3AAEB

Crystal structure of actin capping protein in complex with carmil fragment
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
264
structure length
264
Chain Sequence
DQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
publication title Two distinct mechanisms for the regulation of actin capping protein-competitive or allosteric inhibitions
rcsb
source organism Gallus gallus
total genus 80
structure length 264
sequence length 264
chains with identical sequence D, F, H, J
ec nomenclature
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aaeB01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aaeB02
3AAEB 4AKRA 3AA1A 5AFUK 3AA0A 3LK41 2KZ7B 3AAAA 1IZNB 3LK2A 3LK42 2KXPA 3AA7A 3AA6A 5ADXK 3AA1B 4AKRB 5AFUL 3LK3A 3AA0B 3AAEA 3AAAB 3LK2B 2KXPB 2KZ7A 3AA7B 3AA6B 5ADXL 1IZNA 3LK3B
chains in the Genus database with same CATH superfamily
4LSIA 3IA3A 3AA1A 1BR4A 3ZEFB 1E2AA 2KWIB 4CI3B 2XAJB 1YD8G 1MIWA 3N9LA 4UEMA 4H9NC 4HFHA 1V9DA 2WZHA 4NIQA 2KC0A 2XJ7A 1GQEA 4GCSA 5DL7A 2YN6A 5ETWA 8PRNA 2UXCT 3RYIE 3DA4A 3PUXF 4CXXA 2WCAA 3CPZA 4UF0B 3PTRB 2XM1A 1UCUA 2VKJA 3JCFA 4IHJE 4X64T 3PQSA 3UU3A 4LFBT 1WLXA 4D5UA 1ORMA 4O4IE 2N2NA 5AQHB 2NR4A 2XQ6A 4B3RT 4H63H 1T1LA 2K5BB 5TAOA 4CTDA 3ONLC 2XE2A 5JRCB 2GK9A 3MZKB 1OEDA 3NJTA 7PRNA 3BQKA 2XE3A 5EK4A 4AISA 4ILBA 2H88A 2EHOA 3HA4A 3LK2B 4PW8A 2QA7A 4AXPA 4N59A 3AA6B 1BH3A 5FP3A 1W0BA 1SA0E 2JIWA 5ABGA 1W09A 5AQLB 1J1JA 4QH1A 4NXMT 2H7OA 4JI8T 4JI6T 4C00A 1MMNA 5JDFA 4V1Av 4FUVA 2IHR1 5AQGB 4YXDA 3KV6A 3PU3A 4XBFB 3TLUA 3POXA 5T5FA 2CE7A 2N2LA 1EZ3A 3PURA 4J2CA 2Y0HA 4CN6A 3AA0B 4GYRA 2BG9A 1HTJF 4TWFA 4GIWA 4RL9A 1OXZA 2X9WA 1IAPA 3BQLA 1UK5A 1QJ9A 4AKRA 5JQGE 2CWYA 1MMAA 2X51A 4ZI7E 2DHRA 1N33T 5HAXA 3RQUA 4LF5T 3ZN0B 5IYUA 2WSSV 4AKHA 1H7CA 4HFBA 3ZPOA 2VKHA 4I55E 3FZMB 5A1LA 4DV6T 4H9QC 4XAXB 3KFWX 3DTOA 4IDQA 3KV5A 2E9XC 5FNVE 4EB6E 5LNKA 3OTOT 4H9PC 4U3CA 2O4VA 1I94T 2K3WA 3NVOA 4YSYA 3PV0F 4EOZB 5G26A 2XTRA 4O3XB 1HCIA 5F8PA 3BS0A 4IE0A 3RKOA 4DR4T 2YKSA 4UXNB 4AQYT 5FKYA 3FXDB 4OK0A 1CUNA 1I6ZA 2VB6A 1FMWA 4K0KT 2H89A 4WYVA 4AIUA 4YFSA 2NWBA 3GP6A 2R8AA 4YJ2E 3T24A 4GCQA 3AE8A 2CXLA 4QKNA 2LOSA 3ZYMA 2XQ9A 4RLBA 1D1AA 2X9XA 2JJ9A 4HWIB 3A0BO 4UR9A 4JI2T 3RIAA 3N2KE 2CMRA 2J4GA 2B76A 3ETUA 3QUJA 3LFMA 3I0OA 4MHCA 2X9KA 3EMNX 2ZLYA 2W81C 4AKMA 4K3CA 1MM5A 3NZQA 4O3ZA 4PR7A 1THQA 4QXBB 4KRAA 4HFEA 4DV7T 1HR0T 4HWDA 4LSFA 5IHYA 3P7IA 2ZLDA 1Y01A 3V5SA 3DZMA 4UB6O 1S35A 3H3MA 2E9XD 4PFPA 1QJPA 5G39A 3DP7A 1GFNA 1WR6A 1KF6A 5JDPA 3UU6A 3C4XA 5HWXA 4DVDA 4FJOA 3B5MA 3AA7A 3HKDE 4KR4A 2MPKA 1VCTA 1YQ4A 2CHOA 3AE4A 3N9PA 3MA9A 2Y0KA 2V5DA 3B57A 1P4TA 3SOLA 4FOZA 3JAEA 4JI1T 1S94A 3AA0A 3O1HA 1UGOA 2X9HA 3AXJB 4GHBA 4AYNA 2YDQA 2W61A 2LLYA 2WBLA 1IBKT 2WJQA 5LA6E 2VVSA 2D9DA 3PUSA 2IUBA 4O4JE 3LBXA 2PRNA 3KBUA 2DLRA 4FSPA 1G90A 3AEAA 3UU2A 1WYBA 2LKHA 4C90A 1E54A 1GFMA 3V8UA 3FXEB 3VZUX 1YXRA 2WWVA 3AE3A 1L0VA 1BR2A 4O8SA 5FY0A 4NUUA 4XZCA 3ANWA 3F2EA 4QHOA 3RIUC 4NXNT 5AQRB 4EEBA 5LMUT 1OEDC 1IBMT 2X0LB 4DBQA 3SFEA 2QRXA 4DR2T 5LP6E 4X20E 3RGLA 4YTMA 2R88A 3CMLA 4GYSA 3HR0A 5L47A 2FJBA 5KX5E 4TWHA 4AKIA 3A0HO 2KMFA 5B66O 4ZZCA 3RI5A 3OKQA 5AQUB 2LKGA 4B61A 4G76A 3MACA 2LRLA 4HWFA 2LT3A 3TZGA 3OPCA 3ZMZB 1H6S1 4TX5A 2MHLA 3LK3A 2UU9T 4HGAA 2V6XA 4YY3T 1MIYA 2XQ4A 5H6RB 5ABEA 2PFVA 4KBMB 3TLSA 2JQYA 4X62T 2BS2A 5LBQB 4A5XA 3OVUA 5LXTE 4AKLA 4N75A 4O3YA 1G8XA 2AE9A 4O2AE 3PUAA 3RRCA 5KMGP 1DU2A 4C4VA 2UXBT 2OLTA 2BG9C 4DV5T 2W00A 2JMMA 1HX1B 4FSOA 4YSZA 5LJMA 3AE2A 4IL4A 4TV8E 5JDQA 3JC6D 4FZMA 1W9RA 2N9DA 2HH7A 4FT6A 3SZVA 1OEDB 1WYCA 1ZP0A 4FRTA 4U33A 2ACZA 3GWHA 4HFDA 5HYAA 4CN1A 4JI3T 1NEKA 5TISO 4EIWA 5JDLA 2EHOB 2VQET 1XDOA 3NWIA 5KDMC 2WVPA 2JMHA 4U7IA 2XQ7A 2EHOD 4E7ZA 5DL6A 3ZT7A 2L9QA 4LF8T 2D2SA 1J5WA 2BDEA 3PUQA 3E22E 3ABVA 5GV0A 3P8CD 4JEHB 4HEAA 2BBHA 4Z91A 3PQUA 4GCPA 4JCHA 1HNXT 2FJDA 3OBVE 2LSJA 2XQAA 4ADZA 2HPLA 4X66T 3FBLA 4G2AA 4IE4A 4I0UA 3EDUA 3C98B 2BBJA 3O9XA 3EABA 3BQIA 3ZYKA 5M4YA 1T7SA 3VHLA 4AKRB 4YHJA 4ILAA 1HFAA 4DR7T 4N78D 1HG2A 4K3BA 3WI4A 1HXXA 1ZHTA 2NTYA 4PK6A 2W63A 1HXTA 3QRCA 4U31A 3QK6A 2A3DA 2E5VA 3C5OA 1OSMA 4LMKA 2BKOA 3G7GA 1WCRA 4CI1B 4RJXA 5HXCA 4BJMA 2Q9QA 1UX5A 5GONE 2FBWA 4GKJT 1KNRA 3UUNA 4IIJE 2K9AA 4ZI2C 3AAIA 4JI5T 5BMVE 3CK6A 1XDPA 3AEDA 4HWHA 5L3CB 3FHNA 1QJ8A 4AFKA 2LHRA 2X9YA 4PJMA 3HW9A 3ZSSA 2C5IT 2LSYA 4GK5E 1MM4A 3PDYA 3SY7A 4LSHA 1JNZA 4KHPT 4QXCB 4ZS3A 2H3RA 2KXPB 2X66A 2F1CX 3KVAA 4JYAT 2HN1A 2WS3A 3GA8A 1VRBA 3POUA 2W2UA 4XNKA 1LVKA 4EYUA 2ES0A 3R84B 2DCFA 2D5UA 1UURA 3C4WA 3G06A 5HEGA 2K4TA 4DMVA 2RPAA 4UV9B 4HN9A 5FL0A 3K19A 3I9WA 2JQKA 3C64A 2MTQA 2LM9A 4QWNB 3UTKA 2BKPA 3RYHE 4DR6T 3K8PC 4B3MT 1NAFA 2J1NA 2Y6XA 2XY8B 2V7MA 2FGRA 4X1IE 4CXWA 1D0YA 4O4UA 5FMNA 3K1SA 3AAAA 4ZI2D 2Y7SA 5AQTB 2IWWA 3B13A 3UU4A 4JUYA 4EEDA 3ZSTA 2KT9A 4PAGA 3AA7B 1G73A 2M6IA 2JQHA 3ZJ1A 3P4SA 2ZMAA 3WI5A 2DL1A 3X1DA 1N34T 2V8SV 5HEHA 1XMQT 2VVNA 4EXTA 4PNIA 2WU2A 4JLEA 4PJJA 2VWAA 2W0GA 3CWZB 5G38A 4AYEC 3UUMA 3BRZA 3ONXA 2AXDS 5AQQB 3H3AA 4LF7T 3EAMA 5KAIO 3LBXB 3ZLIA 5JDGA 2ZM0A 2E5LT 4TUYE 3HWBA 2KSRA 2K24A 5AQKB 5GTIO 4LMLA 3AB3B 2XQ5A 1U5PA 3ANWB 5LHIB 4QH5A 2DWKA 1B7TA 2UXDT 4FQEA 5FYMA 1W0AA 3FBZA 3VZTX 