4LSFA

Ion selectivity of ompf soaked in 0.1m kbr
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
340
structure length
339
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Outer membrane protein F
publication title A structural study of ion permeation in OmpF porin from anomalous X-ray diffraction and molecular dynamics simulations.
pubmed doi rcsb
source organism Escherichia coli
total genus 98
structure length 339
sequence length 340
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4lsfA00
5FVNA 3PRNA 1PHOA 1GFNA 3POXA 1E54A 7PRNA 3VZTX 2FGRA 3JTYA 1GFOA 2XE2A 3WI4A 4LSIA 2J4UP 1GFQA 4LSEA 4GCQA 2PRNA 2ZLDA 1OSMA 3T20A 6PRNA 1HXTA 2Y0LA 3EMNX 3PORA 3UU2A 2Y2XA 2FGQX 3HWBA 2XG6A 3SYBA 3VZWX 2XE3A 3SZDA 2XE1A 3T24A 5DL6A 2O4VA 1OPFA 3NSGA 5DL8A 4GCPA 4KR8A 4D5UA 2QTKA 4AUIA 3A2SX 4LSFA 3SY9A 3FYXA 3T0SA 4FSOA 5JDPA 2PORA 1HXXA 3SY7A 1BT9A 3POQA 1GFMA 3O0EA 4FRXA 4KRAA 4LSHA 4BUMX 5PRNA 4FOZA 3K19A 4FSPA 2ODJA 2J1NA 2XE5A 4FRTA 1BH3A 3SZVA 3UPGA 1PRNA 2Y0KA 4KR4A 2K4TA 4D64A 2Y0HA 3VY9X 3SYSA 4RJWA 4RJXA 4FMSA 3VY8X 3WI5A 3POUA 5DL5A 4GCSA 3VZUX 4C69X 1H6S1 2ZFGA 1HXUA 4JFBA 4FT6A 2OMFA 5DL7A 8PRNA 1MPFA 3HW9A 4D65A 1GFPA
chains in the Genus database with same CATH superfamily
5FVNA 4O3XB 4K3BA 3A0BO 3PRNA 1PHOA 4E1SA 5KAIO 3DA3A 3KZIO 1GFNA 3AA6A 3POXA 2MHLA 1E54A 2KXPB 3DA4A 3VZTX 3PGUA 7PRNA 4FZMA 4FUVA 2FGRA 3JTYA 3AAEB 1BXWA 2JMMA 4O4XA 1GFOA 1ZHWA 2WVPA 5KAFO 2XE2A 4AZLA 2XTRA 3WI4A 4CTDA 4LSIA 1ZHZA 1YS5A 2MNHA 2J4UP 1GFQA 1T16A 2YPVA 3QRAA 4LSEA 4GCQA 3LK41 2PRNA 1P4TA 2XTQA 1OSMA 2ZLDA 2X27X 4O4UA 2WJRA 3T20A 6PRNA 2KC0A 1HXTA 2Y0LA 2Y7SA 4C4VB 2R89A 3EMNX 3PORA 3DZMA 3UU2A 3BRYA 4C00A 2Y2XA 2WJQA 1QJ8A 2ERVA 3WU2O 2W80C 1IZNB 2FGQX 3HWBA 2KZ7A 2XG6A 3HOEA 3SYBA 3UAQA 2W81C 3VZWX 4B61A 5B5EO 2XE3A 3AA1B 3PGSA 2XE1A 3PGRA 4GHBA 4O3YA 3SZDA 3LK2A 4K3CA 3T24A 2R88A 2YNKA 3PF1A 5DL6A 1ZHXA 2O4VA 5E79O 3AAAA 5G3AA 1OPFA 1Q9FA 3NSGA 5DL8A 4GCPA 4N58A 5B66O 4XNLA 4KR8A 4N74A 4D5UA 3GP6A 3KVDD 5ADXL 2QTKA 2R4PA 4AUIA 5IYUA 5G26A 3A2SX 3A0HO 2F1CX 3AA6B 2KXPA 4LSFA 3AA7A 1QJPA 3FYXA 4N59A 3SY9A 3T0SA 4F4BA 4O49A 1Q9GA 3QRCA 5ADXK 4FSOA 5JDPA 2PORA 3DWNA 2M06A 4U9CA 4PJ0O 4AFKA 4E1TA 