4LSFA

Ion selectivity of ompf soaked in 0.1m kbr
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
340
structure length
339
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein F
publication title A structural study of ion permeation in OmpF porin from anomalous X-ray diffraction and molecular dynamics simulations.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 98
structure length 339
sequence length 340
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4lsfA00
4FOZA 2Y0LA 3T20A 2Y2XA 3EMNX 3POQA 3VY8X 3SY7A 4FSOA 2Y0KA 4RJWA 2FGQX 4BUMX 2O4VA 2OMFA 2ZLDA 3HW9A 4FRXA 3UU2A 3WI5A 4LSEA 4KRAA 4D5UA 3POUA 4C69X 3K19A 5JDPA 3NSGA 3JTYA 1H6S1 2ODJA 4GCSA 3SZDA 2XE5A 5DL5A 1BH3A 3PORA 4FSPA 5DL7A 3VZUX 3HWBA 3VZWX 2Y0HA 5FVNA 2ZFGA 3SZVA 4KR8A 2QTKA 4FMSA 4KR4A 1HXXA 3WI4A 3A2SX 1OSMA 1MPFA 2FGRA 7PRNA 4LSIA 4GCQA 4JFBA 2PRNA 1GFPA 2PORA 1GFOA 2XE1A 3VZTX 1PRNA 2J1NA 3T0SA 6PRNA 1HXTA 2J4UP 3UPGA 3VY9X 4AUIA 4LSHA 2XE3A 1BT9A 3SY9A 1GFNA 3FYXA 2K4TA 4LSFA 5PRNA 1OPFA 3SYBA 4RJXA 4FRTA 2XG6A 3T24A 8PRNA 1HXUA 1PHOA 1E54A 3O0EA 3SYSA 4FT6A 5DL6A 4GCPA 5DL8A 4D65A 1GFQA 4D64A 3POXA 2XE2A 3PRNA 1GFMA
chains in the Genus database with same CATH superfamily
1ORMA 4AKRA 4FOZA 1ZHYA 2Y0LA 4CTDA 4RLCA 5GV0A 2Y2XA 3T20A 1P4TA 2W81C 3EMNX 3AA0A 3POQA 4PUXA 2X27X 2JMMA 4IL6O 3VY8X 4RL9A 1T1LA 2KXPB 3SY7A 4FSOA 2Y0KA 3PGSA 4RJWA 1Q9FA 2FGQX 3AA6A 5D5DA 5KAFO 4FQEA 4FZMA 4BUMX 4N75A 2O4VA 2OMFA 2ZLDA 3HW9A 4FRXA 3UU2A 5KAIO 2Y7SA 3WI5A 4LSEA 2F1VA 4KRAA 4D5UA 3POUA 5GTIO 1QJ9A 4C69X 3K19A 5JDPA 4O3YA 3NSGA 2M06A 4AKMA 3JTYA 1H6S1 4O3XB 3LK42 2ODJA 4GHBA 1ZHXA 4GCSA 5G39A 4C00A 4G75A 3SZDA 3AAAB 2KXPA 4K3BA 5E79O 2MHLA 4AYEC 4AZLA 2XE5A 5DL5A 5B5EO 4O3WA 2IWWA 1BH3A 3PORA 2GE4A 3A0BO 4FSPA 5DL7A 5TISO 3HWBA 1ZHZA 3VZUX 3VZWX 4N74A 2KZ7B 2WJRA 2Y0HA 2R4PA 3JCUO 2AXTO 1YS5A 5FVNA 4F4BA 4PR7A 2ZFGA 3SZVA 2LFUA 3AA7B 2XTRA 5G3AA 1THQA 3AA1B 4O49A 4KR8A 4PJ0O 2QTKA 5IYUA 2N2MA 1QJ8A 2R8AA 4FMSA 5ADXK 1BXWA 4C4VA 4KR4A 5GTHO 5H2FO 1HXXA 2XTQA 3PQUA 3VE2A 3A2SX 5G26A 3PGUA 1OSMA 3WI4A 1MM4A 3WU2O 1MPFA 2FGRA 4C4VB 5B66O 2F1CX 4N58A 4GCQA 4LSIA 4JFBA 2KDYA 2R89A 3QRCA 4QQ1A 2R4NA 4RLBA 3AAAA 4O4UA 3PF1A 