3AAEB

Crystal structure of actin capping protein in complex with carmil fragment
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
264
structure length
264
Chain Sequence
DQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-1
publication title Two distinct mechanisms for the regulation of actin capping protein-competitive or allosteric inhibitions
rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 80
structure length 264
sequence length 264
chains with identical sequence D, F, H, J
ec nomenclature
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aaeB01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aaeB02
1IZNB 3LK3B 2KZ7A 3AA0A 3AA6A 2KXPA 2KZ7B 3AA0B 3AAAA 4AKRA 3AAEA 3AA6B 5AFUL 2KXPB 3AAAB 3LK2A 3LK42 3AA7A 3AAEB 4AKRB 3AA1A 3AA7B 5AFUK 3LK41 5ADXL 3LK2B 3AA1B 3LK3A 1IZNA 5ADXK
chains in the Genus database with same CATH superfamily
5AQTB 2DI4A 1B7TA 3KDSE 2VL8A 3EMNX 3IHRA 4CI1B 5B66O 4JI4T 2K3WA 1FEWA 4BAYB 3LG7A 3ZYKA 4YXDA 8PRNA 2PG8A 2KC0A 2WU2A 2A9UA 3VY9X 3RIUA 4B3TT 4HN9A 2MOZA 4KHPT 2CLYC 4E7ZA 5H6QB 3KVBA 3UPGA 5LJNA 2W00A 2PFVA 2Z6EA 3VE2A 4Z90A 2NW7A 4TX5A 3FBZA 4EZHA 5L4EA 3HKBE 3AA6A 4EYYR 2Y2XA 1ZV4X 1N33T 2UXXB 4B3ST 3VZWX 3KV4A 4FZLA 1MMGA 3KFWX 3RH3A 4OYKA 3N9LA 3OYZA 3SOLA 3I0QA 2R89A 2DL1A 1HXUA 3PORA 5FXXA 4AIUA 4ISSA 4D64A 1UX5A 1WYCA 4JYAT 3P7IA 2NTXA 4E1TA 1SUMB 2X66A 2ZLDA 2M6BA 5JDMA 1OEDC 3C4ZA 3DA3A 4BJNA 3ZEFB 3VHLA 1GFOA 5JR9B 5M4YA 4FOZA 2W67A 3I1AA 4COFA 1CUNA 2FJBA 4DV5T 3C4WA 2CBIA 3RRCA 2A3DA 3POXA 4UR9A 2LRKA 3C5OA 2WJRA 4DIDB 2L8KA 4P1NA 4N75A 3P4QA 4HFVA 4KRAA 3GMIA 4YTNA 4X1YE 4IDOA 3HWBA 2JIWA 4TN7B 4H9NC 2Y48B 2V7JA 3AAAB 1YQ3A 3L3PA 4P0BA 4AKLA 3C51A 1BR2A 5AQSB 1LVKA 2WDQA 3UUMA 4AFKA 3UUNA 3PRNA 2BG9C 3OJAA 3OYXA 1UX4A 2MBGA 4EV6A 2J47A 1VCSA 4O2BE 1MMNA 4QQ1A 4WZXA 2LLYA 3QK6A 4FSPA 4WBOA 1E7PA 3PJAA 4N58A 2CXLA 2AXTO 5JDHA 4I43B 3SS1A 3ZMVB 2R4PA 4YY3T 3PUGA 5AQHB 2QA7A 3HA4A 2KMFA 5EE2A 2JQQA 2WU5A 1LKXA 1KNRA 1FMWA 2KT9A 2QYWA 5E79O 4C00A 4N59A 3NZPA 4G76A 3PUVF 2C5IT 4X62T 3B5MA 3QNUA 5LHHB 5LP6E 2AE9A 1BR4A 3K1SA 3HKEE 1SHZC 2F1CX 5JRCB 2GE4A 3DA4A 2FJEA 2R4LA 1HNZT 5LOVE 5LA6E 1MM5A 2C0SA 4LMLA 4AKRB 1Q9FA 3Q5WA 4H63V 3PUYF 5IWAT 3WAKA 1BXWA 2E8IA 4GYSA 2XHEB 2RP4A 5B5EO 3FXDB 3OVUA 5BMVE 1MPFA 4AZLA 1T8BA 3L39A 4B61A 3ZPOA 4CXWA 2LHRA 2H3RA 3SYSA 3ONJA 4A5XA 5DQVA 1QJ8A 2BVMA 4FRXA 3AEGA 2XQ5A 4AQFA 2QTKA 4UF0A 4KMCA 4KI0F 2W80C 3KVDD 1WCRA 1YW0A 4ZI3C 1HCIA 2K0LA 4IDNA 5EZYE 3ZMZB 4ZZCA 4DV6T 4D65A 5HCJA 2JMHA 3AA6B 3SYBA 4LSFA 5ADXL 3GN5A 3NBXX 3TLSA 1S94A 5AQQB 2DHRA 1S35A 1WLXA 2VASA 3L09A 2CM0A 4UVAB 3CKDA 5JREA 4DV7T 3F2EA 5A1LA 3T24A 4MFRA 3AA1A 2GK9A 3EDVA 1OXZA 2YKSA 2OMFA 2E9XA 3AEBA 2MTQA 4K0UA 2XY8B 4YFSA 4ILAA 4LFBT 2CCQA 2DCFA 4DUZT 4LF8T 1ORMA 4D5UA 3NVOA 3PU8A 5JDLA 3MKDA 3KBTA 3FB2A 3W15B 3RYCE 2CRBA 3ZMTB 5L47A 1G73A 2XZEA 1L0VA 4CTDA 1FIOA 1HX8A 2CPTA 4EEBA 3UUXB 3N9NA 1ZP0A 2X9KA 4AYNA 2XUEA 2V6YB 2IDOB 2ZMAA 5CGMA 1ZHYA 3PQSA 5LMNT 3K3NA 1HF8A 2LOPA 4LF7T 4QH5A 5C3JA 1IBMT 1ZHWA 4PFOA 5KAFO 2J4GA 2CLYB 5HEUA 2DWGA 4LSIA 3UFEA 2NWBA 4A56A 4AKIA 2JQHA 4YT0A 2XSAA 1NENA 4KUMB 4EGWA 5G39A 1Z8UA 3PF1A 2BDEA 5FVLA 3UU4A 3RF1A 1WR6A 3LK41 2LSIA 2W0GA 1HXXA 3OKQA 5G26A 2RPAA 3H3MA 5KMGP 4FQEA 3I9WA 2XAFB 4HFDA 3VU7H 3KBUA 3K8PC 3VY8X 1X79A 4CXXA 1Y01A 4GCQA 4AYMC 3RYIE 5IUXA 3JADA 4GOUA 2NR4A 1NWMX 1P4TA 2UXNB 4LF4T 4AKHA 1M62A 4TV8E 4NUVA 4U31A 3BK9A 3UU2A 5JDGA 2V6XA 3UU8A 3LK3B 2XMXA 2D2SA 3SFDA 4EYUA 3IBPA 2V1DB 2JMMA 4YSXA 4QKNA 4EB6E 4IE6A 3CVRA 3O1HA 1NAFA 3SZDA 3KV6A 1KNPA 4LSEA 1T98A 5AQNB 4JI1T 1IZNA 1JNZA 2XQYA 4ILUA 4ZEYA 1OPFA 5ADXK 4YTPA 4HWIB 5ABFA 2VURA 1ZHXA 4UF0B 1IBKT 4FSOA 3RIUC 4U7YA 2BG9B 5HXCA 4AQGA 4UB6O 5EK2A 4O2AE 2EHOA 4LF9T 4H9RC 1XMQT 4ZI3D 1UCUA 3UTKA 4DBQA 4CN1A 3Q5DA 1HX1B 3T8OA 3R6NA 4CQIA 2VK9A 2WDRA 5AFUL 3ZT5A 4XZCA 5J0ZA 2IWWA 5LB7B 2Y0LA 5IHYA 3AA1B 3AEDA 4N78D 4FI5A 3FZLB 4PUXA 2HN2A 4KP3C 4HWDA 3DP7A 2N2LA 5GTHO 2YEVC 2IMLA 1YKHB 4EEDA 4F4BA 1BR1A 3CQCB 2XAGB 4DV0T 2VB6A 3BQIA 1Q9GA 4AUIA 1E2AA 2MPKA 1FMVA 4O49A 5GONE 1ZOYA 2B1EA 2XTLA 3P4WA 3QOFA 2LJLA 4ADZA 5ETWA 5AQVB 3AE4A 1UURA 3AE7A 1VCTA 3B13A 3ZSTA 2V7LA 3AXJB 3VRAA 4L5GA 2R88A 3SY7A 4V1Av 2J1NA 4IDQA 3AEEA 4QXHB 4PJNA 1YS5A 2XPKA 1MIVA 3AEAA 3MXZA 4FZNA 3ESLA 2KWIB 4PAGA 2WBLA 4ZOLE 5LGUB 3QC9A 5C2TA 2IW5B 2L9QA 3HW9A 4C91A 4L9IA 4TWHA 2D0UA 4HFCA 3UFGA 3RQWA 2V7KA 2FBWA 3CIRA 3T0SA 2WMNA 4KR4A 1WRDA 2K24A 2ZM8A 3AE3A 3JTYA 4AQYT 5LHGB 2K48A 4L0RA 1XDOA 2MNHA 2M06A 2Y0HA 3UAQA 3AVSA 3O0EA 4HFHA 3WI3A 1HNXT 3HR0A 3LBXA 4UV8B 3UU3A 2QRXA 2F4VT 4GCSA 1WFDA 1KFYA 4FRTA 3PQUA 1N34T 2KNDA 2W81C 2Q9QA 1UGOA 2JRKA 2XAJB 3FXEB 4G75A 4EOZB 3PUSA 2R4NA 1OEDE 5JH7E 2AXDS 3PV0F 4U74A 3QB5A 4PJMA 1J1JA 3BS0A 4YSZA 2BS4A 2WWUA 2WSSV 1IZNB 2I0MA 3LJCA 2FGQX 3PU3A 3ZN1B 4AQFC 2LEHA 1XWMA 5FXWA 5H2FO 4ZXLA 3V5UA 4KR8A 5AFUK 4C4VB 1UK5A 3BQLA 4YJ3E 5CFBA 4TWFA 2YDSA 2EHOB 1HG5A 3P4SA 2N1GA 4DR4T 4HWHA 4AYEC 2LSYA 2N2MA 4JI2T 4DV3T 2X9XA 2BG9E 5IYZE 5HWXA 4CI3B 2D9DA 2WZIA 5F8PA 4U9CA 5ABEA 2PBIA 5HCMA 2UUBT 4U3CA 3E0ZA 2MAWA 2J62A 3QRAA 2P9BA 3CX8B 2E9XC 2X9WA 2YPVA 1HG2A 3N2GE 4A97A 4Z8XA 3LDQB 4X1KE 4NXNT 4JEUB 2JPFA 3JC6C 3N9QA 1YXRA 2IUBA 4DV4T 2BKOA 3Q5EA 5FP3A 5KDMC 1N36T 3ZC0A 2WWVA 3I9YA 2PTFA 1QSDA 4PNIA 3HL6A 