2XE5A

Molecular insights into clinically isolated ompc mutants and their role in multi-drug resistance (ompc26)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
343
structure length
343
Chain Sequence
b'AEIYNKDGNKLDLYGKVEGLHYFSDNDSKDGDKTYMRLGFKGETQVTDQLTGYGQWEYQIQGNEPESDNSSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYDSDNFMQQRGNGFATYRNTDFFGLVDGLDFAVQYQGKNGSAHGEGMTTNGRDDVFEQNGDGVGGSITYNYEGFGIGAAVSSSKRTWDQNNTGLIGTGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNRFTRDAGINTDDIVALGLVYQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PORIN C
publication title Altered Antibiotic Transport in Ompc Mutants Isolated from a Series of Clinical Strains of Multi-Drug Resistant E. Coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 101
structure length 343
sequence length 343
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2xe5A00
5DL7A 4FOZA 3SY9A 4KR4A 3VZTX 2PRNA 4LSHA 3EMNX 4RJWA 1GFQA 1HXXA 5DL5A 3WI5A 1HXUA 2ODJA 4FRXA 4FRTA 2XG6A 3SZVA 5PRNA 2O4VA 2Y0HA 3SY7A 1BH3A 3O0EA 3SYSA 3NSGA 3UPGA 2FGQX 3WI4A 3VY9X 3UU2A 3POUA 1OSMA 2XE3A 1GFOA 2ZLDA 3SZDA 3VY8X 3K19A 3HWBA 1HXTA 2FGRA 2Y2XA 4FT6A 1GFPA 2J1NA 2XE2A 4GCPA 1BT9A 3PRNA 2OMFA 3POXA 1H6S1 3T0SA 1MPFA 4GCQA 3T20A 7PRNA 4BUMX 4LSIA 4RJXA 4FMSA 4C69X 2Y0KA 5DL8A 3PORA 1OPFA 5FVNA 4D65A 8PRNA 6PRNA 4D5UA 4FSOA 2ZFGA 2K4TA 4GCSA 2J4UP 4JFBA 4D64A 2XE5A 3A2SX 4KR8A 3T24A 2QTKA 5DL6A 2XE1A 3POQA 3JTYA 1E54A 3FYXA 1PHOA 4LSFA 2Y0LA 1GFNA 4LSEA 1GFMA 3SYBA 3VZWX 3HW9A 4KRAA 1PRNA 4AUIA 4FSPA 5JDPA 3VZUX 2PORA
chains in the Genus database with same CATH superfamily
3DWOX 5DL7A 4FOZA 3SY9A 2KZ7A 3DA4A 4KR4A 5G3AA 3VZTX 2PRNA 2LHFA 4RL9A 4LSHA 3EMNX 3HOLA 2F1CX 1QJ8A 4XNLA 4AYID 5H2FO 2N2MA 4RJWA 1GFQA 1HXXA 1ZHYA 5DL5A 2XMXA 3BRZA 3LK2B 5TISO 1HXUA 2ODJA 3WI5A 4FRXA 4N59A 3AA0A 4FRTA 2XG6A 3A0BO 3DA3A 3SZVA 5PRNA 4AYNA 4C00A 2IWWA 2O4VA 3VE1A 2Y0HA 5E79O 3LK2A 4AYDC 4N74A 3SY7A 1BH3A 3O0EA 3NJTA 2WJQA 3SYSA 3NSGA 3UPGA 2FGQX 3WI4A 3VY8X 3VY9X 5ADXK 1ZHWA 3KVDD 3UU2A 1ORMA 4PJ0O 4JCHA 3POUA 5AFUL 4AYMC 2GE4A 1OSMA 4PUXA 2XE3A 1GFOA 2R89A 2ZLDA 3LK42 5T5FA 3SZDA 3K19A 2R4NA 2MHLA 1ZHZA 2XTRA 2YNKA 2YPVA 3HWBA 3PQUA 4K3BA 1HXTA 2FGRA 2Y2XA 5GV0A 3VE2A 4FT6A 3DZMA 3GP6A 1GFPA 2J1NA 2XE2A 3LK41 4GCPA 5IYUA 