3QRCA

The crystal structure of ail, the attachment invasion locus protein of yersinia pestis, in complex with the heparin analogue sucrose octasulfate
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
157
structure length
153
Chain Sequence
MEGESSISIGYAQSRVKEDGYKLDKNPRGFNLKYRYEFNNDWGVIGSFAQTRRGFEESVLIDGDFKYYSVTAGPVFRINEYVSLYGLLGAGHGKAKFSSIFGQSESRSKTSLAYGAGLQFNPHPNFVIDASYEYSKLDDVKVGTWMLGAGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell invasion
molecule keywords Attachment invasion locus protein
publication title Structural Insights into Ail-Mediated Adhesion in Yersinia pestis.
pubmed doi rcsb
source organism Yersinia pestis
total genus 40
structure length 153
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 3qrcA00
2GE4A 3C5OA 1Q9FA 3QRAA 1MM5A 1ORMA 1MM4A 2N2LA 1QJ8A 2F1VA 2JMMA 2K0LA 2N2MA 4RLCA 3G7GA 1QJ9A 1THQA 2ERVA 3QRCA 2LHFA 1Q9GA 2M07A 3GP6A 2X27X 2MNHA 2M06A 2MHLA 1G90A 1BXWA 1QJPA 4PUXA 2F1TA 1P4TA
chains in the Genus database with same CATH superfamily
4GF4A 3WI5A 1ZHYA 3PGRA 2KZ7A 2WVPA 4AYNA 3FYXA 3AA0B 4FMSA 3SY9A 4UB8O 3VE1A 3UU2A 5JDPA 1MM4A 3LK41 4JCHA 2WJRA 2FGRA 4QQ1A 4LSFA 4U9CA 1T1LA 2PORA 5ADXK 3DA3A 3HWBA 2R89A 2KDYA 3G7GA 4O3WA 5H2FO 4FSPA 3HOLA 3O0EA 4GHBA 4E1TA 5ADXL 4FRTA 1GFQA 4AYDC 4C4VB 4AYMC 2LHFA 3AA7A 4RJWA 2PRNA 3DWNA 4O4UA 1GFOA 3AA1B 5D5DA 4AYID 8PRNA 2KXPB 4CTDA 3LK2B 4IL6O 2J1NA 3RBHA 2XTQA 3PQUA 5E79O 4GCQA 3T24A 3SY7A 3DWOX 5G39A 3T0SA 3TZGA 3BRZA 4FZNA 3HOEA 4D5UA 1ZHTA 1G90A 1S5LO 3K19A 4D65A 3EMNX 5IYUA 1PRNA 1P4TA 2GE4A 3C5OA 3VZUX 3BRYA 3PGUA 3SYSA 1Q9FA 3VZWX 2AXTO 3AAEB 2F1CX 4FESA 2XE1A 3VZTX 3DZMA 2R4PA 4FSOA 2ODJA 2JMMA 4G75A 3SZVA 2R4OA 1ZHWA 4RLCA 3UPGA 4GCPA 4LSEA 1GFNA 3AAAA 4KR4A 5DL8A 2XE2A 6PRNA 2R4LA 3QRCA 1GFMA 4AKRA 2ZFGA 2KZ7B 2Y0HA 4E1SA 5FVNA 3KVDD 4FRXA 5TISO 4LSHA 4JFBA 5GTIO 1T16A 3POUA 3SYBA 2Y2XA 3NJTA 2JQYA 3SZDA 5KAIO 2R8AA 4AUIA 3LK3A 3T20A 2Y0LA 2W81C 3UAQA 4O4XA 2KC0A 1BH3A 2XG6A 2R4NA 4RJXA 5AFUK 2K4TA 4G76A 4AYEC 3JCUO 3QRAA 1MM5A 