4QX7B 4GKKT 1ZHZA 4PK6A 3A0BO 4BJMA 1I94T 2WZHA 4ILCA 2NW9A 2ZM0A 3AVRA 5DL5A 4I55E 2IHR1 4JI8T 1S5LO 3T1YT 4WBNE 1XMOT 4DR5T 1CHUA 2KDYA 4JLEA 3MA9A 5LBQB 3FZHB 4N74A 2KZ7A 3RYFE 4O4XA 5F3JA 3PGSA 2VQFT 3UU5A 4MALA 1GFQA 2KINB 2XE5A 3RI5A 2KLQA 5ABGA 3ZN0B 5LG4A 3C98B 3PUXF 4CN4A 4OK0A 1G8XA 2PRNA 3FBLA 3RQUA 4HWFA 2XQ7A 1YKEB 2YDQA 2V8SV 2WVPA 4EIWA 3LBXB 4QWNB 4ANJA 2XG6A 2FJAA 5LG3A 1XNQT 2X67A 2X51A 5FKYA 3P8CD 2X68A 3ZC1A 3Q5XA 2R6GF 1HNWT 2Q9QB 3TZGA 3TLWA 2XQ6A 3PUQA 3PGRA 2YOEA 1IJ5A 2VKJA 2QVAA 1R8IA 3ZJ2A 3LK2A 2R4OA 4ZI7E 3AE6A 3ETUA 3GP6A 3RHWA 1PHOA 2F1VA 3CK6A 3QUJA 2JQKA 3VRBA 5JDPA 1LVFA 3IEEA 4OHFA 2XSBA 1Z0PA 3RBHA 2LHFA 2A72A 5HXHA 2PJQA 4TUYE 5AQRB 3NWIA 4PK4A 2C5KT 5CJ5A 5HEJA 4IL9A 3U3IA 4FJOA 2VKHA 2BKNA 5LCYA 1ZHCA 2D5UA 5FNVE 2IIUA 4H63H 1T72A 4ASKA 2YDRA 2EHOC 4AI6A 4JI6T 3TLTA 2J4UP 3N2OA 1OWAA 4HE8A 2CWOA 3Q2MA 2CE7A 3UQ4A 4RLCA 4ILBA 3KV9A 4MBQA 2LM9A 4HTEA 4IDZA 4JI0T 5HEOA 3MZKB 4OX9T 1D1CA 1VOMA 3EDUA 4QX8B 1QUUA 2WM9A 2IAKA 5DL6A 5E0OA 1T16A 2K9AA 4HGAA 4Z91A 4BA9A 3KV5A 4OYJA 1BH3A 2DNXA 4XNLA 3SFEA 3ANWA 4JI5T 3V8UA 4H9PC 5J2TE 2E9XD 3ZLIA 3LSVA 4X20E 2ACZA 3G06A 3ZMUB 3F31A 2BZBA 5JVDE 3VR8A 5LGTB 3JC6D 3OBVE 4DR3T 4OFZA 3N2KE 3QB5K 4AKGA 5CA1E 2W4XA 1D1BA 2XASB 2ZLYA 3J9X1 3AAEA 2X9YA 2H89A 1X9BA 2HPJA 2W63A 2ODVA 4ISTA 1XZYA 3QRCA 5J1GA 5JR9A 3VKGA 4DNDA 4KBMB 4DR1T 4NPPA 2WB5A 4H9QC 3J7Yq 5DL7A 4U2ZA 1O3XA 2KZ7B 2XJ7A 4ZI2C 1OSMA 3U78A 3IA3A 4PJLA 3A0HO 3TKLB 3P4PA 4K3CA 3C4XA 3E22E 3RC3A 4CZZB 5BR8T 3ZJ1A 4LF5T 2BBJA 2ES0A 3T1HT 4MLKA 2VKDA 4B3MT 3GN5B 4HFEA 4UXNB 3LFMA 4PJJA 1BR0A 2KXPA 3HKDE 2WAUA 4P09A 3A8YC 2I59A 3AE2A 3ETVA 2YN6A 4B3RT 4XBFB 3RIFA 2XAHB 5DABA 5HEHA 4TWDA 1IBLT 3O4XE 2YU1A 2F1TA 3O1JA 2LT3A 5KX5E 2E9XB 5HEGA 5ABHA 1I6ZA 1HFAA 4C69X 2Q9QC 1MNEA 3DWOX 4F8HA 4WNKA 2YK0A 4FUVA 4P0AA 4IT4A 1XDPA 1KF6A 4GIWA 1KNZA 3ZCIA 3ONLC 2OLTA 4JUYA 5GV0A 3S4UA 4UVBB 1N32T 1GFNA 4AYDC 5T5FA 5JDQA 2M07A 5C8YE 5CA0E 4WW0A 1T7SA 2WP9A 2LSKA 4X1IE 3TLVA 3HOLA 4XAXB 1E54A 1HS7A 5TISO 2KWHA 3JCFA 3CWZB 5J2UE 5KXJA 2I6HA 4FT6A 2W2UA 5HXRA 5FMNA 5L4HA 3WU2O 2IWVA 4AKRA 1ZHTA 5L3CB 2XM1A 4K3BA 2ERVA 2VKOA 4XNKA 2N9DA 3G7GA 4JCHA 2JQ9A 4PW8A 1QJPA 5HAXA 4DV1T 5PRNA 3NKZA 1D0XA 2X27X 3KINB 4IGUA 3AECA 4YJ2E 1YQ4A 2EHOD 4HFIA 4DBRA 4FESA 1GFPA 3PUWF 4JI3T 4ZHQE 4UV9B 4O4IE 1QLBA 3DTOA 3MACA 4HEAA 2HN1A 3EUHA 1NEKA 5EK3A 4AYID 3EABA 2D0TA 5F5WA 3GA8A 3UT5E 2W62A 2L3LA 3K19A 5L3FB 3PJAJ 1Y64B 4I50E 4IE5A 2XE3A 1GQEA 2WJQA 3SRZA 4K0KT 5IYUA 3I0OA 3AA0A 5EK4A 3ANWB 2R8AA 2K5BB 4ERRA 5AQMB 3SY9A 4X65T 3NRXA 1D0YA 4JFBA 4IDPA 4AXPA 1PRNA 3OPCA 7PRNA 3FYXA 2RA1A 3BRZA 4RJXA 1DU2A 3DWNA 2C5JA 5L3GB 3AE5A 2QGSA 4DO0A 4TNWA 4EXTA 3O1IA 5HXSA 1AJ3A 3AAEB 1ZEEA 3RRWA 4HFBA 4DVDA 4O3YA 3RKGA 4GCPA 2ODUA 1US7B 4U72A 2LE8A 2WCAA 2VQET 2LHNA 5ABFB 4TV9E 5LHIB 1H7CA 2HPLA 1D0ZA 1G90A 4A98A 4PFPA 4E7SA 2NOXA 3C64A 5D5DA 5AQUB 2V7IA 4AISA 3N5LA 4H9OC 4CXYA 3FHNA 2E2AA 4QHOA 4PR7A 3MK7C 1J5WA 4IE4A 3EAMA 4LSHA 2YU2A 4Z3TA 4ZI2D 3CX6B 3CQXC 2VWAA 2CWYA 1HXTA 2LOSA 4O3WA 2KXPB 4YSYA 2CXFA 5FYMA 2NP9A 2V6YA 3OTOT 4G63A 2JQYA 4PJ0O 3ZYMA 2PORA 1JNRA 2G0UA 2M6IA 5JDFA 3BRYA 2J1DG 1MIWA 2V5DA 2Y0KA 3SZVA 3E08A 4QH4A 1MIYA 3ZMSB 2LKHA 1MNDA 4EZ4A 4YHHT 3UQ7A 2MYSA 4M1PA 4IREA 1WYBA 1V9DA 3CQGB 2BS2A 2X0HA 3JAEA 2UUCT 2Q9QD 4KHZF 3R84B 4DR7T 3PDYA 2LM2A 5LYJE 2JMKA 3Q9DA 4UB8O 4UIGA 1GFMA 3VZTX 4IHJE 3ZT6A 3GWHA 3K3OA 3PE0A 3BQKA 4X5TA 1EZ3A 1OEDA 1MMAA 5FL0A 2W66A 1KK7A 3L8RA 2NW8A 2LSGA 4JEHB 1IJ6A 2Y6XA 3CX7B 4GK0E 1QJ9A 3ZSSA 3HKCE 3POQA 4YLHA 3K3QC 2B76A 3B57A 4DUYT 6PRNA 3NRYA 2SPCA 4TZ4C 1W0BA 3EI0A 3UULA 3LK3A 4AKMA 2CMRA 4GK5E 5AQLB 2UUAT 1XNRT 4X66T 4O4UA 5TAOA 5AQJB 2YNKA 5L3BB 5FXVA 4O4LE 2X0LB 3RYHE 3WI4A 4DR2T 3ZCJA 5LMUT 3WAJA 4O4HE 2BKPA 3IF8B 3N9MA 3HOEA 2ZFGA 4WYVA 2XM2A 2MHLA 5LGNB 2V5CA 3PGUA 2XQ3A 2NTYA 5LJMA 3AA0B 2BG9A 3DZMA 3UU6A 4DMWA 3AA7A 1BT9A 1E1HB 4QH1A 5L2LA 3ZT7A 4QXCB 2WDVA 4BUMX 2K4TA 4GHBA 4KX6A 4HKAA 5DJQC 1UUSA 2VVSA 3PUAA 2UXDT 3KVAA 2HHHT 3VZUX 2FUPA 2UXBT 3O9XA 4O3ZA 3FZFB 1T1LA 3ABVA 5FVNA 2WY2A 4TNVA 4E1SA 2V26A 2FJDA 2E5LT 4YTMA 1MMDA 4JV5T 3POUA 4U33A 2N2NA 5AQKB 2ZM6T 3A5XA 3VKHA 1U4QA 2BBHA 3JCUO 2KSRA 3LK42 5JR9C 4X64T 2XE1A 4CN6A 3RKOA 4O3XB 1SA0E 5FY0A 1HR0T 3CMLA 4U2YA 2ZM2A 4HWCA 3KZIO 4ZZBA 5FY1A 3AAIA 3AXJA 3CPZA 5AQFB 2LSJA 4LMKA 3RC8A 1M7KA 5AQPB 2UXCT 5CB4E 4U7IA 4ZS3A 1LRZA 3AEFA 4IL4A 5G3AA 3HI2A 2VVNA 3RLFF 4RJWA 3N9PA 3ZKRA 3PUZF 5HXEA 2XE2A 3P50A 2DLRA 4CI2B 1U5PA 4B6XA 3P4RA 3NSGA 4I0UA 4I4TE 4FMSA 1HTJF 3NZQA 3RIAA 3EVYA 4FZMA 2BS3A 2CHNA 3MJXA 3RGLA 5HYAA 1ZKEA 5FXZA 3T20A 3JAFA 2OA5A 4C90A 4PK5A 5JDNA 2XTQA 3C50A 1W9RA 3AE9A 1D1AA 4JI7T 1OEDB 4H9SE 2YINA 3M65A 3NJTA 4O8SA 3H3AA 1THQA 3UUBA 5AQIB 5DQWA 4F6RC 2DWKA 4NXMT 3FZKB 4RL9A 2LKGA 5HWYA 3F57A 2VL0A 1IAPA 2V7MA 1MM4A 2M67A 2E5VA 2IC9A 2XAQB 2XTRA 5LNKA 2BVLA 3ONXA 4DR6T 5G38A 2O4VA 2CBJA 2CXDA 3H37A 1KEYA 4GKJT 4EAHA 1W0AA 4DV2T 4J2CA 2XQ8A 2Y8DA 2XQ9A 4UELA 3A7MA 5FVKA 4NUUA 4RLBA 3ZYLA 5L3DB 2FGRA 4UEMA 5L3EB 3D0TA 3RPUA 2ACXA 5KAIO 4IL6O 2WS3A 4DMVA 5JTGA 3AAAA 4LMJA 5FL1A 4C4VA 5AQGB 2OV9A 2LRLA 5H6RB 1FJGT 3DJBA 5FY7A 3AA7B 2X9HA 2UU9T 2Y7SA 4LFAT 4O4JE 4IE0A 4MHCA 4Q25A 3AE8A 2XQAA 2H88A 2LFUA 3M3ZB 1J5ET 2IC6A 4LF6T 2WQYA 4G2AA 4UVCB 1SE7A 5JQGE 4GYRA 4YHJA 2ODJA 5LXTE 3LK2B 2W61A 2H7VC 3FZMB 5AQOB 4ZS2A 3N9OA 5DL8A 3RX6A 2CEAA 4IIJE 5LBMA 3TLUA 2JJ9A 5JRCA 2HH7A 4QXBB 3WI5A 2X0YA 3VE1A 3PTRB 3SWHA 4LFCT 3EHZA 3V5SA 4IE7A 1H6S1 4JBWF 1VRBA 3AB3B 4GF4A 2CA5A 1YD8G 2WMOA 1W09A 2XQ4A 2CHOA 1WR0A 3X1DA 5GTIO 2H7OA 4NIQA 3PURA 3A2SX 3AE1A 2A2FX 3VR9A