2PRNA 1GFPA 2YNKA 4O4XA 4K3CA 2PORA 4AYDC 1GFOA 5EE2A 2XE1A 3LK3B 1G90A 3KZIO 3BS0A 3VZTX 3BRZA 4Z3TA 1PRNA 1T16A 2J1NA 2KZ7A 2KC0A 3T0SA 1HXTA 3AAEB 6PRNA 2J4UP 7PRNA 3UAQA 3TZGA 3C5OA 3AA7A 4E1SA 2F1TA 3AA1A 5AFUL 3UPGA 2W80C 5ADXL 3VY9X 1QJPA 2ERVA 1S5LO 2M07A 2XE3A 4LSHA 4O3ZA 1IZNA 4FZLA 4AUIA 1BT9A 3SY9A 2WJQA 1MM5A 4UB8O 5G38A 5T5FA 2IWVA 5AFUK 1GFNA 3FYXA 4JCHA 3PQSA 1IZNB 2K4TA 2X9KA 3KVDD 2LHFA 1OPFA 1ZHTA 4LSFA 5PRNA 2R88A 2K0LA 3SYBA 4AFKA 4GF4A 3LK41 4U9CA 4AYID 4E1TA 1ZHWA 2MNHA 4RJXA 2R4LA 4FRTA 4AKRB 3HOLA 2XG6A 3T24A 8PRNA 4XNLA 3LK3A 3QRAA 3DA3A 4B61A 3AA0B 3LK2A 4G76A 4UB6O 3VE1A 1HXUA 3AAEA 3NJTA 3G7GA 4AYNA 3LK2B 3AA6B 2YPVA 3DWNA 3DA4A 4FESA 1PHOA 3HOEA 1E54A 4FZNA 3O0EA 3V8UA 3A0HO 2R4OA 3BRYA 4XNKA 3RBHA 3SYSA 2N2LA 4FT6A 2WVPA 2XMXA 3DWOX 4AYMC 3PRNA 3PGRA 4FUVA 5DL6A 1Q9GA 4GCPA 5DL8A 1GFQA 3GP6A 4D65A 4D64A 3DZMA 3POXA 4N59A 2XE2A 2JQYA 1GFMA
chains in the Genus database with same CATH topology
1ORMA 4AKRA 4FOZA 1ZHYA 2Y0LA 4RLCA 5GV0A 2Y2XA 3T20A 1P4TA 2W81C 3EMNX 3AA0A 3POQA 4PUXA 2X27X 2JMMA 3VY8X 4RL9A 2KXPB 3SY7A 4FSOA 2Y0KA 4RJWA 1Q9FA 2FGQX 3AA6A 5D5DA 4FZMA 4BUMX 2O4VA 2OMFA 2ZLDA 3HW9A 4FRXA 3UU2A 2Y7SA 3WI5A 4LSEA 2F1VA 4KRAA 4D5UA 3POUA 1QJ9A 4C69X 3K19A 5JDPA 4O3YA 3NSGA 2M06A 4AKMA 3JTYA 1H6S1 4O3XB 3LK42 2ODJA 4GHBA 1ZHXA 4GCSA 4G75A 3SZDA 3AAAB 2KXPA 4AYEC 2MHLA 4AZLA 2XE5A 5DL5A 4O3WA 1BH3A 3PORA 2GE4A 4FSPA 5DL7A 3VZUX 3HWBA 1ZHZA 3VZWX 2KZ7B 2Y0HA 1YS5A 5FVNA 4F4BA 2ZFGA 3SZVA 2LFUA 3AA7B 2XTRA 1THQA 3AA1B 4O49A 4KR8A 2QTKA 2N2MA 1QJ8A 4FMSA 5ADXK 1BXWA 4KR4A 1HXXA 2XTQA 3PQUA 3VE2A 3A2SX 5G26A 3WI4A 1OSMA 1MM4A 1MPFA 2FGRA 7PRNA 4N58A 4GCQA 4LSIA 4JFBA 2KDYA 3QRCA 4RLBA 4QQ1A 5IYUA 3AAAA 4O4UA 2PRNA 1GFPA 2YNKA 4O4XA 2PORA 4AYDC 1GFOA 5EE2A 2XE1A 3LK3B 1G90A 3VZTX 4Z3TA 1PRNA 2J1NA 2KZ7A 2KC0A 3T0SA 1HXTA 3AAEB 6PRNA 2J4UP 3UAQA 3TZGA 3C5OA 3AA7A 4E1SA 2F1TA 3AA1A 5AFUL 3UPGA 2W80C 5ADXL 3VY9X 1QJPA 2ERVA 2M07A 4LSHA 2XE3A 4O3ZA 4AUIA 1IZNA 4FZLA 1BT9A 3SY9A 1MM5A 5T5FA 5AFUK 1GFNA 3FYXA 4JCHA 3PQSA 1IZNB 2K4TA 4LSFA 3KVDD 2LHFA 1OPFA 1ZHTA 5PRNA 4AFKA 3SYBA 2K0LA 4GF4A 3LK41 4U9CA 4AYID 4E1TA 1ZHWA 2MNHA 4RJXA 4FRTA 4AKRB 3HOLA 2XG6A 3T24A 8PRNA 