2FGQX 3HW9A 3AA6A 1GFPA 3AA7B 4B61A 2XTRA 1QJ8A 2K0LA 2Y0KA 2N2MA 1HXTA 3PGSA 3POQA 5PRNA 1YS5A 1OSMA 3PF1A 2XE5A 3PRNA 5G26A 4K3CA 1IZNA 4N75A 3A0BO 1QJ9A 4KRAA 4Z3TA 2OMFA 2ERVA 1PHOA 3AA0A 1ZHXA 4N59A 3NSGA 5T5FA 3VY8X 3WI4A 3PORA 5B66O 5DL6A 5G38A 3GP6A 4O3YA 4BUMX 4AKMA 3JTYA 4O49A 5B5EO 2IWVA 4FZMA 4RL9A 4AZLA 2MNHA 2M06A 4RLBA 2MHLA 1BXWA 1QJPA 2Y7SA 3DA4A 4FOZA 1BT9A 2XMXA 2F1TA 4C4VA 4XNLA 5KAFO 2ZLDA 4O3ZA 3AAAB 5GV0A 4GCSA 3LK42 4O3XB 3AA1A 3VE2A 1ZHZA 2KXPA 4C00A 3LK2A 1ORMA 2WJQA 2YPVA 3VY9X 4AKRB 2N2LA 2W80C 5G3AA 5AFUL 2F1VA 4PUXA 2X9KA 3PQSA 2IWWA 3POXA 3WU2O 3BS0A 4LSIA 3V8UA 3LK3B 5DL5A 1OPFA 1HXXA 1THQA 2YNKA 3KZIO 4FUVA 4UB6O 3AAEA 3A0HO 4FZLA 4FQEA 5DL7A 4XNKA 4PR7A 1Q9GA 1MPFA 2M07A 2QTKA 4K3BA 2O4VA 5EE2A 1H6S1 4N74A 4F4BA 4FT6A 2XE3A 3AA6B 2LFUA 4D64A 7PRNA 2J4UP 2X27X 4AFKA 4C69X 4PJ0O 4N58A 5GTHO 1E54A 2R88A 1HXUA 3A2SX 4KR8A 1IZNB
chains in the Genus database with same CATH topology
4GF4A 3WI5A 1ZHYA 2KZ7A 4AYNA 3FYXA 3AA0B 4FMSA 3SY9A 3VE1A 3UU2A 5JDPA 1MM4A 3LK41 4JCHA 4QQ1A 2FGRA 4U9CA 4LSFA 2PORA 5ADXK 3DA3A 3HWBA 3G7GA 2KDYA 4O3WA 4FSPA 3HOLA 3O0EA 4GHBA 4E1TA 5ADXL 4FRTA 1GFQA 4AYDC 4AYMC 2LHFA 3AA7A 4RJWA 2PRNA 4O4UA 1GFOA 3AA1B 5D5DA 4AYID 8PRNA 2KXPB 3LK2B 3UAQA 2J1NA 3RBHA 2XTQA 3PQUA 4GCQA 3T24A 3SY7A 3T0SA 3TZGA 4D5UA 4FZNA 3HOEA 1ZHTA 1G90A 3K19A 4D65A 3EMNX 5IYUA 1PRNA 1P4TA 2GE4A 3C5OA 3VZUX 3SYSA 1Q9FA 3VZWX 3AAEB 4FESA 3VZTX 2XE1A 4FSOA 2ODJA 2JMMA 4G75A 3SZVA 1ZHWA 4RLCA 3UPGA 4GCPA 4LSEA 1GFNA 3AAAA 4KR4A 5DL8A 2XE2A 6PRNA 3QRCA 1GFMA 4AKRA 2ZFGA 2KZ7B 2Y0HA 4E1SA 5FVNA 3KVDD 4FRXA 4LSHA 4JFBA 3POUA 3SYBA 2Y2XA 4AUIA 3SZDA 3LK3A 3T20A 2Y0LA 2W81C 4O4XA 2KC0A 1BH3A 2XG6A 4RJXA 5AFUK 2K4TA 4G76A 4AYEC 3QRAA 1MM5A 2FGQX 3HW9A 3AA6A 1GFPA 3AA7B 4B61A 2XTRA 1QJ8A 2K0LA 2Y0KA 2N2MA 1HXTA 3POQA 5PRNA 1YS5A 1OSMA 3PRNA 2XE5A 5G26A 1IZNA 1QJ9A 4KRAA 4Z3TA 2OMFA 2ERVA 1PHOA 3AA0A 1ZHXA 4N59A 3NSGA 5T5FA 3VY8X 3WI4A 3PORA 5DL6A 3GP6A 4O3YA 4BUMX 4AKMA 3JTYA 4O49A 4FZMA 4RL9A 4AZLA 2MNHA 2M06A 