2XE5A

Molecular insights into clinically isolated ompc mutants and their role in multi-drug resistance (ompc26)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
343
structure length
343
Chain Sequence
AEIYNKDGNKLDLYGKVEGLHYFSDNDSKDGDKTYMRLGFKGETQVTDQLTGYGQWEYQIQGNEPESDNSSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYDSDNFMQQRGNGFATYRNTDFFGLVDGLDFAVQYQGKNGSAHGEGMTTNGRDDVFEQNGDGVGGSITYNYEGFGIGAAVSSSKRTWDQNNTGLIGTGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNRFTRDAGINTDDIVALGLVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords OUTER MEMBRANE PORIN C
publication title Altered Antibiotic Transport in Ompc Mutants Isolated from a Series of Clinical Strains of Multi-Drug Resistant E. Coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 101
structure length 343
sequence length 343
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2xe5A00
2PRNA 2ZLDA 4LSEA 6PRNA 4GCQA 5FVNA 4KR8A 3VZWX 1PRNA 4FMSA 3JTYA 1OSMA 3T24A 4D5UA 3SYBA 3VY9X 1GFQA 3UPGA 3K19A 3T20A 3POQA 2OMFA 3NSGA 2XE5A 4KRAA 4GCPA 1BT9A 4FRTA 2Y0HA 3FYXA 4LSIA 2K4TA 1HXXA 5DL8A 3WI4A 3PORA 2J1NA 3SZVA 3SY7A 3VZTX 1GFMA 3A2SX 2ODJA 3EMNX 2J4UP 2PORA 3SYSA 2FGQX 5DL5A 2QTKA 4FT6A 4GCSA 1E54A 5JDPA 4LSHA 3POUA 2XG6A 1GFOA 4FSOA 4D64A 2Y2XA 1MPFA 3UU2A 2FGRA 7PRNA 4JFBA 5PRNA 3HW9A 3VY8X 2ZFGA 3SZDA 3T0SA 3VZUX 2Y0KA 3HWBA 4FOZA 4LSFA 3O0EA 4FRXA 4KR4A 2XE1A 5DL7A 2Y0LA 1HXUA 4AUIA 4FSPA 1GFNA 8PRNA 3SY9A 1BH3A 3POXA 2O4VA 4C69X 1GFPA 3PRNA 1PHOA 4BUMX 4D65A 3WI5A 1HXTA 4RJXA 1OPFA 2XE2A 1H6S1 4RJWA 5DL6A 2XE3A
chains in the Genus database with same CATH superfamily
2PRNA 4C00A 2ZLDA 4LSEA 5GTIO 2X27X 4O49A 4AKRA 1IZNA 6PRNA 5KAFO 4GCQA 1BXWA 2IWVA 2KDYA 1MM4A 2K0LA 5EE2A 5D5DA 5E79O 4U9CA 2MHLA 4KR8A 5FVNA 3VZWX 5AFUL 1P4TA 2R8AA 5G26A 2M07A 1PRNA 2X9KA 4N58A 2ERVA 2XMXA 3JTYA 4FMSA 3VE2A 4GF4A 1OSMA 1ZHTA 2XTRA 3A0HO 3AAEB 4K3BA 4AYEC 2M06A 3T24A 4D5UA 2N2LA 3SYBA 5GV0A 3PF1A 3VY9X 1GFQA 2WVPA 3UPGA 3QRAA 3K19A 3AA7B 3PQUA 4RL9A 4FZNA 3POQA 3T20A 4QQ1A 2OMFA 4O4XA 3DA4A 3NSGA 1QJ9A 2XE5A 3LK41 4KRAA 3AA6B 3AA6A 1BT9A 4GCPA 2LFUA 3PQSA 4FRTA 2Y0HA 1THQA 1MM5A 2R4NA 4RLBA 3A0BO 3FYXA 4LSIA 1IZNB 4AKRB 1ZHYA 2K4TA 1HXXA 5DL8A 3DA3A 3WI4A 3AAAA 3PORA 4O4UA 1Q9GA 3V8UA 3AA1B 3WU2O 3AA1A 