1MM5A 1S5LO 1BT9A 3AA1B 3AAAB 5GTHO 3PRNA 3UAQA 2OMFA 3AA7B 4N75A 4F4BA 2F1VA 2MNHA 4O3XB 3AA6B 4PR7A 3POXA 1H6S1 3T0SA 1Q9FA 1MPFA 4GCQA 2K0LA 3LK3B 1QJ9A 2KC0A 3AA1A 3PGRA 4FZNA 4FZMA 2R8AA 3AA7A 2R4LA 4G75A 4O4UA 3T20A 2XTQA 5G38A 4U9CA 3C5OA 4K3CA 4BUMX 7PRNA 4LSIA 4FZLA 4FMSA 4RJXA 2Y0KA 4C69X 3A0HO 5DL8A 2LFUA 4N58A 2W80C 3HOEA 3PORA 4C4VB 4O3WA 1T1LA 4AFKA 2R4PA 1OPFA 5FVNA 5G39A 4FUVA 4AKMA 4D65A 4E1SA 5GTIO 4QQ1A 8PRNA 4AKRB 4C4VA 2M07A 6PRNA 4D5UA 3PQSA 4FSOA 1ZHXA 4GHBA 2WJRA 2M06A 2ZFGA 3DWNA 5KAFO 2Y7SA 2N2LA 4AZLA 2K4TA 4FQEA 4AKRA 4AYEC 4GCSA 2J4UP 1BXWA 2AXTO 4FESA 4JFBA 3V8UA 4Z3TA 5D5DA 4D64A 2XE5A 5B66O 4RLCA 2ERVA 3A2SX 3AAAA 4O3YA 4B61A 4CTDA 5ADXL 2KZ7B 3QRCA 1THQA 4G76A 2F1TA 3AA6A 4GF4A 5KAIO 5EE2A 4KR8A 3LK3A 4UB8O 3T24A 2QTKA 3PF1A 4E1TA 5AFUK 1IZNB 3PGUA 4O3ZA 5DL6A 3AA0B 1QJPA 1YS5A 2XE1A 3BS0A 3KZIO 3POQA 3PGSA 2R4OA 3JTYA 1P4TA 3G7GA 1E54A 3FYXA 1MM4A 4O4XA 3TZGA 1G90A 1IZNA 2W81C 1ZHTA 3AAEB 5B5EO 1PHOA 4XNKA 2JQYA 2Y0LA 4LSFA 2IWVA 2JMMA 2KXPB 3BRYA 1GFNA 4LSEA 1GFMA 1T16A 4O49A 3SYBA 3QRAA 5G26A 3AAEA 3VZWX 2WVPA 3HW9A 4IL6O 3JCUO 4KRAA 2KXPA 3RBHA 3WU2O 1PRNA 4AUIA 1Q9GA 4FSPA 5JDPA 4UB6O 2X9KA 3VZUX 2PORA 2KDYA 2R88A 4RLBA 2X27X
chains in the Genus database with same CATH topology
5DL7A 4FOZA 3SY9A 2KZ7A 3DA4A 4KR4A 3VZTX 2PRNA 2LHFA 4RL9A 4LSHA 3EMNX 3HOLA 4XNLA 1QJ8A 4AYID 2N2MA 4RJWA 1GFQA 1HXXA 1ZHYA 5DL5A 2XMXA 3LK2B 3WI5A 1HXUA 2ODJA 4FRXA 4N59A 3AA0A 4FRTA 2XG6A 3DA3A 3SZVA 5PRNA 4AYNA 2O4VA 3VE1A 2Y0HA 3LK2A 4AYDC 3SY7A 1BH3A 3O0EA 3SYSA 3NSGA 3UPGA 2FGQX 3WI4A 3VY9X 5ADXK 1ZHWA 3KVDD 3UU2A 1ORMA 5AFUL 4JCHA 3POUA 4AYMC 2GE4A 1OSMA 4PUXA 2XE3A 1GFOA 3LK42 2ZLDA 5T5FA 3SZDA 3VY8X 3K19A 3HWBA 2MHLA 1ZHZA 2XTRA 2YNKA 2YPVA 3PQUA 3V8UA 5GV0A 1HXTA 2FGRA 2Y2XA 3VE2A 4FT6A 3GP6A 1GFPA 2J1NA 2XE2A 3LK41 4GCPA 5IYUA 1MM5A 1BT9A 3AA1B 3AAAB 3PRNA 3UAQA 2OMFA 3AA7B 4F4BA 2F1VA 2MNHA 4O3XB 3AA6B 3POXA 1H6S1 3T0SA 1Q9FA 1MPFA 4GCQA 2K0LA 3LK3B 1QJ9A 2KC0A 3AA1A 3T20A 4FZNA 4FZMA 3AA7A 4G75A 4O4UA 2XTQA 4U9CA 3C5OA 7PRNA 4BUMX 4LSIA 4FZLA 4FMSA 4RJXA 2Y0KA 4C69X 5DL8A 2LFUA 4N58A 2W80C 3HOEA 3PORA 4O3WA 4AFKA 1OPFA 5FVNA 4FUVA 4AKMA 4D65A 4E1SA 4QQ1A 8PRNA 4AKRB 6PRNA 2M07A 4D5UA 3PQSA 4FSOA 1ZHXA 4GHBA 2M06A 2ZFGA 4AZLA 2Y7SA 2N2LA 