chains in the Genus database with same CATH topology
5JDGA 2XMXA 3LK3B 2D2SA 3PUQA 5JDFA 2DI4A 1B7TA 3IBPA 3KDSE 2J1DG 2V1DB 4EYUA 2VL8A 1MIWA 2JMMA 3EMNX 2Y0KA 3SZVA 1IJ5A 3IHRA 3E08A 4QKNA 4CI1B 4EB6E 4BAYB 1FEWA 2VKJA 1MIYA 3LG7A 3ZMSB 3ZYKA 1MNDA 4EZ4A 3ZJ2A 4IE6A 3CVRA 3O1HA 3LK2A 1NAFA 4ZI7E 8PRNA 3SZDA 2MYSA 4M1PA 2PG8A 3ETUA 1WYBA 2KC0A 3KV6A 3GP6A 1PHOA 1V9DA 2F1VA 3VY9X 4LSEA 3CQGB 3QUJA 1T98A 1IZNA 4HN9A 3QRCA 1LVFA 2XQYA 4ILUA 2MOZA 1OPFA 2CLYC 5ADXK 4E7ZA 5H6QB 3KVBA 3UPGA 5LJNA 2W00A 2PFVA 2Z6EA 3IEEA 4OHFA 3VE2A 1ZHXA 4UF0B 2Q9QD 3R84B 2NW7A 4TX5A 1Z0PA 3FBZA 3PDYA 3RBHA 4EZHA 2LHFA 3HKBE 3AA6A 4EYYR 2Y2XA 1ZV4X 2UXXB 5LYJE 2JMKA 2A72A 3Q9DA 5HXHA 4E1SA 3VZWX 3KV4A 4FSOA 4FZLA 1MMGA 2PJQA 4TUYE 4UIGA 3KFWX 3RH3A 5HXCA 4PK4A 4OYKA 3N9LA 4AQGA 3OYZA 2C5KT 4IHJE 5EK2A 1GFMA 3VZTX 3SOLA 4O2AE 3GWHA 3K3OA 3PE0A 3BQKA 2EHOA 3U3IA 1EZ3A 3I0QA 4FJOA 2VKHA 1HXUA 5FXXA 3PORA 4D64A 1MMAA 4ISSA 4H9RC 1UX5A 4ZI3D 1UCUA 1WYCA 1KK7A 5LCYA 3P7IA 1ZHCA 2NTXA 2NW8A 2D5UA 2LSGA 3UTKA 5FNVE 4DBQA 3UU2A 4H63H 4JEHB 1IJ6A 4E1TA 3T8OA 4ASKA 2Y6XA 3CX7B 2X66A 3R6NA 4CQIA 2ZLDA 2EHOC 4GK0E 1QJ9A 2VK9A 5JDMA 4AI6A 5AFUL 3HKCE 4XZCA 2J4UP 3N2OA 1OWAA 4HE8A 4YLHA 3POQA 3C4ZA 3DA3A 3K3QC 2CWOA 3B57A 3Q2MA 4BJNA 6PRNA 3NRYA 2CE7A 3ZEFB 2Y0LA 3VHLA 2SPCA 4TZ4C 4RLCA 5IHYA 3AA1B 3UULA 4N78D 3LK3A 4FI5A 4AKMA 2CMRA 4GK5E 4PUXA 3KV9A 4MBQA 2LM9A 4HTEA 4IDZA 4KP3C 3DP7A 5TAOA 1GFOA 4O4UA 2YNKA 5L3BB 3MZKB 5FXVA 2N2LA 1D1CA 2YEVC 5JR9B 5M4YA 1YKHB 1VOMA 4O4LE 3I1AA 4FOZA 3EDUA 4QX8B 1QUUA 1CUNA 2WM9A 2IAKA 5DL6A 5E0OA 4F4BA 2X0LB 3RYHE 3C4WA 1BR1A 3WI4A 3RRCA 2K9AA 2A3DA 4HGAA 3ZCJA 4BA9A 3WAJA 3CQCB 2XAGB 4O4HE 2VB6A 3BQIA 3KV5A 3POXA 3IF8B 3C5OA 3N9MA 3HOEA 2ZFGA 4OYJA 2L8KA 1BH3A 2DNXA 1Q9GA 4XNLA 2MHLA 4AUIA 5LGNB 1FMVA 3ANWA 4O49A 2NTYA 5GONE 5LJMA 2B1EA 2XTLA 4HFVA 4KRAA 3GMIA 2LJLA 3V8UA 4ADZA 4H9PC 5ETWA 4X1YE 3AA0B 5J2TE 3HWBA 2E9XD 4TN7B 4H9NC 2Y48B 2V7JA 3ZLIA 4DMWA 3AAAB 3L3PA 3B13A 4P0BA 4AKLA 3C51A 1BR2A 3AA7A 4X20E 1LVKA 1BT9A 1E1HB 3ZMUB 2V7LA 5L2LA 3F31A 4QXCB 2BZBA 3UUMA 5JVDE 4AFKA 4L5GA 5LGTB 3JC6D 3OBVE 3UUNA 3SY7A 4V1Av 2J1NA 3OJAA 3PRNA 4BUMX 4QXHB 2K4TA 4OFZA 3N2KE 4GHBA 4PJNA 4AKGA 1YS5A 3OYXA 4HKAA 1MIVA 1UX4A 2MBGA 5CA1E 5DJQC 1D1BA 2XASB 2ZLYA 3PUAA 3MXZA 3J9X1 3KVAA 4FZNA 3ESLA 4O2BE 1MMNA 3AAEA 3VZUX 2X9YA 2KWIB 4PAGA 4QQ1A 2HPJA 5JDPA 2WBLA 4ZOLE 5LGUB 3O9XA 2W63A 2ODVA 4O3ZA 3QK6A 3QC9A 4FSPA 4WBOA 4ISTA 2IW5B 5FVNA 2L9QA 3HW9A 4N58A 2CXLA 5JDHA 4I43B 4C91A 3SS1A 5J1GA 2V26A 5JR9A 3PUGA 4L9IA 4KBMB 3ZMVB 4DNDA 3VKGA 2QA7A 2D0UA 2KMFA 3HA4A 3POUA 1MMDA 5EE2A 2JQQA 1LKXA 1FMWA 2N2NA 4H9QC 3J7Yq 5DL7A 1O3XA 2KZ7B 2KT9A 3A5XA 3VKHA 1U4QA 4ZI2C 2V7KA 1OSMA 3T0SA 2WMNA 5JR9C 3LK42 4KR4A 4N59A 3U78A 2XE1A 3NZPA 1WRDA 2K24A 3RKOA 4PJLA 4G76A 3TKLB 2ZM8A 4O3XB 2C5IT 3JTYA 3C4XA 5LHGB 1SA0E 3E22E 2K48A 5FY0A 3RC3A 4CZZB 4L0RA 5LP6E 3CMLA 5LHHB 2MNHA 2M06A 1BR4A 3ZJ1A 2Y0HA 3UAQA 3HKEE 2ES0A 1SHZC 3AVSA 4MLKA 5JRCB 3O0EA 2VKDA 3GN5B 2GE4A 4UXNB 3WI3A 3LFMA 4PJJA 3HR0A 3LBXA 4UV8B 1BR0A 3DA4A 2ZM2A 2KXPA 5LOVE 5LA6E 3HKDE 1MM5A 5FY1A 2WAUA 2C0SA 4P09A 4GCSA 3AAIA 3CPZA 4AKRB 4FRTA 2I59A 2LSJA 3PQUA 1Q9FA 3Q5WA 3RC8A 2A2FX 4H63V 2KNDA 2W81C 3ETVA 4XBFB 2Q9QA 2JRKA 2XAJB 5CB4E 2XAHB 3FXEB 5DABA 3WAKA 1BXWA 4G75A 2E8IA 4ZS3A 4EOZB 1LRZA 3PUSA 4GYSA 3O4XE 2YU1A 2XHEB 2RP4A 2F1TA 3O1JA 3FXDB 2LT3A 3HI2A 5BMVE 5KX5E 2E9XB 1MPFA 4AZLA 5JH7E 4RJWA 3N9PA 4B61A 3ZPOA 1HFAA 4CXWA 5HXEA 2XE2A 2Q9QC 4C69X 2LHRA 1MNEA 2H3RA 4U74A 4WNKA 3SYSA 2YK0A 5DQVA 2DLRA 4PJMA 1QJ8A 2BVMA 4FRXA 4P0AA 4FUVA 4CI2B 4AQFA 1U5PA 4B6XA 4GIWA 3NSGA 2QTKA 1KNZA 3ZCIA 2WWUA 4UF0A 2WSSV 4KMCA 2W80C 1IZNB 3KVDD 4I4TE 4FMSA 1HTJF 3NZQA 5GV0A 1YW0A 3EVYA 3LJCA 4JUYA 3S4UA 4FZMA 4ZI3C 3MJXA 4UVBB 2FGQX 3PU3A 1HCIA 1GFNA 2K0LA 5HYAA 1ZKEA 5EZYE 5FXZA 3ZMZB 4AYDC 4D65A 3ZN1B 4AQFC 5T5FA 2LEHA 2JMHA 3AA6B 5FXWA 5JDQA 2M07A 5C8YE 3T20A 3SYBA 3V5UA 4LSFA 5CA0E 4WW0A 4X1IE 2LSKA 2OA5A 3HOLA 4KR8A 5AFUK 4XAXB 5ADXL 3BQLA 4YJ3E 4C90A 4PK5A 1E54A 1HS7A 3GN5A 3NBXX 2KWHA 5JDNA 1S94A 2XTQA 3CWZB 3C50A 2DHRA 1S35A 2EHOB 1HG5A 1D1AA 1WLXA 2N1GA 2VASA 5J2UE 4AYEC 4H9SE 2LSYA 4FT6A 2YINA 5HXRA 3L09A 2CM0A 3M65A 5FMNA 4UVAB 2N2MA 3CKDA 4AKRA 5JREA 1ZHTA 5L3CB 4O8SA 3H3AA 1THQA 3F2EA 5DQWA 4F6RC 2DWKA 5A1LA 2ERVA 2X9XA 4RL9A 5HWYA 2VKOA 4XNKA 2N9DA 3T24A 4MFRA 5IYZE 3AA1A 3G7GA 2GK9A 3F57A 5HWXA 3EDVA 1IAPA 4JCHA 4PW8A 2V7MA 1OXZA 1MM4A 4CI3B 2M67A 1QJPA 2IC9A 5HAXA 2OMFA 5PRNA 5F8PA 2E9XA 2XAQB 4U9CA 2XTRA 1D0XA 2MTQA 2X27X 4K0UA 5LNKA 2BVLA 3KINB 3ONXA 4IGUA 4YJ2E 4YFSA 2O4VA 2EHOD 2PBIA 4DBRA 2CXDA 2CCQA 4FESA 1GFPA 2DCFA 4ZHQE 4UV9B 3H37A 4O4IE 3E0ZA 3DTOA 3MACA 4HEAA 4EAHA 3QRAA 3EUHA 2P9BA 3CX8B 2E9XC 4J2CA 5EK3A 2X9WA 1ORMA 4AYID 2YPVA 1HG2A 2D0TA 4D5UA 2Y8DA 3N2GE 3GA8A 4UELA 2W62A 2L3LA 3PU8A 3UT5E 3K19A 5L3FB 4Z8XA 5JDLA 4X1KE 4JEUB 2JPFA 3MKDA 4NUUA 1Y64B 4RLBA 3KBTA 4I50E 3FB2A 4IE5A 3W15B 3ZYLA 2XE3A 3JC6C 3N9QA 3RYCE 5L3DB 3SRZA 3ZMTB 2FGRA 5IYUA 