4FESA 2W81C 3LK2A 2R4OA 3AA0A 1ORMA 1S5LO 2J1NA 4GHBA 3SY7A 3SZVA 2F1CX 3KZIO 3DWOX 3VE1A 4N74A 4Z3TA 4AYMC 4O3XB 3VZTX 4AYID 4CTDA 1GFMA 3A2SX 4O3ZA 2ODJA 3EMNX 2J4UP 2PORA 5GTHO 3DWNA 3SYSA 5ADXL 2KC0A 4N75A 1YS5A 2FGQX 2QTKA 5DL5A 2WJRA 3LK42 4FT6A 4IL6O 4GCSA 4XNKA 4XNLA 1E54A 5JDPA 3UAQA 4LSHA 3POUA 2XG6A 1GFOA 4FSOA 4D64A 1MPFA 2Y2XA 4PUXA 4AKMA 4E1TA 4C4VA 3UU2A 2FGRA 3KVDD 7PRNA 1T1LA 4O3YA 4F4BA 5G39A 2R89A 3AAAB 4JFBA 5PRNA 4JCHA 5T5FA 3LK2B 2R4LA 3AA0B 2F1VA 5ADXK 4AYNA 2N2MA 3HW9A 4FUVA 3PGRA 4FQEA 3VY8X 5IYUA 5G3AA 4PR7A 2ZFGA 4K3CA 4O3WA 4UB6O 3SZDA 3T0SA 3VZUX 1Q9FA 2KZ7A 3C5OA 2R88A 2Y0KA 3HWBA 3GP6A 4FOZA 2GE4A 4FZMA 2KXPA 2IWWA 4LSFA 4B61A 2Y7SA 2XTQA 3O0EA 2R4PA 4FRXA 3HOEA 4KR4A 4AFKA 2XE1A 3LK3B 4C4VB 3LK3A 5DL7A 2Y0LA 5B66O 1HXUA 5H2FO 3G7GA 4AUIA 4FSPA 2JQYA 1GFNA 2WJQA 8PRNA 3QRCA 2JMMA 4G75A 4RLCA 3SY9A 1BH3A 1T16A 3PGUA 2O4VA 3POXA 4AYDC 3PGSA 4PJ0O 4C69X 1GFPA 4FZLA 3NJTA 3PRNA 3AAEA 3HOLA 1PHOA 3BRYA 2LHFA 4BUMX 3DZMA 3TZGA 3JCUO 1ZHWA 3BS0A 4D65A 3WI5A 5B5EO 1HXTA 2MNHA 4RJXA 2AXTO 5KAIO 1G90A 1OPFA 4UB8O 1ZHZA 3AA7A 1ZHXA 2KZ7B 5G38A 2XE2A 5TISO 3RBHA 2YPVA 4G76A 2F1TA 1H6S1 2YNKA 4RJWA 3BRZA 5DL6A 1QJPA 2KXPB 2XE3A 4E1SA 4N59A 1QJ8A 2W80C 4AZLA 5AFUK
chains in the Genus database with same CATH topology
2PRNA 2ZLDA 4LSEA 6PRNA 2X27X 4O49A 4AKRA 1IZNA 4GCQA 1BXWA 2KDYA 1MM4A 2K0LA 5EE2A 5D5DA 5FVNA 4U9CA 2MHLA 4KR8A 3VZWX 5GV0A 5AFUL 1P4TA 5G26A 2M07A 1PRNA 4N58A 2ERVA 2XMXA 3JTYA 4FMSA 3VE2A 4GF4A 1OSMA 1ZHTA 2XTRA 3AAEB 4AYEC 2M06A 3T24A 4D5UA 2N2LA 3SYBA 3VY9X 1GFQA 3UPGA 3QRAA 3K19A 3AA7B 3PQUA 4RL9A 4FZNA 3POQA 3T20A 4QQ1A 2OMFA 4O4XA 3DA4A 3NSGA 1QJ9A 2XE5A 3LK41 4KRAA 3AA6B 3AA6A 1BT9A 4GCPA 2LFUA 3PQSA 4FRTA 2Y0HA 1THQA 1MM5A 4RLBA 3FYXA 4LSIA 1IZNB 4AKRB 1ZHYA 2K4TA 1HXXA 5DL8A 3DA3A 3WI4A 3AAAA 3PORA 4O4UA 1Q9GA 3V8UA 3AA1B 3AA1A 4FESA 2W81C 3LK2A 3AA0A 1ORMA 2J1NA 4GHBA 3SY7A 3SZVA 3VE1A 4Z3TA 4AYMC 4O3XB 3VZTX 4AYID 1GFMA 3A2SX 4O3ZA 2ODJA 3EMNX 2J4UP 2PORA 3SYSA 5ADXL 2KC0A 1YS5A 2FGQX 2QTKA 5DL5A 3LK42 4FT6A 4GCSA 4XNKA 4XNLA 1E54A 5JDPA 3UAQA 4LSHA 3POUA 2XG6A 1GFOA 4FSOA 4D64A 1MPFA 2Y2XA 4PUXA 4AKMA 4E1TA 3UU2A 2FGRA 3KVDD 7PRNA 4O3YA 4F4BA 3AAAB 4JFBA 5PRNA 4JCHA 5T5FA 3LK2B 3AA0B 2F1VA 5ADXK 4AYNA 2N2MA 3HW9A 4FUVA 3VY8X 5IYUA 