4UB8O

Native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
243
structure length
243
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem Q(B) protein
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
total genus 56
structure length 243
sequence length 243
chains with identical sequence o
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 4ub8O01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 4ub8O02
5B66O 5GTHO 4UB8O 5H2FO 3JCUO 4IL6O 5E79O 3KZIO 3A0HO 3WU2O 5KAFO 2AXTO 4PJ0O 4UB6O 3A0BO 5G3AA 5G39A 5GTIO 1S5LO 5KAIO 5TISO 5B5EO 5G38A
chains in the Genus database with same CATH superfamily
5B66O 1HXUA 1BXWA 1ZHTA 1GFPA 3SZDA 1THQA 2Y2XA 4JCHA 4XNLA 5H2FO 5PRNA 3O0EA 4FT6A 3VE2A 2PORA 4AKMA 5E79O 1ZHYA 5DL5A 2R8AA 3PQUA 1GFMA 2IWVA 3WI4A 5KAFO 3WI5A 1H6S1 2AXTO 3AAAB 3NSGA 1GFNA 5FVNA 3VE1A 3V8UA 1Q9FA 2QTKA 2X27X 3DZMA 2R4OA 2KZ7A 2XE1A 3PGUA 1QJPA 4GCPA 3SYSA 2YPVA 2R4NA 1ORMA 3AAEA 1PHOA 4FSOA 3NJTA 2YNKA 2GE4A 3VY8X 4RLCA 3PORA 2WVPA 3GP6A 4N58A 2XTRA 4O3YA 5IYUA 4O3WA 3BS0A 4XNKA 4C00A 3UPGA 1IZNA 3DWNA 5GTHO 2OMFA 3JTYA 4PUXA 4K3BA 4D65A 1OPFA 3POUA 1GFOA 2KZ7B 4FQEA 3JCUO 4AYEC 1MM4A 3LK2A 4C4VA 4QQ1A 3KZIO 4AYMC 3A0HO 1YS5A 4GCQA 4FUVA 2KXPA 4E1SA 6PRNA 2XTQA 4RJXA 3HOEA 4FSPA 4FZLA 4U9CA 5DL6A 3SYBA 2ODJA 2W80C 3AA7A 5AFUK 1PRNA 4O3ZA 4FZMA 2MNHA 2N2LA 3DA4A 4G76A 2K0LA 4JFBA 3TZGA 4KRAA 4Z3TA 3C5OA 3T20A 3POXA 4D64A 5GTIO 2R4LA 1S5LO 3VZUX 4F4BA 2XG6A 3AA1A 3LK2B 1BT9A 1ZHWA 3BRYA 3QRAA 4GF4A 5TISO 8PRNA 3QRCA 2LFUA 4O4UA 4FRTA 2KXPB 4FMSA 5G26A 3T0SA 2JQYA 2KDYA 2KC0A 5G38A 4AYDC 2M07A 4D5UA 5ADXK 1ZHXA 4G75A 4FOZA 3LK41 1ZHZA 2R88A 1GFQA 4FRXA 3AA7B 4O3XB 2K4TA 4N59A 1QJ9A 3A2SX 4PR7A 4O4XA 3LK3A 4O49A 4RJWA 4RLBA 3VZTX 2XMXA 2R4PA 5ADXL 3RBHA 1BH3A 1OSMA 2F1CX 4N74A 1HXTA 3HWBA 3AA6A 3AAEB 4K3CA 3AA1B 4KR4A 2J1NA 4LSHA 2M06A 3UU2A 3HW9A 3WU2O 1E54A 4AKRA 4AYID 4BUMX 2IWWA 1MPFA 4UB6O 5G3AA 1HXXA 3HOLA 2Y0KA 2LHFA 3T24A 1IZNB 3PQSA 3BRZA 5T5FA 5DL7A 4KR8A 2WJQA 3SY7A 1QJ8A 3LK3B 3G7GA 3UAQA 4AYNA 5GV0A 1G90A 1T16A 3PF1A 5DL8A 4FZNA 