4UB8O

Native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
243
structure length
243
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem Q(B) protein
total genus 56
structure length 243
sequence length 243
chains with identical sequence o
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 4ub8O01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 4ub8O02
5KAIO 5B5EO 1S5LO 3A0HO 5G38A 3JCUO 5G3AA 5H2FO 3A0BO 5G39A 3KZIO 2AXTO 5B66O 4UB6O 5GTHO 4UB8O 3WU2O 5TISO 4PJ0O 5KAFO 4IL6O 5E79O 5GTIO
chains in the Genus database with same CATH superfamily
3VE1A 5KAIO 3AA1B 4K3BA 3T24A 1ZHWA 2XE1A 4RLCA 1OPFA 2M07A 2WVPA 1ZHXA 3AAAB 3BS0A 3FYXA 4C4VA 5AFUK 1G90A 1HXUA 5D5DA 3POQA 5DL5A 2JQYA 3PGRA 2ODJA 4FZMA 2LHFA 2MNHA 4AFKA 3PORA 1BXWA 4GCSA 2R4NA 3BRYA 4GF4A 4RL9A 2R4PA 2OMFA 4K3CA 4JCHA 4O3WA 1BH3A 3O0EA 5FVNA 2AXTO 2X9KA 4KR4A 5GV0A 3VY9X 2F1CX 1THQA 5B66O 4G75A 4UB6O 5EE2A 4UB8O 1MM4A 3PQSA 4O3ZA 4CTDA 2YNKA 1ZHTA 2ERVA 5E79O 3AA7B 3AAEA 4N58A 4O3XB 4FUVA 2N2LA 2F1VA 3SYBA 1PHOA 4O4UA 3LK2A 5DL6A 3C5OA 4PR7A 3RBHA 3SYSA 2XMXA 4AYDC 4B61A 2R88A 2XE3A 4PUXA 4FQEA 4O4XA 4FRXA 2JMMA 1S5LO 1OSMA 4FZNA 4LSEA 1T1LA 4FMSA 2IWVA 1H6S1 2MHLA 3A0HO 4FRTA 1MPFA 2KZ7A 3UPGA 2KXPA 3AA6A 3JCUO 3PGUA 2GE4A 2FGQX 3LK3B 3A2SX 1P4TA 3A0BO 4RLBA 5AFUL 3AAAA 5DL7A 2XTRA 4AKRA 4C4VB 5B5EO 3GP6A 4FESA 3LK41 4Z3TA 5G39A 1HXTA 2XE5A 4GCQA 5DL8A 3HOEA 2N2MA 1HXXA 3K19A 4FZLA 3WU2O 3KVDD 4GCPA 2Y0HA 4FT6A 4BUMX 4PJ0O 1GFOA 4KRAA 2QTKA 3UAQA 1E54A 4F4BA 5GTIO 3DWOX 5T5FA 1ZHYA 4N59A 2KC0A 3PQUA 4E1SA 8PRNA 4D64A 3V8UA 2YPVA 2R8AA 4N75A 2W81C 4O3YA 3WI4A 2IWWA 1Q9GA 4AUIA 2Y0LA 1IZNB 2ZFGA 2M06A 3AA6B 3LK3A 4LSFA 2Y2XA 6PRNA 5ADXL 2J4UP 4N74A 3AA1A 2Y7SA 3HWBA 3POXA 2FGRA 1GFMA 4XNLA 3AA0A 5H2FO 3PF1A 4JFBA 4C00A 3LK42 3VZWX 3NSGA 7PRNA 3NJTA 1GFPA 2XG6A 1YS5A 2XTQA 3KZIO 4RJXA 4G76A 4QQ1A 4AYEC 3VY8X 3SY7A 4FOZA 5G26A 2LFUA 3DA3A 4AKRB 1T16A 3BRZA 2R4LA 2ZLDA 1ZHZA 4LSHA 4U9CA 3WI5A 4AYMC 3VE2A 4O49A 2R89A 4LSIA 4XNKA 3TZGA 4C69X 2PRNA 4KR8A 3DZMA 2XE2A 2PORA 3DWNA 4E1TA 