4G76A 3HOLA 4UB6O 1HXXA 2JQYA 3SY7A 1BT9A 4FZLA 3PQSA 5AFUL 3POQA 1GFMA 5G38A 3O0EA 2AXTO 3BRZA 4FRXA 1THQA 2IWVA 4UB8O 4KRAA 3TZGA 3RBHA 4Z3TA 4AKRB 3LK42 2LHFA 4N75A 4RL9A 3AA0A 4RLBA 4LSHA 4AYNA 5PRNA 4BUMX 5AFUK 1G90A 4FOZA 3K19A 4FSPA 2ODJA 4AYMC 5H2FO 2J1NA 2KDYA 2XE5A 3JCUO 3LK3B 4FRTA 1BH3A 4GF4A 2KZ7B 4FESA 2M07A 2R4LA 2LFUA 3VE2A 4O3WA 3SZVA 2R8AA 1S5LO 3LK2B 3AAEA 3UPGA 4PR7A 4IL6O 3VY8X 2IWWA 3AAAB 1PRNA 2R4OA 2Y0KA 2X9KA 5D5DA 4AKMA 4KR4A 4RLCA 3C5OA 4G75A 2K4TA 1ORMA 4D64A 2K0LA 2Y0HA 3VY9X 4JCHA 2GE4A 3SYSA 4RJWA 3AA7B 5GTHO 4QQ1A 1QJ9A 1T1LA 3G7GA 4FZNA 2N2MA 5TISO 4C4VA 4RJXA 4FMSA 5G39A 2N2LA 1ZHTA 3POUA 4FQEA 4GCSA 5DL5A 5EE2A 3WI5A 5GV0A 3VE1A 5GTIO 2F1VA 3V8UA 1H6S1 2F1TA 2ZFGA 3VZUX 4AYDC 4AYID 4C69X 1IZNA 1HXUA 3PQUA 5T5FA 4AYEC 2XMXA 3AA1A 4FT6A 2OMFA 2R4NA 4JFBA 1MPFA 3HW9A 4O3ZA 5DL7A 1ZHYA 4AKRA 4D65A 8PRNA 1MM4A 3BS0A 4PUXA 4XNKA 3DWOX 3AA0B 1GFPA 3NJTA 1MM5A 3LK3A
chains in the Genus database with same CATH topology
5FVNA 4O3XB 3PRNA 1PHOA 4E1SA 3DA3A 1GFNA 3AA6A 3POXA 2MHLA 1E54A 2KXPB 3DA4A 3VZTX 7PRNA 4FZMA 4FUVA 2FGRA 3JTYA 3AAEB 1BXWA 2JMMA 4O4XA 1GFOA 1ZHWA 2XE2A 4AZLA 2XTRA 3WI4A 4LSIA 1ZHZA 1YS5A 2MNHA 2J4UP 1GFQA 2YPVA 3QRAA 4LSEA 4GCQA 3LK41 2PRNA 1P4TA 2XTQA 1OSMA 2ZLDA 2X27X 4O4UA 3T20A 6PRNA 2KC0A 1HXTA 2Y0LA 2Y7SA 3EMNX 3PORA 3UU2A 2Y2XA 1QJ8A 2ERVA 2W80C 1IZNB 2FGQX 3HWBA 2KZ7A 2XG6A 3HOEA 3SYBA 3UAQA 2W81C 3VZWX 2XE3A 3AA1B 4O3YA 2XE1A 3SZDA 4GHBA 3LK2A 3T24A 2YNKA 5DL6A 1ZHXA 2O4VA 3AAAA 1OPFA 1Q9FA 3NSGA 5DL8A 4GCPA 4N58A 4XNLA 4KR8A 5ADXL 4D5UA 3GP6A 3KVDD 2QTKA 4AUIA 5IYUA 5G26A 3A2SX 3AA6B 2KXPA 4LSFA 3AA7A 1QJPA 3FYXA 4N59A 3SY9A 3T0SA 4F4BA 4O49A 1Q9GA 3QRCA 5ADXK 4FSOA 5JDPA 2PORA 2M06A 4U9CA 4AFKA 4E1TA 4G76A 3HOLA 1HXXA 3SY7A 1BT9A 4FZLA 3PQSA 5AFUL 3POQA 1GFMA 3O0EA 4FRXA 1THQA 4KRAA 3TZGA 3RBHA 4Z3TA 4AKRB 3LK42 2LHFA 4RL9A 3AA0A 4RLBA 4LSHA 4AYNA 5PRNA 4BUMX 5AFUK 1G90A 4FOZA 3K19A 4FSPA 2ODJA 4AYMC 2J1NA 2KDYA 2XE5A 3LK3B 4FRTA 1BH3A 4GF4A 2KZ7B 4FESA 2M07A 2LFUA 3VE2A 4O3WA 3SZVA 3LK2B 3AAEA 3UPGA 3AAAB 1PRNA 2Y0KA 5D5DA 4AKMA 4KR4A 4RLCA 3C5OA 4G75A 2K4TA 1ORMA 4D64A 2K0LA 2Y0HA 3VY9X 4JCHA 2GE4A 3SYSA 4RJWA 3AA7B 4QQ1A 1QJ9A 3G7GA 4FZNA 