2XE5A

Molecular insights into clinically isolated ompc mutants and their role in multi-drug resistance (ompc26)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
343
structure length
343
Chain Sequence
AEIYNKDGNKLDLYGKVEGLHYFSDNDSKDGDKTYMRLGFKGETQVTDQLTGYGQWEYQIQGNEPESDNSSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYDSDNFMQQRGNGFATYRNTDFFGLVDGLDFAVQYQGKNGSAHGEGMTTNGRDDVFEQNGDGVGGSITYNYEGFGIGAAVSSSKRTWDQNNTGLIGTGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNRFTRDAGINTDDIVALGLVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PORIN C
publication title Altered Antibiotic Transport in Ompc Mutants Isolated from a Series of Clinical Strains of Multi-Drug Resistant E. Coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 101
structure length 343
sequence length 343
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2xe5A00
4LSIA 3JTYA 4KRAA 4GCSA 3VZWX 3POQA 2FGRA 3POUA 4FSOA 6PRNA 2XE3A 3WI5A 1PHOA 3UU2A 1GFOA 4KR4A 4LSHA 2ZLDA 4D65A 4FMSA 1H6S1 4LSFA 4JFBA 4KR8A 4FSPA 1E54A 7PRNA 2PORA 3FYXA 1HXUA 3SY7A 3T0SA 5PRNA 5DL6A 3T24A 2QTKA 4FRTA 5DL7A 3VZUX 1OSMA 4D64A 2Y2XA 3NSGA 3SYBA 3HWBA 3HW9A 2XG6A 4BUMX 5FVNA 1BT9A 1GFPA 3SZDA 2PRNA 3SY9A 1BH3A 3SYSA 4AUIA 2O4VA 3VY9X 5DL8A 4FRXA 1HXTA 3PORA 4C69X 8PRNA 4FOZA 3UPGA 3VZTX 3EMNX 2XE5A 4FT6A 1PRNA 2J4UP 2Y0KA 3O0EA 2ODJA 1MPFA 3A2SX 3T20A 3SZVA 3WI4A 2Y0LA 3POXA 1OPFA 4RJXA 1GFNA 4GCPA 1GFQA 4LSEA 2FGQX 3K19A 1GFMA 5JDPA 2OMFA 2Y0HA 3PRNA 5DL5A 4GCQA 2XE2A 2K4TA 2XE1A 4D5UA 1HXXA 3VY8X 4RJWA 2J1NA 2ZFGA
chains in the Genus database with same CATH superfamily
4LSIA 2IWWA 4FZNA 2K0LA 2R88A 3JTYA 4KRAA 4GCSA 3JCUO 4IL6O 1ORMA 4N74A 2R4OA 3VZWX 3POQA 1ZHZA 2FGRA 3POUA 4FSOA 6PRNA 2XE3A 3WI5A 1G90A 4O4XA 1PHOA 2XTQA 1GFOA 3AAEA 4KR4A 4LSHA 4N75A 3UU2A 4CTDA 2ZLDA 4D65A 4FUVA 4UB6O 4FMSA 2N2MA 4C4VB 3HOLA 3HOEA 1ZHWA 5GTIO 1Q9GA 1H6S1 1ZHTA 4LSFA 4RLCA 3GP6A 3VE2A 4JFBA 3BRZA 4G75A 4KR8A 3PGSA 3AAAA 4FSPA 3V8UA 1E54A 4O3XB 2XTRA 7PRNA 2PORA 2YNKA 4AFKA 2MHLA 3FYXA 5GTHO 1HXUA 3SY7A 4F4BA 3LK41 1QJ9A 3DWOX 5E79O 3T0SA 2Y7SA 5PRNA 5DL6A 4AYDC 3T24A 2IWVA 2QTKA 4O49A 2XMXA 2R4NA 3KZIO 2KZ7A 1ZHYA 2WJRA 4FRTA 1MM4A 2N2LA 2WVPA 5IYUA 5DL7A 3VZUX 1S5LO 2WJQA 4FZMA 1OSMA 4GF4A 2R4LA 2R8AA 2R89A 3PQSA 5D5DA 