2K4TA 4AKRA 4AYEC 4GCSA 2J4UP 1BXWA 4JFBA 4FESA 4Z3TA 5D5DA 4D64A 2XE5A 4RLCA 2ERVA 3A2SX 3AAAA 4O3YA 4B61A 5ADXL 2KZ7B 3QRCA 1THQA 4G76A 2F1TA 3AA6A 4GF4A 5EE2A 4KR8A 3LK3A 3T24A 2QTKA 4E1TA 5AFUK 1IZNB 5DL6A 4O3ZA 3AA0B 1QJPA 1YS5A 2XE1A 3POQA 3JTYA 1P4TA 3G7GA 1E54A 3FYXA 1MM4A 4O4XA 3TZGA 1G90A 1IZNA 2W81C 1ZHTA 3AAEB 1PHOA 4XNKA 2Y0LA 4LSFA 2JMMA 2KXPB 1GFNA 4LSEA 1GFMA 4O49A 3SYBA 3QRAA 5G26A 3AAEA 3VZWX 3HW9A 4KRAA 3RBHA 2KXPA 1PRNA 4AUIA 1Q9GA 4FSPA 5JDPA 3VZUX 2PORA 2KDYA 4RLBA 2X27X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DL7 A;  4FOZ A;  3SY9 A;  4KR4 A;  3VZT X;  2PRN A;  4LSH A;  3EMN X;  4RJW A;  1GFQ A;  1HXX A;  5DL5 A;  3WI5 A;  1HXU A;  2ODJ A;  4FRX A;  4FRT A;  2XG6 A;  3SZV A;  5PRN A;  2O4V A;  2Y0H A;  3SY7 A;  1BH3 A;  3O0E A;  3SYS A;  3NSG A;  3UPG A;  2FGQ X;  3WI4 A;  3VY9 X;  3UU2 A;  3POU A;  1OSM A;  2XE3 A;  1GFO A;  2ZLD A;  3SZD A;  3VY8 X;  3K19 A;  3HWB A;  1HXT A;  2FGR A;  2Y2X A;  4FT6 A;  1GFP A;  2J1N A;  2XE2 A;  4GCP A;  1BT9 A;  3PRN A;  2OMF A;  3POX A;  1H6S 1;  3T0S A;  1MPF A;  4GCQ A;  3T20 A;  7PRN A;  4BUM X;  4LSI A;  4RJX A;  4FMS A;  4C69 X;  2Y0K A;  5DL8 A;  3POR A;  1OPF A;  5FVN A;  4D65 A;  8PRN A;  6PRN A;  4D5U A;  4FSO A;  2ZFG A;  2K4T A;  4GCS A;  2J4U P;  4JFB A;  4D64 A;  2XE5 A;  3A2S X;  4KR8 A;  3T24 A;  2QTK A;  5DL6 A;  2XE1 A;  3POQ A;  3JTY A;  1E54 A;  3FYX A;  1PHO A;  4LSF A;  2Y0L A;  1GFN A;  4LSE A;  1GFM A;  3SYB A;  3VZW X;  3HW9 A;  4KRA A;  1PRN A;  4AUI A;  4FSP A;  5JDP A;  3VZU X;  2POR A; 
#chains in the Genus database with same CATH topology
 3DWO X;  5DL7 A;  4FOZ A;  3SY9 A;  2KZ7 A;  3DA4 A;  4KR4 A;  5G3A A;  3VZT X;  2PRN A;  2LHF A;  4RL9 A;  4LSH A;  3EMN X;  3HOL A;  2F1C X;  1QJ8 A;  4XNL A;  4AYI D;  5H2F O;  2N2M A;  4RJW A;  1GFQ A;  1HXX A;  1ZHY A;  5DL5 A;  2XMX A;  3BRZ A;  3LK2 B;  5TIS O;  1HXU A;  2ODJ A;  3WI5 A;  4FRX A;  4N59 A;  3AA0 A;  4FRT A;  2XG6 A;  3A0B O;  3DA3 A;  3SZV A;  5PRN A;  4AYN A;  4C00 A;  2IWW A;  2O4V A;  3VE1 A;  2Y0H A;  5E79 O;  3LK2 A;  4AYD C;  4N74 A;  3SY7 A;  1BH3 A;  3O0E A;  3NJT A;  2WJQ A;  3SYS A;  3NSG A;  3UPG A;  2FGQ X;  3WI4 A;  3VY8 X;  3VY9 X;  5ADX K;  1ZHW A;  3KVD D;  3UU2 A;  1ORM A;  4PJ0 O;  4JCH A;  