4UB8O

Native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
243
structure length
243
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 56
structure length 243
sequence length 243
chains with identical sequence o
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 4ub8O01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 4ub8O02
4UB8O 5GTIO 5B66O 5G39A 3KZIO 4IL6O 3A0HO 5KAIO 5G3AA 3JCUO 3A0BO 5B5EO 5E79O 3WU2O 2AXTO 5TISO 5GTHO 5G38A 5KAFO 5H2FO 4PJ0O 1S5LO 4UB6O
chains in the Genus database with same CATH superfamily
5IYUA 3PQSA 4GHBA 3AA6A 1THQA 3DA3A 2Y2XA 4GCPA 4LSHA 4UB8O 3VZTX 4AZLA 1H6S1 4E1SA 5AFUL 1E54A 3BRZA 3UAQA 2K0LA 2QTKA 4FOZA 4D5UA 1HXUA 4C4VA 2MNHA 4AKRA 2YNKA 4FRXA 2XE3A 5G39A 2R4PA 2M07A 5G26A 4C69X 3NSGA 4LSIA 5JDPA 1Q9FA 3UPGA 4N74A 8PRNA 3A0HO 1T16A 3AAAA 2ZFGA 4RL9A 2IWVA 4FUVA 5DL7A 2WVPA 4FRTA 4FT6A 2F1CX 2MHLA 4FMSA 3PGUA 4G75A 3A0BO 3LK3B 3UU2A 3AA1B 4AYDC 7PRNA 4XNKA 5B5EO 2Y0HA 5T5FA 4D64A 2X27X 3AA0A 1GFOA 1BH3A 3AAEA 3HW9A 1GFPA 4KR8A 1Q9GA 5PRNA 3LK42 4O3XB 1G90A 4GF4A 5KAFO 5H2FO 3AA7B 4O3YA 2KZ7A 4PJ0O 3POXA 1MM5A 3PF1A 1QJPA 4FSOA 4KR4A 4O49A 4O4UA 3C5OA 4QQ1A 5ADXL 1ORMA 4JFBA 5B66O 4RLCA 3K19A 4AYNA 3KZIO 3AA6B 1ZHXA 3DZMA 3HWBA 2FGQX 3O0EA 2XE2A 5ADXK 6PRNA 4CTDA 2XE1A 4KRAA 4N59A 5D5DA 4C4VB 2WJQA 4AKRB 4E1TA 4AYEC 3PORA 5DL6A 3DWOX 3VY8X 3LK2A 1ZHYA 3WI4A 2KXPB 3SYSA 3VE2A 5TISO 2J1NA 2FGRA 3SY7A 3TZGA 2JQYA 2R4NA 3SZDA 2JMMA 1IZNA 2YPVA 1P4TA 4AUIA 3PQUA 4FZLA 3AA0B 3G7GA 3POQA 3AAEB 5DL8A 3SZVA 4K3BA 3DA4A 3HOLA 4PUXA 4C00A 2R88A 3QRCA 2O4VA 4GCSA 1MPFA 4AKMA 4AYMC 2ODJA 3PGRA 1QJ9A 1PRNA 1GFNA 2KZ7B 2W80C 4JCHA 4FESA 4PR7A 2R4OA 4AFKA 4LSEA 3WI5A 3T20A 4XNLA 4IL6O 3VE1A 3GP6A 2ZLDA 3LK41 5GV0A 3T24A 1OSMA 1T1LA 1MM4A 2LFUA 5G3AA 2J4UP 3SYBA 3KVDD 3JTYA 4LSFA 1ZHZA 4RJXA 3BS0A 3A2SX 1PHOA 2LHFA 3WU2O 1BXWA 2R8AA 2XMXA 2M06A 2N2LA 3AAAB 1OPFA 4BUMX 3EMNX 2F1TA 5G38A 4K3CA 2F1VA 3LK2B 4Z3TA 2W81C 4RLBA 4GCQA 1S5LO 3VZWX 4UB6O 1GFMA 4G76A 2XTRA 2XG6A 3T0SA 3V8UA 1BT9A 2Y7SA 5AFUK 1HXXA 2XE5A 