2ZFGA 4O3WA 3SZDA 3T0SA 3VZUX 1Q9FA 2KZ7A 3C5OA 2Y0KA 3HWBA 3GP6A 4FOZA 2GE4A 4FZMA 2KXPA 4LSFA 4B61A 2Y7SA 2XTQA 3O0EA 4FRXA 3HOEA 4KR4A 4AFKA 2XE1A 3LK3B 3LK3A 5DL7A 2Y0LA 1HXUA 3G7GA 4AUIA 4FSPA 1GFNA 8PRNA 3QRCA 2JMMA 4G75A 4RLCA 3SY9A 1BH3A 4AYDC 3POXA 2O4VA 4C69X 1GFPA 4FZLA 3PRNA 3AAEA 3HOLA 1PHOA 4BUMX 2LHFA 3TZGA 4D65A 1ZHWA 3WI5A 1HXTA 2MNHA 4RJXA 1G90A 1OPFA 1ZHZA 3AA7A 1ZHXA 2KZ7B 2XE2A 3RBHA 2YPVA 4G76A 2F1TA 1H6S1 2YNKA 4RJWA 5DL6A 1QJPA 2KXPB 2XE3A 4E1SA 4N59A 1QJ8A 2W80C 4AZLA 5AFUK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PRN A;  2ZLD A;  4LSE A;  6PRN A;  4GCQ A;  5FVN A;  4KR8 A;  3VZW X;  1PRN A;  4FMS A;  3JTY A;  1OSM A;  3T24 A;  4D5U A;  3SYB A;  3VY9 X;  1GFQ A;  3UPG A;  3K19 A;  3T20 A;  3POQ A;  2OMF A;  3NSG A;  2XE5 A;  4KRA A;  4GCP A;  1BT9 A;  4FRT A;  2Y0H A;  3FYX A;  4LSI A;  2K4T A;  1HXX A;  5DL8 A;  3WI4 A;  3POR A;  2J1N A;  3SZV A;  3SY7 A;  3VZT X;  1GFM A;  3A2S X;  2ODJ A;  3EMN X;  2J4U P;  2POR A;  3SYS A;  2FGQ X;  5DL5 A;  2QTK A;  4FT6 A;  4GCS A;  1E54 A;  5JDP A;  4LSH A;  3POU A;  2XG6 A;  1GFO A;  4FSO A;  4D64 A;  2Y2X A;  1MPF A;  3UU2 A;  2FGR A;  7PRN A;  4JFB A;  5PRN A;  3HW9 A;  3VY8 X;  2ZFG A;  3SZD A;  3T0S A;  3VZU X;  2Y0K A;  3HWB A;  4FOZ A;  4LSF A;  3O0E A;  4FRX A;  4KR4 A;  2XE1 A;  5DL7 A;  2Y0L A;  1HXU A;  4AUI A;  4FSP A;  1GFN A;  8PRN A;  3SY9 A;  1BH3 A;  3POX A;  2O4V A;  4C69 X;  1GFP A;  3PRN A;  1PHO A;  4BUM X;  4D65 A;  3WI5 A;  1HXT A;  4RJX A;  1OPF A;  2XE2 A;  1H6S 1;  4RJW A;  5DL6 A;  2XE3 A; 
#chains in the Genus database with same CATH topology
 2PRN A;  4C00 A;  2ZLD A;  4LSE A;  5GTI O;  2X27 X;  4O49 A;  4AKR A;  1IZN A;  6PRN A;  5KAF O;  4GCQ A;  1BXW A;  2IWV A;  2KDY A;  1MM4 A;  2K0L A;  5EE2 A;  5D5D A;  5E79 O;  4U9C A;  2MHL A;  4KR8 A;  5FVN A;  3VZW X;  5AFU L;  1P4T A;  2R8A A;  5G26 A;  2M07 A;  1PRN A;  2X9K A;  4N58 A;  2ERV A;  2XMX A;  3JTY A;  4FMS A;  3VE2 A;  4GF4 A;  1OSM A;  1ZHT A;  2XTR A;  3A0H O;  3AAE B;  4K3B A;  4AYE C;  2M06 A;  3T24 A;  4D5U A;  2N2L A;  3SYB A;  5GV0 A;  3PF1 A;  3VY9 X;  1GFQ A;  2WVP A;  3UPG A;  3QRA A;  3K19 A;  3AA7 B;  3PQU A;  4RL9 A;  4FZN A;  3POQ A;  3T20 A;  4QQ1 A;  2OMF A;  4O4X A;  3DA4 A;  3NSG A;  1QJ9 