4XNLA 3LK3A 3QRAA 3DA3A 4B61A 3AA0B 3LK2A 4G76A 3VE1A 1HXUA 3AAEA 3G7GA 4AYNA 3LK2B 3AA6B 2YPVA 4FESA 3DA4A 1PHOA 3HOEA 1E54A 4FZNA 3O0EA 3V8UA 4XNKA 3RBHA 3SYSA 2N2LA 4FT6A 2XMXA 4AYMC 4FUVA 5DL6A 1Q9GA 4GCPA 5DL8A 1GFQA 3GP6A 4D65A 4D64A 3POXA 4N59A 2XE2A 3PRNA 1GFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FOZ A;  2Y0L A;  3T20 A;  2Y2X A;  3EMN X;  3POQ A;  3VY8 X;  3SY7 A;  4FSO A;  2Y0K A;  4RJW A;  2FGQ X;  4BUM X;  2O4V A;  2OMF A;  2ZLD A;  3HW9 A;  4FRX A;  3UU2 A;  3WI5 A;  4LSE A;  4KRA A;  4D5U A;  3POU A;  4C69 X;  3K19 A;  5JDP A;  3NSG A;  3JTY A;  1H6S 1;  2ODJ A;  4GCS A;  3SZD A;  2XE5 A;  5DL5 A;  1BH3 A;  3POR A;  4FSP A;  5DL7 A;  3VZU X;  3HWB A;  3VZW X;  2Y0H A;  5FVN A;  2ZFG A;  3SZV A;  4KR8 A;  2QTK A;  4FMS A;  4KR4 A;  1HXX A;  3WI4 A;  3A2S X;  1OSM A;  1MPF A;  2FGR A;  7PRN A;  4LSI A;  4GCQ A;  4JFB A;  2PRN A;  1GFP A;  2POR A;  1GFO A;  2XE1 A;  3VZT X;  1PRN A;  2J1N A;  3T0S A;  6PRN A;  1HXT A;  2J4U P;  3UPG A;  3VY9 X;  4AUI A;  4LSH A;  2XE3 A;  1BT9 A;  3SY9 A;  1GFN A;  3FYX A;  2K4T A;  4LSF A;  5PRN A;  1OPF A;  3SYB A;  4RJX A;  4FRT A;  2XG6 A;  3T24 A;  8PRN A;  1HXU A;  1PHO A;  1E54 A;  3O0E A;  3SYS A;  4FT6 A;  5DL6 A;  4GCP A;  5DL8 A;  4D65 A;  1GFQ A;  4D64 A;  3POX A;  2XE2 A;  3PRN A;  1GFM A; 
#chains in the Genus database with same CATH topology
 1ORM A;  4AKR A;  4FOZ A;  1ZHY A;  2Y0L A;  4CTD A;  4RLC A;  5GV0 A;  2Y2X A;  3T20 A;  1P4T A;  2W81 C;  3EMN X;  3AA0 A;  3POQ A;  4PUX A;  2X27 X;  2JMM A;  4IL6 O;  3VY8 X;  4RL9 A;  1T1L A;  2KXP B;  3SY7 A;  4FSO A;  2Y0K A;  3PGS A;  4RJW A;  1Q9F A;  2FGQ X;  3AA6 A;  5D5D A;  5KAF O;  4FQE A;  4FZM A;  4BUM X;  4N75 A;  2O4V A;  2OMF A;  2ZLD A;  3HW9 A;  4FRX A;  3UU2 A;  5KAI O;  2Y7S A;  3WI5 A;  4LSE A;  2F1V A;  4KRA A;  4D5U A;  3POU A;  5GTI O;  1QJ9 A;  4C69 X;  3K19 A;  5JDP A;  4O3Y A;  3NSG A;  2M06 A;  4AKM A;  3JTY A;  1H6S 1;  4O3X B;  3LK4 2;  2ODJ A;  4GHB A;  1ZHX A;  4GCS A;  5G39 A;  4C00 A;  4G75 A;  3SZD A;  3AAA B;  2KXP A;  4K3B A;  5E79 O;  2MHL A;  4AYE C;  4AZL A;  2XE5 A;  5DL5 A;  5B5E O;  4O3W A;  2IWW A;  1BH3 A;  3POR A;  2GE4 A;  3A0B