1Q9GA 2XM2A 1MNEA 5LG4A 3VR8A 3SWHA 2XAHB 2KZ7A 2WJRA 2XAQB 2QTKA 4EZ4A 2X0YA 2N2MA 1YQ3A 1PRNA 4HWCA 3FZHB 3C50A 4U74A 1BT9A 2DI4A 2KXPA 3FYXA 2OV9A 4GKKT 1HF8A 4CN4A 3J7Yq 1T8BA 3MJXA 3DWNA 4RJWA 2ZM8A 3ZN1B 4OHFA 4ASKA 3RC8A 1J5ET 3OYZA 3LK3B 2F1VA 3K3QC 3MXZA 3SYBA 2B1EA 1HS7A 4ZEYA 1FJGT 1GFOA 5JVDE 5AQNB 4FZLA 4D64A 3VR9A 2W66A 3LSVA 1IZNA 3Q5EA 4KX6A 4EGWA 3NRXA 1N32T 2J47A 3N5LA 3ZMVB 4C4VB 2X27X 3UFEA 2FUPA 2M06A 3PRNA 3POQA 4JI7T 4L0RA 2WDRA 3M3ZB 4DV4T 4IL9A 3RIFA 3PU8A 5CB4E 4TZ4C 5HXSA 3VE1A 5EZYE 3VY8X 4IT4A 3NSGA 5E79O 5JR9A 2WDQA 5AQOB 3AE6A 4UVAB 1R8IA 2RP4A 2XTQA 1KFYA 1IBLT 2MAWA 2CLYC 4I50E 4IE5A 1HX8A 5HWYA 4TWDA 1UX4A 3PGSA 5BR8T 2J1DG 3QOFA 3NRYA 2V26A 5F5WA 3HKCE 4YLHA 3N9MA 1MMDA 5L3FB 3P50A 3PJAJ 3GN5A 4KI0F 5IYZE 2MYSA 1X79A 3KV4A 3QB5K 2M07A 2IDOB 2HN2A 3TKLB 5L3EB 2L3LA 3KVBA 2PJQA 2IMLA 2KNDA 3FZKB 3WU2O 1D0ZA 3IBPA 2WY2A 5IUXA 3T20A 2JQQA 2ZM6T 2DWGA 5FXXA 1N36T 2LOPA 4OX9T 4GF4A 3A5XA 5B5EO 4UIGA 3JC6C 2J62A 2JMKA 1E1HB 2VKOA 3DJBA 1WR0A 4NPPA 4HTEA 4QX7B 4BA9A 3TLTA 2VKDA 1D1BA 5L3BB 2VL8A 3UPGA 3C4ZA 3U3IA 5DJQC 3AEGA 3F57A 4DMWA 2EHOC 3Q5DA 2Q9QB 1T16A 4LF4T 2C5KT 4HFIA 3PE0A 4E1TA 2CLYB 2LJLA 2WP9A 4XNLA 4ZI3C 1MMGA 4HE8A 3FZLB 5L4EA 4DR3T 3DA3A 2YDSA 3EDVA 2ODUA 3ZC1A 3PF1A 4YHHT 1QUUA 2YDRA 3ETVA 2LHFA 2XMXA 3GMIA 1NENA 2BS4A 2XAGB 4YTPA 3Q2MA 5KXJA 1YKHB 2C5JA 3I0QA 4ISSA 2YPVA 4FI5A 4IE7A 4EYYR 2LSIA 4EAHA 3PUWF 3K3OA 5FY7A 3LK41 5EE2A 1CHUA 1YS5A 5ABFA 2NP9A 5FVKA 2XQ3A 4DV2T 3UU5A 3AAEA 3VKGA 2CXDA 2NW8A 4IE6A 4ZXLA 1GFPA 3CX7B 3TLWA 5AQFB 5AQPB 3FB2A 4PJLA 3RX6A 4AZLA 4EZHA 4FESA 4AYMC 1ZOYA 2BZBA 2P9BA 5FVNA 4LF9T 4ZS2A 5HXEA 2NOXA 5G3AA 3RBHA 4YSXA 4UVCB 5AQSB 4M1PA 5EK2A 1BR0A 2PBIA 4DUYT 4DBRA 5AQIB 2XPKA 4U2ZA 3KBTA 2OA5A 4JEUB 3PGRA 2E9XA 3UU8A 2LE8A 2XSAA 4MALA 1S5LO 3CKDA 4N74A 2LFUA 1IJ6A 2R4OA 1ZHXA 3NKZA 3Q5WA 3V5UA 3AAAB 4Q25A 5FXZA 4ZI3D 2WDVA 5JH7E 3F31A 1XMOT 2WB5A 3O4XE 3ZT5A 4DNDA 4DIDB 1M62A 2YEVC 3CQXC 2X0HA 4O3WA 3ESLA 5PRNA 4A98A 2SPCA 4QX8B 4DO0A 4YJ3E 5AQMB 3D0TA 4CI2B 1QSDA 1HG5A 2C0SA 2HHHT 4E1SA 1XZYA 2CCQA 4WW0A 5DQWA 2WMOA 4KR8A 2QYWA 2CWOA 3KDSE 4C69X 4WNKA 4DR5T 5FY1A 5DL8A 3PUGA 4B6XA 3UQ4A 2Y8DA 4FMSA 5HEOA 1LRZA 5H6QB 4UV8B 5GTHO 2V7LA 3NBXX 2XG6A 3N2GE 3A8YC 4IL6O 3CIRA 2CA5A 5LB7B 1HNWT 2BKNA 3TLVA 5LGNB 2W80C 4I43B 5LMNT 3BK9A 2LM2A 3HKEE 3N2OA 2WQYA 5LOVE 4O49A 2K0LA 3RPUA 3IHRA 2V7IA 2KZ7B 3N9NA 4OYKA 4O4XA 3N9QA 2UUAT 3UAQA 5JR9C 4IDPA 3LJCA 2FJAA 2KINB 3RKGA 4P0AA 3DWOX 3KVDD 1ZHCA 2BVMA 4A56A 3VZWX 3CQCB 4H9OC 4ILUA 2Y0LA 3JTYA 2CBIA 4U9CA 1ZKEA 2CBJA 2A2FX 5JDMA 5L2LA 1VCSA 1Z8UA 4G63A 4X65T 3VY9X 5HXHA 5J2UE 2VK9A 4AYID 5LG3A 2NTXA 2QGSA 3J9X1 2F1TA 4G75A 3C51A 3L8RA 4U72A 1T98A 1BXWA 5J1GA 3VRBA 2CRBA 4TV9E 5C8YE 2LSKA 3ZMTB 2XQ8A 1IZNB 2ZFGA 2D0UA 2RA1A 1D0XA 4BAYB 4WBNE 2CEAA 3RF1A 5FXWA 2E2AA 2YNKA 4ZZBA 3AVSA 2IIUA 4K0UA 3RIUA 4WZXA 4CQIA 4QXHB 3RQWA 5LGUB 3HOLA 2IC9A 1ZEEA 2H7VC 4IDNA 4X1KE 2XSBA 3P4RA 3E0ZA 4ILCA 3KV9A 2WWUA 2XTLA 5ADXK 2M67A 4Z90A 5JR9B 5AQVB 3ZCIA 4U2YA 4KHZF 2ODJA 4O2BE 1HNZT 5J0ZA 1FIOA 4JBWF 3WI3A 2X67A 3AE5A 3JAFA 5LGTB 2LSGA 4UVBB 2ZM2A 2I0MA 3P4PA 4BUMX 5C2TA 3R6NA 2R89A 2ERVA 3ZJ2A 2W67A 4LFAT 3AE9A 5ADXL 5DL5A 3A2SX 4EV6A 3GN5B 1OEDE 2OMFA 3VE2A 4OYJA 4AQGA 2AXTO 2F4VT 2ACXA 1JNRA 5JTGA 2HPJA 3E08A 4X5TA 2IAKA 2PORA 1ZHYA 1BR1A 2LRKA 4LF6T 4DR1T 2I6HA 3O1JA 4P09A 4IDOA 3VKHA 4COFA 4YTNA 5L4HA 3RYFE 3HOEA 5C3JA 4AI6A 4UELA 2V6YA 1MNDA 3L3PA 1WFDA 3HI2A 4DV0T 2CPTA 3BRYA 3K3NA 1SUMB 4PUXA 2CHNA 1OPFA 2XASB 2MOZA 4L5GA 3SS1A 2WU5A 3RRWA 3Q5XA 1LKXA 2XE5A 2XZEA 4CZZB 3LK42 2QVAA 3UQ7A 4ZOLE 4AQFA 1YKEB 2BG9E 3FZFB 2DNXA 2WAUA 3PUZF 2GE4A 1XNRT 4AYDC 1X9BA 1ZHZA 2KDYA 4C91A 3H37A 3OJAA 3AVRA 1WRDA 4MLKA 5CA1E 2XAFB 3SRZA 3A7MA 3RYCE 3ZMUB 1ZV4X 1NWMX 3HKBE 2XUEA 5CGMA 4UF0A 2Z6EA 4TNVA 4PJ0O 3CX6B 2LEHA 4AUIA 3PUYF 3JADA 5ABFB 3M65A 3W15B 4IDZA 1MPFA 3AAEB 3P4WA 4H9RC 3JCUO 3CVRA 2L8KA 2VL0A 2W4XA 2PTFA 3QC9A 3KZIO 4Z3TA 5JDNA 2V7JA 3L39A 3SYSA 3T8OA 5JRCA 1U4QA 4F8HA 1XNQT 4A97A 2Y2XA 1US7B 4JFBA 1KNPA 5LHHB 4N58A 3SZDA 4U7YA 3PUVF 4B3ST 2IW5B 3AE1A 3LG7A 3LK2A 4P1NA 2E9XB 3AA6A 3UUBA 2BS3A 3MKDA 4PJNA 4MBQA 3I1AA 2Q9QC 4PK4A 4KUMB 3AEEA 5LBMA 2Y48B 3WAJA 2J4UP 5HCMA 2VURA 5AFUK 2JQ9A 5EK3A 2R4NA 2WMNA 3QNUA 2K48A 2WZIA 5CA0E 5D5DA 5LYJE 4JV5T 2G0UA 5KAFO 4NUVA 3U78A 5FVLA 3O0EA 4X1YE 3RHWA 1MIVA 3LDQB 4JI0T 3NZPA 2FGQX 2NW7A 1SHZC 5AFUL 3OYXA 4O4LE 1Q9FA 4D65A 4GOUA 4KP3C 5IWAT 2IWVA 3ZYLA 5HXRA 1XWMA 2XQYA 4QQ1A 5L3GB 2UXXB 3MK7C 5HCJA 3L09A 3VU7H 3UULA 4ANJA 3ZCJA 4QH4A 4DV3T 1M7KA 1PHOA 2BVLA 2X68A 2R6GF 2VASA 2Q9QD 5L3DB 2CM0A 3RH3A 2I59A 4ERRA 3AA1B 1FEWA 4RLCA 5FL1A 4TN7B 3QB5A 3RLFF 2UUCT 2YK0A 1Y64B 1LVFA 4P0BA 2D0TA 5ABHA 1YW0A 3UT5E 3P4QA 2A9UA 4LMJA 3ZMSB 4PFOA 2V1DB 5JREA 3PGUA 1VOMA 3ZT6A 5LHGB 3SY9A 4E7SA 1UUSA 4AKGA 4B3TT 1T72A 1KEYA 2E8IA 2YINA 4F4BA 4MFRA 4Z8XA 5HEUA 2XE1A 5E0OA 3I9YA 5CFBA 1KNZA 4LSEA 3S4UA 2M6BA 4YT0A 3AE7A 4FRXA 2A72A 2JRKA 1SE7A 3PORA 2R4LA 4H9SE 2V5CA 3EVYA 4ISTA 3QRAA 5DQVA 2FJEA 3IEEA 3UFGA 4WBOA 3KINB 2V7KA 4I4TE 1AJ3A 4FZNA 3RC3A 3VRAA 1Z0PA 2YU2A 3AEFA 3AECA 5FXVA 2JPFA 3ONJA 4TNWA 2MNHA 3IF8B 4JI4T 5J2TE 2KWHA 3AEBA 2W62A 1D1CA 3T1HT 5CJ5A 3ZKRA 3CQGB 4GK0E 1GFQA 2MBGA 2IC6A 4O4HE 5LJNA 2NW9A 4DV1T 3EI0A 2VQFT 2LHNA 2PG8A 4HKAA 1E7PA 2UUBT 5H2FO 4IGUA 4OFZA 4AQFC 5HEJA 5JDHA 3T1YT 3AXJA 4HFVA 3UUXB 2YU1A 2N1GA 3EUHA 3O1IA 3PJAA 3WAKA 3Q9DA 1ZHWA 5AQJB 1IJ5A 4L9IA 3EHZA 4ZHQE 5F3JA 5DABA 2XHEB 4F6RC 3CX8B 3ZC0A 2CXFA 2ODVA 4BJNA 2KLQA 1O3XA 4HFCA 4UB8O 2BG9B 4H63V 2YOEA 1QLBA 3HL6A 2R4PA 2UXNB 3N9OA 4LFCT 4CXYA 1OWAA 5LCYA 6PRNA 2V6YB 4IREA 1KK7A 1HXUA 2WM9A 4KMCA 4PK5A 3T0SA 4DUZT 1FMVA 3SFDA