1PRNA 2W80C 3JTYA 3VZUX 3AAEB 3AA7A 3EMNX 3SY9A 4AYNA 3HW9A 5IYUA 3AA0B 3SZDA 1BT9A 2O4VA 3LK2B 5PRNA 3PRNA 5G38A 4GHBA 5G3AA 3VZTX 1GFNA 1MM5A 3T20A 2K0LA 1ORMA 3T0SA 2J1NA 2K4TA 3SZVA 4AKMA 2R4OA 3QRAA 3HOLA 4FSPA 2KDYA 3G7GA 1QJPA 1QJ8A 2Y0KA 2F1TA 1Q9FA 4D65A 3PGSA 4FSOA 4RJWA 2WJQA 5GTHO 3POUA 5TISO 4AYID 3UU2A 1QJ9A 2WJRA 2X27X 4IL6O 5KAFO 3QRCA 4AZLA 1IZNA 5JDPA 4D5UA 5ADXK 2KZ7B 3DA4A 1GFQA 2KXPB
chains in the Genus database with same CATH topology
5KAIO 5B5EO 1S5LO 3A0HO 5G38A 3JCUO 5G3AA 5H2FO 3A0BO 5G39A 3KZIO 2AXTO 5B66O 4UB6O 5GTHO 4UB8O 3WU2O 5TISO 4PJ0O 5KAFO 4IL6O 5E79O 5GTIO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAI O;  5B5E O;  1S5L O;  3A0H O;  5G38 A;  3JCU O;  5G3A A;  5H2F O;  3A0B O;  5G39 A;  3KZI O;  2AXT O;  5B66 O;  4UB6 O;  5GTH O;  4UB8 O;  3WU2 O;  5TIS O;  4PJ0 O;  5KAF O;  4IL6 O;  5E79 O;  5GTI O; 
#chains in the Genus database with same CATH topology
 3VE1 A;  5KAI O;  3AA1 B;  4K3B A;  3T24 A;  1ZHW A;  2XE1 A;  4RLC A;  1OPF A;  2M07 A;  2WVP A;  1ZHX A;  3AAA B;  3BS0 A;  3FYX A;  4C4V A;  5AFU K;  1G90 A;  1HXU A;  5D5D A;  3POQ A;  5DL5 A;  2JQY A;  3PGR A;  2ODJ A;  4FZM A;  2LHF A;  2MNH A;  4AFK A;  3POR A;  1BXW A;  4GCS A;  2R4N A;  3BRY A;  4GF4 A;  4RL9 A;  2R4P A;  2OMF A;  4K3C A;  4JCH A;  4O3W A;  1BH3 A;  3O0E A;  5FVN A;  2AXT O;  2X9K A;  4KR4 A;  5GV0 A;  3VY9 X;  2F1C X;  1THQ A;  5B66 O;  4G75 A;  4UB6 O;  5EE2 A;  4UB8 O;  1MM4 A;  3PQS A;  4O3Z A;  4CTD A;  2YNK A;  1ZHT A;  2ERV A;  5E79 O;  3AA7 B;  3AAE A;  4N58 A;  4O3X B;  4FUV A;  2N2L A;  2F1V A;  3SYB A;  1PHO A;  4O4U A;  3LK2 A;  5DL6 A;  3C5O A;  4PR7 A;  3RBH A;  3SYS A;  2XMX A;  4AYD C;  4B61 A;  2R88 A;  2XE3 A;  4PUX A;  4FQE A;  4O4X A;  4FRX A;  2JMM A;  1S5L O;  1OSM A;  4FZN A;  4LSE A;  1T1L A;  4FMS A;  2IWV A;  1H6S 1;  2MHL A;  3A0H O;  4FRT A;  1MPF A;  2KZ7 A;  3UPG A;  2KXP A;  3AA6 A;  3JCU O;  3PGU A;  2GE4 A;  2FGQ X;  3LK3 B;  3A2S X;  1P4T A;  3A0B O;  4RLB A;  5AFU L;  3AAA A;  5DL7 A;  2XTR A;  