4D64A 2Y2XA 2YPVA 3PGUA 2M07A 5T5FA 3NSGA 3SYBA 3HWBA 3HW9A 2XG6A 4UB8O 4AYNA 3AA0B 3LK3B 4BUMX 5FVNA 3DWNA 1BT9A 1GFPA 3SZDA 4E1SA 2PRNA 4K3CA 3SY9A 1T1LA 4C4VA 4XNKA 1BH3A 5GV0A 4PR7A 3AA7B 3PF1A 3SYSA 4AUIA 5ADXL 3DA4A 2O4VA 1YS5A 3AA6B 2MNHA 4FESA 4U9CA 3VY9X 3LK2B 5G38A 3A0HO 4RLBA 3G7GA 5DL8A 4FRXA 1HXTA 3PORA 2X27X 2LFUA 4B61A 2KDYA 4C69X 3LK2A 5KAIO 4AZLA 4C00A 4QQ1A 4FOZA 5AFUL 8PRNA 3UPGA 2W81C 3EMNX 3VZTX 2XE5A 2W80C 2AXTO 2GE4A 3NJTA 5EE2A 4AKRB 3AA1B 2KXPB 5ADXK 4FQEA 4O3ZA 2X9KA 1BXWA 4Z3TA 2KC0A 4FT6A 5TISO 1MM5A 3AA1A 3RBHA 2F1TA 3DZMA 4AYMC 2F1CX 5AFUK 1IZNB 1QJPA 1PRNA 1ZHXA 4JCHA 4E1TA 2M06A 3AA0A 3LK3A 2J4UP 4AKMA 1T16A 1Q9FA 2Y0KA 3O0EA 4K3BA 3KVDD 4O3YA 5B66O 2ODJA 1MPFA 3A2SX 3DA3A 4FZLA 4GHBA 3T20A 3SZVA 5G26A 2Y0LA 3POXA 3WI4A 1OPFA 4N58A 4RJXA 1GFNA 4GCPA 1GFQA 1THQA 4RL9A 3AAEB 3AA7A 3QRCA 4LSEA 1QJ8A 2FGQX 4PJ0O 1P4TA 3K19A 4PUXA 2JMMA 3AA6A 3UAQA 2ERVA 4XNLA 3BS0A 3C5OA 4AYID 1GFMA 5H2FO 3PQUA 5KAFO 5JDPA 3WU2O 2OMFA 2Y0HA 3QRAA 4O4UA 3VE1A 3AAAB 3LK42 3PRNA 2F1VA 2LHFA 3PGRA 4G76A 5DL5A 5G39A 5G3AA 4AKRA 2KXPA 4GCQA 2JQYA 4N59A 4O3WA 2XE2A 2K4TA 2XE1A 4D5UA 1HXXA 3TZGA 3BRYA 3A0BO 5B5EO 3VY8X 4RJWA 2J1NA 2R4PA 1IZNA 2KZ7B 2ZFGA 4AYEC
chains in the Genus database with same CATH topology
4LSIA 4FZNA 2K0LA 3JTYA 4KRAA 4GCSA 1ORMA 3VZWX 3POQA 1ZHZA 2FGRA 3POUA 4FSOA 6PRNA 2XE3A 3WI5A 1G90A 4O4XA 1PHOA 2XTQA 1GFOA 3AAEA 4KR4A 4LSHA 3UU2A 2ZLDA 4D65A 4FUVA 4FMSA 2N2MA 3HOLA 3HOEA 1ZHWA 1Q9GA 1H6S1 1ZHTA 4LSFA 4RLCA 3GP6A 3VE2A 4JFBA 4G75A 4KR8A 3AAAA 4FSPA 3V8UA 1E54A 4O3XB 2XTRA 7PRNA 2PORA 2YNKA 4AFKA 2MHLA 3FYXA 1HXUA 3SY7A 4F4BA 3LK41 1QJ9A 3T0SA 2Y7SA 5PRNA 5DL6A 4AYDC 3T24A 2QTKA 4O49A 2XMXA 2KZ7A 1ZHYA 4FRTA 1MM4A 2N2LA 5IYUA 5DL7A 3VZUX 4FZMA 1OSMA 4GF4A 3PQSA 4D64A 5D5DA 2Y2XA 2YPVA 2M07A 5T5FA 3NSGA 3SYBA 3HWBA 3HW9A 2XG6A 4AYNA 3AA0B 3LK3B 4BUMX 5FVNA 1BT9A 1GFPA 3SZDA 4E1SA 2PRNA 3SY9A 4XNKA 1BH3A 5GV0A 3AA7B 3SYSA 4AUIA 5ADXL 3DA4A 2O4VA 1YS5A 3AA6B 2MNHA 4FESA 4U9CA 3VY9X 3LK2B 5DL8A 4RLBA 3G7GA 4FRXA 1HXTA 3PORA 2X27X 2LFUA 4B61A 2KDYA 4C69X 3LK2A 4AZLA 8PRNA 4QQ1A 4FOZA 5AFUL 3UPGA 2W81C 3EMNX 3VZTX 2XE5A 2W80C 5EE2A 2GE4A 4AKRB 5ADXK 3AA1B 2KXPB 4O3ZA 1BXWA 4Z3TA 2KC0A 4FT6A 3RBHA 1MM5A 3AA1A 2F1TA 4AYMC 5AFUK 1IZNB 1QJPA 