chains in the Genus database with same CATH topology
3VE2A 4OYJA 4AQGA 4LSIA 5HXSA 3VE1A 5EZYE 3AA1A 2ACXA 3VY8X 3NSGA 5LXTE 4AKLA 5JR9A 2HPJA 1BR4A 3E08A 4UVAB 3ZEFB 1G8XA 4O3YA 2RP4A 2XTQA 2IAKA 4O2AE 2PORA 2KWIB 3PUAA 3RRCA 5KMGP 1BR1A 1ZHYA 4CI3B 2XAJB 1YD8G 2CLYC 4I50E 4IE5A 1HX8A 2W00A 3O1JA 1MIWA 1UX4A 4P09A 5HWYA 2JMMA 3N9LA 3VKHA 4FSOA 2J1DG 4UEMA 4H9NC 3RYFE 1V9DA 3HOEA 4AI6A 4UELA 5LJMA 4TV8E 1MNDA 3NRYA 5JDQA 2V26A 3JC6D 3L3PA 4FZMA 2KC0A 2N9DA 3HKCE 2HH7A 4YLHA 4FT6A 3N9MA 1MMDA 3SZVA 5L3FB 1WYCA 3HI2A 4GCSA 5DL7A 4FRTA 3GN5A 5ETWA 5IYZE 8PRNA 3K3NA 3GWHA 3RYIE 4PUXA 2MYSA 1X79A 1OPFA 2XASB 5HYAA 3KV4A 3DA4A 2M07A 2MOZA 4CXXA 4L5GA 3SS1A 3CPZA 3TKLB 5L3EB 4UF0B 4EIWA 3PTRB 5JDLA 3RRWA 2EHOB 3Q5XA 2L3LA 3KVBA 2PJQA 1UCUA 2KNDA 2VKJA 5KDMC 4IHJE 2JMHA 3PQSA 1D0ZA 1LKXA 2EHOD 3IBPA 2XE5A 1WLXA 4E7ZA 5DL6A 2L9QA 4D5UA 4CZZB 1ORMA 2D2SA 3LK42 3T20A 2JQQA 2BDEA 3PUQA 4O4IE 2N2NA 4ZOLE 4AQFA 3E22E 1YKEB 2DWGA 5FXXA 4H63H 2LOPA 5GV0A 3P8CD 2K5BB 4JEHB 3A5XA 5TAOA 4GF4A 4UIGA 2DNXA 3JC6C 2WAUA 2JMKA 1E1HB 2VKOA 2XE2A 5JRCB 2GE4A 3DJBA 2GK9A 3MZKB 4AYDC 1ZHZA 2KDYA 4C91A 3H37A 3OJAA 4HTEA 4QX7B 4BA9A 3AVRA 1WRDA 7PRNA 2VKDA 4MLKA 5CA1E 1D1BA 4HEAA 2XAFB 5L3BB 2VL8A 3SRZA 3PQUA 3BQKA 4GCPA 2XE3A 3UPGA 5EK4A 3RYCE 4JCHA 3C4ZA 3ZMUB 1ZV4X 1NWMX 3HKBE 2XUEA 3OBVE 4UF0A 2Z6EA 2EHOA 3HA4A 3CX6B 2LEHA 4AUIA 3U3IA 5DJQC 3LK2B 2LSJA 3F57A 4PW8A 4DMWA 2EHOC 2QA7A 4ADZA 2HPLA 4AXPA 4N59A 3M65A 3AA6B 1BH3A 2Q9QB 3W15B 2C5KT 5FP3A 3FBLA 4IDZA 1MPFA 3AAEB 3PE0A 4H9RC 4E1TA 4G2AA 2CLYB 2L8KA 2LJLA 3CVRA 4IE4A 4XNLA 4ZI3C 1MMGA 3EDUA 3C98B 3O9XA 3BQIA 3ZYKA 1SA0E 3QC9A 4HE8A 4Z3TA 5M4YA 5JDNA 2V7JA 3DA3A 3SYSA 3T8OA 3VHLA 5JRCA 4AKRB 4YHJA 3EDVA 1U4QA 2ODUA 1HFAA 3ZC1A 3HOLA 2H7OA 2Y2XA 1QUUA 3ETVA 4N78D 2LHFA 1HG2A 2XMXA 3WI4A 3GMIA 1HXXA 1ZHTA 1US7B 1MMNA 2XAGB 4JFBA 3Q2MA 5JDFA 2NTYA 4V1Av 5LHHB 1YKHB 2C5JA 4PK6A 3I0QA 4ISSA 4FUVA 2YPVA 2W63A 1HXTA 3QRCA 4FI5A 4N58A 3QK6A 3SZDA 4IE7A 3KV6A 3PU3A 4EYYR 2A3DA 4XBFB 2LSIA 3C5OA 4EAHA 1OSMA 3POXA 5T5FA 3K3OA 5FY7A 2IW5B 2CE7A 3LK41 3G7GA 3LG7A 5EE2A 1YS5A 2N2LA 3LK2A 2NP9A 1EZ3A 3PURA 4CI1B 4RJXA 5HXCA 4BJMA 4J2CA 2Y0HA 2E9XB 3AA6A 2Q9QA 3MKDA 1UX5A 4PJNA 5GONE 3AA0B 4MBQA 3I1AA 2Q9QC 4GYRA 4PK4A 3UUNA 4IIJE 2K9AA 2CXDA 2NW8A 4IE6A 3VKGA 4ZI2C 1HTJF 3AAIA 5BMVE 1GFPA 4GIWA 4KUMB 3CX7B 4RL9A 5L3CB 3FB2A 3FHNA 4PJLA 3RX6A 1OXZA 2Y48B 5LBMA 4EZHA 2X9WA 3WAJA 1IAPA 1QJ8A 4FESA 3BQLA 4AYMC 4AFKA 2BZBA 1QJ9A 2P9BA 2J4UP 2LHRA 4AKRA 2X9YA 4PJMA 5FVNA 5AFUK 5JQGE 2CWYA 3HW9A 1MMAA 4ZS2A 5HXEA 2C5IT 2LSYA 2X51A 5EK3A 4GK5E 4ZI7E 1MM4A 2DHRA 2NOXA 3PDYA 2WMNA 5HAXA 3SY7A 4LSHA 3ZN0B 4QXCB 3RBHA 5IYUA 2K48A 4UVCB 2WSSV 5CA0E 4AKHA 5D5DA 1H7CA 4M1PA 5EK2A 5LYJE 1BR0A 2G0UA 3ZPOA 2VKHA 2PBIA 4ZS3A 2H3RA 4I55E 4DBRA 2KXPB 2X66A 3KVAA 3KBTA 2OA5A 5A1LA 4NUVA 4JEUB 3U78A 2E9XA 3O0EA 3GA8A 4H9QC 1VRBA 2LE8A 4XAXB 3KFWX 4X1YE 3DTOA 1MIVA 4MALA 3KV5A 2E9XC 5FNVE 4EB6E 3POUA 5LNKA 3CKDA 4H9PC 2O4VA 1LVKA 4XNKA 4EYUA 3NZPA 2FGQX 2ES0A 2LFUA 1IJ6A 2NW7A 3R84B 1ZHXA 2DCFA 4EOZB 2D5UA 1SHZC 5G26A 3C4WA 5AFUL 3OYXA 2XTRA 2K4TA 3Q5WA 4O4LE 3V5UA 4O3XB 1HCIA 5F8PA 1Q9FA 3AAAB 4IE0A 3RKOA 5FXZA 4D65A 4ZI3D 4GOUA 4DMVA 5JH7E 4UXNB 3F31A 4UV9B 4KP3C 4HN9A 5HXRA 3ZYLA 3FXDB 4OK0A 3K19A 1CUNA 2XQYA 3I9WA 3O4XE 3C64A 2VB6A 2MTQA 4DNDA 2LM9A 1FMWA 4QQ1A 5L3GB 2UXXB 2YEVC 4QWNB 3CQXC 3UTKA 3MK7C 4O3WA 4YFSA 3L09A 2NWBA 3VU7H 3ESLA 5PRNA 3RYHE 3UULA 3GP6A 4ANJA 3ZCJA 2SPCA 4QX8B 4YJ2E 4DO0A 3T24A 4GCQA 3K8PC 4YJ3E 2CXLA 1NAFA 1PHOA 2BVLA 2LOSA 4QKNA 2J1NA 3ZYMA 2Y6XA 4RLBA 2V7MA 2X68A 3D0TA 1D1AA 2FGRA 2X9XA 4CI2B 1QSDA 2JJ9A 1HG5A 2VASA 2C0SA 4E1SA 4X1IE 4CXWA 1D0YA 4O4UA 3AAEA 5FMNA 3N2KE 2CCQA 2CMRA 2Q9QD 5L3DB 3AAAA 4ZI2D 2Y7SA 4WW0A 2CM0A 2WMOA 5DQWA 3ETUA 3QUJA 3RH3A 4KR8A 2CWOA 2I59A 3B13A 3KDSE 3LFMA 4C69X 4WNKA 4ERRA 3I0OA 3AA1B 1FEWA 4JUYA 4MHCA 5FY1A 4RLCA 5DL8A 3EMNX 3PUGA 4TN7B 4B6XA 2ZLYA 2YK0A 2W81C 4AKMA 2Y8DA 2KT9A 1Y64B 4PAGA 1MM5A 3AA7B 1LVFA 4FMSA 1LRZA 4P0BA 2D0TA 5H6QB 3NZQA 1YW0A 4UV8B 4O3ZA 3UT5E 1THQA 4QXBB 4KRAA 1G73A 3ZJ1A 3ZMSB 4PFOA 2V7LA 2ZMAA 2V1DB 4LSFA 5JREA 3NBXX 1VOMA 3WI5A 2XG6A 3N2GE 5LHGB 5IHYA 3P7IA 4E7SA 2ZLDA 3SY9A 4AKGA 2CA5A 3V5SA 1S35A 5LGUB 4EXTA 2E9XD 2E8IA 2YINA 4PFPA 4F4BA 1QJPA 4MFRA 4Z8XA 5LGNB 2W80C 4PNIA 4JLEA 3DP7A 4PJJA 4I43B 1GFNA 2VWAA 3I9YA 3BK9A 5E0OA 2W0GA 2XE1A 3CWZB 3HKEE 3N2OA 1WR6A 1KNZA 4AYEC 3UUMA 5LOVE 4O49A 2K0LA 3RPUA 5JDPA 3IHRA 3ONXA 3C4XA 5HWXA 4LSEA 2V7IA 2KZ7B 3N9NA 4DVDA 3S4UA 3H3AA 2OMFA 4OYKA 4O4XA 4FJOA 3N9QA 3AA7A 3UAQA 5JR9C 3LBXB 3HKDE 3ZLIA 2A72A 4FRXA 5JDGA 2JRKA 4KR4A 3LJCA 2ZM0A 2KINB 4P0AA 3KVDD 4TUYE 3HWBA 3PORA 1ZHCA 2BVMA 3N9PA 4H9SE 3EVYA 3MA9A 4A56A 2Y0KA 2K24A 4ISTA 