4UEMA 5L3EB 3D0TA 1G73A 3I0OA 3RPUA 3AA0A 5EK4A 3ANWB 2ACXA 1FIOA 4DMVA 3AAAA 1HX8A 2K5BB 4ERRA 3SY9A 5FP3A 3UUXB 3NRXA 5KDMC 3N9NA 1D0YA 5H6RB 3DJBA 5FY7A 3AA7B 2X9HA 4JFBA 2Y7SA 4AYNA 2XUEA 4O4JE 4IE0A 4AXPA 2ZMAA 1PRNA 3ZC0A 4MHCA 7PRNA 3I9YA 3FYXA 2RA1A 4RJXA 2LFUA 1ZHYA 2IC6A 3PQSA 2C5JA 1QSDA 4PNIA 3HL6A 4QX7B 1ZHZA 4G2AA 5L3GB 4PK6A 4UVCB 3K3NA 1HF8A 2LOPA 2QGSA 4BJMA 4DO0A 4EXTA 3O1IA 5HXSA 5JQGE 1AJ3A 1ZHWA 3AAEB 4PFOA 1ZEEA 2NW9A 2CLYB 2ZM0A 4GYRA 4YHJA 3AVRA 5DL5A 4I55E 2ODJA 5LXTE 3LK2B 2DWGA 4LSIA 2W61A 2H7VC 3RRWA 4WBNE 4ZS2A 4DVDA 3UFEA 2NWBA 4O3YA 4A56A 4AKIA 2KDYA 4JLEA 3MA9A 5LBQB 4KUMB 2ODUA 4GCPA 1US7B 3N9OA 4U72A 2LE8A 3RYFE 2KZ7A 4O4XA 5F3JA 5DL8A 3RX6A 2LHNA 4TV9E 5LHIB 1H7CA 2CEAA 2HPLA 1D0ZA 4IIJE 2BDEA 1G90A 4MALA 4PFPA 4E7SA 2KINB 2NOXA 3C64A 1GFQA 2XE5A 5D5DA 2V7IA 3N5LA 1WR6A 4H9OC 2KLQA 5LBMA 3LK41 3ZN0B 4CXYA 2LSIA 5LG4A 2W0GA 3FHNA 1HXXA 3C98B 2JJ9A 3OKQA 4QHOA 2HH7A 5JRCA 5G26A 4QXBB 4OK0A 3WI5A 3VE1A 3MK7C 4IE4A 3PTRB 5KMGP 1G8XA 3SWHA 2PRNA 3I9WA 3FBLA 2YU2A 2XAFB 4LSHA 3V5SA 3VU7H 3KBUA 4Z3TA 2G0UA 4IE7A 4ZI2D 1YKEB 1H6S1 3K8PC 3CX6B 3VY8X 3CQXC 1X79A 4CXXA 4EIWA 2VWAA 2CWYA 3LBXB 4QWNB 2LOSA 4ANJA 1VRBA 1HXTA 4GCQA 3RYIE 4AYMC 4O3WA 2XG6A 3AB3B 4GF4A 2KXPB 4GOUA 2CA5A 1YD8G 2CXFA 5FYMA 2WMOA 1NWMX 2NP9A 1P4TA 2UXNB 4G63A 2X67A 2X51A 4TV8E 4AKHA 2H7OA 3P8CD 4NUVA 2X68A 3PURA 3ZC1A 3ZYMA 3A2SX 3BK9A 3Q5XA 2PORA 2Q9QB 3TZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IZN B;  3LK3 B;  2KZ7 A;  3AA0 A;  3AA6 A;  2KXP A;  2KZ7 B;  3AA0 B;  3AAA A;  4AKR A;  3AAE A;  3AA6 B;  5AFU L;  2KXP B;  3AAA B;  3LK2 A;  3LK4 2;  3AA7 A;  3AAE B;  4AKR B;  3AA1 A;  3AA7 B;  5AFU K;  3LK4 1;  5ADX L;  3LK2 B;  3AA1 B;  3LK3 A;  1IZN A;  5ADX K; 
#chains in the Genus database with same CATH topology
 5AQT B;  2DI4 A;  1B7T A;  3KDS E;  2VL8 A;  3EMN X;  3IHR A;  4CI1 B;  5B66 O;  4JI4 T;  2K3W A;  1FEW A;  4BAY B;  3LG7 A;  3ZYK A;  4YXD A;  8PRN A;  2PG8 A;  2KC0 A;  2WU2 A;  2A9U A;  3VY9 X;  3RIU A;  4B3T T;  4HN9 A;  2MOZ A;  4KHP T;  2CLY C;  4E7Z A;  5H6Q B;  3KVB A;  3UPG A;  5LJN A;  2W00 A;  2PFV A;  2Z6E A;  3VE2 A;  4Z90 A;  2NW7 A;  4TX5 A;  3FBZ A;  4EZH A;  5L4E A;  3HKB E;  3AA6 A;  4EYY R;  2Y2X A;  1ZV4 X;  1N33 T;  2UXX B;  4B3S T;  3VZW X;  3KV4 A;  4FZL A;  1MMG A;  3KFW X;  3RH3 A;  4OYK A;  3N9L A;  3OYZ A;  3SOL A;  3I0Q A;  2R89 A;  2DL1 A;  1HXU A;  3POR A;  5FXX A;  4AIU A;  4ISS A;  4D64 A;  1UX5 A;  1WYC A;  4JYA T;  3P7I A;  2NTX A;  4E1T A;  1SUM B;  2X66 A;  2ZLD A;  2M6B A;  5JDM A;  1OED C;  3C4Z A;  3DA3 A;  4BJN A;  3ZEF B;  3VHL A;  1GFO A;  5JR9 B;  5M4Y A;  4FOZ A;  2W67 A;  3I1A A;  4COF A;  1CUN A;  2FJB A;  4DV5 T;  3C4W A;  2CBI A;  3RRC A;  2A3D A;  3POX A;  4UR9 A;  2LRK A;  3C5O A;  2WJR A;  4DID B;  2L8K A;  4P1N A;  4N75 A;  3P4Q A;  4HFV A;  4KRA A;  3GMI A;  4YTN A;  4X1Y E;  4IDO A;  3HWB A;  2JIW A;  4TN7 B;  4H9N C;  2Y48 B;  2V7J A;  3AAA B;  1YQ3 A;  3L3P A;  4P0B A;  4AKL A;  3C51 A;  1BR2 A;  5AQS B;  1LVK A;  2WDQ A;  3UUM A;  4AFK A;  3UUN A;  3PRN A;  2BG9 C;  3OJA A;  3OYX A;  1UX4 A;  2MBG A;  4EV6 A;  2J47 A;  1VCS A;  4O2B E;  1MMN A;  4QQ1 A;  4WZX A;  2LLY A;  3QK6 A;  4FSP A;  4WBO A;  1E7P A;  3PJA A;  4N58 A;  2CXL A;  2AXT O;  5JDH A;  4I43 B;  3SS1 A;  3ZMV B;  2R4P A;  4YY3 T;  3PUG A;  5AQH B;  2QA7 A;  3HA4 A;  2KMF A;  5EE2 A;  2JQQ A;  2WU5 A;  1LKX A;  1KNR A;  1FMW A;  2KT9 A;  2QYW A;  5E79 O;  4C00 A;  4N59 A;  3NZP A;  4G76 A;  3PUV F;  2C5I T;  4X62 T;  3B5M A;  3QNU A;  5LHH B;  5LP6 E;  2AE9 A;  1BR4 A;  3K1S A;  3HKE E;  1SHZ C;  2F1C X;  5JRC B;  2GE4 A;  3DA4 A;  2FJE A;  2R4L A;  1HNZ T;  5LOV E;  5LA6 E;  1MM5 A;  2C0S A;  4LML A;  4AKR B;  1Q9F A;  3Q5W A;  4H63 V;  3PUY F;  5IWA T;  3WAK A;  1BXW A;  2E8I A;  4GYS A;  2XHE B;  2RP4 A;  5B5E O;  3FXD B;  3OVU A;  5BMV E;  1MPF A;  4AZL A;  1T8B A;  3L39 A;  4B61 A;  3ZPO A;  4CXW A;  2LHR A;  2H3R A;  3SYS A;  3ONJ A;  4A5X A;  5DQV A;  1QJ8 A;  2BVM A;  4FRX A;  3AEG A;  2XQ5 A;  4AQF A;  2QTK A;  4UF0 A;  4KMC A;  4KI0 F;  2W80 C;  3KVD D;  1WCR A;  1YW0 A;  4ZI3 C;  1HCI A;  2K0L A;  4IDN A;  5EZY E;  3ZMZ B;  4ZZC A;  4DV6 T;  4D65 A;  5HCJ A;  2JMH A;  3AA6 B;  3SYB A;  4LSF A;  5ADX L;  3GN5 A;  3NBX X;  3TLS A;  1S94 A;  5AQQ B;  2DHR A;  1S35 A;  1WLX A;  2VAS A;  3L09 A;  2CM0 A;  4UVA B;  3CKD A;  5JRE A;  4DV7 T;  3F2E A;  5A1L A;  3T24 A;  4MFR A;  3AA1 A;  2GK9 A;  3EDV A;  1OXZ A;  2YKS A;  2OMF A;  2E9X A;  3AEB A;  2MTQ A;  4K0U A;  2XY8 B;  4YFS A;  4ILA A;  4LFB T;  2CCQ A;  2DCF A;  4DUZ T;  4LF8 T;  1ORM A;  4D5U A;  3NVO A;  3PU8 A;  5JDL A;  3MKD A;  3KBT A;  3FB2 A;  3W15 B;  3RYC E;  2CRB A;  3ZMT B;  5L47 A;  1G73 A;  2XZE A;  1L0V A;  4CTD A;  1FIO A;  1HX8 A;  2CPT A;  4EEB A;  3UUX B;  3N9N A;  1ZP0 A;  2X9K A;  4AYN A;  2XUE A;  2V6Y B;  2IDO B;  2ZMA A;  5CGM A;  1ZHY A;  3PQS A;  5LMN T;  3K3N A;  1HF8 A;  2LOP A;  4LF7 T;  4QH5 A;  5C3J A;  1IBM T;  1ZHW A;  4PFO A;  5KAF O;  2J4G A;  2CLY B;  5HEU A;  2DWG A;  4LSI A;  3UFE A;  2NWB A;  4A56 A;  4AKI A;  2JQH A;  4YT0 A;  2XSA A;  1NEN A;  4KUM B;  4EGW A;  5G39 A;  1Z8U A;  3PF1 A;  2BDE A;  5FVL A;  3UU4 A;  3RF1 A;  1WR6 A;  3LK4 1;  2LSI A;  