3POU A;  5AFU L;  4AYM C;  2GE4 A;  1OSM A;  4PUX A;  2XE3 A;  1GFO A;  2R89 A;  2ZLD A;  3LK4 2;  5T5F A;  3SZD A;  3K19 A;  2R4N A;  2MHL A;  1ZHZ A;  2XTR A;  2YNK A;  2YPV A;  3HWB A;  3PQU A;  4K3B A;  1HXT A;  2FGR A;  2Y2X A;  5GV0 A;  3VE2 A;  4FT6 A;  3DZM A;  3GP6 A;  1GFP A;  2J1N A;  2XE2 A;  3LK4 1;  4GCP A;  5IYU A;  1MM5 A;  1S5L O;  1BT9 A;  3AA1 B;  3AAA B;  5GTH O;  3PRN A;  3UAQ A;  2OMF A;  3AA7 B;  4N75 A;  4F4B A;  2F1V A;  2MNH A;  4O3X B;  3AA6 B;  4PR7 A;  3POX A;  1H6S 1;  3T0S A;  1Q9F A;  1MPF A;  4GCQ A;  2K0L A;  3LK3 B;  1QJ9 A;  2KC0 A;  3AA1 A;  3PGR A;  4FZN A;  4FZM A;  2R8A A;  3AA7 A;  2R4L A;  4G75 A;  4O4U A;  3T20 A;  2XTQ A;  5G38 A;  4U9C A;  3C5O A;  4K3C A;  4BUM X;  7PRN A;  4LSI A;  4FZL A;  4FMS A;  4RJX A;  2Y0K A;  4C69 X;  3A0H O;  5DL8 A;  2LFU A;  4N58 A;  2W80 C;  3HOE A;  3POR A;  4C4V B;  4O3W A;  1T1L A;  4AFK A;  2R4P A;  1OPF A;  5FVN A;  5G39 A;  4FUV A;  4AKM A;  4D65 A;  4E1S A;  5GTI O;  4QQ1 A;  8PRN A;  4AKR B;  4C4V A;  2M07 A;  6PRN A;  4D5U A;  3PQS A;  4FSO A;  1ZHX A;  4GHB A;  2WJR A;  2M06 A;  2ZFG A;  3DWN A;  5KAF O;  2Y7S A;  2N2L A;  4AZL A;  2K4T A;  4FQE A;  4AKR A;  4AYE C;  4GCS A;  2J4U P;  1BXW A;  2AXT O;  4FES A;  4JFB A;  3V8U A;  4Z3T A;  5D5D A;  4D64 A;  2XE5 A;  5B66 O;  4RLC A;  2ERV A;  3A2S X;  3AAA A;  4O3Y A;  4B61 A;  4CTD A;  5ADX L;  2KZ7 B;  3QRC A;  1THQ A;  4G76 A;  2F1T A;  3AA6 A;  4GF4 A;  5KAI O;  5EE2 A;  4KR8 A;  3LK3 A;  4UB8 O;  3T24 A;  2QTK A;  3PF1 A;  4E1T A;  5AFU K;  1IZN B;  3PGU A;  4O3Z A;  5DL6 A;  3AA0 B;  1QJP A;  1YS5 A;  2XE1 A;  3BS0 A;  3KZI O;  3POQ A;  3PGS A;  2R4O A;  3JTY A;  1P4T A;  3G7G A;  1E54 A;  3FYX A;  1MM4 A;  4O4X A;  3TZG A;  1G90 A;  1IZN A;  2W81 C;  1ZHT A;  3AAE B;  5B5E O;  1PHO A;  4XNK A;  2JQY A;  2Y0L A;  4LSF A;  2IWV A;  2JMM A;  2KXP B;  3BRY A;  1GFN A;  4LSE A;  1GFM A;  1T16 A;  4O49 A;  3SYB A;  3QRA A;  5G26 A;  3AAE A;  3VZW X;  2WVP A;  3HW9 A;  4IL6 O;  3JCU O;  4KRA A;  2KXP A;  3RBH A;  3WU2 O;  1PRN A;  4AUI A;  1Q9G A;  4FSP A;  5JDP A;  4UB6 O;  2X9K A;  3VZU X;  2POR A;  2KDY A;  2R88 A;  4RLB A;  2X27 X; 
#chains in the Genus database with same CATH homology