3QRAA 3VZWX 3CQCB 3B57A 5DQVA 4H9OC 3IEEA 4ILUA 2Y0LA 3JTYA 3AB3B 4WBOA 1P4TA 3SOLA 3KINB 2V7KA 4I4TE 1AJ3A 4FZNA 4U9CA 1ZKEA 4FOZA 2A2FX 3RC3A 1Z0PA 2YU2A 1U5PA 1S94A 5JDMA 5L2LA 3AA0A 3O1HA 2X9HA 3ANWB 4G63A 4GHBA 3VY9X 4AYNA 5LHIB 5FXVA 2DWKA 1B7TA 2JPFA 5HXHA 5J2UE 2VK9A 2W61A 4AYID 5FYMA 3FBZA 2MNHA 3VZTX 3IF8B 2WBLA 2NTXA 1Q9GA 5J2TE 1MNEA 5LA6E 2QGSA 5LG4A 2KWHA 3J9X1 2F1TA 3PUSA 4AZLA 4G75A 2W62A 3SWHA 2XAHB 1D1CA 2KZ7A 4O4JE 3C51A 3CQGB 2XAQB 4GK0E 1GFQA 2MBGA 2IC6A 4U72A 1T98A 3LBXA 4O4HE 4EZ4A 2PRNA 2QTKA 3KBUA 5LJNA 1BXWA 2DLRA 5J1GA 2NW9A 1PRNA 2N2MA 4FSPA 1G90A 4TV9E 5C8YE 2LSKA 3ZMTB 2LHNA 3C50A 1IZNB 2PG8A 4U74A 3UU2A 4HKAA 2ZFGA 2D0UA 2RA1A 1BT9A 1WYBA 1D0XA 2DI4A 4BAYB 4WBNE 2KXPA 2CEAA 4C90A 1E54A 5FXWA 1GFMA 2YNKA 3V8UA 3FXEB 4IGUA 3AVSA 3FYXA 1HF8A 3J7Yq 4OFZA 4AQFC 3VZUX 3MJXA 4K0UA 4RJWA 5JDHA 2ZM8A 4CQIA 4QXHB 3ZN1B 4OHFA 1BR2A 4O8SA 5FY0A 4NUUA 4XZCA 3ANWA 3F2EA 4HFVA 4QHOA 4ASKA 3OYZA 2IC9A 1ZEEA 3UUXB 3RC8A 2YU1A 2H7VC 3LK3B 2N1GA 3EUHA 3O1IA 2F1VA 3K3QC 3WAKA 2X0LB 4DBQA 4X1KE 3Q9DA 3MXZA 3E0ZA 1ZHWA 3SYBA 2B1EA 1HS7A 5LP6E 1IJ5A 4X20E 4L9IA 1GFOA 3CMLA 3KV9A 5JVDE 2WWUA 2XTLA 4GYSA 5ADXK 3HR0A 4ZHQE 5F3JA 4FZLA 4D64A 5KX5E 5DABA 2XHEB 4F6RC 3CX8B 2M67A 3ZC0A 5JR9B 4AKIA 2CXFA 2ODVA 4BJNA 3ZCIA 2KMFA 1IZNA 2KLQA 3OKQA 1O3XA 3NRXA 2ODJA 4O2BE 4H63V 3N5LA 3ZMVB 4B61A 4G76A 3HL6A 3MACA 2X27X 2UXNB 1FIOA 3N9OA 3WI3A 2LT3A 2X67A 3UFEA 3TZGA 5LGTB 2LSGA 3ZMZB 1H6S1 4TX5A 4UVBB 2ZM2A 2M06A 4CXYA 3POQA 3PRNA 1OWAA 5LCYA 4L0RA 2MHLA 6PRNA 3LK3A 4BUMX 4HGAA 3R6NA 1MIYA 5H6RB 2ERVA 1KK7A 3ZJ2A 1HXUA 2WM9A 2PFVA 4KMCA 4KBMB 4PK5A 5ADXL 3T0SA 1FMVA 3PU8A 5DL5A 3A2SX 5CB4E 3GN5B 4TZ4C 5LBQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAE B;  4AKR A;  3AA1 A;  5AFU K;  3AA0 A;  3LK4 1;  2KZ7 B;  3AAA A;  1IZN B;  3LK2 A;  3LK4 2;  2KXP A;  3AA7 A;  3AA6 A;  5ADX K;  3AA1 B;  4AKR B;  5AFU L;  3LK3 A;  3AA0 B;  3AAE A;  3AAA B;  3LK2 B;  2KXP B;  2KZ7 A;  3AA7 B;  3AA6 B;  5ADX L;  1IZN A;  3LK3 B; 
#chains in the Genus database with same CATH topology
 4LSI A;  3IA3 A;  3AA1 A;  1BR4 A;  3ZEF B;  1E2A A;  2KWI B;  4CI3 B;  2XAJ B;  1YD8 G;  1MIW A;  3N9L A;  4UEM A;  4H9N C;  4HFH A;  1V9D A;  2WZH A;  4NIQ A;  2KC0 A;  2XJ7 A;  1GQE A;  4GCS A;  5DL7 A;  2YN6 A;  5ETW A;  8PRN A;  2UXC T;  3RYI E;  3DA4 A;  3PUX F;  4CXX A;  2WCA A;  3CPZ A;  4UF0 B;  3PTR B;  2XM1 A;  1UCU A;  2VKJ A;  3JCF A;  4IHJ E;  4X64 T;  3PQS A;  3UU3 A;  4LFB T;  1WLX A;  4D5U A;  1ORM A;  4O4I E;  2N2N A;  5AQH B;  2NR4 A;  2XQ6 A;  4B3R T;  4H63 H;  1T1L A;  2K5B B;  5TAO A;  4CTD A;  3ONL C;  2XE2 A;  5JRC B;  2GK9 A;  3MZK B;  1OED A;  3NJT A;  7PRN A;  3BQK A;  2XE3 A;  5EK4 A;  4AIS A;  4ILB A;  2H88 A;  2EHO A;  3HA4 A;  3LK2 B;  4PW8 A;  2QA7 A;  4AXP A;  4N59 A;  3AA6 B;  1BH3 A;  5FP3 A;  1W0B A;  1SA0 E;  2JIW A;  5ABG A;  1W09 A;  5AQL B;  1J1J A;  4QH1 A;  4NXM T;  2H7O A;  4JI8 T;  4JI6 T;  4C00 A;  1MMN A;  5JDF A;  4V1A v;  4FUV A;  2IHR 1;  5AQG B;  4YXD A;  3KV6 A;  3PU3 A;  4XBF B;  3TLU A;  3POX A;  5T5F A;  2CE7 A;  2N2L A;  1EZ3 A;  3PUR A;  4J2C A;  2Y0H A;  4CN6 A;  3AA0 B;  4GYR A;  2BG9 A;  1HTJ F;  4TWF A;  4GIW A;  4RL9 A;  1OXZ A;  2X9W A;  1IAP A;  3BQL A;  1UK5 A;  1QJ9 A;  4AKR A;  5JQG E;  2CWY A;  1MMA A;  2X51 A;  4ZI7 E;  2DHR A;  1N33 T;  5HAX A;  3RQU A;  4LF5 T;  3ZN0 B;  5IYU A;  2WSS V;  4AKH A;  1H7C A;  4HFB A;  3ZPO A;  2VKH A;  4I55 E;  3FZM B;  5A1L A;  4DV6 T;  4H9Q C;  4XAX B;  3KFW X;  3DTO A;  4IDQ A;  3KV5 A;  2E9X C;  5FNV E;  4EB6 E;  5LNK A;  3OTO T;  4H9P C;  4U3C A;  2O4V A;  1I94 T;  2K3W A;  3NVO A;  4YSY A;  3PV0 F;  4EOZ B;  5G26 A;  2XTR A;  4O3X B;  1HCI A;  5F8P A;  3BS0 A;  4IE0 A;  3RKO A;  4DR4 T;  2YKS A;  4UXN B;  4AQY T;  5FKY A;  3FXD B;  4OK0 A;  1CUN A;  1I6Z A;  2VB6 A;  1FMW A;  4K0K T;  2H89 A;  4WYV A;  4AIU A;  4YFS A;  2NWB A;  3GP6 A;  2R8A A;  4YJ2 E;  3T24 A;  4GCQ A;  3AE8 A;  2CXL A;  4QKN A;  2LOS A;  3ZYM A;  2XQ9 A;  4RLB A;  1D1A A;  2X9X A;  2JJ9 A;  4HWI B;  3A0B O;  4UR9 A;  4JI2 T;  3RIA A;  3N2K E;  2CMR A;  2J4G A;  2B76 A;  3ETU A;  3QUJ A;  3LFM A;  3I0O A;  4MHC A;  2X9K A;  3EMN X;  2ZLY A;  2W81 C;  4AKM A;  4K3C A;  1MM5 A;  3NZQ A;  4O3Z A;  4PR7 A;  1THQ A;  4QXB B;  4KRA A;  4HFE A;  4DV7 T;  1HR0 T;  4HWD A;  4LSF A;  5IHY A;  3P7I A;  2ZLD A;  1Y01 A;  3V5S A;  3DZM A;  4UB6 O;  1S35 A;  3H3M A;  2E9X D;  4PFP A;  1QJP A;  5G39 A;  3DP7 A;  1GFN A;  1WR6 A;  1KF6 A;  5JDP A;  3UU6 A;  3C4X A;  5HWX A;  4DVD A;  4FJO A;  3B5M A;  3AA7 A;  3HKD E;  4KR4 A;  2MPK A;  1VCT A;  1YQ4 A;  2CHO A;  3AE4 A;  3N9P A;  3MA9 A;  2Y0K A;  2V5D A;  3B57 A;  1P4T A;  3SOL A;  4FOZ A;  3JAE A;  4JI1 T;  1S94 A;  3AA0 A;  3O1H A;  1UGO A;  2X9H A;  3AXJ B;  4GHB A;  4AYN A;  2YDQ A;  2W61 A;  2LLY A;  2WBL A;  1IBK T;  2WJQ A;  5LA6 E;  2VVS A;  2D9D A;  3PUS A;  2IUB A;  4O4J E;  3LBX A;  2PRN A;  3KBU A;  2DLR A;  4FSP A;  1G90 A;  3AEA A;  3UU2 A;  1WYB A;  2LKH A;  4C90 A;  1E54 A;  1GFM A;  3V8U A;  3FXE B;  3VZU X;  1YXR A;  2WWV A;  3AE3 A;  1L0V A;  1BR2 A;  4O8S A;  5FY0 A;  4NUU A;  4XZC A;  3ANW A;  3F2E A;  4QHO