1PRNA 1ZHXA 4JCHA 4E1TA 2M06A 3AA0A 3LK3A 2J4UP 4AKMA 1Q9FA 2Y0KA 3O0EA 3KVDD 4O3YA 2ODJA 1MPFA 3A2SX 3DA3A 4FZLA 4GHBA 3T20A 3SZVA 5G26A 2Y0LA 3POXA 3WI4A 1OPFA 4N58A 4RJXA 1GFNA 4GCPA 1GFQA 1THQA 4RL9A 3AAEB 3AA7A 3QRCA 4LSEA 1QJ8A 2FGQX 4PUXA 1P4TA 3K19A 3UAQA 2JMMA 3AA6A 2ERVA 4XNLA 3C5OA 4AYID 1GFMA 3PQUA 5JDPA 2OMFA 2Y0HA 3QRAA 4O4UA 3VE1A 3AAAB 3LK42 3PRNA 2F1VA 2LHFA 4G76A 5DL5A 4AKRA 2KXPA 4GCQA 4N59A 4O3WA 2XE2A 2K4TA 2XE1A 4D5UA 1HXXA 3TZGA 3VY8X 4RJWA 2J1NA 1IZNA 2KZ7B 2ZFGA 4AYEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LSI A;  3JTY A;  4KRA A;  4GCS A;  3VZW X;  3POQ A;  2FGR A;  3POU A;  4FSO A;  6PRN A;  2XE3 A;  3WI5 A;  1PHO A;  3UU2 A;  1GFO A;  4KR4 A;  4LSH A;  2ZLD A;  4D65 A;  4FMS A;  1H6S 1;  4LSF A;  4JFB A;  4KR8 A;  4FSP A;  1E54 A;  7PRN A;  2POR A;  3FYX A;  1HXU A;  3SY7 A;  3T0S A;  5PRN A;  5DL6 A;  3T24 A;  2QTK A;  4FRT A;  5DL7 A;  3VZU X;  1OSM A;  4D64 A;  2Y2X A;  3NSG A;  3SYB A;  3HWB A;  3HW9 A;  2XG6 A;  4BUM X;  5FVN A;  1BT9 A;  1GFP A;  3SZD A;  2PRN A;  3SY9 A;  1BH3 A;  3SYS A;  4AUI A;  2O4V A;  3VY9 X;  5DL8 A;  4FRX A;  1HXT A;  3POR A;  4C69 X;  8PRN A;  4FOZ A;  3UPG A;  3VZT X;  3EMN X;  2XE5 A;  4FT6 A;  1PRN A;  2J4U P;  2Y0K A;  3O0E A;  2ODJ A;  1MPF A;  3A2S X;  3T20 A;  3SZV A;  3WI4 A;  2Y0L A;  3POX A;  1OPF A;  4RJX A;  1GFN A;  4GCP A;  1GFQ A;  4LSE A;  2FGQ X;  3K19 A;  1GFM A;  5JDP A;  2OMF A;  2Y0H A;  3PRN A;  5DL5 A;  4GCQ A;  2XE2 A;  2K4T A;  2XE1 A;  4D5U A;  1HXX A;  3VY8 X;  4RJW A;  2J1N A;  2ZFG A; 
#chains in the Genus database with same CATH topology
 4LSI A;  2IWW A;  4FZN A;  2K0L A;  2R88 A;  3JTY A;  4KRA A;  4GCS A;  3JCU O;  4IL6 O;  1ORM A;  4N74 A;  2R4O A;  3VZW X;  3POQ A;  1ZHZ A;  2FGR A;  3POU A;  4FSO A;  6PRN A;  2XE3 A;  3WI5 A;  1G90 A;  4O4X A;  1PHO A;  2XTQ A;  1GFO A;  3AAE A;  4KR4 A;  4LSH A;  4N75 A;  3UU2 A;  4CTD A;  2ZLD A;  4D65 A;  4FUV A;  4UB6 O;  4FMS A;  2N2M A;  4C4V B;  3HOL A;  3HOE A;  1ZHW A;  5GTI O;  1Q9G A;  1H6S 1;  1ZHT A;  4LSF A;  4RLC A;  3GP6 A;  3VE2 A;  4JFB A;  3BRZ A;  4G75 A;  4KR8 A;  3PGS A;  3AAA A;  4FSP A;  3V8U A;  1E54 A;  4O3X B;  2XTR A;  7PRN A;  2POR A;  2YNK A;  4AFK A;  2MHL A;  3FYX A;  5GTH O;  1HXU A;  3SY7 A;  