4RLBA 2MHLA 1BXWA 1QJPA 2Y7SA 3DA4A 4FOZA 1BT9A 2XMXA 2F1TA 4XNLA 2ZLDA 4O3ZA 3AAAB 5GV0A 4GCSA 3LK42 4O3XB 3AA1A 3VE2A 1ZHZA 2KXPA 3LK2A 1ORMA 2YPVA 3VY9X 4AKRB 2N2LA 2W80C 5AFUL 2F1VA 3PQSA 3POXA 4LSIA 3V8UA 3LK3B 5DL5A 1OPFA 1HXXA 1THQA 2YNKA 4FUVA 3AAEA 4FZLA 5DL7A 4XNKA 1Q9GA 1MPFA 2M07A 2QTKA 5EE2A 2O4VA 4F4BA 1H6S1 4FT6A 2XE3A 3AA6B 2LFUA 4D64A 7PRNA 2J4UP 2X27X 4AFKA 4C69X 4N58A 1E54A 4PUXA 1HXUA 3A2SX 4KR8A 1IZNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GE4 A;  3C5O A;  1Q9F A;  3QRA A;  1MM5 A;  1ORM A;  1MM4 A;  2N2L A;  1QJ8 A;  2F1V A;  2JMM A;  2K0L A;  2N2M A;  4RLC A;  3G7G A;  1QJ9 A;  1THQ A;  2ERV A;  3QRC A;  2LHF A;  1Q9G A;  2M07 A;  3GP6 A;  2X27 X;  2MNH A;  2M06 A;  2MHL A;  1G90 A;  1BXW A;  1QJP A;  4PUX A;  2F1T A;  1P4T A; 
#chains in the Genus database with same CATH topology
 4GF4 A;  3WI5 A;  1ZHY A;  3PGR A;  2KZ7 A;  2WVP A;  4AYN A;  3FYX A;  3AA0 B;  4FMS A;  3SY9 A;  4UB8 O;  3VE1 A;  3UU2 A;  5JDP A;  1MM4 A;  3LK4 1;  4JCH A;  2WJR A;  2FGR A;  4QQ1 A;  4LSF A;  4U9C A;  1T1L A;  2POR A;  5ADX K;  3DA3 A;  3HWB A;  2R89 A;  2KDY A;  3G7G A;  4O3W A;  5H2F O;  4FSP A;  3HOL A;  3O0E A;  4GHB A;  4E1T A;  5ADX L;  4FRT A;  1GFQ A;  4AYD C;  4C4V B;  4AYM C;  2LHF A;  3AA7 A;  4RJW A;  2PRN A;  3DWN A;  4O4U A;  1GFO A;  3AA1 B;  5D5D A;  4AYI D;  8PRN A;  2KXP B;  4CTD A;  3LK2 B;  4IL6 O;  2J1N A;  3RBH A;  2XTQ A;  3PQU A;  5E79 O;  4GCQ A;  3T24 A;  3SY7 A;  3DWO X;  5G39 A;  3T0S A;  3TZG A;  3BRZ A;  4FZN A;  3HOE A;  4D5U A;  1ZHT A;  1G90 A;  1S5L O;  3K19 A;  4D65 A;  3EMN X;  5IYU A;  1PRN A;  1P4T A;  2GE4 A;  3C5O A;  3VZU X;  3BRY A;  3PGU A;  3SYS A;  1Q9F A;  3VZW X;  2AXT O;  3AAE B;  2F1C X;  4FES A;  2XE1 A;  3VZT X;  3DZM A;  2R4P A;  4FSO A;  2ODJ A;  2JMM A;  4G75 A;  3SZV A;  2R4O A;  1ZHW A;  4RLC A;  3UPG A;  4GCP A;  4LSE A;  1GFN A;  3AAA A;  4KR4 A;  5DL8 A;  2XE2 A;  6PRN A;  2R4L A;  3QRC A;  1GFM A;  4AKR A;  2ZFG A;  2KZ7 B;  2Y0H A;  4E1S A;  5FVN