A;  3RIU C;  4NXN T;  5AQR B;  4EEB A;  5LMU T;  1OED C;  1IBM T;  2X0L B;  4DBQ A;  3SFE A;  2QRX A;  4DR2 T;  5LP6 E;  4X20 E;  3RGL A;  4YTM A;  2R88 A;  3CML A;  4GYS A;  3HR0 A;  5L47 A;  2FJB A;  5KX5 E;  4TWH A;  4AKI A;  3A0H O;  2KMF A;  5B66 O;  4ZZC A;  3RI5 A;  3OKQ A;  5AQU B;  2LKG A;  4B61 A;  4G76 A;  3MAC A;  2LRL A;  4HWF A;  2LT3 A;  3TZG A;  3OPC A;  3ZMZ B;  1H6S 1;  4TX5 A;  2MHL A;  3LK3 A;  2UU9 T;  4HGA A;  2V6X A;  4YY3 T;  1MIY A;  2XQ4 A;  5H6R B;  5ABE A;  2PFV A;  4KBM B;  3TLS A;  2JQY A;  4X62 T;  2BS2 A;  5LBQ B;  4A5X A;  3OVU A;  5LXT E;  4AKL A;  4N75 A;  4O3Y A;  1G8X A;  2AE9 A;  4O2A E;  3PUA A;  3RRC A;  5KMG P;  1DU2 A;  4C4V A;  2UXB T;  2OLT A;  2BG9 C;  4DV5 T;  2W00 A;  2JMM A;  1HX1 B;  4FSO A;  4YSZ A;  5LJM A;  3AE2 A;  4IL4 A;  4TV8 E;  5JDQ A;  3JC6 D;  4FZM A;  1W9R A;  2N9D A;  2HH7 A;  4FT6 A;  3SZV A;  1OED B;  1WYC A;  1ZP0 A;  4FRT A;  4U33 A;  2ACZ A;  3GWH A;  4HFD A;  5HYA A;  4CN1 A;  4JI3 T;  1NEK A;  5TIS O;  4EIW A;  5JDL A;  2EHO B;  2VQE T;  1XDO A;  3NWI A;  5KDM C;  2WVP A;  2JMH A;  4U7I A;  2XQ7 A;  2EHO D;  4E7Z A;  5DL6 A;  3ZT7 A;  2L9Q A;  4LF8 T;  2D2S A;  1J5W A;  2BDE A;  3PUQ A;  3E22 E;  3ABV A;  5GV0 A;  3P8C D;  4JEH B;  4HEA A;  2BBH A;  4Z91 A;  3PQU A;  4GCP A;  4JCH A;  1HNX T;  2FJD A;  3OBV E;  2LSJ A;  2XQA A;  4ADZ A;  2HPL A;  4X66 T;  3FBL A;  4G2A A;  4IE4 A;  4I0U A;  3EDU A;  3C98 B;  2BBJ A;  3O9X A;  3EAB A;  3BQI A;  3ZYK A;  5M4Y A;  1T7S A;  3VHL A;  4AKR B;  4YHJ A;  4ILA A;  1HFA A;  4DR7 T;  4N78 D;  1HG2 A;  4K3B A;  3WI4 A;  1HXX A;  1ZHT A;  2NTY A;  4PK6 A;  2W63 A;  1HXT A;  3QRC A;  4U31 A;  3QK6 A;  2A3D A;  2E5V A;  3C5O A;  1OSM A;  4LMK A;  2BKO A;  3G7G A;  1WCR A;  4CI1 B;  4RJX A;  5HXC A;  4BJM A;  2Q9Q A;  1UX5 A;  5GON E;  2FBW A;  4GKJ T;  1KNR A;  3UUN A;  4IIJ E;  2K9A A;  4ZI2 C;  3AAI A;  4JI5 T;  5BMV E;  3CK6 A;  1XDP A;  3AED A;  4HWH A;  5L3C B;  3FHN A;  1QJ8 A;  4AFK A;  2LHR A;  2X9Y A;  4PJM A;  3HW9 A;  3ZSS A;  2C5I T;  2LSY A;  4GK5 E;  1MM4 A;  3PDY A;  3SY7 A;  4LSH A;  1JNZ A;  4KHP T;  4QXC B;  4ZS3 A;  2H3R A;  2KXP B;  2X66 A;  2F1C X;  3KVA A;  4JYA T;  2HN1 A;  2WS3 A;  3GA8 A;  1VRB A;  3POU A;  2W2U A;  4XNK A;  1LVK A;  4EYU A;  2ES0 A;  3R84 B;  2DCF A;  2D5U A;  1UUR A;  3C4W A;  3G06 A;  5HEG A;  2K4T A;  4DMV A;  2RPA A;  4UV9 B;  4HN9 A;  5FL0 A;  3K19 A;  3I9W A;  2JQK A;  3C64 A;  2MTQ A;  2LM9 A;  4QWN B;  3UTK A;  2BKP A;  3RYH E;  4DR6 T;  3K8P C;  4B3M T;  1NAF A;  2J1N A;  2Y6X A;  2XY8 B;  2V7M A;  2FGR A;  4X1I E;  4CXW A;  1D0Y A;  4O4U A;  5FMN A;  3K1S A;  3AAA A;  4ZI2 D;  2Y7S A;  5AQT B;  2IWW A;  3B13 A;  3UU4 A;  4JUY A;  4EED A;  3ZST A;  2KT9 A;  4PAG A;  3AA7 B;  1G73 A;  2M6I A;  2JQH A;  3ZJ1 A;  3P4S A;  2ZMA A;  3WI5 A;  2DL1 A;  3X1D A;  1N34 T;  2V8S V;  5HEH A;  1XMQ T;  2VVN A;  4EXT A;  4PNI A;  2WU2 A;  4JLE A;  4PJJ A;  2VWA A;  2W0G A;  3CWZ B;  5G38 A;  4AYE C;  3UUM A;  3BRZ A;  3ONX A;  2AXD S;  5AQQ B;  3H3A A;  4LF7 T;  3EAM A;  5KAI O;  3LBX B;  3ZLI A;  5JDG A;  2ZM0 A;  2E5L T;  4TUY E;  3HWB A;  2KSR A;  2K24 A;  5AQK B;  5GTI O;  4LML A;  3AB3 B;  2XQ5 A;  1U5P A;  3ANW B;  5LHI B;  4QH5 A;  2DWK A;  1B7T A;  2UXD T;  4FQE A;  5FYM A;  1W0A A;  3FBZ A;  3VZT X;  1Q9G A;  2XM2 A;  1MNE A;  5LG4 A;  3VR8 A;  3SWH A;  2XAH B;  2KZ7 A;  2WJR A;  2XAQ B;  2QTK A;  4EZ4 A;  2X0Y A;  2N2M A;  1YQ3 A;  1PRN A;  4HWC A;  3FZH B;  3C50 A;  4U74 A;  1BT9 A;  2DI4 A;  2KXP A;  3FYX A;  2OV9 A;  4GKK T;  1HF8 A;  4CN4 A;  3J7Y q;  1T8B A;  3MJX A;  3DWN A;  4RJW A;  2ZM8 A;  3ZN1 B;  4OHF A;  4ASK A;  3RC8 A;  1J5E T;  3OYZ A;  3LK3 B;  2F1V A;  3K3Q C;  3MXZ A;  3SYB A;  2B1E A;  1HS7 A;  4ZEY A;  1FJG T;  1GFO A;  5JVD E;  5AQN B;  4FZL A;  4D64 A;  3VR9 A;  2W66 A;  3LSV A;  1IZN A;  3Q5E A;  4KX6 A;  4EGW A;  3NRX A;  1N32 T;  2J47 A;  3N5L A;  3ZMV B;  4C4V B;  2X27 X;  3UFE A;  2FUP A;  2M06 A;  3PRN A;  3POQ A;  4JI7 T;  4L0R A;  2WDR A;  3M3Z B;  4DV4 T;  4IL9 A;  3RIF A;  3PU8 A;  5CB4 E;  4TZ4 C;  5HXS A;  3VE1 A;  5EZY E;  3VY8 X;  4IT4 A;  3NSG A;  5E79 O;  5JR9 A;  2WDQ A;  5AQO B;  3AE6 A;  4UVA B;  1R8I A;  2RP4 A;  2XTQ A;  1KFY A;  1IBL T;  2MAW A;  2CLY C;  4I50 E;  4IE5 A;  1HX8 A;  5HWY A;  4TWD A;  1UX4 A;  3PGS A;  5BR8 T;  2J1D G;  3QOF A;  3NRY A;  2V26 A;  5F5W A;  3HKC E;  4YLH A;  3N9M A;  1MMD A;  5L3F B;  3P50 A;  3PJA J;  3GN5 A;  4KI0 F;  5IYZ E;  2MYS A;  1X79 A;  3KV4 A;  3QB5 K;  2M07 A;  2IDO B;  2HN2 A;  3TKL B;  5L3E B;  2L3L A;  3KVB A;  2PJQ A;  2IML A;  2KND A;  3FZK B;  3WU2 O;  1D0Z A;  3IBP A;  2WY2 A;  5IUX A;  3T20 A;  2JQQ A;  2ZM6 T;  2DWG A;  5FXX A;  1N36 T;  2LOP A;  4OX9 T;  4GF4 A;  3A5X A;  5B5E O;  4UIG A;  3JC6 C;  2J62 A;  2JMK A;  1E1H B;  2VKO A;  3DJB A;  1WR0 A;  4NPP A;  4HTE A;  4QX7 B;  4BA9 A;  3TLT A;  2VKD A;  1D1B A;  5L3B B;  2VL8 A;  3UPG A;  3C4Z A;  3U3I A;  5DJQ C;  3AEG A;  3F57 A;  4DMW A;  2EHO C;  3Q5D A;  2Q9Q B;  1T16 A;  4LF4 T;  2C5K T;  4HFI A;  3PE0 A;  4E1T A;  2CLY B;  2LJL A;  2WP9 A;  4XNL A;  4ZI3 C;  1MMG A;  4HE8 A;  3FZL B;  5L4E A;  4DR3 