4AKR A;  4C4V B;  5B5E O;  3GP6 A;  4FES A;  3LK4 1;  4Z3T A;  5G39 A;  1HXT A;  2XE5 A;  4GCQ A;  5DL8 A;  3HOE A;  2N2M A;  1HXX A;  3K19 A;  4FZL A;  3WU2 O;  3KVD D;  4GCP A;  2Y0H A;  4FT6 A;  4BUM X;  4PJ0 O;  1GFO A;  4KRA A;  2QTK A;  3UAQ A;  1E54 A;  4F4B A;  5GTI O;  3DWO X;  5T5F A;  1ZHY A;  4N59 A;  2KC0 A;  3PQU A;  4E1S A;  8PRN A;  4D64 A;  3V8U A;  2YPV A;  2R8A A;  4N75 A;  2W81 C;  4O3Y A;  3WI4 A;  2IWW A;  1Q9G A;  4AUI A;  2Y0L A;  1IZN B;  2ZFG A;  2M06 A;  3AA6 B;  3LK3 A;  4LSF A;  2Y2X A;  6PRN A;  5ADX L;  2J4U P;  4N74 A;  3AA1 A;  2Y7S A;  3HWB A;  3POX A;  2FGR A;  1GFM A;  4XNL A;  3AA0 A;  5H2F O;  3PF1 A;  4JFB A;  4C00 A;  3LK4 2;  3VZW X;  3NSG A;  7PRN A;  3NJT A;  1GFP A;  2XG6 A;  1YS5 A;  2XTQ A;  3KZI O;  4RJX A;  4G76 A;  4QQ1 A;  4AYE C;  3VY8 X;  3SY7 A;  4FOZ A;  5G26 A;  2LFU A;  3DA3 A;  4AKR B;  1T16 A;  3BRZ A;  2R4L A;  2ZLD A;  1ZHZ A;  4LSH A;  4U9C A;  3WI5 A;  4AYM C;  3VE2 A;  4O49 A;  2R89 A;  4LSI A;  4XNK A;  3TZG A;  4C69 X;  2PRN A;  4KR8 A;  3DZM A;  2XE2 A;  2POR A;  3DWN A;  4E1T A;  1PRN A;  2W80 C;  3JTY A;  3VZU X;  3AAE B;  3AA7 A;  3EMN X;  3SY9 A;  4AYN A;  3HW9 A;  5IYU A;  3AA0 B;  3SZD A;  1BT9 A;  2O4V A;  3LK2 B;  5PRN A;  3PRN A;  5G38 A;  4GHB A;  5G3A A;  3VZT X;  1GFN A;  1MM5 A;  3T20 A;  2K0L A;  1ORM A;  3T0S A;  2J1N A;  2K4T A;  3SZV A;  4AKM A;  2R4O A;  3QRA A;  3HOL A;  4FSP A;  2KDY A;  3G7G A;  1QJP A;  1QJ8 A;  2Y0K A;  2F1T A;  1Q9F A;  4D65 A;  3PGS A;  4FSO A;  4RJW A;  2WJQ A;  5GTH O;  3POU A;  5TIS O;  4AYI D;  3UU2 A;  1QJ9 A;  2WJR A;  2X27 X;  4IL6 O;  5KAF O;  3QRC A;  4AZL A;  1IZN A;  5JDP A;  4D5U A;  5ADX K;  2KZ7 B;  3DA4 A;  1GFQ A;  2KXP B; 
#chains in the Genus database with same CATH homology
 5KAI O;  5B5E O;  1S5L O;  3A0H O;  5G38 A;  3JCU O;  5G3A A;  5H2F O;  3A0B O;  5G39 A;  3KZI O;  2AXT O;  5B66 O;  4UB6 O;  5GTH O;  4UB8 O;  3WU2 O;  5TIS O;  4PJ0 O;  5KAF O;  4IL6 O;  5E79 O;  5GTI O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...