A;  2XE5 A;  3LK4 1;  4KRA A;  3AA6 B;  3AA6 A;  1BT9 A;  4GCP A;  2LFU A;  3PQS A;  4FRT A;  2Y0H A;  1THQ A;  1MM5 A;  2R4N A;  4RLB A;  3A0B O;  3FYX A;  4LSI A;  1IZN B;  4AKR B;  1ZHY A;  2K4T A;  1HXX A;  5DL8 A;  3DA3 A;  3WI4 A;  3AAA A;  3POR A;  4O4U A;  1Q9G A;  3V8U A;  3AA1 B;  3WU2 O;  3AA1 A;  4FES A;  2W81 C;  3LK2 A;  2R4O A;  3AA0 A;  1ORM A;  1S5L O;  2J1N A;  4GHB A;  3SY7 A;  3SZV A;  2F1C X;  3KZI O;  3DWO X;  3VE1 A;  4N74 A;  4Z3T A;  4AYM C;  4O3X B;  3VZT X;  4AYI D;  4CTD A;  1GFM A;  3A2S X;  4O3Z A;  2ODJ A;  3EMN X;  2J4U P;  2POR A;  5GTH O;  3DWN A;  3SYS A;  5ADX L;  2KC0 A;  4N75 A;  1YS5 A;  2FGQ X;  2QTK A;  5DL5 A;  2WJR A;  3LK4 2;  4FT6 A;  4IL6 O;  4GCS A;  4XNK A;  4XNL A;  1E54 A;  5JDP A;  3UAQ A;  4LSH A;  3POU A;  2XG6 A;  1GFO A;  4FSO A;  4D64 A;  1MPF A;  2Y2X A;  4PUX A;  4AKM A;  4E1T A;  4C4V A;  3UU2 A;  2FGR A;  3KVD D;  7PRN A;  1T1L A;  4O3Y A;  4F4B A;  5G39 A;  2R89 A;  3AAA B;  4JFB A;  5PRN A;  4JCH A;  5T5F A;  3LK2 B;  2R4L A;  3AA0 B;  2F1V A;  5ADX K;  4AYN A;  2N2M A;  3HW9 A;  4FUV A;  3PGR A;  4FQE A;  3VY8 X;  5IYU A;  5G3A A;  4PR7 A;  2ZFG A;  4K3C A;  4O3W A;  4UB6 O;  3SZD A;  3T0S A;  3VZU X;  1Q9F A;  2KZ7 A;  3C5O A;  2R88 A;  2Y0K A;  3HWB A;  3GP6 A;  4FOZ A;  2GE4 A;  4FZM A;  2KXP A;  2IWW A;  4LSF A;  4B61 A;  2Y7S A;  2XTQ A;  3O0E A;  2R4P A;  4FRX A;  3HOE A;  4KR4 A;  4AFK A;  2XE1 A;  3LK3 B;  4C4V B;  3LK3 A;  5DL7 A;  2Y0L A;  5B66 O;  1HXU A;  5H2F O;  3G7G A;  4AUI A;  4FSP A;  2JQY A;  1GFN A;  2WJQ A;  8PRN A;  3QRC A;  2JMM A;  4G75 A;  4RLC A;  3SY9 A;  1BH3 A;  1T16 A;  3PGU A;  2O4V A;  3POX A;  4AYD C;  3PGS A;  4PJ0 O;  4C69 X;  1GFP A;  4FZL A;  3NJT A;  3PRN A;  3AAE A;  3HOL A;  1PHO A;  3BRY A;  2LHF A;  4BUM X;  3DZM A;  3TZG A;  3JCU O;  1ZHW A;  3BS0 A;  4D65 A;  3WI5 A;  5B5E O;  1HXT A;  2MNH A;  4RJX A;  2AXT O;  5KAI O;  1G90 A;  1OPF A;  4UB8 O;  1ZHZ A;  3AA7 A;  1ZHX A;  2KZ7 B;  5G38 A;  2XE2 A;  5TIS O;  3RBH A;  2YPV A;  4G76 A;  2F1T A;  1H6S 1;  2YNK A;  4RJW A;  3BRZ A;  5DL6 A;  1QJP A;  2KXP B;  2XE3 A;  4E1S A;  4N59 A;  1QJ8 A;  2W80 C;  4AZL A;  5AFU K; 
#chains in the Genus database with same CATH homology