T;  3DA3 A;  2YDS A;  3EDV A;  2ODU A;  3ZC1 A;  3PF1 A;  4YHH T;  1QUU A;  2YDR A;  3ETV A;  2LHF A;  2XMX A;  3GMI A;  1NEN A;  2BS4 A;  2XAG B;  4YTP A;  3Q2M A;  5KXJ A;  1YKH B;  2C5J A;  3I0Q A;  4ISS A;  2YPV A;  4FI5 A;  4IE7 A;  4EYY R;  2LSI A;  4EAH A;  3PUW F;  3K3O A;  5FY7 A;  3LK4 1;  5EE2 A;  1CHU A;  1YS5 A;  5ABF A;  2NP9 A;  5FVK A;  2XQ3 A;  4DV2 T;  3UU5 A;  3AAE A;  3VKG A;  2CXD A;  2NW8 A;  4IE6 A;  4ZXL A;  1GFP A;  3CX7 B;  3TLW A;  5AQF B;  5AQP B;  3FB2 A;  4PJL A;  3RX6 A;  4AZL A;  4EZH A;  4FES A;  4AYM C;  1ZOY A;  2BZB A;  2P9B A;  5FVN A;  4LF9 T;  4ZS2 A;  5HXE A;  2NOX A;  5G3A A;  3RBH A;  4YSX A;  4UVC B;  5AQS B;  4M1P A;  5EK2 A;  1BR0 A;  2PBI A;  4DUY T;  4DBR A;  5AQI B;  2XPK A;  4U2Z A;  3KBT A;  2OA5 A;  4JEU B;  3PGR A;  2E9X A;  3UU8 A;  2LE8 A;  2XSA A;  4MAL A;  1S5L O;  3CKD A;  4N74 A;  2LFU A;  1IJ6 A;  2R4O A;  1ZHX A;  3NKZ A;  3Q5W A;  3V5U A;  3AAA B;  4Q25 A;  5FXZ A;  4ZI3 D;  2WDV A;  5JH7 E;  3F31 A;  1XMO T;  2WB5 A;  3O4X E;  3ZT5 A;  4DND A;  4DID B;  1M62 A;  2YEV C;  3CQX C;  2X0H A;  4O3W A;  3ESL A;  5PRN A;  4A98 A;  2SPC A;  4QX8 B;  4DO0 A;  4YJ3 E;  5AQM B;  3D0T A;  4CI2 B;  1QSD A;  1HG5 A;  2C0S A;  2HHH T;  4E1S A;  1XZY A;  2CCQ A;  4WW0 A;  5DQW A;  2WMO A;  4KR8 A;  2QYW A;  2CWO A;  3KDS E;  4C69 X;  4WNK A;  4DR5 T;  5FY1 A;  5DL8 A;  3PUG A;  4B6X A;  3UQ4 A;  2Y8D A;  4FMS A;  5HEO A;  1LRZ A;  5H6Q B;  4UV8 B;  5GTH O;  2V7L A;  3NBX X;  2XG6 A;  3N2G E;  3A8Y C;  4IL6 O;  3CIR A;  2CA5 A;  5LB7 B;  1HNW T;  2BKN A;  3TLV A;  5LGN B;  2W80 C;  4I43 B;  5LMN T;  3BK9 A;  2LM2 A;  3HKE E;  3N2O A;  2WQY A;  5LOV E;  4O49 A;  2K0L A;  3RPU A;  3IHR A;  2V7I A;  2KZ7 B;  3N9N A;  4OYK A;  4O4X A;  3N9Q A;  2UUA T;  3UAQ A;  5JR9 C;  4IDP A;  3LJC A;  2FJA A;  2KIN B;  3RKG A;  4P0A A;  3DWO X;  3KVD D;  1ZHC A;  2BVM A;  4A56 A;  3VZW X;  3CQC B;  4H9O C;  4ILU A;  2Y0L A;  3JTY A;  2CBI A;  4U9C A;  1ZKE A;  2CBJ A;  2A2F X;  5JDM A;  5L2L A;  1VCS A;  1Z8U A;  4G63 A;  4X65 T;  3VY9 X;  5HXH A;  5J2U E;  2VK9 A;  4AYI D;  5LG3 A;  2NTX A;  2QGS A;  3J9X 1;  2F1T A;  4G75 A;  3C51 A;  3L8R A;  4U72 A;  1T98 A;  1BXW A;  5J1G A;  3VRB A;  2CRB A;  4TV9 E;  5C8Y E;  2LSK A;  3ZMT B;  2XQ8 A;  1IZN B;  2ZFG A;  2D0U A;  2RA1 A;  1D0X A;  4BAY B;  4WBN E;  2CEA A;  3RF1 A;  5FXW A;  2E2A A;  2YNK A;  4ZZB A;  3AVS A;  2IIU A;  4K0U A;  3RIU A;  4WZX A;  4CQI A;  4QXH B;  3RQW A;  5LGU B;  3HOL A;  2IC9 A;  1ZEE A;  2H7V C;  4IDN A;  4X1K E;  2XSB A;  3P4R A;  3E0Z A;  4ILC A;  3KV9 A;  2WWU A;  2XTL A;  5ADX K;  2M67 A;  4Z90 A;  5JR9 B;  5AQV B;  3ZCI A;  4U2Y A;  4KHZ F;  2ODJ A;  4O2B E;  1HNZ T;  5J0Z A;  1FIO A;  4JBW F;  3WI3 A;  2X67 A;  3AE5 A;  3JAF A;  5LGT B;  2LSG A;  4UVB B;  2ZM2 A;  2I0M A;  3P4P A;  4BUM X;  5C2T A;  3R6N A;  2R89 A;  2ERV A;  3ZJ2 A;  2W67 A;  4LFA T;  3AE9 A;  5ADX L;  5DL5 A;  3A2S X;  4EV6 A;  3GN5 B;  1OED E;  2OMF A;  3VE2 A;  4OYJ A;  4AQG A;  2AXT O;  2F4V T;  2ACX A;  1JNR A;  5JTG A;  2HPJ A;  3E08 A;  4X5T A;  2IAK A;  2POR A;  1ZHY A;  1BR1 A;  2LRK A;  4LF6 T;  4DR1 T;  2I6H A;  3O1J A;  4P09 A;  4IDO A;  3VKH A;  4COF A;  4YTN A;  5L4H A;  3RYF E;  3HOE A;  5C3J A;  4AI6 A;  4UEL A;  2V6Y A;  1MND A;  3L3P A;  1WFD A;  3HI2 A;  4DV0 T;  2CPT A;  3BRY A;  3K3N A;  1SUM B;  4PUX A;  2CHN A;  1OPF A;  2XAS B;  2MOZ A;  4L5G A;  3SS1 A;  2WU5 A;  3RRW A;  3Q5X A;  1LKX A;  2XE5 A;  2XZE A;  4CZZ B;  3LK4 2;  2QVA A;  3UQ7 A;  4ZOL E;  4AQF A;  1YKE B;  2BG9 E;  3FZF B;  2DNX A;  2WAU A;  3PUZ F;  2GE4 A;  1XNR T;  4AYD C;  1X9B A;  1ZHZ A;  2KDY A;  4C91 A;  3H37 A;  3OJA A;  3AVR A;  1WRD A;  4MLK A;  5CA1 E;  2XAF B;  3SRZ A;  3A7M A;  3RYC E;  3ZMU B;  1ZV4 X;  1NWM X;  3HKB E;  2XUE A;  5CGM A;  4UF0 A;  2Z6E A;  4TNV A;  4PJ0 O;  3CX6 B;  2LEH A;  4AUI A;  3PUY F;  3JAD A;  5ABF B;  3M65 A;  3W15 B;  4IDZ A;  1MPF A;  3AAE B;  3P4W A;  4H9R C;  3JCU O;  3CVR A;  2L8K A;  2VL0 A;  2W4X A;  2PTF A;  3QC9 A;  3KZI O;  4Z3T A;  5JDN A;  2V7J A;  3L39 A;  3SYS A;  3T8O A;  5JRC A;  1U4Q A;  4F8H A;  1XNQ T;  4A97 A;  2Y2X A;  1US7 B;  4JFB A;  1KNP A;  5LHH B;  4N58 A;  3SZD A;  4U7Y A;  3PUV F;  4B3S T;  2IW5 B;  3AE1 A;  3LG7 A;  3LK2 A;  4P1N A;  2E9X B;  3AA6 A;  3UUB A;  2BS3 A;  3MKD A;  4PJN A;  4MBQ A;  3I1A A;  2Q9Q C;  4PK4 A;  4KUM B;  3AEE A;  5LBM A;  2Y48 B;  3WAJ A;  2J4U P;  5HCM A;  2VUR A;  5AFU K;  2JQ9 A;  5EK3 A;  2R4N A;  2WMN A;  3QNU A;  2K48 A;  2WZI A;  5CA0 E;  5D5D A;  5LYJ E;  4JV5 T;  2G0U A;  5KAF O;  4NUV A;  3U78 A;  5FVL A;  3O0E A;  4X1Y E;  3RHW A;  1MIV A;  3LDQ B;  4JI0 T;  3NZP A;  2FGQ X;  2NW7 A;  1SHZ C;  5AFU L;  3OYX A;  4O4L E;  1Q9F A;  4D65 A;  4GOU A;  4KP3 C;  5IWA T;  2IWV A;  3ZYL A;  5HXR A;  1XWM A;  2XQY A;  4QQ1 A;  5L3G B;  2UXX B;  3MK7 C;  5HCJ A;  3L09 A;  3VU7 H;  3UUL A;  4ANJ A;  3ZCJ A;  4QH4 A;  4DV3 T;  1M7K A;  1PHO A;  2BVL A;  2X68 A;  2R6G F;  2VAS A;  2Q9Q D;  5L3D B;  2CM0 A;  3RH3 A;  2I59 A;  4ERR A;  3AA1 B;  1FEW A;  4RLC A;  5FL1 A;  4TN7 B;  3QB5 A;  3RLF F;  2UUC T;  2YK0 A;  1Y64 B;  1LVF A;  4P0B A;  2D0T