4C4VB 3KVDD 3DWOX 4AUIA 1MM5A 3PGSA 4LSIA 4AKRB 4LSEA 2ZLDA 2O4VA 2N2MA 5D5DA 4UB8O 2WJRA 4AZLA 3SY9A 3POQA 2PRNA 4GCSA 3FYXA 3VZWX 1Q9GA 4GHBA 4CTDA 4IL6O 3AA0A 3PRNA 2X9KA 4B61A 3LK42 7PRNA 4PJ0O 5AFUL 4LSFA 2Y0HA 2ERVA 2F1VA 3A0BO 5JDPA 2R89A 2Y7SA 2XE2A 3PGRA 2Y0LA 3K19A 2JMMA 2FGRA 4N75A 2F1TA 3DA3A 4C69X 2ZFGA 5G39A 2XE5A 2J4UP 2XE3A 5KAIO 4AFKA 1P4TA 1T1LA 2FGQX 3SZVA 3VY9X 2W81C 5B5EO 3EMNX 3AAAA 3AA0B 2MHLA 4RL9A 4FESA 4E1TA 3AA6B 5EE2A
chains in the Genus database with same CATH topology
5B66O 5GTHO 4UB8O 5H2FO 3JCUO 4IL6O 5E79O 3KZIO 3A0HO 3WU2O 5KAFO 2AXTO 4PJ0O 4UB6O 3A0BO 5G3AA 5G39A 5GTIO 1S5LO 5KAIO 5TISO 5B5EO 5G38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B66 O;  5GTH O;  4UB8 O;  5H2F O;  3JCU O;  4IL6 O;  5E79 O;  3KZI O;  3A0H O;  3WU2 O;  5KAF O;  2AXT O;  4PJ0 O;  4UB6 O;  3A0B O;  5G3A A;  5G39 A;  5GTI O;  1S5L O;  5KAI O;  5TIS O;  5B5E O;  5G38 A; 
#chains in the Genus database with same CATH topology
 5B66 O;  1HXU A;  1BXW A;  1ZHT A;  1GFP A;  3SZD A;  1THQ A;  2Y2X A;  4JCH A;  4XNL A;  5H2F O;  5PRN A;  3O0E A;  4FT6 A;  3VE2 A;  2POR A;  4AKM A;  5E79 O;  1ZHY A;  5DL5 A;  2R8A A;  3PQU A;  1GFM A;  2IWV A;  3WI4 A;  5KAF O;  3WI5 A;  1H6S 1;  2AXT O;  3AAA B;  3NSG A;  1GFN A;  5FVN A;  3VE1 A;  3V8U A;  1Q9F A;  2QTK A;  2X27 X;  3DZM A;  2R4O A;  2KZ7 A;  2XE1 A;  3PGU A;  1QJP A;  4GCP A;  3SYS A;  2YPV A;  2R4N A;  1ORM A;  3AAE A;  1PHO A;  4FSO A;  3NJT A;  2YNK A;  2GE4 A;  3VY8 X;  4RLC A;  3POR A;  2WVP A;  3GP6 A;  4N58 A;  2XTR A;  4O3Y A;  5IYU A;  4O3W A;  3BS0 A;  4XNK A;  4C00 A;  3UPG A;  1IZN A;  3DWN A;  5GTH O;  2OMF A;  3JTY A;  4PUX A;  4K3B A;  4D65 A;  1OPF A;  3POU A;  1GFO A;  2KZ7 B;  4FQE A;  3JCU O;  4AYE C;  1MM4 A;  3LK2 A;  4C4V A;  4QQ1 A;  3KZI O;  4AYM C;  3A0H O;  1YS5 A;  4GCQ A;  4FUV A;  2KXP A;  4E1S A;  6PRN A;  2XTQ A;  4RJX A;  3HOE A;  4FSP A;  4FZL A;  4U9C A;  5DL6 A;  3SYB A;  2ODJ A;  2W80 C;  3AA7 A;  5AFU K;  1PRN A;  4O3Z A;  4FZM A;  2MNH A;  2N2L A;  3DA4 A;  4G76 A;  2K0L A;  