2W0G A;  1HXX A;  3OKQ A;  5G26 A;  2RPA A;  3H3M A;  5KMG P;  4FQE A;  3I9W A;  2XAF B;  4HFD A;  3VU7 H;  3KBU A;  3K8P C;  3VY8 X;  1X79 A;  4CXX A;  1Y01 A;  4GCQ A;  4AYM C;  3RYI E;  5IUX A;  3JAD A;  4GOU A;  2NR4 A;  1NWM X;  1P4T A;  2UXN B;  4LF4 T;  4AKH A;  1M62 A;  4TV8 E;  4NUV A;  4U31 A;  3BK9 A;  3UU2 A;  5JDG A;  2V6X A;  3UU8 A;  3LK3 B;  2XMX A;  2D2S A;  3SFD A;  4EYU A;  3IBP A;  2V1D B;  2JMM A;  4YSX A;  4QKN A;  4EB6 E;  4IE6 A;  3CVR A;  3O1H A;  1NAF A;  3SZD A;  3KV6 A;  1KNP A;  4LSE A;  1T98 A;  5AQN B;  4JI1 T;  1IZN A;  1JNZ A;  2XQY A;  4ILU A;  4ZEY A;  1OPF A;  5ADX K;  4YTP A;  4HWI B;  5ABF A;  2VUR A;  1ZHX A;  4UF0 B;  1IBK T;  4FSO A;  3RIU C;  4U7Y A;  2BG9 B;  5HXC A;  4AQG A;  4UB6 O;  5EK2 A;  4O2A E;  2EHO A;  4LF9 T;  4H9R C;  1XMQ T;  4ZI3 D;  1UCU A;  3UTK A;  4DBQ A;  4CN1 A;  3Q5D A;  1HX1 B;  3T8O A;  3R6N A;  4CQI A;  2VK9 A;  2WDR A;  5AFU L;  3ZT5 A;  4XZC A;  5J0Z A;  2IWW A;  5LB7 B;  2Y0L A;  5IHY A;  3AA1 B;  3AED A;  4N78 D;  4FI5 A;  3FZL B;  4PUX A;  2HN2 A;  4KP3 C;  4HWD A;  3DP7 A;  2N2L A;  5GTH O;  2YEV C;  2IML A;  1YKH B;  4EED A;  4F4B A;  1BR1 A;  3CQC B;  2XAG B;  4DV0 T;  2VB6 A;  3BQI A;  1Q9G A;  4AUI A;  1E2A A;  2MPK A;  1FMV A;  4O49 A;  5GON E;  1ZOY A;  2B1E A;  2XTL A;  3P4W A;  3QOF A;  2LJL A;  4ADZ A;  5ETW A;  5AQV B;  3AE4 A;  1UUR A;  3AE7 A;  1VCT A;  3B13 A;  3ZST A;  2V7L A;  3AXJ B;  3VRA A;  4L5G A;  2R88 A;  3SY7 A;  4V1A v;  2J1N A;  4IDQ A;  3AEE A;  4QXH B;  4PJN A;  1YS5 A;  2XPK A;  1MIV A;  3AEA A;  3MXZ A;  4FZN A;  3ESL A;  2KWI B;  4PAG A;  2WBL A;  4ZOL E;  5LGU B;  3QC9 A;  5C2T A;  2IW5 B;  2L9Q A;  3HW9 A;  4C91 A;  4L9I A;  4TWH A;  2D0U A;  4HFC A;  3UFG A;  3RQW A;  2V7K A;  2FBW A;  3CIR A;  3T0S A;  2WMN A;  4KR4 A;  1WRD A;  2K24 A;  2ZM8 A;  3AE3 A;  3JTY A;  4AQY T;  5LHG B;  2K48 A;  4L0R A;  1XDO A;  2MNH A;  2M06 A;  2Y0H A;  3UAQ A;  3AVS A;  3O0E A;  4HFH A;  3WI3 A;  1HNX T;  3HR0 A;  3LBX A;  4UV8 B;  3UU3 A;  2QRX A;  2F4V T;  4GCS A;  1WFD A;  1KFY A;  4FRT A;  3PQU A;  1N34 T;  2KND A;  2W81 C;  2Q9Q A;  1UGO A;  2JRK A;  2XAJ B;  3FXE B;  4G75 A;  4EOZ B;  3PUS A;  2R4N A;  1OED E;  5JH7 E;  2AXD S;  3PV0 F;  4U74 A;  3QB5 A;  4PJM A;  1J1J A;  3BS0 A;  4YSZ A;  2BS4 A;  2WWU A;  2WSS V;  1IZN B;  2I0M A;  3LJC A;  2FGQ X;  3PU3 A;  3ZN1 B;  4AQF C;  2LEH A;  1XWM A;  5FXW A;  5H2F O;  4ZXL A;  3V5U A;  4KR8 A;  5AFU K;  4C4V B;  1UK5 A;  3BQL A;  4YJ3 E;  5CFB A;  4TWF A;  2YDS A;  2EHO B;  1HG5 A;  3P4S A;  2N1G A;  4DR4 T;  4HWH A;  4AYE C;  2LSY A;  2N2M A;  4JI2 T;  4DV3 T;  2X9X A;  2BG9 E;  5IYZ E;  5HWX A;  4CI3 B;  2D9D A;  2WZI A;  5F8P A;  4U9C A;  5ABE A;  2PBI A;  5HCM A;  2UUB T;  4U3C A;  3E0Z A;  2MAW A;  2J62 A;  3QRA A;  2P9B A;  3CX8 B;  2E9X C;  2X9W A;  2YPV A;  1HG2 A;  3N2G E;  4A97 A;  4Z8X A;  3LDQ B;  4X1K E;  4NXN T;  4JEU B;  2JPF A;  3JC6 C;  3N9Q A;  1YXR A;  2IUB A;  4DV4 T;  2BKO A;  3Q5E A;  5FP3 A;  5KDM C;  1N36 T;  3ZC0 A;  2WWV A;  3I9Y A;  2PTF A;  1QSD A;  4PNI A;  3HL6 A;  4QX7 B;  4GKK T;  1ZHZ A;  4PK6 A;  3A0B O;  4BJM A;  1I94 T;  2WZH A;  4ILC A;  2NW9 A;  2ZM0 A;  3AVR A;  5DL5 A;  4I55 E;  2IHR 1;  4JI8 T;  1S5L O;  3T1Y T;  4WBN E;  1XMO T;  4DR5 T;  1CHU A;  2KDY A;  4JLE A;  3MA9 A;  5LBQ B;  3FZH B;  4N74 A;  2KZ7 A;  3RYF E;  4O4X A;  5F3J A;  3PGS A;  2VQF T;  3UU5 A;  4MAL A;  1GFQ A;  2KIN B;  2XE5 A;  3RI5 A;  2KLQ A;  5ABG A;  3ZN0 B;  5LG4 A;  3C98 B;  3PUX F;  4CN4 A;  4OK0 A;  1G8X A;  2PRN A;  3FBL A;  3RQU A;  4HWF A;  2XQ7 A;  1YKE B;  2YDQ A;  2V8S V;  2WVP A;  4EIW A;  3LBX B;  4QWN B;  4ANJ A;  2XG6 A;  2FJA A;  5LG3 A;  1XNQ T;  2X67 A;  2X51 A;  5FKY A;  3P8C D;  2X68 A;  3ZC1 A;  3Q5X A;  2R6G F;  1HNW T;  2Q9Q B;  3TZG A;  3TLW A;  2XQ6 A;  3PUQ A;  3PGR A;  2YOE A;  1IJ5 A;  2VKJ A;  2QVA A;  1R8I A;  3ZJ2 A;  3LK2 A;  2R4O A;  4ZI7 E;  3AE6 A;  3ETU A;  3GP6 A;  3RHW A;  1PHO A;  2F1V A;  3CK6 A;  3QUJ A;  2JQK A;  3VRB A;  5JDP A;  1LVF A;  3IEE A;  4OHF A;  2XSB A;  1Z0P A;  3RBH A;  2LHF A;  2A72 A;  5HXH A;  2PJQ A;  4TUY E;  5AQR B;  3NWI A;  4PK4 A;  2C5K T;  5CJ5 A;  5HEJ A;  4IL9 A;  3U3I A;  4FJO A;  2VKH A;  2BKN A;  5LCY A;  1ZHC A;  2D5U A;  5FNV E;  2IIU A;  4H63 H;  1T72 A;  4ASK A;  2YDR A;  2EHO C;  4AI6 A;  4JI6 T;  3TLT A;  2J4U P;  3N2O A;  1OWA A;  4HE8 A;  2CWO A;  3Q2M A;  2CE7 A;  3UQ4 A;  4RLC A;  4ILB A;  3KV9 A;  4MBQ A;  2LM9 A;  4HTE A;  4IDZ A;  4JI0 T;  5HEO A;  3MZK B;  4OX9 T;  1D1C A;  1VOM A;  3EDU A;  4QX8 B;  1QUU A;  2WM9 A;  2IAK A;  5DL6 A;  5E0O A;  1T16 A;  2K9A A;  4HGA A;  4Z91 A;  4BA9 A;  3KV5 A;  4OYJ A;  1BH3 A;  2DNX A;  4XNL A;  3SFE A;  3ANW A;  4JI5 T;  3V8U A;  4H9P C;  5J2T E;  2E9X D;  3ZLI A;  3LSV A;  4X20 E;  2ACZ A;  3G06 A;  3ZMU B;  3F31 A;  2BZB A;  5JVD E;  3VR8 A;  5LGT B;  3JC6 D;  3OBV E;  4DR3 T;  4OFZ A;  3N2K E;  3QB5 K;  4AKG A;  5CA1 E;  2W4X A;  1D1B A;  2XAS B;  2ZLY A;  3J9X 1;  3AAE A;  2X9Y A;  2H89 A;  1X9B A;  2HPJ A;  2W63 A;  2ODV A;  4IST A;  1XZY A;  3QRC A;  5J1G A;  5JR9 A;  3VKG A;  4DND A;  4KBM B;  4DR1 T;  4NPP A;  2WB5 A;  4H9Q C;  3J7Y q;  5DL7 A;  4U2Z A;  1O3X A;  2KZ7 B;  2XJ7 A;  4ZI2 C;  1OSM A;  3U78 A;  