A;  5ABH A;  1YW0 A;  3UT5 E;  3P4Q A;  2A9U A;  4LMJ A;  3ZMS B;  4PFO A;  2V1D B;  5JRE A;  3PGU A;  1VOM A;  3ZT6 A;  5LHG B;  3SY9 A;  4E7S A;  1UUS A;  4AKG A;  4B3T T;  1T72 A;  1KEY A;  2E8I A;  2YIN A;  4F4B A;  4MFR A;  4Z8X A;  5HEU A;  2XE1 A;  5E0O A;  3I9Y A;  5CFB A;  1KNZ A;  4LSE A;  3S4U A;  2M6B A;  4YT0 A;  3AE7 A;  4FRX A;  2A72 A;  2JRK A;  1SE7 A;  3POR A;  2R4L A;  4H9S E;  2V5C A;  3EVY A;  4IST A;  3QRA A;  5DQV A;  2FJE A;  3IEE A;  3UFG A;  4WBO A;  3KIN B;  2V7K A;  4I4T E;  1AJ3 A;  4FZN A;  3RC3 A;  3VRA A;  1Z0P A;  2YU2 A;  3AEF A;  3AEC A;  5FXV A;  2JPF A;  3ONJ A;  4TNW A;  2MNH A;  3IF8 B;  4JI4 T;  5J2T E;  2KWH A;  3AEB A;  2W62 A;  1D1C A;  3T1H T;  5CJ5 A;  3ZKR A;  3CQG B;  4GK0 E;  1GFQ A;  2MBG A;  2IC6 A;  4O4H E;  5LJN A;  2NW9 A;  4DV1 T;  3EI0 A;  2VQF T;  2LHN A;  2PG8 A;  4HKA A;  1E7P A;  2UUB T;  5H2F O;  4IGU A;  4OFZ A;  4AQF C;  5HEJ A;  5JDH A;  3T1Y T;  3AXJ A;  4HFV A;  3UUX B;  2YU1 A;  2N1G A;  3EUH A;  3O1I A;  3PJA A;  3WAK A;  3Q9D A;  1ZHW A;  5AQJ B;  1IJ5 A;  4L9I A;  3EHZ A;  4ZHQ E;  5F3J A;  5DAB A;  2XHE B;  4F6R C;  3CX8 B;  3ZC0 A;  2CXF A;  2ODV A;  4BJN A;  2KLQ A;  1O3X A;  4HFC A;  4UB8 O;  2BG9 B;  4H63 V;  2YOE A;  1QLB A;  3HL6 A;  2R4P A;  2UXN B;  3N9O A;  4LFC T;  4CXY A;  1OWA A;  5LCY A;  6PRN A;  2V6Y B;  4IRE A;  1KK7 A;  1HXU A;  2WM9 A;  4KMC A;  4PK5 A;  3T0S A;  4DUZ T;  1FMV A;  3SFD A; 
#chains in the Genus database with same CATH homology
 3VE2 A;  4OYJ A;  4AQG A;  4LSI A;  5HXS A;  3VE1 A;  5EZY E;  3AA1 A;  2ACX A;  3VY8 X;  3NSG A;  5LXT E;  4AKL A;  5JR9 A;  2HPJ A;  1BR4 A;  3E08 A;  4UVA B;  3ZEF B;  1G8X A;  4O3Y A;  2RP4 A;  2XTQ A;  2IAK A;  4O2A E;  2POR A;  2KWI B;  3PUA A;  3RRC A;  5KMG P;  1BR1 A;  1ZHY A;  4CI3 B;  2XAJ B;  1YD8 G;  2CLY C;  4I50 E;  4IE5 A;  1HX8 A;  2W00 A;  3O1J A;  1MIW A;  1UX4 A;  4P09 A;  5HWY A;  2JMM A;  3N9L A;  3VKH A;  4FSO A;  2J1D G;  4UEM A;  4H9N C;  3RYF E;  1V9D A;  3HOE A;  4AI6 A;  4UEL A;  5LJM A;  4TV8 E;  1MND A;  3NRY A;  5JDQ A;  2V26 A;  3JC6 D;  3L3P A;  4FZM A;  2KC0 A;  2N9D A;  3HKC E;  2HH7 A;  4YLH A;  4FT6 A;  3N9M A;  1MMD A;  3SZV A;  5L3F B;  1WYC A;  3HI2 A;  4GCS A;  5DL7 A;  4FRT A;  3GN5 A;  5ETW A;  5IYZ E;  8PRN A;  3K3N A;  3GWH A;  3RYI E;  4PUX A;  2MYS A;  1X79 A;  1OPF A;  2XAS B;  5HYA A;  3KV4 A;  3DA4 A;  2M07 A;  2MOZ A;  4CXX A;  4L5G A;  3SS1 A;  3CPZ A;  3TKL B;  5L3E B;  4UF0 B;  4EIW A;  3PTR B;  5JDL A;  3RRW A;  2EHO B;  3Q5X A;  2L3L A;  3KVB A;  2PJQ A;  1UCU A;  2KND A;  2VKJ A;  5KDM C;  4IHJ E;  2JMH A;  3PQS A;  1D0Z A;  1LKX A;  2EHO D;  3IBP A;  2XE5 A;  1WLX A;  4E7Z A;  5DL6 A;  2L9Q A;  4D5U A;  4CZZ B;  1ORM A;  2D2S A;  3LK4 2;  3T20 A;  2JQQ A;  2BDE A;  3PUQ A;  4O4I E;  2N2N A;  4ZOL E;  4AQF A;  3E22 E;  1YKE B;  2DWG A;  5FXX A;  4H63 H;  2LOP A;  5GV0 A;  3P8C D;  2K5B B;  4JEH B;  3A5X A;  5TAO A;  4GF4 A;  4UIG A;  2DNX A;  3JC6 C;  2WAU A;  2JMK A;  1E1H B;  2VKO A;  2XE2 A;  5JRC B;  2GE4 A;  3DJB A;  2GK9 A;  3MZK B;  4AYD C;  1ZHZ A;  2KDY A;  4C91 A;  3H37 A;  3OJA A;  4HTE A;  4QX7 B;  4BA9 A;  3AVR A;  1WRD A;  7PRN A;  2VKD A;  4MLK A;  5CA1 E;  1D1B A;  4HEA A;  2XAF B;  5L3B B;  2VL8 A;  3SRZ A;  3PQU A;  3BQK A;  4GCP A;  2XE3 A;  3UPG A;  5EK4 A;  3RYC E;  4JCH A;  3C4Z A;  3ZMU B;  1ZV4 X;  1NWM X;  3HKB E;  2XUE A;  3OBV E;  4UF0 A;  2Z6E A;  2EHO A;  3HA4 A;  3CX6 B;  2LEH A;  4AUI A;  3U3I A;  5DJQ C;  3LK2 B;  2LSJ A;  3F57 A;  4PW8 A;  4DMW A;  2EHO C;  2QA7 A;  4ADZ A;  2HPL A;  4AXP A;  4N59 A;  3M65 A;  3AA6 B;  1BH3 A;  2Q9Q B;  3W15 B;  2C5K T;  5FP3 A;  3FBL A;  4IDZ A;  1MPF A;  3AAE B;  3PE0 A;  4H9R C;  4E1T A;  4G2A A;  2CLY B;  2L8K A;  2LJL A;  3CVR A;  4IE4 A;  4XNL A;  4ZI3 C;  1MMG A;  3EDU A;  3C98 B;  3O9X A;  3BQI A;  3ZYK A;  1SA0 E;  3QC9 A;  4HE8 A;  4Z3T A;  5M4Y A;  5JDN A;  2V7J A;  3DA3 A;  3SYS A;  3T8O A;  3VHL A;  5JRC A;  4AKR B;  4YHJ A;  3EDV A;  1U4Q A;  2ODU A;  1HFA A;  3ZC1 A;  3HOL A;  2H7O A;  2Y2X A;  1QUU A;  3ETV A;  4N78 D;  2LHF A;  1HG2 A;  2XMX A;  3WI4 A;  3GMI A;  1HXX A;  1ZHT A;  1US7 B;  1MMN A;  2XAG B;  4JFB A;  3Q2M A;  5JDF A;  2NTY A;  4V1A v;  5LHH B;  1YKH B;  2C5J A;  4PK6 A;  3I0Q A;  4ISS A;  4FUV A;  2YPV A;  2W63 A;  1HXT A;  3QRC A;  4FI5 A;  4N58 A;  3QK6 A;  3SZD A;  4IE7 A;  3KV6 A;  3PU3 A;  4EYY R;  2A3D A;  4XBF B;  2LSI A;  3C5O A;  4EAH A;  1OSM A;  3POX A;  5T5F A;  3K3O A;  5FY7 A;  2IW5 B;  2CE7 A;  3LK4 1;  3G7G A;  3LG7 A;  5EE2 A;  1YS5 A;  2N2L A;  3LK2 A;  2NP9 A;  1EZ3 A;  3PUR A;  4CI1 B;  4RJX A;  5HXC A;  4BJM A;  4J2C A;  2Y0H A;  2E9X B;  3AA6 A;  2Q9Q A;  3MKD A;  1UX5 A;  4PJN A;  5GON E;  3AA0 B;  4MBQ A;  3I1A A;  2Q9Q C;  4GYR A;  4PK4 A;  3UUN A;  4IIJ E;  2K9A A;  2CXD A;  2NW8 A;  4IE6 A;  3VKG A;  4ZI2 C;  1HTJ F;  3AAI A;  5BMV E;  1GFP A;  4GIW A;  4KUM B;  3CX7 B;  4RL9 A;  5L3C B;  3FB2 A;  3FHN A;  4PJL A;  3RX6 A;  1OXZ A;  2Y48 B;  5LBM A;  4EZH A;  2X9W A;  3WAJ A;  1IAP A;  1QJ8 A;  4FES A;  3BQL A;  4AYM C;  4AFK A;  2BZB A;  1QJ9 A;  2P9B A;  2J4U P;  2LHR A;  4AKR A;  2X9Y A;  4PJM A;  