O;  4FSP A;  5DL7 A;  5TIS O;  3HWB A;  1ZHZ A;  3VZU X;  3VZW X;  4N74 A;  2KZ7 B;  2WJR A;  2Y0H A;  2R4P A;  3JCU O;  2AXT O;  1YS5 A;  5FVN A;  4F4B A;  4PR7 A;  2ZFG A;  3SZV A;  2LFU A;  3AA7 B;  2XTR A;  5G3A A;  1THQ A;  3AA1 B;  4O49 A;  4KR8 A;  4PJ0 O;  2QTK A;  5IYU A;  2N2M A;  1QJ8 A;  2R8A A;  4FMS A;  5ADX K;  1BXW A;  4C4V A;  4KR4 A;  5GTH O;  5H2F O;  1HXX A;  2XTQ A;  3PQU A;  3VE2 A;  3A2S X;  5G26 A;  3PGU A;  1OSM A;  3WI4 A;  1MM4 A;  3WU2 O;  1MPF A;  2FGR A;  4C4V B;  5B66 O;  2F1C X;  4N58 A;  4GCQ A;  4LSI A;  4JFB A;  2KDY A;  2R89 A;  3QRC A;  4QQ1 A;  2R4N A;  4RLB A;  3AAA A;  4O4U A;  3PF1 A;  2PRN A;  1GFP A;  2YNK A;  4O4X A;  4K3C A;  2POR A;  4AYD C;  1GFO A;  5EE2 A;  2XE1 A;  3LK3 B;  1G90 A;  3KZI O;  3BS0 A;  3VZT X;  3BRZ A;  4Z3T A;  1PRN A;  1T16 A;  2J1N A;  2KZ7 A;  2KC0 A;  3T0S A;  1HXT A;  3AAE B;  6PRN A;  2J4U P;  7PRN A;  3UAQ A;  3TZG A;  3C5O A;  3AA7 A;  4E1S A;  2F1T A;  3AA1 A;  5AFU L;  3UPG A;  2W80 C;  5ADX L;  3VY9 X;  1QJP A;  2ERV A;  1S5L O;  2M07 A;  2XE3 A;  4LSH A;  4O3Z A;  1IZN A;  4FZL A;  4AUI A;  1BT9 A;  3SY9 A;  2WJQ A;  1MM5 A;  4UB8 O;  5G38 A;  5T5F A;  2IWV A;  5AFU K;  1GFN A;  3FYX A;  4JCH A;  3PQS A;  1IZN B;  2K4T A;  2X9K A;  3KVD D;  2LHF A;  1OPF A;  1ZHT A;  4LSF A;  5PRN A;  2R88 A;  2K0L A;  3SYB A;  4AFK A;  4GF4 A;  3LK4 1;  4U9C A;  4AYI D;  4E1T A;  1ZHW A;  2MNH A;  4RJX A;  2R4L A;  4FRT A;  4AKR B;  3HOL A;  2XG6 A;  3T24 A;  8PRN A;  4XNL A;  3LK3 A;  3QRA A;  3DA3 A;  4B61 A;  3AA0 B;  3LK2 A;  4G76 A;  4UB6 O;  3VE1 A;  1HXU A;  3AAE A;  3NJT A;  3G7G A;  4AYN A;  3LK2 B;  3AA6 B;  2YPV A;  3DWN A;  3DA4 A;  4FES A;  1PHO A;  3HOE A;  1E54 A;  4FZN A;  3O0E A;  3V8U A;  3A0H O;  2R4O A;  3BRY A;  4XNK A;  3RBH A;  3SYS A;  2N2L A;  4FT6 A;  2WVP A;  2XMX A;  3DWO X;  4AYM C;  3PRN A;  3PGR A;  4FUV A;  5DL6 A;  1Q9G A;  4GCP A;  5DL8 A;  1GFQ A;  3GP6 A;  4D65 A;  4D64 A;  3DZM A;  3POX A;  4N59 A;  2XE2 A;  2JQY A;  1GFM A; 
#chains in the Genus database with same CATH homology