2N2MA 4RJXA 4FMSA 3VY8X 2N2LA 1ZHTA 3POUA 4GCSA 5DL5A 5EE2A 3WI5A 5GV0A 3VE1A 3VZUX 2F1VA 3V8UA 1H6S1 2F1TA 2ZFGA 4AYDC 4AYID 4B61A 4C69X 1IZNA 1HXUA 3PQUA 5T5FA 4AYEC 2XMXA 3AA1A 4FT6A 2OMFA 4JFBA 5DL7A 1MPFA 3HW9A 4O3ZA 4AKRA 1ZHYA 4D65A 8PRNA 1MM4A 4PUXA 4XNKA 3AA0B 1GFPA 1MM5A 3LK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FVN A;  3PRN A;  1PHO A;  1GFN A;  3POX A;  1E54 A;  7PRN A;  3VZT X;  2FGR A;  3JTY A;  1GFO A;  2XE2 A;  3WI4 A;  4LSI A;  2J4U P;  1GFQ A;  4LSE A;  4GCQ A;  2PRN A;  2ZLD A;  1OSM A;  3T20 A;  6PRN A;  1HXT A;  2Y0L A;  3EMN X;  3POR A;  3UU2 A;  2Y2X A;  2FGQ X;  3HWB A;  2XG6 A;  3SYB A;  3VZW X;  2XE3 A;  3SZD A;  2XE1 A;  3T24 A;  5DL6 A;  2O4V A;  1OPF A;  3NSG A;  5DL8 A;  4GCP A;  4KR8 A;  4D5U A;  2QTK A;  4AUI A;  3A2S X;  4LSF A;  3SY9 A;  3FYX A;  3T0S A;  4FSO A;  5JDP A;  2POR A;  1HXX A;  3SY7 A;  1BT9 A;  3POQ A;  1GFM A;  3O0E A;  4FRX A;  4KRA A;  4LSH A;  4BUM X;  5PRN A;  4FOZ A;  3K19 A;  4FSP A;  2ODJ A;  2J1N A;  2XE5 A;  4FRT A;  1BH3 A;  3SZV A;  3UPG A;  1PRN A;  2Y0K A;  4KR4 A;  2K4T A;  4D64 A;  2Y0H A;  3VY9 X;  3SYS A;  4RJW A;  4RJX A;  4FMS A;  3VY8 X;  3WI5 A;  3POU A;  5DL5 A;  4GCS A;  3VZU X;  4C69 X;  1H6S 1;  2ZFG A;  1HXU A;  4JFB A;  4FT6 A;  2OMF A;  5DL7 A;  8PRN A;  1MPF A;  3HW9 A;  4D65 A;  1GFP A; 
#chains in the Genus database with same CATH topology
 5FVN A;  4O3X B;  4K3B A;  3A0B O;  3PRN A;  1PHO A;  4E1S A;  5KAI O;  3DA3 A;  3KZI O;  1GFN A;  3AA6 A;  3POX A;  2MHL A;  1E54 A;  2KXP B;  3DA4 A;  3VZT X;  3PGU A;  7PRN A;  4FZM A;  4FUV A;  2FGR A;  3JTY A;  3AAE B;  1BXW A;  2JMM A;  4O4X A;  1GFO A;  1ZHW A;  2WVP A;  5KAF O;  2XE2 A;  4AZL A;  2XTR A;  3WI4 A;  4CTD A;  4LSI A;  1ZHZ A;  1YS5 A;  2MNH A;  2J4U P;  1GFQ A;  1T16 A;  2YPV A;  3QRA A;  4LSE A;  4GCQ A;  3LK4 1;  2PRN A;  1P4T A;  2XTQ A;  1OSM A;  2ZLD A;  2X27 X;  4O4U A;  2WJR A;  3T20 A;  6PRN A;  2KC0 A;  1HXT A;  2Y0L A;  2Y7S A;  4C4V B;  2R89 A;  3EMN X;  3POR A;  3DZM A;  3UU2 A;  3BRY A;  4C00 A;  2Y2X A;  2WJQ A;  1QJ8 A;  2ERV A;  3WU2 O;  2W80 C;  1IZN B;  2FGQ X;  3HWB A;  2KZ7 A;  2XG6 A;  3HOE A;  3SYB A;  3UAQ A;  2W81 C;  3VZW