4F4B A;  3LK4 1;  1QJ9 A;  3DWO X;  5E79 O;  3T0S A;  2Y7S A;  5PRN A;  5DL6 A;  4AYD C;  3T24 A;  2IWV A;  2QTK A;  4O49 A;  2XMX A;  2R4N A;  3KZI O;  2KZ7 A;  1ZHY A;  2WJR A;  4FRT A;  1MM4 A;  2N2L A;  2WVP A;  5IYU A;  5DL7 A;  3VZU X;  1S5L O;  2WJQ A;  4FZM A;  1OSM A;  4GF4 A;  2R4L A;  2R8A A;  2R89 A;  3PQS A;  5D5D A;  4D64 A;  2Y2X A;  2YPV A;  3PGU A;  2M07 A;  5T5F A;  3NSG A;  3SYB A;  3HWB A;  3HW9 A;  2XG6 A;  4UB8 O;  4AYN A;  3AA0 B;  3LK3 B;  4BUM X;  5FVN A;  3DWN A;  1BT9 A;  1GFP A;  3SZD A;  4E1S A;  2PRN A;  4K3C A;  3SY9 A;  1T1L A;  4C4V A;  4XNK A;  1BH3 A;  5GV0 A;  4PR7 A;  3AA7 B;  3PF1 A;  3SYS A;  4AUI A;  5ADX L;  3DA4 A;  2O4V A;  1YS5 A;  3AA6 B;  2MNH A;  4FES A;  4U9C A;  3VY9 X;  3LK2 B;  5G38 A;  3A0H O;  4RLB A;  3G7G A;  5DL8 A;  4FRX A;  1HXT A;  3POR A;  2X27 X;  2LFU A;  4B61 A;  2KDY A;  4C69 X;  3LK2 A;  5KAI O;  4AZL A;  4C00 A;  4QQ1 A;  4FOZ A;  5AFU L;  8PRN A;  3UPG A;  2W81 C;  3EMN X;  3VZT X;  2XE5 A;  2W80 C;  2AXT O;  2GE4 A;  3NJT A;  5EE2 A;  4AKR B;  3AA1 B;  2KXP B;  5ADX K;  4FQE A;  4O3Z A;  2X9K A;  1BXW A;  4Z3T A;  2KC0 A;  4FT6 A;  5TIS O;  1MM5 A;  3AA1 A;  3RBH A;  2F1T A;  3DZM A;  4AYM C;  2F1C X;  5AFU K;  1IZN B;  1QJP A;  1PRN A;  1ZHX A;  4JCH A;  4E1T A;  2M06 A;  3AA0 A;  3LK3 A;  2J4U P;  4AKM A;  1T16 A;  1Q9F A;  2Y0K A;  3O0E A;  4K3B A;  3KVD D;  4O3Y A;  5B66 O;  2ODJ A;  1MPF A;  3A2S X;  3DA3 A;  4FZL A;  4GHB A;  3T20 A;  3SZV A;  5G26 A;  2Y0L A;  3POX A;  3WI4 A;  1OPF A;  4N58 A;  4RJX A;  1GFN A;  4GCP A;  1GFQ A;  1THQ A;  4RL9 A;  3AAE B;  3AA7 A;  3QRC A;  4LSE A;  1QJ8 A;  2FGQ X;  4PJ0 O;  1P4T A;  3K19 A;  4PUX A;  2JMM A;  3AA6 A;  3UAQ A;  2ERV A;  4XNL A;  3BS0 A;  3C5O A;  4AYI D;  1GFM A;  5H2F O;  3PQU A;  5KAF O;  5JDP A;  3WU2 O;  2OMF A;  2Y0H A;  3QRA A;  4O4U A;  3VE1 A;  3AAA B;  3LK4 2;  3PRN A;  2F1V A;  2LHF A;  3PGR A;  4G76 A;  5DL5 A;  5G39 A;  5G3A A;  4AKR A;  2KXP A;  4GCQ A;  2JQY A;  4N59 A;  4O3W A;  2XE2 A;  2K4T A;  2XE1 A;  4D5U A;  1HXX A;  3TZG A;  3BRY A;  3A0B O;  5B5E O;  3VY8 X;  4RJW A;  2J1N A;  2R4P A;  1IZN A;  2KZ7 B;  2ZFG A;  4AYE C; 
#chains in the Genus database with same CATH homology