3IA3 A;  4PJL A;  3A0H O;  3TKL B;  3P4P A;  4K3C A;  3C4X A;  3E22 E;  3RC3 A;  4CZZ B;  5BR8 T;  3ZJ1 A;  4LF5 T;  2BBJ A;  2ES0 A;  3T1H T;  4MLK A;  2VKD A;  4B3M T;  3GN5 B;  4HFE A;  4UXN B;  3LFM A;  4PJJ A;  1BR0 A;  2KXP A;  3HKD E;  2WAU A;  4P09 A;  3A8Y C;  2I59 A;  3AE2 A;  3ETV A;  2YN6 A;  4B3R T;  4XBF B;  3RIF A;  2XAH B;  5DAB A;  5HEH A;  4TWD A;  1IBL T;  3O4X E;  2YU1 A;  2F1T A;  3O1J A;  2LT3 A;  5KX5 E;  2E9X B;  5HEG A;  5ABH A;  1I6Z A;  1HFA A;  4C69 X;  2Q9Q C;  1MNE A;  3DWO X;  4F8H A;  4WNK A;  2YK0 A;  4FUV A;  4P0A A;  4IT4 A;  1XDP A;  1KF6 A;  4GIW A;  1KNZ A;  3ZCI A;  3ONL C;  2OLT A;  4JUY A;  5GV0 A;  3S4U A;  4UVB B;  1N32 T;  1GFN A;  4AYD C;  5T5F A;  5JDQ A;  2M07 A;  5C8Y E;  5CA0 E;  4WW0 A;  1T7S A;  2WP9 A;  2LSK A;  4X1I E;  3TLV A;  3HOL A;  4XAX B;  1E54 A;  1HS7 A;  5TIS O;  2KWH A;  3JCF A;  3CWZ B;  5J2U E;  5KXJ A;  2I6H A;  4FT6 A;  2W2U A;  5HXR A;  5FMN A;  5L4H A;  3WU2 O;  2IWV A;  4AKR A;  1ZHT A;  5L3C B;  2XM1 A;  4K3B A;  2ERV A;  2VKO A;  4XNK A;  2N9D A;  3G7G A;  4JCH A;  2JQ9 A;  4PW8 A;  1QJP A;  5HAX A;  4DV1 T;  5PRN A;  3NKZ A;  1D0X A;  2X27 X;  3KIN B;  4IGU A;  3AEC A;  4YJ2 E;  1YQ4 A;  2EHO D;  4HFI A;  4DBR A;  4FES A;  1GFP A;  3PUW F;  4JI3 T;  4ZHQ E;  4UV9 B;  4O4I E;  1QLB A;  3DTO A;  3MAC A;  4HEA A;  2HN1 A;  3EUH A;  1NEK A;  5EK3 A;  4AYI D;  3EAB A;  2D0T A;  5F5W A;  3GA8 A;  3UT5 E;  2W62 A;  2L3L A;  3K19 A;  5L3F B;  3PJA J;  1Y64 B;  4I50 E;  4IE5 A;  2XE3 A;  1GQE A;  2WJQ A;  3SRZ A;  4K0K T;  5IYU A;  3I0O A;  3AA0 A;  5EK4 A;  3ANW B;  2R8A A;  2K5B B;  4ERR A;  5AQM B;  3SY9 A;  4X65 T;  3NRX A;  1D0Y A;  4JFB A;  4IDP A;  4AXP A;  1PRN A;  3OPC A;  7PRN A;  3FYX A;  2RA1 A;  3BRZ A;  4RJX A;  1DU2 A;  3DWN A;  2C5J A;  5L3G B;  3AE5 A;  2QGS A;  4DO0 A;  4TNW A;  4EXT A;  3O1I A;  5HXS A;  1AJ3 A;  3AAE B;  1ZEE A;  3RRW A;  4HFB A;  4DVD A;  4O3Y A;  3RKG A;  4GCP A;  2ODU A;  1US7 B;  4U72 A;  2LE8 A;  2WCA A;  2VQE T;  2LHN A;  5ABF B;  4TV9 E;  5LHI B;  1H7C A;  2HPL A;  1D0Z A;  1G90 A;  4A98 A;  4PFP A;  4E7S A;  2NOX A;  3C64 A;  5D5D A;  5AQU B;  2V7I A;  4AIS A;  3N5L A;  4H9O C;  4CXY A;  3FHN A;  2E2A A;  4QHO A;  4PR7 A;  3MK7 C;  1J5W A;  4IE4 A;  3EAM A;  4LSH A;  2YU2 A;  4Z3T A;  4ZI2 D;  3CX6 B;  3CQX C;  2VWA A;  2CWY A;  1HXT A;  2LOS A;  4O3W A;  2KXP B;  4YSY A;  2CXF A;  5FYM A;  2NP9 A;  2V6Y A;  3OTO T;  4G63 A;  2JQY A;  4PJ0 O;  3ZYM A;  2POR A;  1JNR A;  2G0U A;  2M6I A;  5JDF A;  3BRY A;  2J1D G;  1MIW A;  2V5D A;  2Y0K A;  3SZV A;  3E08 A;  4QH4 A;  1MIY A;  3ZMS B;  2LKH A;  1MND A;  4EZ4 A;  4YHH T;  3UQ7 A;  2MYS A;  4M1P A;  4IRE A;  1WYB A;  1V9D A;  3CQG B;  2BS2 A;  2X0H A;  3JAE A;  2UUC T;  2Q9Q D;  4KHZ F;  3R84 B;  4DR7 T;  3PDY A;  2LM2 A;  5LYJ E;  2JMK A;  3Q9D A;  4UB8 O;  4UIG A;  1GFM A;  3VZT X;  4IHJ E;  3ZT6 A;  3GWH A;  3K3O A;  3PE0 A;  3BQK A;  4X5T A;  1EZ3 A;  1OED A;  1MMA A;  5FL0 A;  2W66 A;  1KK7 A;  3L8R A;  2NW8 A;  2LSG A;  4JEH B;  1IJ6 A;  2Y6X A;  3CX7 B;  4GK0 E;  1QJ9 A;  3ZSS A;  3HKC E;  3POQ A;  4YLH A;  3K3Q C;  2B76 A;  3B57 A;  4DUY T;  6PRN A;  3NRY A;  2SPC A;  4TZ4 C;  1W0B A;  3EI0 A;  3UUL A;  3LK3 A;  4AKM A;  2CMR A;  4GK5 E;  5AQL B;  2UUA T;  1XNR T;  4X66 T;  4O4U A;  5TAO A;  5AQJ B;  2YNK A;  5L3B B;  5FXV A;  4O4L E;  2X0L B;  3RYH E;  3WI4 A;  4DR2 T;  3ZCJ A;  5LMU T;  3WAJ A;  4O4H E;  2BKP A;  3IF8 B;  3N9M A;  3HOE A;  2ZFG A;  4WYV A;  2XM2 A;  2MHL A;  5LGN B;  2V5C A;  3PGU A;  2XQ3 A;  2NTY A;  5LJM A;  3AA0 B;  2BG9 A;  3DZM A;  3UU6 A;  4DMW A;  3AA7 A;  1BT9 A;  1E1H B;  4QH1 A;  5L2L A;  3ZT7 A;  4QXC B;  2WDV A;  4BUM X;  2K4T A;  4GHB A;  4KX6 A;  4HKA A;  5DJQ C;  1UUS A;  2VVS A;  3PUA A;  2UXD T;  3KVA A;  2HHH T;  3VZU X;  2FUP A;  2UXB T;  3O9X A;  4O3Z A;  3FZF B;  1T1L A;  3ABV A;  5FVN A;  2WY2 A;  4TNV A;  4E1S A;  2V26 A;  2FJD A;  2E5L T;  4YTM A;  1MMD A;  4JV5 T;  3POU A;  4U33 A;  2N2N A;  5AQK B;  2ZM6 T;  3A5X A;  3VKH A;  1U4Q A;  2BBH A;  3JCU O;  2KSR A;  3LK4 2;  5JR9 C;  4X64 T;  2XE1 A;  4CN6 A;  3RKO A;  4O3X B;  1SA0 E;  5FY0 A;  1HR0 T;  3CML A;  4U2Y A;  2ZM2 A;  4HWC A;  3KZI O;  4ZZB A;  5FY1 A;  3AAI A;  3AXJ A;  3CPZ A;  5AQF B;  2LSJ A;  4LMK A;  3RC8 A;  1M7K A;  5AQP B;  2UXC T;  5CB4 E;  4U7I A;  4ZS3 A;  1LRZ A;  3AEF A;  4IL4 A;  5G3A A;  3HI2 A;  2VVN A;  3RLF F;  4RJW A;  3N9P A;  3ZKR A;  3PUZ F;  5HXE A;  2XE2 A;  3P50 A;  2DLR A;  4CI2 B;  1U5P A;  4B6X A;  3P4R A;  3NSG A;  4I0U A;  4I4T E;  4FMS A;  1HTJ F;  3NZQ A;  3RIA A;  3EVY A;  4FZM A;  2BS3 A;  2CHN A;  3MJX A;  3RGL A;  5HYA A;  1ZKE A;  5FXZ A;  3T20 A;  3JAF A;  2OA5 A;  4C90 A;  4PK5 A;  5JDN A;  2XTQ A;  3C50 A;  1W9R A;  3AE9 A;  1D1A A;  4JI7 T;  1OED B;  4H9S E;  2YIN A;  3M65 A;  3NJT A;  4O8S A;  3H3A A;  1THQ A;  3UUB A;  5AQI B;  5DQW A;  4F6R C;  2DWK A;  4NXM T;  3FZK B;  4RL9 A;  2LKG A;  5HWY A;  3F57 A;  2VL0 A;  1IAP A;  2V7M A;  1MM4 A;  2M67 A;  2E5V A;  2IC9 A;  2XAQ B;  2XTR A;  5LNK A;  2BVL A;  3ONX A;  4DR6 T;  5G38 A;  2O4V A;  2CBJ A;  2CXD A;  3H37 A;  1KEY A;  4GKJ T;  4EAH A;  1W0A A;  4DV2 T;  4J2C A;  2XQ8 A;  2Y8D A;  2XQ9 A;  4UEL A;  3A7M A;  5FVK A;  4NUU A;  