 5DL7 A;  4FOZ A;  3SY9 A;  2KZ7 A;  3DA4 A;  4KR4 A;  3VZT X;  2PRN A;  2LHF A;  4RL9 A;  4LSH A;  3EMN X;  3HOL A;  4XNL A;  1QJ8 A;  4AYI D;  2N2M A;  4RJW A;  1GFQ A;  1HXX A;  1ZHY A;  5DL5 A;  2XMX A;  3LK2 B;  3WI5 A;  1HXU A;  2ODJ A;  4FRX A;  4N59 A;  3AA0 A;  4FRT A;  2XG6 A;  3DA3 A;  3SZV A;  5PRN A;  4AYN A;  2O4V A;  3VE1 A;  2Y0H A;  3LK2 A;  4AYD C;  3SY7 A;  1BH3 A;  3O0E A;  3SYS A;  3NSG A;  3UPG A;  2FGQ X;  3WI4 A;  3VY9 X;  5ADX K;  1ZHW A;  3KVD D;  3UU2 A;  1ORM A;  5AFU L;  4JCH A;  3POU A;  4AYM C;  2GE4 A;  1OSM A;  4PUX A;  2XE3 A;  1GFO A;  3LK4 2;  2ZLD A;  5T5F A;  3SZD A;  3VY8 X;  3K19 A;  3HWB A;  2MHL A;  1ZHZ A;  2XTR A;  2YNK A;  2YPV A;  3PQU A;  3V8U A;  5GV0 A;  1HXT A;  2FGR A;  2Y2X A;  3VE2 A;  4FT6 A;  3GP6 A;  1GFP A;  2J1N A;  2XE2 A;  3LK4 1;  4GCP A;  5IYU A;  1MM5 A;  1BT9 A;  3AA1 B;  3AAA B;  3PRN A;  3UAQ A;  2OMF A;  3AA7 B;  4F4B A;  2F1V A;  2MNH A;  4O3X B;  3AA6 B;  3POX A;  1H6S 1;  3T0S A;  1Q9F A;  1MPF A;  4GCQ A;  2K0L A;  3LK3 B;  1QJ9 A;  2KC0 A;  3AA1 A;  3T20 A;  4FZN A;  4FZM A;  3AA7 A;  4G75 A;  4O4U A;  2XTQ A;  4U9C A;  3C5O A;  7PRN A;  4BUM X;  4LSI A;  4FZL A;  4FMS A;  4RJX A;  2Y0K A;  4C69 X;  5DL8 A;  2LFU A;  4N58 A;  2W80 C;  3HOE A;  3POR A;  4O3W A;  4AFK A;  1OPF A;  5FVN A;  4FUV A;  4AKM A;  4D65 A;  4E1S A;  4QQ1 A;  8PRN A;  4AKR B;  6PRN A;  2M07 A;  4D5U A;  3PQS A;  4FSO A;  1ZHX A;  4GHB A;  2M06 A;  2ZFG A;  4AZL A;  2Y7S A;  2N2L A;  2K4T A;  4AKR A;  4AYE C;  4GCS A;  2J4U P;  1BXW A;  4JFB A;  4FES A;  4Z3T A;  5D5D A;  4D64 A;  2XE5 A;  4RLC A;  2ERV A;  3A2S X;  3AAA A;  4O3Y A;  4B61 A;  5ADX L;  2KZ7 B;  3QRC A;  1THQ A;  4G76 A;  2F1T A;  3AA6 A;  4GF4 A;  5EE2 A;  4KR8 A;  3LK3 A;  3T24 A;  2QTK A;  4E1T A;  5AFU K;  1IZN B;  5DL6 A;  4O3Z A;  3AA0 B;  1QJP A;  1YS5 A;  2XE1 A;  3POQ A;  3JTY A;  1P4T A;  3G7G A;  1E54 A;  3FYX A;  1MM4 A;  4O4X A;  3TZG A;  1G90 A;  1IZN A;  2W81 C;  1ZHT A;  3AAE B;  1PHO A;  4XNK A;  2Y0L A;  4LSF A;  2JMM A;  2KXP B;  1GFN A;  4LSE A;  1GFM A;  4O49 A;  3SYB A;  3QRA A;  5G26 A;  3AAE A;  3VZW X;  3HW9 A;  4KRA A;  3RBH A;  2KXP A;  1PRN A;  4AUI A;  1Q9G A;  4FSP A;  5JDP A;  3VZU X;  2POR A;  2KDY A;  4RLB A;  2X27 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...