A;  3KVD D;  4FRX A;  5TIS O;  4LSH A;  4JFB A;  5GTI O;  1T16 A;  3POU A;  3SYB A;  2Y2X A;  3NJT A;  2JQY A;  3SZD A;  5KAI O;  2R8A A;  4AUI A;  3LK3 A;  3T20 A;  2Y0L A;  2W81 C;  3UAQ A;  4O4X A;  2KC0 A;  1BH3 A;  2XG6 A;  2R4N A;  4RJX A;  5AFU K;  2K4T A;  4G76 A;  4AYE C;  3JCU O;  3QRA A;  1MM5 A;  2FGQ X;  3HW9 A;  3AA6 A;  1GFP A;  3AA7 B;  4B61 A;  2XTR A;  1QJ8 A;  2K0L A;  2Y0K A;  2N2M A;  1HXT A;  3PGS A;  3POQ A;  5PRN A;  1YS5 A;  1OSM A;  3PF1 A;  2XE5 A;  3PRN A;  5G26 A;  4K3C A;  1IZN A;  4N75 A;  3A0B O;  1QJ9 A;  4KRA A;  4Z3T A;  2OMF A;  2ERV A;  1PHO A;  3AA0 A;  1ZHX A;  4N59 A;  3NSG A;  5T5F A;  3VY8 X;  3WI4 A;  3POR A;  5B66 O;  5DL6 A;  5G38 A;  3GP6 A;  4O3Y A;  4BUM X;  4AKM A;  3JTY A;  4O49 A;  5B5E O;  2IWV A;  4FZM A;  4RL9 A;  4AZL A;  2MNH A;  2M06 A;  4RLB A;  2MHL A;  1BXW A;  1QJP A;  2Y7S A;  3DA4 A;  4FOZ A;  1BT9 A;  2XMX A;  2F1T A;  4C4V A;  4XNL A;  5KAF O;  2ZLD A;  4O3Z A;  3AAA B;  5GV0 A;  4GCS A;  3LK4 2;  4O3X B;  3AA1 A;  3VE2 A;  1ZHZ A;  2KXP A;  4C00 A;  3LK2 A;  1ORM A;  2WJQ A;  2YPV A;  3VY9 X;  4AKR B;  2N2L A;  2W80 C;  5G3A A;  5AFU L;  2F1V A;  4PUX A;  2X9K A;  3PQS A;  2IWW A;  3POX A;  3WU2 O;  3BS0 A;  4LSI A;  3V8U A;  3LK3 B;  5DL5 A;  1OPF A;  1HXX A;  1THQ A;  2YNK A;  3KZI O;  4FUV A;  4UB6 O;  3AAE A;  3A0H O;  4FZL A;  4FQE A;  5DL7 A;  4XNK A;  4PR7 A;  1Q9G A;  1MPF A;  2M07 A;  2QTK A;  4K3B A;  2O4V A;  5EE2 A;  1H6S 1;  4N74 A;  4F4B A;  4FT6 A;  2XE3 A;  3AA6 B;  2LFU A;  4D64 A;  7PRN A;  2J4U P;  2X27 X;  4AFK A;  4C69 X;  4PJ0 O;  4N58 A;  5GTH O;  1E54 A;  2R88 A;  1HXU A;  3A2S X;  4KR8 A;  1IZN B; 
#chains in the Genus database with same CATH homology