4RLB A;  3ZYL A;  5L3D B;  2FGR A;  4UEM A;  5L3E B;  3D0T A;  3RPU A;  2ACX A;  5KAI O;  4IL6 O;  2WS3 A;  4DMV A;  5JTG A;  3AAA A;  4LMJ A;  5FL1 A;  4C4V A;  5AQG B;  2OV9 A;  2LRL A;  5H6R B;  1FJG T;  3DJB A;  5FY7 A;  3AA7 B;  2X9H A;  2UU9 T;  2Y7S A;  4LFA T;  4O4J E;  4IE0 A;  4MHC A;  4Q25 A;  3AE8 A;  2XQA A;  2H88 A;  2LFU A;  3M3Z B;  1J5E T;  2IC6 A;  4LF6 T;  2WQY A;  4G2A A;  4UVC B;  1SE7 A;  5JQG E;  4GYR A;  4YHJ A;  2ODJ A;  5LXT E;  3LK2 B;  2W61 A;  2H7V C;  3FZM B;  5AQO B;  4ZS2 A;  3N9O A;  5DL8 A;  3RX6 A;  2CEA A;  4IIJ E;  5LBM A;  3TLU A;  2JJ9 A;  5JRC A;  2HH7 A;  4QXB B;  3WI5 A;  2X0Y A;  3VE1 A;  3PTR B;  3SWH A;  4LFC T;  3EHZ A;  3V5S A;  4IE7 A;  1H6S 1;  4JBW F;  1VRB A;  3AB3 B;  4GF4 A;  2CA5 A;  1YD8 G;  2WMO A;  1W09 A;  2XQ4 A;  2CHO A;  1WR0 A;  3X1D A;  5GTI O;  2H7O A;  4NIQ A;  3PUR A;  3A2S X;  3AE1 A;  2A2F X;  3VR9 A; 
#chains in the Genus database with same CATH homology
 5JDG A;  2XMX A;  3LK3 B;  2D2S A;  3PUQ A;  5JDF A;  2DI4 A;  1B7T A;  3IBP A;  3KDS E;  2J1D G;  2V1D B;  4EYU A;  2VL8 A;  1MIW A;  2JMM A;  3EMN X;  2Y0K A;  3SZV A;  1IJ5 A;  3IHR A;  3E08 A;  4QKN A;  4CI1 B;  4EB6 E;  4BAY B;  1FEW A;  2VKJ A;  1MIY A;  3LG7 A;  3ZMS B;  3ZYK A;  1MND A;  4EZ4 A;  3ZJ2 A;  4IE6 A;  3CVR A;  3O1H A;  3LK2 A;  1NAF A;  4ZI7 E;  8PRN A;  3SZD A;  2MYS A;  4M1P A;  2PG8 A;  3ETU A;  1WYB A;  2KC0 A;  3KV6 A;  3GP6 A;  1PHO A;  1V9D A;  2F1V A;  3VY9 X;  4LSE A;  3CQG B;  3QUJ A;  1T98 A;  1IZN A;  4HN9 A;  3QRC A;  1LVF A;  2XQY A;  4ILU A;  2MOZ A;  1OPF A;  2CLY C;  5ADX K;  4E7Z A;  5H6Q B;  3KVB A;  3UPG A;  5LJN A;  2W00 A;  2PFV A;  2Z6E A;  3IEE A;  4OHF A;  3VE2 A;  1ZHX A;  4UF0 B;  2Q9Q D;  3R84 B;  2NW7 A;  4TX5 A;  1Z0P A;  3FBZ A;  3PDY A;  3RBH A;  4EZH A;  2LHF A;  3HKB E;  3AA6 A;  4EYY R;  2Y2X A;  1ZV4 X;  2UXX B;  5LYJ E;  2JMK A;  2A72 A;  3Q9D A;  5HXH A;  4E1S A;  3VZW X;  3KV4 A;  4FSO A;  4FZL A;  1MMG A;  2PJQ A;  4TUY E;  4UIG A;  3KFW X;  3RH3 A;  5HXC A;  4PK4 A;  4OYK A;  3N9L A;  4AQG A;  3OYZ A;  2C5K T;  4IHJ E;  5EK2 A;  1GFM A;  3VZT X;  3SOL A;  4O2A E;  3GWH A;  3K3O A;  3PE0 A;  3BQK A;  2EHO A;  3U3I A;  1EZ3 A;  3I0Q A;  4FJO A;  2VKH A;  1HXU A;  5FXX A;  3POR A;  4D64 A;  1MMA A;  4ISS A;  4H9R C;  1UX5 A;  4ZI3 D;  1UCU A;  1WYC A;  1KK7 A;  5LCY A;  3P7I A;  1ZHC A;  2NTX A;  2NW8 A;  2D5U A;  2LSG A;  3UTK A;  5FNV E;  4DBQ A;  3UU2 A;  4H63 H;  4JEH B;  1IJ6 A;  4E1T A;  3T8O A;  4ASK A;  2Y6X A;  3CX7 B;  2X66 A;  3R6N A;  4CQI A;  2ZLD A;  2EHO C;  4GK0 E;  1QJ9 A;  2VK9 A;  5JDM A;  4AI6 A;  5AFU L;  3HKC E;  4XZC A;  2J4U P;  3N2O A;  1OWA A;  4HE8 A;  4YLH A;  3POQ A;  3C4Z A;  3DA3 A;  3K3Q C;  2CWO A;  3B57 A;  3Q2M A;  4BJN A;  6PRN A;  3NRY A;  2CE7 A;  3ZEF B;  2Y0L A;  3VHL A;  2SPC A;  4TZ4 C;  4RLC A;  5IHY A;  3AA1 B;  3UUL A;  4N78 D;  3LK3 A;  4FI5 A;  4AKM A;  2CMR A;  4GK5 E;  4PUX A;  3KV9 A;  4MBQ A;  2LM9 A;  4HTE A;  4IDZ A;  4KP3 C;  3DP7 A;  5TAO A;  1GFO A;  4O4U A;  2YNK A;  5L3B B;  3MZK B;  5FXV A;  2N2L A;  1D1C A;  2YEV C;  5JR9 B;  5M4Y A;  1YKH B;  1VOM A;  4O4L E;  3I1A A;  4FOZ A;  3EDU A;  4QX8 B;  1QUU A;  1CUN A;  2WM9 A;  2IAK A;  5DL6 A;  5E0O A;  4F4B A;  2X0L B;  3RYH E;  3C4W A;  1BR1 A;  3WI4 A;  3RRC A;  2K9A A;  2A3D A;  4HGA A;  3ZCJ A;  4BA9 A;  3WAJ A;  3CQC B;  2XAG B;  4O4H E;  2VB6 A;  3BQI A;  3KV5 A;  3POX A;  3IF8 B;  3C5O A;  3N9M A;  3HOE A;  2ZFG A;  4OYJ A;  2L8K A;  1BH3 A;  2DNX A;  1Q9G A;  4XNL A;  2MHL A;  4AUI A;  5LGN B;  1FMV A;  3ANW A;  4O49 A;  2NTY A;  5GON E;  5LJM A;  2B1E A;  2XTL A;  4HFV A;  4KRA A;  3GMI A;  2LJL A;  3V8U A;  4ADZ A;  4H9P C;  5ETW A;  4X1Y E;  3AA0 B;  5J2T E;  3HWB A;  2E9X D;  4TN7 B;  4H9N C;  2Y48 B;  2V7J A;  3ZLI A;  4DMW A;  3AAA B;  3L3P A;  3B13 A;  4P0B A;  4AKL A;  3C51 A;  1BR2 A;  3AA7 A;  4X20 E;  1LVK A;  1BT9 A;  1E1H B;  3ZMU B;  2V7L A;  5L2L A;  3F31 A;  4QXC B;  2BZB A;  3UUM A;  5JVD E;  4AFK A;  4L5G A;  5LGT B;  3JC6 D;  3OBV E;  3UUN A;  3SY7 A;  4V1A v;  2J1N A;  3OJA A;  3PRN A;  4BUM X;  4QXH B;  2K4T A;  4OFZ A;  3N2K E;  4GHB A;  4PJN A;  4AKG A;  1YS5 A;  3OYX A;  4HKA A;  1MIV A;  1UX4 A;  2MBG A;  5CA1 E;  5DJQ C;  1D1B A;  2XAS B;  2ZLY A;  3PUA A;  3MXZ A;  3J9X 1;  3KVA A;  4FZN A;  3ESL A;  4O2B E;  1MMN A;  3AAE A;  3VZU X;  2X9Y A;  2KWI B;  4PAG A;  4QQ1 A;  2HPJ A;  5JDP A;  2WBL A;  4ZOL E;  5LGU B;  3O9X A;  2W63 A;  2ODV A;  4O3Z A;  3QK6 A;  3QC9 A;  4FSP A;  4WBO A;  4IST A;  2IW5 B;  5FVN A;  2L9Q A;  3HW9 A;  4N58 A;  2CXL A;  5JDH A;  4I43 B;  4C91 A;  3SS1 A;  5J1G A;  2V26 A;  5JR9 A;  3PUG A;  4L9I A;  4KBM B;  3ZMV B;  4DND A;  3VKG A;  2QA7 A;  2D0U A;  2KMF A;  3HA4 A;  3POU A;  1MMD A;  5EE2 A;  2JQQ A;  1LKX A;  1FMW A;  2N2N A;  4H9Q C;  3J7Y q;  5DL7 A;  1O3X A;  2KZ7 B;  2KT9 A;  3A5X A;  3VKH A;  1U4Q A;  4ZI2 C;  2V7K A;  1OSM A;  3T0S A;  2WMN A;  5JR9 C;  3LK4 2;  4KR4 A;  4N59 A;  3U78 A;  2XE1 A;  3NZP A;  1WRD A;  2K24 A;  3RKO A;  4PJL A;  4G76 A;  3TKL B;  2ZM8 A;  4O3X B;  2C5I T;  3JTY A;  3C4X A;  5LHG B;  1SA0 E;  3E22 E;  2K48 A;  5FY0 A;  3RC3 A;  4CZZ B;  4L0R A;  5LP6 E;  3CML A;  5LHH B;  2MNH A;  2M06 A;  1BR4 A;  3ZJ1 