3HOEA 5GTIO 2Y0LA 4RJWA 4FQEA 2IWWA 4N58A 2ERVA 2R89A 1ZHWA 4FZMA 5DL5A 5FVNA 3LK3A 1IZNB 1YS5A 3AA1A 2OMFA 4F4BA 4O3WA 3RBHA 3VY9X 4AYID 3POUA 3SY9A 4U9CA 2KXPA 4N75A 2XTQA 1GFQA 5KAIO 2PORA 2R4LA 3JCUO 3PGSA 3AA7A 3VZUX 4O3ZA 2K4TA 5E79O 2N2MA 2KC0A 4FSPA 2GE4A 4D65A 2WJRA 3PRNA 2AXTO 2PRNA 4FZNA 3FYXA 3BRYA 3QRAA 1ZHTA 1QJ8A 5GTHO 1HXTA 4B61A 5EE2A 2X9KA 4O4XA 3NJTA 2Y0KA 2KDYA 3DWNA
chains in the Genus database with same CATH topology
4UB8O 5GTIO 5B66O 5G39A 3KZIO 4IL6O 3A0HO 5KAIO 5G3AA 3JCUO 3A0BO 5B5EO 5E79O 3WU2O 2AXTO 5TISO 5GTHO 5G38A 5KAFO 5H2FO 4PJ0O 1S5LO 4UB6O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB8 O;  5GTI O;  5B66 O;  5G39 A;  3KZI O;  4IL6 O;  3A0H O;  5KAI O;  5G3A A;  3JCU O;  3A0B O;  5B5E O;  5E79 O;  3WU2 O;  2AXT O;  5TIS O;  5GTH O;  5G38 A;  5KAF O;  5H2F O;  4PJ0 O;  1S5L O;  4UB6 O; 
#chains in the Genus database with same CATH topology
 5IYU A;  3PQS A;  4GHB A;  3AA6 A;  1THQ A;  3DA3 A;  2Y2X A;  4GCP A;  4LSH A;  4UB8 O;  3VZT X;  4AZL A;  1H6S 1;  4E1S A;  5AFU L;  1E54 A;  3BRZ A;  3UAQ A;  2K0L A;  2QTK A;  4FOZ A;  4D5U A;  1HXU A;  4C4V A;  2MNH A;  4AKR A;  2YNK A;  4FRX A;  2XE3 A;  5G39 A;  2R4P A;  2M07 A;  5G26 A;  4C69 X;  3NSG A;  4LSI A;  5JDP A;  1Q9F A;  3UPG A;  4N74 A;  8PRN A;  3A0H O;  1T16 A;  3AAA A;  2ZFG A;  4RL9 A;  2IWV A;  4FUV A;  5DL7 A;  2WVP A;  4FRT A;  4FT6 A;  2F1C X;  2MHL A;  4FMS A;  3PGU A;  4G75 A;  3A0B O;  3LK3 B;  3UU2 A;  3AA1 B;  4AYD C;  7PRN A;  4XNK A;  5B5E O;  2Y0H A;  5T5F A;  4D64 A;  2X27 X;  3AA0 A;  1GFO A;  1BH3 A;  3AAE A;  3HW9 A;  1GFP A;  4KR8 A;  1Q9G A;  5PRN A;  3LK4 2;  4O3X B;  1G90 A;  4GF4 A;  5KAF O;  5H2F O;  3AA7 B;  4O3Y A;  2KZ7 A;  4PJ0 O;  3POX A;  1MM5 A;  3PF1 A;  1QJP A;  4FSO A;  4KR4 A;  4O49 A;  4O4U A;  3C5O A;  4QQ1 A;  5ADX L;  1ORM A;  4JFB A;  5B66 O;  4RLC A;  3K19 A;  4AYN A;  3KZI O;  3AA6 B;  1ZHX A;  3DZM A;  3HWB A;  2FGQ X;  3O0E A;  2XE2 A;  5ADX K;  6PRN A;  4CTD A;  2XE1 A;  4KRA A;  4N59 A;  5D5D A;  