 4GF4 A;  3WI5 A;  1ZHY A;  2KZ7 A;  4AYN A;  3FYX A;  3AA0 B;  4FMS A;  3SY9 A;  3VE1 A;  3UU2 A;  5JDP A;  1MM4 A;  3LK4 1;  4JCH A;  4QQ1 A;  2FGR A;  4U9C A;  4LSF A;  2POR A;  5ADX K;  3DA3 A;  3HWB A;  3G7G A;  2KDY A;  4O3W A;  4FSP A;  3HOL A;  3O0E A;  4GHB A;  4E1T A;  5ADX L;  4FRT A;  1GFQ A;  4AYD C;  4AYM C;  2LHF A;  3AA7 A;  4RJW A;  2PRN A;  4O4U A;  1GFO A;  3AA1 B;  5D5D A;  4AYI D;  8PRN A;  2KXP B;  3LK2 B;  3UAQ A;  2J1N A;  3RBH A;  2XTQ A;  3PQU A;  4GCQ A;  3T24 A;  3SY7 A;  3T0S A;  3TZG A;  4D5U A;  4FZN A;  3HOE A;  1ZHT A;  1G90 A;  3K19 A;  4D65 A;  3EMN X;  5IYU A;  1PRN A;  1P4T A;  2GE4 A;  3C5O A;  3VZU X;  3SYS A;  1Q9F A;  3VZW X;  3AAE B;  4FES A;  3VZT X;  2XE1 A;  4FSO A;  2ODJ A;  2JMM A;  4G75 A;  3SZV A;  1ZHW A;  4RLC A;  3UPG A;  4GCP A;  4LSE A;  1GFN A;  3AAA A;  4KR4 A;  5DL8 A;  2XE2 A;  6PRN A;  3QRC A;  1GFM A;  4AKR A;  2ZFG A;  2KZ7 B;  2Y0H A;  4E1S A;  5FVN A;  3KVD D;  4FRX A;  4LSH A;  4JFB A;  3POU A;  3SYB A;  2Y2X A;  4AUI A;  3SZD A;  3LK3 A;  3T20 A;  2Y0L A;  2W81 C;  4O4X A;  2KC0 A;  1BH3 A;  2XG6 A;  4RJX A;  5AFU K;  2K4T A;  4G76 A;  4AYE C;  3QRA A;  1MM5 A;  2FGQ X;  3HW9 A;  3AA6 A;  1GFP A;  3AA7 B;  4B61 A;  2XTR A;  1QJ8 A;  2K0L A;  2Y0K A;  2N2M A;  1HXT A;  3POQ A;  5PRN A;  1YS5 A;  1OSM A;  3PRN A;  2XE5 A;  5G26 A;  1IZN A;  1QJ9 A;  4KRA A;  4Z3T A;  2OMF A;  2ERV A;  1PHO A;  3AA0 A;  1ZHX A;  4N59 A;  3NSG A;  5T5F A;  3VY8 X;  3WI4 A;  3POR A;  5DL6 A;  3GP6 A;  4O3Y A;  4BUM X;  4AKM A;  3JTY A;  4O49 A;  4FZM A;  4RL9 A;  4AZL A;  2MNH A;  2M06 A;  4RLB A;  2MHL A;  1BXW A;  1QJP A;  2Y7S A;  3DA4 A;  4FOZ A;  1BT9 A;  2XMX A;  2F1T A;  4XNL A;  2ZLD A;  4O3Z A;  3AAA B;  5GV0 A;  4GCS A;  3LK4 2;  4O3X B;  3AA1 A;  3VE2 A;  1ZHZ A;  2KXP A;  3LK2 A;  1ORM A;  2YPV A;  3VY9 X;  4AKR B;  2N2L A;  2W80 C;  5AFU L;  2F1V A;  3PQS A;  3POX A;  4LSI A;  3V8U A;  3LK3 B;  5DL5 A;  1OPF A;  1HXX A;  1THQ A;  2YNK A;  4FUV A;  3AAE A;  4FZL A;  5DL7 A;  4XNK A;  1Q9G A;  1MPF A;  2M07 A;  2QTK A;  5EE2 A;  2O4V A;  4F4B A;  1H6S 1;  4FT6 A;  2XE3 A;  3AA6 B;  2LFU A;  4D64 A;  7PRN A;  2J4U P;  2X27 X;  4AFK A;  4C69 X;  4N58 A;  1E54 A;  4PUX A;  1HXU A;  3A2S X;  4KR8 A;  1IZN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...