4JFB A;  3TZG A;  4KRA A;  4Z3T A;  3C5O A;  3T20 A;  3POX A;  4D64 A;  5GTI O;  2R4L A;  1S5L O;  3VZU X;  4F4B A;  2XG6 A;  3AA1 A;  3LK2 B;  1BT9 A;  1ZHW A;  3BRY A;  3QRA A;  4GF4 A;  5TIS O;  8PRN A;  3QRC A;  2LFU A;  4O4U A;  4FRT A;  2KXP B;  4FMS A;  5G26 A;  3T0S A;  2JQY A;  2KDY A;  2KC0 A;  5G38 A;  4AYD C;  2M07 A;  4D5U A;  5ADX K;  1ZHX A;  4G75 A;  4FOZ A;  3LK4 1;  1ZHZ A;  2R88 A;  1GFQ A;  4FRX A;  3AA7 B;  4O3X B;  2K4T A;  4N59 A;  1QJ9 A;  3A2S X;  4PR7 A;  4O4X A;  3LK3 A;  4O49 A;  4RJW A;  4RLB A;  3VZT X;  2XMX A;  2R4P A;  5ADX L;  3RBH A;  1BH3 A;  1OSM A;  2F1C X;  4N74 A;  1HXT A;  3HWB A;  3AA6 A;  3AAE B;  4K3C A;  3AA1 B;  4KR4 A;  2J1N A;  4LSH A;  2M06 A;  3UU2 A;  3HW9 A;  3WU2 O;  1E54 A;  4AKR A;  4AYI D;  4BUM X;  2IWW A;  1MPF A;  4UB6 O;  5G3A A;  1HXX A;  3HOL A;  2Y0K A;  2LHF A;  3T24 A;  1IZN B;  3PQS A;  3BRZ A;  5T5F A;  5DL7 A;  4KR8 A;  2WJQ A;  3SY7 A;  1QJ8 A;  3LK3 B;  3G7G A;  3UAQ A;  4AYN A;  5GV0 A;  1G90 A;  1T16 A;  3PF1 A;  5DL8 A;  4FZN A;  4C4V B;  3KVD D;  3DWO X;  4AUI A;  1MM5 A;  3PGS A;  4LSI A;  4AKR B;  4LSE A;  2ZLD A;  2O4V A;  2N2M A;  5D5D A;  4UB8 O;  2WJR A;  4AZL A;  3SY9 A;  3POQ A;  2PRN A;  4GCS A;  3FYX A;  3VZW X;  1Q9G A;  4GHB A;  4CTD A;  4IL6 O;  3AA0 A;  3PRN A;  2X9K A;  4B61 A;  3LK4 2;  7PRN A;  4PJ0 O;  5AFU L;  4LSF A;  2Y0H A;  2ERV A;  2F1V A;  3A0B O;  5JDP A;  2R89 A;  2Y7S A;  2XE2 A;  3PGR A;  2Y0L A;  3K19 A;  2JMM A;  2FGR A;  4N75 A;  2F1T A;  3DA3 A;  4C69 X;  2ZFG A;  5G39 A;  2XE5 A;  2J4U P;  2XE3 A;  5KAI O;  4AFK A;  1P4T A;  1T1L A;  2FGQ X;  3SZV A;  3VY9 X;  2W81 C;  5B5E O;  3EMN X;  3AAA A;  3AA0 B;  2MHL A;  4RL9 A;  4FES A;  4E1T A;  3AA6 B;  5EE2 A; 
#chains in the Genus database with same CATH homology
 5B66 O;  5GTH O;  4UB8 O;  5H2F O;  3JCU O;  4IL6 O;  5E79 O;  3KZI O;  3A0H O;  3WU2 O;  5KAF O;  2AXT O;  4PJ0 O;  4UB6 O;  3A0B O;  5G3A A;  5G39 A;  5GTI O;  1S5L O;  5KAI O;  5TIS O;  5B5E O;  5G38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...