X;  4B61 A;  5B5E O;  2XE3 A;  3AA1 B;  3PGS A;  2XE1 A;  3PGR A;  4GHB A;  4O3Y A;  3SZD A;  3LK2 A;  4K3C A;  3T24 A;  2R88 A;  2YNK A;  3PF1 A;  5DL6 A;  1ZHX A;  2O4V A;  5E79 O;  3AAA A;  5G3A A;  1OPF A;  1Q9F A;  3NSG A;  5DL8 A;  4GCP A;  4N58 A;  5B66 O;  4XNL A;  4KR8 A;  4N74 A;  4D5U A;  3GP6 A;  3KVD D;  5ADX L;  2QTK A;  2R4P A;  4AUI A;  5IYU A;  5G26 A;  3A2S X;  3A0H O;  2F1C X;  3AA6 B;  2KXP A;  4LSF A;  3AA7 A;  1QJP A;  3FYX A;  4N59 A;  3SY9 A;  3T0S A;  4F4B A;  4O49 A;  1Q9G A;  3QRC A;  5ADX K;  4FSO A;  5JDP A;  2POR A;  3DWN A;  2M06 A;  4U9C A;  4PJ0 O;  4AFK A;  4E1T A;  4G76 A;  3HOL A;  4UB6 O;  1HXX A;  2JQY A;  3SY7 A;  1BT9 A;  4FZL A;  3PQS A;  5AFU L;  3POQ A;  1GFM A;  5G38 A;  3O0E A;  2AXT O;  3BRZ A;  4FRX A;  1THQ A;  2IWV A;  4UB8 O;  4KRA A;  3TZG A;  3RBH A;  4Z3T A;  4AKR B;  3LK4 2;  2LHF A;  4N75 A;  4RL9 A;  3AA0 A;  4RLB A;  4LSH A;  4AYN A;  5PRN A;  4BUM X;  5AFU K;  1G90 A;  4FOZ A;  3K19 A;  4FSP A;  2ODJ A;  4AYM C;  5H2F O;  2J1N A;  2KDY A;  2XE5 A;  3JCU O;  3LK3 B;  4FRT A;  1BH3 A;  4GF4 A;  2KZ7 B;  4FES A;  2M07 A;  2R4L A;  2LFU A;  3VE2 A;  4O3W A;  3SZV A;  2R8A A;  1S5L O;  3LK2 B;  3AAE A;  3UPG A;  4PR7 A;  4IL6 O;  3VY8 X;  2IWW A;  3AAA B;  1PRN A;  2R4O A;  2Y0K A;  2X9K A;  5D5D A;  4AKM A;  4KR4 A;  4RLC A;  3C5O A;  4G75 A;  2K4T A;  1ORM A;  4D64 A;  2K0L A;  2Y0H A;  3VY9 X;  4JCH A;  2GE4 A;  3SYS A;  4RJW A;  3AA7 B;  5GTH O;  4QQ1 A;  1QJ9 A;  1T1L A;  3G7G A;  4FZN A;  2N2M A;  5TIS O;  4C4V A;  4RJX A;  4FMS A;  5G39 A;  2N2L A;  1ZHT A;  3POU A;  4FQE A;  4GCS A;  5DL5 A;  5EE2 A;  3WI5 A;  5GV0 A;  3VE1 A;  5GTI O;  2F1V A;  3V8U A;  1H6S 1;  2F1T A;  2ZFG A;  3VZU X;  4AYD C;  4AYI D;  4C69 X;  1IZN A;  1HXU A;  3PQU A;  5T5F A;  4AYE C;  2XMX A;  3AA1 A;  4FT6 A;  2OMF A;  2R4N A;  4JFB A;  1MPF A;  3HW9 A;  4O3Z A;  5DL7 A;  1ZHY A;  4AKR A;  4D65 A;  8PRN A;  1MM4 A;  3BS0 A;  4PUX A;  4XNK A;  3DWO X;  3AA0 B;  1GFP A;  3NJT A;  1MM5 A;  3LK3 A; 
#chains in the Genus database with same CATH homology