 2PRN A;  2ZLD A;  4LSE A;  6PRN A;  2X27 X;  4O49 A;  4AKR A;  1IZN A;  4GCQ A;  1BXW A;  2KDY A;  1MM4 A;  2K0L A;  5EE2 A;  5D5D A;  5FVN A;  4U9C A;  2MHL A;  4KR8 A;  3VZW X;  5GV0 A;  5AFU L;  1P4T A;  5G26 A;  2M07 A;  1PRN A;  4N58 A;  2ERV A;  2XMX A;  3JTY A;  4FMS A;  3VE2 A;  4GF4 A;  1OSM A;  1ZHT A;  2XTR A;  3AAE B;  4AYE C;  2M06 A;  3T24 A;  4D5U A;  2N2L A;  3SYB A;  3VY9 X;  1GFQ A;  3UPG A;  3QRA A;  3K19 A;  3AA7 B;  3PQU A;  4RL9 A;  4FZN A;  3POQ A;  3T20 A;  4QQ1 A;  2OMF A;  4O4X A;  3DA4 A;  3NSG A;  1QJ9 A;  2XE5 A;  3LK4 1;  4KRA A;  3AA6 B;  3AA6 A;  1BT9 A;  4GCP A;  2LFU A;  3PQS A;  4FRT A;  2Y0H A;  1THQ A;  1MM5 A;  4RLB A;  3FYX A;  4LSI A;  1IZN B;  4AKR B;  1ZHY A;  2K4T A;  1HXX A;  5DL8 A;  3DA3 A;  3WI4 A;  3AAA A;  3POR A;  4O4U A;  1Q9G A;  3V8U A;  3AA1 B;  3AA1 A;  4FES A;  2W81 C;  3LK2 A;  3AA0 A;  1ORM A;  2J1N A;  4GHB A;  3SY7 A;  3SZV A;  3VE1 A;  4Z3T A;  4AYM C;  4O3X B;  3VZT X;  4AYI D;  1GFM A;  3A2S X;  4O3Z A;  2ODJ A;  3EMN X;  2J4U P;  2POR A;  3SYS A;  5ADX L;  2KC0 A;  1YS5 A;  2FGQ X;  2QTK A;  5DL5 A;  3LK4 2;  4FT6 A;  4GCS A;  4XNK A;  4XNL A;  1E54 A;  5JDP A;  3UAQ A;  4LSH A;  3POU A;  2XG6 A;  1GFO A;  4FSO A;  4D64 A;  1MPF A;  2Y2X A;  4PUX A;  4AKM A;  4E1T A;  3UU2 A;  2FGR A;  3KVD D;  7PRN A;  4O3Y A;  4F4B A;  3AAA B;  4JFB A;  5PRN A;  4JCH A;  5T5F A;  3LK2 B;  3AA0 B;  2F1V A;  5ADX K;  4AYN A;  2N2M A;  3HW9 A;  4FUV A;  3VY8 X;  5IYU A;  2ZFG A;  4O3W A;  3SZD A;  3T0S A;  3VZU X;  1Q9F A;  2KZ7 A;  3C5O A;  2Y0K A;  3HWB A;  3GP6 A;  4FOZ A;  2GE4 A;  4FZM A;  2KXP A;  4LSF A;  4B61 A;  2Y7S A;  2XTQ A;  3O0E A;  4FRX A;  3HOE A;  4KR4 A;  4AFK A;  2XE1 A;  3LK3 B;  3LK3 A;  5DL7 A;  2Y0L A;  1HXU A;  3G7G A;  4AUI A;  4FSP A;  1GFN A;  8PRN A;  3QRC A;  2JMM A;  4G75 A;  4RLC A;  3SY9 A;  1BH3 A;  4AYD C;  3POX A;  2O4V A;  4C69 X;  1GFP A;  4FZL A;  3PRN A;  3AAE A;  3HOL A;  1PHO A;  4BUM X;  2LHF A;  3TZG A;  4D65 A;  1ZHW A;  3WI5 A;  1HXT A;  2MNH A;  4RJX A;  1G90 A;  1OPF A;  1ZHZ A;  3AA7 A;  1ZHX A;  2KZ7 B;  2XE2 A;  3RBH A;  2YPV A;  4G76 A;  2F1T A;  1H6S 1;  2YNK A;  4RJW A;  5DL6 A;  1QJP A;  2KXP B;  2XE3 A;  4E1S A;  4N59 A;  1QJ8 A;  2W80 C;  4AZL A;  5AFU K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...