 1ORM A;  4AKR A;  4FOZ A;  1ZHY A;  2Y0L A;  4RLC A;  5GV0 A;  2Y2X A;  3T20 A;  1P4T A;  2W81 C;  3EMN X;  3AA0 A;  3POQ A;  4PUX A;  2X27 X;  2JMM A;  3VY8 X;  4RL9 A;  2KXP B;  3SY7 A;  4FSO A;  2Y0K A;  4RJW A;  1Q9F A;  2FGQ X;  3AA6 A;  5D5D A;  4FZM A;  4BUM X;  2O4V A;  2OMF A;  2ZLD A;  3HW9 A;  4FRX A;  3UU2 A;  2Y7S A;  3WI5 A;  4LSE A;  2F1V A;  4KRA A;  4D5U A;  3POU A;  1QJ9 A;  4C69 X;  3K19 A;  5JDP A;  4O3Y A;  3NSG A;  2M06 A;  4AKM A;  3JTY A;  1H6S 1;  4O3X B;  3LK4 2;  2ODJ A;  4GHB A;  1ZHX A;  4GCS A;  4G75 A;  3SZD A;  3AAA B;  2KXP A;  4AYE C;  2MHL A;  4AZL A;  2XE5 A;  5DL5 A;  4O3W A;  1BH3 A;  3POR A;  2GE4 A;  4FSP A;  5DL7 A;  3VZU X;  3HWB A;  1ZHZ A;  3VZW X;  2KZ7 B;  2Y0H A;  1YS5 A;  5FVN A;  4F4B A;  2ZFG A;  3SZV A;  2LFU A;  3AA7 B;  2XTR A;  1THQ A;  3AA1 B;  4O49 A;  4KR8 A;  2QTK A;  2N2M A;  1QJ8 A;  4FMS A;  5ADX K;  1BXW A;  4KR4 A;  1HXX A;  2XTQ A;  3PQU A;  3VE2 A;  3A2S X;  5G26 A;  3WI4 A;  1OSM A;  1MM4 A;  1MPF A;  2FGR A;  7PRN A;  4N58 A;  4GCQ A;  4LSI A;  4JFB A;  2KDY A;  3QRC A;  4RLB A;  4QQ1 A;  5IYU A;  3AAA A;  4O4U A;  2PRN A;  1GFP A;  2YNK A;  4O4X A;  2POR A;  4AYD C;  1GFO A;  5EE2 A;  2XE1 A;  3LK3 B;  1G90 A;  3VZT X;  4Z3T A;  1PRN A;  2J1N A;  2KZ7 A;  2KC0 A;  3T0S A;  1HXT A;  3AAE B;  6PRN A;  2J4U P;  3UAQ A;  3TZG A;  3C5O A;  3AA7 A;  4E1S A;  2F1T A;  3AA1 A;  5AFU L;  3UPG A;  2W80 C;  5ADX L;  3VY9 X;  1QJP A;  2ERV A;  2M07 A;  4LSH A;  2XE3 A;  4O3Z A;  4AUI A;  1IZN A;  4FZL A;  1BT9 A;  3SY9 A;  1MM5 A;  5T5F A;  5AFU K;  1GFN A;  3FYX A;  4JCH A;  3PQS A;  1IZN B;  2K4T A;  4LSF A;  3KVD D;  2LHF A;  1OPF A;  1ZHT A;  5PRN A;  4AFK A;  3SYB A;  2K0L A;  4GF4 A;  3LK4 1;  4U9C A;  4AYI D;  4E1T A;  1ZHW A;  2MNH A;  4RJX A;  4FRT A;  4AKR B;  3HOL A;  2XG6 A;  3T24 A;  8PRN A;  4XNL A;  3LK3 A;  3QRA A;  3DA3 A;  4B61 A;  3AA0 B;  3LK2 A;  4G76 A;  3VE1 A;  1HXU A;  3AAE A;  3G7G A;  4AYN A;  3LK2 B;  3AA6 B;  2YPV A;  4FES A;  3DA4 A;  1PHO A;  3HOE A;  1E54 A;  4FZN A;  3O0E A;  3V8U A;  4XNK A;  3RBH A;  3SYS A;  2N2L A;  4FT6 A;  2XMX A;  4AYM C;  4FUV A;  5DL6 A;  1Q9G A;  4GCP A;  5DL8 A;  1GFQ A;  3GP6 A;  4D65 A;  4D64 A;  3POX A;  4N59 A;  2XE2 A;  3PRN A;  1GFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...