 5FVN A;  4O3X B;  3PRN A;  1PHO A;  4E1S A;  3DA3 A;  1GFN A;  3AA6 A;  3POX A;  2MHL A;  1E54 A;  2KXP B;  3DA4 A;  3VZT X;  7PRN A;  4FZM A;  4FUV A;  2FGR A;  3JTY A;  3AAE B;  1BXW A;  2JMM A;  4O4X A;  1GFO A;  1ZHW A;  2XE2 A;  4AZL A;  2XTR A;  3WI4 A;  4LSI A;  1ZHZ A;  1YS5 A;  2MNH A;  2J4U P;  1GFQ A;  2YPV A;  3QRA A;  4LSE A;  4GCQ A;  3LK4 1;  2PRN A;  1P4T A;  2XTQ A;  1OSM A;  2ZLD A;  2X27 X;  4O4U A;  3T20 A;  6PRN A;  2KC0 A;  1HXT A;  2Y0L A;  2Y7S A;  3EMN X;  3POR A;  3UU2 A;  2Y2X A;  1QJ8 A;  2ERV A;  2W80 C;  1IZN B;  2FGQ X;  3HWB A;  2KZ7 A;  2XG6 A;  3HOE A;  3SYB A;  3UAQ A;  2W81 C;  3VZW X;  2XE3 A;  3AA1 B;  4O3Y A;  2XE1 A;  3SZD A;  4GHB A;  3LK2 A;  3T24 A;  2YNK A;  5DL6 A;  1ZHX A;  2O4V A;  3AAA A;  1OPF A;  1Q9F A;  3NSG A;  5DL8 A;  4GCP A;  4N58 A;  4XNL A;  4KR8 A;  5ADX L;  4D5U A;  3GP6 A;  3KVD D;  2QTK A;  4AUI A;  5IYU A;  5G26 A;  3A2S X;  3AA6 B;  2KXP A;  4LSF A;  3AA7 A;  1QJP A;  3FYX A;  4N59 A;  3SY9 A;  3T0S A;  4F4B A;  4O49 A;  1Q9G A;  3QRC A;  5ADX K;  4FSO A;  5JDP A;  2POR A;  2M06 A;  4U9C A;  4AFK A;  4E1T A;  4G76 A;  3HOL A;  1HXX A;  3SY7 A;  1BT9 A;  4FZL A;  3PQS A;  5AFU L;  3POQ A;  1GFM A;  3O0E A;  4FRX A;  1THQ A;  4KRA A;  3TZG A;  3RBH A;  4Z3T A;  4AKR B;  3LK4 2;  2LHF A;  4RL9 A;  3AA0 A;  4RLB A;  4LSH A;  4AYN A;  5PRN A;  4BUM X;  5AFU K;  1G90 A;  4FOZ A;  3K19 A;  4FSP A;  2ODJ A;  4AYM C;  2J1N A;  2KDY A;  2XE5 A;  3LK3 B;  4FRT A;  1BH3 A;  4GF4 A;  2KZ7 B;  4FES A;  2M07 A;  2LFU A;  3VE2 A;  4O3W A;  3SZV A;  3LK2 B;  3AAE A;  3UPG A;  3AAA B;  1PRN A;  2Y0K A;  5D5D A;  4AKM A;  4KR4 A;  4RLC A;  3C5O A;  4G75 A;  2K4T A;  1ORM A;  4D64 A;  2K0L A;  2Y0H A;  3VY9 X;  4JCH A;  2GE4 A;  3SYS A;  4RJW A;  3AA7 B;  4QQ1 A;  1QJ9 A;  3G7G A;  4FZN A;  2N2M A;  4RJX A;  4FMS A;  3VY8 X;  2N2L A;  1ZHT A;  3POU A;  4GCS A;  5DL5 A;  5EE2 A;  3WI5 A;  5GV0 A;  3VE1 A;  3VZU X;  2F1V A;  3V8U A;  1H6S 1;  2F1T A;  2ZFG A;  4AYD C;  4AYI D;  4B61 A;  4C69 X;  1IZN A;  1HXU A;  3PQU A;  5T5F A;  4AYE C;  2XMX A;  3AA1 A;  4FT6 A;  2OMF A;  4JFB A;  5DL7 A;  1MPF A;  3HW9 A;  4O3Z A;  4AKR A;  1ZHY A;  4D65 A;  8PRN A;  1MM4 A;  4PUX A;  4XNK A;  3AA0 B;  1GFP A;  1MM5 A;  3LK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...