 4LSI A;  4FZN A;  2K0L A;  3JTY A;  4KRA A;  4GCS A;  1ORM A;  3VZW X;  3POQ A;  1ZHZ A;  2FGR A;  3POU A;  4FSO A;  6PRN A;  2XE3 A;  3WI5 A;  1G90 A;  4O4X A;  1PHO A;  2XTQ A;  1GFO A;  3AAE A;  4KR4 A;  4LSH A;  3UU2 A;  2ZLD A;  4D65 A;  4FUV A;  4FMS A;  2N2M A;  3HOL A;  3HOE A;  1ZHW A;  1Q9G A;  1H6S 1;  1ZHT A;  4LSF A;  4RLC A;  3GP6 A;  3VE2 A;  4JFB A;  4G75 A;  4KR8 A;  3AAA A;  4FSP A;  3V8U A;  1E54 A;  4O3X B;  2XTR A;  7PRN A;  2POR A;  2YNK A;  4AFK A;  2MHL A;  3FYX A;  1HXU A;  3SY7 A;  4F4B A;  3LK4 1;  1QJ9 A;  3T0S A;  2Y7S A;  5PRN A;  5DL6 A;  4AYD C;  3T24 A;  2QTK A;  4O49 A;  2XMX A;  2KZ7 A;  1ZHY A;  4FRT A;  1MM4 A;  2N2L A;  5IYU A;  5DL7 A;  3VZU X;  4FZM A;  1OSM A;  4GF4 A;  3PQS A;  4D64 A;  5D5D A;  2Y2X A;  2YPV A;  2M07 A;  5T5F A;  3NSG A;  3SYB A;  3HWB A;  3HW9 A;  2XG6 A;  4AYN A;  3AA0 B;  3LK3 B;  4BUM X;  5FVN A;  1BT9 A;  1GFP A;  3SZD A;  4E1S A;  2PRN A;  3SY9 A;  4XNK A;  1BH3 A;  5GV0 A;  3AA7 B;  3SYS A;  4AUI A;  5ADX L;  3DA4 A;  2O4V A;  1YS5 A;  3AA6 B;  2MNH A;  4FES A;  4U9C A;  3VY9 X;  3LK2 B;  5DL8 A;  4RLB A;  3G7G A;  4FRX A;  1HXT A;  3POR A;  2X27 X;  2LFU A;  4B61 A;  2KDY A;  4C69 X;  3LK2 A;  4AZL A;  8PRN A;  4QQ1 A;  4FOZ A;  5AFU L;  3UPG A;  2W81 C;  3EMN X;  3VZT X;  2XE5 A;  2W80 C;  5EE2 A;  2GE4 A;  4AKR B;  5ADX K;  3AA1 B;  2KXP B;  4O3Z A;  1BXW A;  4Z3T A;  2KC0 A;  4FT6 A;  3RBH A;  1MM5 A;  3AA1 A;  2F1T A;  4AYM C;  5AFU K;  1IZN B;  1QJP A;  1PRN A;  1ZHX A;  4JCH A;  4E1T A;  2M06 A;  3AA0 A;  3LK3 A;  2J4U P;  4AKM A;  1Q9F A;  2Y0K A;  3O0E A;  3KVD D;  4O3Y A;  2ODJ A;  1MPF A;  3A2S X;  3DA3 A;  4FZL A;  4GHB A;  3T20 A;  3SZV A;  5G26 A;  2Y0L A;  3POX A;  3WI4 A;  1OPF A;  4N58 A;  4RJX A;  1GFN A;  4GCP A;  1GFQ A;  1THQ A;  4RL9 A;  3AAE B;  3AA7 A;  3QRC A;  4LSE A;  1QJ8 A;  2FGQ X;  4PUX A;  1P4T A;  3K19 A;  3UAQ A;  2JMM A;  3AA6 A;  2ERV A;  4XNL A;  3C5O A;  4AYI D;  1GFM A;  3PQU A;  5JDP A;  2OMF A;  2Y0H A;  3QRA A;  4O4U A;  3VE1 A;  3AAA B;  3LK4 2;  3PRN A;  2F1V A;  2LHF A;  4G76 A;  5DL5 A;  4AKR A;  2KXP A;  4GCQ A;  4N59 A;  4O3W A;  2XE2 A;  2K4T A;  2XE1 A;  4D5U A;  1HXX A;  3TZG A;  3VY8 X;  4RJW A;  2J1N A;  1IZN A;  2KZ7 B;  2ZFG A;  4AYE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...