A;  2Y0H A;  3UAQ A;  3HKE E;  2ES0 A;  1SHZ C;  3AVS A;  4MLK A;  5JRC B;  3O0E A;  2VKD A;  3GN5 B;  2GE4 A;  4UXN B;  3WI3 A;  3LFM A;  4PJJ A;  3HR0 A;  3LBX A;  4UV8 B;  1BR0 A;  3DA4 A;  2ZM2 A;  2KXP A;  5LOV E;  5LA6 E;  3HKD E;  1MM5 A;  5FY1 A;  2WAU A;  2C0S A;  4P09 A;  4GCS A;  3AAI A;  3CPZ A;  4AKR B;  4FRT A;  2I59 A;  2LSJ A;  3PQU A;  1Q9F A;  3Q5W A;  3RC8 A;  2A2F X;  4H63 V;  2KND A;  2W81 C;  3ETV A;  4XBF B;  2Q9Q A;  2JRK A;  2XAJ B;  5CB4 E;  2XAH B;  3FXE B;  5DAB A;  3WAK A;  1BXW A;  4G75 A;  2E8I A;  4ZS3 A;  4EOZ B;  1LRZ A;  3PUS A;  4GYS A;  3O4X E;  2YU1 A;  2XHE B;  2RP4 A;  2F1T A;  3O1J A;  3FXD B;  2LT3 A;  3HI2 A;  5BMV E;  5KX5 E;  2E9X B;  1MPF A;  4AZL A;  5JH7 E;  4RJW A;  3N9P A;  4B61 A;  3ZPO A;  1HFA A;  4CXW A;  5HXE A;  2XE2 A;  2Q9Q C;  4C69 X;  2LHR A;  1MNE A;  2H3R A;  4U74 A;  4WNK A;  3SYS A;  2YK0 A;  5DQV A;  2DLR A;  4PJM A;  1QJ8 A;  2BVM A;  4FRX A;  4P0A A;  4FUV A;  4CI2 B;  4AQF A;  1U5P A;  4B6X A;  4GIW A;  3NSG A;  2QTK A;  1KNZ A;  3ZCI A;  2WWU A;  4UF0 A;  2WSS V;  4KMC A;  2W80 C;  1IZN B;  3KVD D;  4I4T E;  4FMS A;  1HTJ F;  3NZQ A;  5GV0 A;  1YW0 A;  3EVY A;  3LJC A;  4JUY A;  3S4U A;  4FZM A;  4ZI3 C;  3MJX A;  4UVB B;  2FGQ X;  3PU3 A;  1HCI A;  1GFN A;  2K0L A;  5HYA A;  1ZKE A;  5EZY E;  5FXZ A;  3ZMZ B;  4AYD C;  4D65 A;  3ZN1 B;  4AQF C;  5T5F A;  2LEH A;  2JMH A;  3AA6 B;  5FXW A;  5JDQ A;  2M07 A;  5C8Y E;  3T20 A;  3SYB A;  3V5U A;  4LSF A;  5CA0 E;  4WW0 A;  4X1I E;  2LSK A;  2OA5 A;  3HOL A;  4KR8 A;  5AFU K;  4XAX B;  5ADX L;  3BQL A;  4YJ3 E;  4C90 A;  4PK5 A;  1E54 A;  1HS7 A;  3GN5 A;  3NBX X;  2KWH A;  5JDN A;  1S94 A;  2XTQ A;  3CWZ B;  3C50 A;  2DHR A;  1S35 A;  2EHO B;  1HG5 A;  1D1A A;  1WLX A;  2N1G A;  2VAS A;  5J2U E;  4AYE C;  4H9S E;  2LSY A;  4FT6 A;  2YIN A;  5HXR A;  3L09 A;  2CM0 A;  3M65 A;  5FMN A;  4UVA B;  2N2M A;  3CKD A;  4AKR A;  5JRE A;  1ZHT A;  5L3C B;  4O8S A;  3H3A A;  1THQ A;  3F2E A;  5DQW A;  4F6R C;  2DWK A;  5A1L A;  2ERV A;  2X9X A;  4RL9 A;  5HWY A;  2VKO A;  4XNK A;  2N9D A;  3T24 A;  4MFR A;  5IYZ E;  3AA1 A;  3G7G A;  2GK9 A;  3F57 A;  5HWX A;  3EDV A;  1IAP A;  4JCH A;  4PW8 A;  2V7M A;  1OXZ A;  1MM4 A;  4CI3 B;  2M67 A;  1QJP A;  2IC9 A;  5HAX A;  2OMF A;  5PRN A;  5F8P A;  2E9X A;  2XAQ B;  4U9C A;  2XTR A;  1D0X A;  2MTQ A;  2X27 X;  4K0U A;  5LNK A;  2BVL A;  3KIN B;  3ONX A;  4IGU A;  4YJ2 E;  4YFS A;  2O4V A;  2EHO D;  2PBI A;  4DBR A;  2CXD A;  2CCQ A;  4FES A;  1GFP A;  2DCF A;  4ZHQ E;  4UV9 B;  3H37 A;  4O4I E;  3E0Z A;  3DTO A;  3MAC A;  4HEA A;  4EAH A;  3QRA A;  3EUH A;  2P9B A;  3CX8 B;  2E9X C;  4J2C A;  5EK3 A;  2X9W A;  1ORM A;  4AYI D;  2YPV A;  1HG2 A;  2D0T A;  4D5U A;  2Y8D A;  3N2G E;  3GA8 A;  4UEL A;  2W62 A;  2L3L A;  3PU8 A;  3UT5 E;  3K19 A;  5L3F B;  4Z8X A;  5JDL A;  4X1K E;  4JEU B;  2JPF A;  3MKD A;  4NUU A;  1Y64 B;  4RLB A;  3KBT A;  4I50 E;  3FB2 A;  4IE5 A;  3W15 B;  3ZYL A;  2XE3 A;  3JC6 C;  3N9Q A;  3RYC E;  5L3D B;  3SRZ A;  3ZMT B;  2FGR A;  5IYU A;  4UEM A;  5L3E B;  3D0T A;  1G73 A;  3I0O A;  3RPU A;  3AA0 A;  5EK4 A;  3ANW B;  2ACX A;  1FIO A;  4DMV A;  3AAA A;  1HX8 A;  2K5B B;  4ERR A;  3SY9 A;  5FP3 A;  3UUX B;  3NRX A;  5KDM C;  3N9N A;  1D0Y A;  5H6R B;  3DJB A;  5FY7 A;  3AA7 B;  2X9H A;  4JFB A;  2Y7S A;  4AYN A;  2XUE A;  4O4J E;  4IE0 A;  4AXP A;  2ZMA A;  1PRN A;  3ZC0 A;  4MHC A;  7PRN A;  3I9Y A;  3FYX A;  2RA1 A;  4RJX A;  2LFU A;  1ZHY A;  2IC6 A;  3PQS A;  2C5J A;  1QSD A;  4PNI A;  3HL6 A;  4QX7 B;  1ZHZ A;  4G2A A;  5L3G B;  4PK6 A;  4UVC B;  3K3N A;  1HF8 A;  2LOP A;  2QGS A;  4BJM A;  4DO0 A;  4EXT A;  3O1I A;  5HXS A;  5JQG E;  1AJ3 A;  1ZHW A;  3AAE B;  4PFO A;  1ZEE A;  2NW9 A;  2CLY B;  2ZM0 A;  4GYR A;  4YHJ A;  3AVR A;  5DL5 A;  4I55 E;  2ODJ A;  5LXT E;  3LK2 B;  2DWG A;  4LSI A;  2W61 A;  2H7V C;  3RRW A;  4WBN E;  4ZS2 A;  4DVD A;  3UFE A;  2NWB A;  4O3Y A;  4A56 A;  4AKI A;  2KDY A;  4JLE A;  3MA9 A;  5LBQ B;  4KUM B;  2ODU A;  4GCP A;  1US7 B;  3N9O A;  4U72 A;  2LE8 A;  3RYF E;  2KZ7 A;  4O4X A;  5F3J A;  5DL8 A;  3RX6 A;  2LHN A;  4TV9 E;  5LHI B;  1H7C A;  2CEA A;  2HPL A;  1D0Z A;  4IIJ E;  2BDE A;  1G90 A;  4MAL A;  4PFP A;  4E7S A;  2KIN B;  2NOX A;  3C64 A;  1GFQ A;  2XE5 A;  5D5D A;  2V7I A;  3N5L A;  1WR6 A;  4H9O C;  2KLQ A;  5LBM A;  3LK4 1;  3ZN0 B;  4CXY A;  2LSI A;  5LG4 A;  2W0G A;  3FHN A;  1HXX A;  3C98 B;  2JJ9 A;  3OKQ A;  4QHO A;  2HH7 A;  5JRC A;  5G26 A;  4QXB B;  4OK0 A;  3WI5 A;  3VE1 A;  3MK7 C;  4IE4 A;  3PTR B;  5KMG P;  1G8X A;  3SWH A;  2PRN A;  3I9W A;  3FBL A;  2YU2 A;  2XAF B;  4LSH A;  3V5S A;  3VU7 H;  3KBU A;  4Z3T A;  2G0U A;  4IE7 A;  4ZI2 D;  1YKE B;  1H6S 1;  3K8P C;  3CX6 B;  3VY8 X;  3CQX C;  1X79 A;  4CXX A;  4EIW A;  2VWA A;  2CWY A;  3LBX B;  4QWN B;  2LOS A;  4ANJ A;  1VRB A;  1HXT A;  4GCQ A;  3RYI E;  4AYM C;  4O3W A;  2XG6 A;  3AB3 B;  4GF4 A;  2KXP B;  4GOU A;  2CA5 A;  1YD8 G;  2CXF A;  5FYM A;  2WMO A;  1NWM X;  2NP9 A;  1P4T A;  2UXN B;  4G63 A;  2X67 A;  2X51 A;  4TV8 E;  4AKH A;  2H7O A;  3P8C D;  4NUV A;  2X68 A;  3PUR A;  3ZC1 A;  3ZYM A;  3A2S X;  3BK9 A;  3Q5X A;  2POR A;  2Q9Q B;  3TZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...