A 1G90A 1QJPA 2KZ7A 1Q9FA 5AFUL 1BT9A 2XE3A 2ZFGA 3POQA 2KXPB 2O4VA 4JCHA 4O49A 3V8UA 5D5DA 4LSEA 3SY7A 4RJXA 3T0SA 3VY9X 1E54A 4FSOA 4O3WA 2JMMA 2F1VA 3A2SX 3GP6A 4FUVA 2N2MA 3SYSA 1IZNA 1ZHZA 7PRNA 2XMXA 1BH3A 3SZVA 2J4UP 4LSFA 3PQUA 4GHBA 3T20A 1GFOA 2F1TA 3POXA 2KXPA 4AZLA 3VZWX 4XNKA 2Y7SA 3FYXA 3LK42 2LFUA 3QRAA 4AYDC 2YPVA 2ZLDA 4XNLA 3AAEB 5ADXL 1P4TA 1PHOA 2Y0KA 4G75A 3VZUX 1Q9GA 4AFKA 2FGQX 2Y0HA 1HXUA 4O4UA 4D5UA 2OMFA 1GFMA 2XE5A 2N2LA 4AYNA 3G7GA 3RBHA 2PORA 4O3ZA 1MPFA 3AAEA 4KR4A 4F4BA 4RJWA 3O0EA 4O3YA 4RLCA 4GCQA 4O4XA 1THQA 4LSHA 1ZHYA 3UU2A 4Z3TA 1GFNA 2PRNA 3LK41 4AYMC 4PUXA 4FZMA 3HOLA 4AKRB 3T24A 4FSPA 4G76A 5T5FA 3AAAB 4RLBA 4GCSA 3SY9A 3POUA 3LK3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9G A;  1QJ8 A;  2M07 A;  2GE4 A;  1G90 A;  2M06 A;  2MHL A;  1QJP A;  1MM5 A;  2ERV A;  1Q9F A;  2N2L A;  3QRC A;  2X27 X;  1BXW A;  3G7G A;  1QJ9 A;  1ORM A;  2JMM A;  2F1V A;  3GP6 A;  2N2M A;  4RLC A;  1MM4 A;  1THQ A;  2MNH A;  2K0L A;  2F1T A;  3C5O A;  4PUX A;  2LHF A;  3QRA A;  1P4T A; 
#chains in the Genus database with same CATH topology
 2X9K A;  4KRA A;  2AXT O;  2GE4 A;  4GF4 A;  2M06 A;  3POR A;  4FZL A;  4JFB A;  5TIS O;  1MM5 A;  4FT6 A;  2ERV A;  3QRC A;  1ZHW A;  4AKR A;  3KZI O;  2K4T A;  1BXW A;  2W80 C;  1YS5 A;  1HXX A;  1T1L A;  3AAA A;  1OSM A;  2R4N A;  4N59 A;  3WI5 A;  5GV0 A;  3AA7 B;  4FZN A;  4N75 A;  3BRZ A;  4AUI A;  5G39 A;  3PGR A;  1MM4 A;  5DL6 A;  2W81 C;  3VZT X;  2MNH A;  4N58 A;  4B61 A;  3AA1 B;  4O3X B;  2IWV A;  3EMN X;  1GFP A;  2FGR A;  3BRY A;  2LHF A;  3UAQ A;  4QQ1 A;  2XTQ A;  3VE2 A;  5KAI O;  3WU2 O;  3PRN A;  2KDY A;  2XG6 A;  3AA6 B;  3AA7 A;  5DL5 A;  5JDP A;  5FVN A;  2QTK A;  4UB8 O;  5PRN A;  4FRT A;  3AA0 B;  4GCP A;  5B66 O;  5H2F O;  5G3A A;  3UPG A;  3SYB A;  2M07 A;  4E1S A;  4LSI A;  3LK2 B;  5AFU K;  3KVD D;  4FOZ A;  3DZM A;  4D65 A;  2R89 A;  5G26 A;  1HXT A;  3SZD A;  3WI4 A;  4KR8 A;  2X27 X;  1OPF A;  2WVP A;  2XE1 A;  2Y2X A;  3AA6 A;  3HOE A;  3JTY A;  4RL9 A;  3VE1 A;  1QJ9 A;  3K19 A;  4U9C A;  1ORM A;  4AYE C;  4C69 X;  