4C4V B;  2WJQ A;  4AKR B;  4E1T A;  4AYE C;  3POR A;  5DL6 A;  3DWO X;  3VY8 X;  3LK2 A;  1ZHY A;  3WI4 A;  2KXP B;  3SYS A;  3VE2 A;  5TIS O;  2J1N A;  2FGR A;  3SY7 A;  3TZG A;  2JQY A;  2R4N A;  3SZD A;  2JMM A;  1IZN A;  2YPV A;  1P4T A;  4AUI A;  3PQU A;  4FZL A;  3AA0 B;  3G7G A;  3POQ A;  3AAE B;  5DL8 A;  3SZV A;  4K3B A;  3DA4 A;  3HOL A;  4PUX A;  4C00 A;  2R88 A;  3QRC A;  2O4V A;  4GCS A;  1MPF A;  4AKM A;  4AYM C;  2ODJ A;  3PGR A;  1QJ9 A;  1PRN A;  1GFN A;  2KZ7 B;  2W80 C;  4JCH A;  4FES A;  4PR7 A;  2R4O A;  4AFK A;  4LSE A;  3WI5 A;  3T20 A;  4XNL A;  4IL6 O;  3VE1 A;  3GP6 A;  2ZLD A;  3LK4 1;  5GV0 A;  3T24 A;  1OSM A;  1T1L A;  1MM4 A;  2LFU A;  5G3A A;  2J4U P;  3SYB A;  3KVD D;  3JTY A;  4LSF A;  1ZHZ A;  4RJX A;  3BS0 A;  3A2S X;  1PHO A;  2LHF A;  3WU2 O;  1BXW A;  2R8A A;  2XMX A;  2M06 A;  2N2L A;  3AAA B;  1OPF A;  4BUM X;  3EMN X;  2F1T A;  5G38 A;  4K3C A;  2F1V A;  3LK2 B;  4Z3T A;  2W81 C;  4RLB A;  4GCQ A;  1S5L O;  3VZW X;  4UB6 O;  1GFM A;  4G76 A;  2XTR A;  2XG6 A;  3T0S A;  3V8U A;  1BT9 A;  2Y7S A;  5AFU K;  1HXX A;  2XE5 A;  3HOE A;  5GTI O;  2Y0L A;  4RJW A;  4FQE A;  2IWW A;  4N58 A;  2ERV A;  2R89 A;  1ZHW A;  4FZM A;  5DL5 A;  5FVN A;  3LK3 A;  1IZN B;  1YS5 A;  3AA1 A;  2OMF A;  4F4B A;  4O3W A;  3RBH A;  3VY9 X;  4AYI D;  3POU A;  3SY9 A;  4U9C A;  2KXP A;  4N75 A;  2XTQ A;  1GFQ A;  5KAI O;  2POR A;  2R4L A;  3JCU O;  3PGS A;  3AA7 A;  3VZU X;  4O3Z A;  2K4T A;  5E79 O;  2N2M A;  2KC0 A;  4FSP A;  2GE4 A;  4D65 A;  2WJR A;  3PRN A;  2AXT O;  2PRN A;  4FZN A;  3FYX A;  3BRY A;  3QRA A;  1ZHT A;  1QJ8 A;  5GTH O;  1HXT A;  4B61 A;  5EE2 A;  2X9K A;  4O4X A;  3NJT A;  2Y0K A;  2KDY A;  3DWN A; 
#chains in the Genus database with same CATH homology
 4UB8 O;  5GTI O;  5B66 O;  5G39 A;  3KZI O;  4IL6 O;  3A0H O;  5KAI O;  5G3A A;  3JCU O;  3A0B O;  5B5E O;  5E79 O;  3WU2 O;  2AXT O;  5TIS O;  5GTH O;  5G38 A;  5KAF O;  5H2F O;  4PJ0 O;  1S5L O;  4UB6 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...