4D64 A;  3AA0 A;  2YNK A;  3HW9 A;  3DWO X;  3TZG A;  3VY8 X;  2Y0L A;  3LK3 A;  4FMS A;  4E1T A;  2XE2 A;  3LK2 A;  4FES A;  3HWB A;  4K3C A;  3PGS A;  2IWW A;  2K0L A;  4PR7 A;  2J1N A;  2ODJ A;  4FRX A;  5EE2 A;  4AYI D;  1ZHT A;  2KC0 A;  4C4V B;  3C5O A;  5DL7 A;  2KZ7 B;  5B5E O;  6PRN A;  3NSG A;  4AKM A;  8PRN A;  5ADX K;  5G38 A;  2R88 A;  5DL8 A;  4BUM X;  3PQS A;  1PRN A;  1ZHX A;  1QJ8 A;  1IZN B;  2XTR A;  5IYU A;  3AA1 A;  3DA3 A;  1GFQ A;  1H6S 1;  2MHL A;  3A0B O;  3DA4 A;  1QJP A;  1G90 A;  4C4V A;  2KZ7 A;  1Q9F A;  5AFU L;  1BT9 A;  2XE3 A;  2ZFG A;  3POQ A;  2KXP B;  2O4V A;  4JCH A;  4O49 A;  2WJR A;  5D5D A;  4LSE A;  3SY7 A;  4RJX A;  3T0S A;  2F1C X;  3VY9 X;  1E54 A;  4FSO A;  4O3W A;  2JMM A;  2F1V A;  3A2S X;  3GP6 A;  4FUV A;  2N2M A;  5GTI O;  3SYS A;  1IZN A;  1ZHZ A;  7PRN A;  2XMX A;  1BH3 A;  3PGU A;  4FQE A;  3SZV A;  2J4U P;  4LSF A;  3PQU A;  4GHB A;  3T20 A;  1GFO A;  4PJ0 O;  2F1T A;  4K3B A;  3POX A;  2KXP A;  3PF1 A;  4AZL A;  5KAF O;  3VZW X;  4XNK A;  2Y7S A;  3FYX A;  3LK4 2;  2LFU A;  3QRA A;  4AYD C;  2YPV A;  3DWN A;  2WJQ A;  2ZLD A;  3NJT A;  4XNL A;  3AAE B;  5ADX L;  1P4T A;  1PHO A;  2Y0K A;  4G75 A;  4UB6 O;  1Q9G A;  3VZU X;  4AFK A;  2FGQ X;  2Y0H A;  1HXU A;  3BS0 A;  4O4U A;  4D5U A;  2OMF A;  5GTH O;  1T16 A;  1GFM A;  2XE5 A;  2N2L A;  4IL6 O;  4AYN A;  3A0H O;  1S5L O;  3G7G A;  3RBH A;  2POR A;  4O3Z A;  3V8U A;  1MPF A;  2R4P A;  3AAE A;  4KR4 A;  4F4B A;  2R4O A;  4RJW A;  2JQY A;  3O0E A;  4O3Y A;  4RLC A;  4GCQ A;  4O4X A;  4C00 A;  1THQ A;  4LSH A;  1ZHY A;  3UU2 A;  2R8A A;  4Z3T A;  1GFN A;  5E79 O;  2PRN A;  3LK4 1;  4AYM C;  4PUX A;  4FZM A;  3HOL A;  3JCU O;  4AKR B;  3T24 A;  4CTD A;  4FSP A;  4G76 A;  5T5F A;  2R4L A;  3AAA B;  4GCS A;  4N74 A;  4RLB A;  3SY9 A;  3POU A;  3LK3 B; 
#chains in the Genus database with same CATH homology
 4KRA A;  2GE4 A;  4GF4 A;  2M06 A;  3POR A;  4FZL A;  4JFB A;  1MM5 A;  4FT6 A;  2ERV A;  3QRC A;  1ZHW A;  4AKR A;  2K4T A;  1BXW A;  2W80 C;  1YS5 A;  1HXX A;  3AAA A;  4N59 A;  1OSM A;  3WI5 A;  5GV0 A;  3AA7 B;  4FZN A;  4AUI A;  5DL6 A;  1MM4 A;  3VZT X;  2W81 C;  4B61 A;  2MNH A;  4N58 A;  3AA1 B;  4O3X B;  3EMN X;  1GFP A;  2FGR A;  2LHF A;  3UAQ A;  4QQ1 A;  2XTQ A;  3VE2 A;  3PRN A;  2KDY A;  2XG6 A;  3AA6 B;  3AA7 A;  5DL5 A;  5JDP A;  5FVN A;  2QTK A;  5PRN A;  4FRT A;  3AA0 B;  4GCP A;  3UPG A;  3SYB A;  2M07 A;  4E1S A;  4LSI A;  3LK2 B;  5AFU K;  3KVD D;  4FOZ A;  4D65 A;  5G26 A;  1HXT A;  3SZD A;  3WI4 A;  4KR8 A;  2X27 X;  1OPF A;  2XE1 A;  2Y2X A;  3AA6 A;  3HOE A;  3JTY A;  4RL9 A;  3VE1 A;  4AYE C;  1QJ9 A;  3K19 A;  4U9C A;  1ORM A;  4C69 X;  4D64 A;  3AA0 A;  2YNK A;  3HW9 A;  3VY8 X;  3TZG A;  2Y0L A;  3LK3 A;  4FMS A;  4E1T A;  2XE2 A;  3LK2 A;  4FES A;  3HWB A;  2K0L A;  2J1N A;  2ODJ A;  4FRX A;  5EE2 A;  4AYI D;  1ZHT A;  2KC0 A;  3C5O A;  5DL7 A;  2KZ7 B;  6PRN A;  3NSG A;  4AKM A;  8PRN A;  5ADX K;  5DL8 A;  4BUM X;  3PQS A;  1PRN A;  1ZHX A;  1QJ8 A;  1IZN B;  2XTR A;  5IYU A;  3AA1 A;  3DA3 A;  1GFQ A;  1H6S 1;  2MHL A;  3DA4 A;  1G90 A;  1QJP A;  2KZ7 A;  1Q9F A;  5AFU L;  1BT9 A;  2XE3 A;  2ZFG A;  3POQ A;  2KXP B;  2O4V A;  4JCH A;  4O49 A;  3V8U A;  5D5D A;  4LSE A;  3SY7 A;  4RJX A;  3T0S A;  3VY9 X;  1E54 A;  4FSO A;  4O3W A;  2JMM A;  2F1V A;  3A2S X;  3GP6 A;  4FUV A;  2N2M A;  3SYS A;  1IZN A;  1ZHZ A;  7PRN A;  2XMX A;  1BH3 A;  3SZV A;  2J4U P;  4LSF A;  3PQU A;  4GHB A;  3T20 A;  1GFO A;  2F1T A;  3POX A;  2KXP A;  4AZL A;  3VZW X;  4XNK A;  2Y7S A;  3FYX A;  3LK4 2;  2LFU A;  3QRA A;  4AYD C;  2YPV A;  2ZLD A;  4XNL A;  3AAE B;  5ADX L;  1P4T A;  1PHO A;  2Y0K A;  4G75 A;  3VZU X;  1Q9G A;  4AFK A;  2FGQ X;  2Y0H A;  1HXU A;  4O4U A;  4D5U A;  2OMF A;  1GFM A;  2XE5 A;  2N2L A;  4AYN A;  3G7G A;  3RBH A;  2POR A;  4O3Z A;  1MPF A;  3AAE A;  4KR4 A;  4F4B A;  4RJW A;  3O0E A;  4O3Y A;  4RLC A;  4GCQ A;  4O4X A;  1THQ A;  4LSH A;  1ZHY A;  3UU2 A;  4Z3T A;  1GFN A;  2PRN A;  3LK4 1;  4AYM C;  4PUX A;  4FZM A;  3HOL A;  4AKR B;  3T24 A;  4FSP A;  4G76 A;  5T5F A;  3AAA B;  4RLB A;  4GCS A;  3SY9 A;  3POU A;  3LK3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...