5FVN A;  5AFU K;  5JQG E;  2CWY A;  3HW9 A;  1MMA A;  4ZS2 A;  5HXE A;  2C5I T;  2LSY A;  2X51 A;  5EK3 A;  4GK5 E;  4ZI7 E;  1MM4 A;  2DHR A;  2NOX A;  3PDY A;  2WMN A;  5HAX A;  3SY7 A;  4LSH A;  3ZN0 B;  4QXC B;  3RBH A;  5IYU A;  2K48 A;  4UVC B;  2WSS V;  5CA0 E;  4AKH A;  5D5D A;  1H7C A;  4M1P A;  5EK2 A;  5LYJ E;  1BR0 A;  2G0U A;  3ZPO A;  2VKH A;  2PBI A;  4ZS3 A;  2H3R A;  4I55 E;  4DBR A;  2KXP B;  2X66 A;  3KVA A;  3KBT A;  2OA5 A;  5A1L A;  4NUV A;  4JEU B;  3U78 A;  2E9X A;  3O0E A;  3GA8 A;  4H9Q C;  1VRB A;  2LE8 A;  4XAX B;  3KFW X;  4X1Y E;  3DTO A;  1MIV A;  4MAL A;  3KV5 A;  2E9X C;  5FNV E;  4EB6 E;  3POU A;  5LNK A;  3CKD A;  4H9P C;  2O4V A;  1LVK A;  4XNK A;  4EYU A;  3NZP A;  2FGQ X;  2ES0 A;  2LFU A;  1IJ6 A;  2NW7 A;  3R84 B;  1ZHX A;  2DCF A;  4EOZ B;  2D5U A;  1SHZ C;  5G26 A;  3C4W A;  5AFU L;  3OYX A;  2XTR A;  2K4T A;  3Q5W A;  4O4L E;  3V5U A;  4O3X B;  1HCI A;  5F8P A;  1Q9F A;  3AAA B;  4IE0 A;  3RKO A;  5FXZ A;  4D65 A;  4ZI3 D;  4GOU A;  4DMV A;  5JH7 E;  4UXN B;  3F31 A;  4UV9 B;  4KP3 C;  4HN9 A;  5HXR A;  3ZYL A;  3FXD B;  4OK0 A;  3K19 A;  1CUN A;  2XQY A;  3I9W A;  3O4X E;  3C64 A;  2VB6 A;  2MTQ A;  4DND A;  2LM9 A;  1FMW A;  4QQ1 A;  5L3G B;  2UXX B;  2YEV C;  4QWN B;  3CQX C;  3UTK A;  3MK7 C;  4O3W A;  4YFS A;  3L09 A;  2NWB A;  3VU7 H;  3ESL A;  5PRN A;  3RYH E;  3UUL A;  3GP6 A;  4ANJ A;  3ZCJ A;  2SPC A;  4QX8 B;  4YJ2 E;  4DO0 A;  3T24 A;  4GCQ A;  3K8P C;  4YJ3 E;  2CXL A;  1NAF A;  1PHO A;  2BVL A;  2LOS A;  4QKN A;  2J1N A;  3ZYM A;  2Y6X A;  4RLB A;  2V7M A;  2X68 A;  3D0T A;  1D1A A;  2FGR A;  2X9X A;  4CI2 B;  1QSD A;  2JJ9 A;  1HG5 A;  2VAS A;  2C0S A;  4E1S A;  4X1I E;  4CXW A;  1D0Y A;  4O4U A;  3AAE A;  5FMN A;  3N2K E;  2CCQ A;  2CMR A;  2Q9Q D;  5L3D B;  3AAA A;  4ZI2 D;  2Y7S A;  4WW0 A;  2CM0 A;  2WMO A;  5DQW A;  3ETU A;  3QUJ A;  3RH3 A;  4KR8 A;  2CWO A;  2I59 A;  3B13 A;  3KDS E;  3LFM A;  4C69 X;  4WNK A;  4ERR A;  3I0O A;  3AA1 B;  1FEW A;  4JUY A;  4MHC A;  5FY1 A;  4RLC A;  5DL8 A;  3EMN X;  3PUG A;  4TN7 B;  4B6X A;  2ZLY A;  2YK0 A;  2W81 C;  4AKM A;  2Y8D A;  2KT9 A;  1Y64 B;  4PAG A;  1MM5 A;  3AA7 B;  1LVF A;  4FMS A;  1LRZ A;  4P0B A;  2D0T A;  5H6Q B;  3NZQ A;  1YW0 A;  4UV8 B;  4O3Z A;  3UT5 E;  1THQ A;  4QXB B;  4KRA A;  1G73 A;  3ZJ1 A;  3ZMS B;  4PFO A;  2V7L A;  2ZMA A;  2V1D B;  4LSF A;  5JRE A;  3NBX X;  1VOM A;  3WI5 A;  2XG6 A;  3N2G E;  5LHG B;  5IHY A;  3P7I A;  4E7S A;  2ZLD A;  3SY9 A;  4AKG A;  2CA5 A;  3V5S A;  1S35 A;  5LGU B;  4EXT A;  2E9X D;  2E8I A;  2YIN A;  4PFP A;  4F4B A;  1QJP A;  4MFR A;  4Z8X A;  5LGN B;  2W80 C;  4PNI A;  4JLE A;  3DP7 A;  4PJJ A;  4I43 B;  1GFN A;  2VWA A;  3I9Y A;  3BK9 A;  5E0O A;  2W0G A;  2XE1 A;  3CWZ B;  3HKE E;  3N2O A;  1WR6 A;  1KNZ A;  4AYE C;  3UUM A;  5LOV E;  4O49 A;  2K0L A;  3RPU A;  5JDP A;  3IHR A;  3ONX A;  3C4X A;  5HWX A;  4LSE A;  2V7I A;  2KZ7 B;  3N9N A;  4DVD A;  3S4U A;  3H3A A;  2OMF A;  4OYK A;  4O4X A;  4FJO A;  3N9Q A;  3AA7 A;  3UAQ A;  5JR9 C;  3LBX B;  3HKD E;  3ZLI A;  2A72 A;  4FRX A;  5JDG A;  2JRK A;  4KR4 A;  3LJC A;  2ZM0 A;  2KIN B;  4P0A A;  3KVD D;  4TUY E;  3HWB A;  3POR A;  1ZHC A;  2BVM A;  3N9P A;  4H9S E;  3EVY A;  3MA9 A;  4A56 A;  2Y0K A;  2K24 A;  4IST A;  3QRA A;  3VZW X;  3CQC B;  3B57 A;  5DQV A;  4H9O C;  3IEE A;  4ILU A;  2Y0L A;  3JTY A;  3AB3 B;  4WBO A;  1P4T A;  3SOL A;  3KIN B;  2V7K A;  4I4T E;  1AJ3 A;  4FZN A;  4U9C A;  1ZKE A;  4FOZ A;  2A2F X;  3RC3 A;  1Z0P A;  2YU2 A;  1U5P A;  1S94 A;  5JDM A;  5L2L A;  3AA0 A;  3O1H A;  2X9H A;  3ANW B;  4G63 A;  4GHB A;  3VY9 X;  4AYN A;  5LHI B;  5FXV A;  2DWK A;  1B7T A;  2JPF A;  5HXH A;  5J2U E;  2VK9 A;  2W61 A;  4AYI D;  5FYM A;  3FBZ A;  2MNH A;  3VZT X;  3IF8 B;  2WBL A;  2NTX A;  1Q9G A;  5J2T E;  1MNE A;  5LA6 E;  2QGS A;  5LG4 A;  2KWH A;  3J9X 1;  2F1T A;  3PUS A;  4AZL A;  4G75 A;  2W62 A;  3SWH A;  2XAH B;  1D1C A;  2KZ7 A;  4O4J E;  3C51 A;  3CQG B;  2XAQ B;  4GK0 E;  1GFQ A;  2MBG A;  2IC6 A;  4U72 A;  1T98 A;  3LBX A;  4O4H E;  4EZ4 A;  2PRN A;  2QTK A;  3KBU A;  5LJN A;  1BXW A;  2DLR A;  5J1G A;  2NW9 A;  1PRN A;  2N2M A;  4FSP A;  1G90 A;  4TV9 E;  5C8Y E;  2LSK A;  3ZMT B;  2LHN A;  3C50 A;  1IZN B;  2PG8 A;  4U74 A;  3UU2 A;  4HKA A;  2ZFG A;  2D0U A;  2RA1 A;  1BT9 A;  1WYB A;  1D0X A;  2DI4 A;  4BAY B;  4WBN E;  2KXP A;  2CEA A;  4C90 A;  1E54 A;  5FXW A;  1GFM A;  2YNK A;  3V8U A;  3FXE B;  4IGU A;  3AVS A;  3FYX A;  1HF8 A;  3J7Y q;  4OFZ A;  4AQF C;  3VZU X;  3MJX A;  4K0U A;  4RJW A;  5JDH A;  2ZM8 A;  4CQI A;  4QXH B;  3ZN1 B;  4OHF A;  1BR2 A;  4O8S A;  5FY0 A;  4NUU A;  4XZC A;  3ANW A;  3F2E A;  4HFV A;  4QHO A;  4ASK A;  3OYZ A;  2IC9 A;  1ZEE A;  3UUX B;  3RC8 A;  2YU1 A;  2H7V C;  3LK3 B;  2N1G A;  3EUH A;  3O1I A;  2F1V A;  3K3Q C;  3WAK A;  2X0L B;  4DBQ A;  4X1K E;  3Q9D A;  3MXZ A;  3E0Z A;  1ZHW A;  3SYB A;  2B1E A;  1HS7 A;  5LP6 E;  1IJ5 A;  4X20 E;  4L9I A;  1GFO A;  3CML A;  3KV9 A;  5JVD E;  2WWU A;  2XTL A;  4GYS A;  5ADX K;  3HR0 A;  4ZHQ E;  5F3J A;  4FZL A;  4D64 A;  5KX5 E;  5DAB A;  2XHE B;  4F6R C;  3CX8 B;  2M67 A;  3ZC0 A;  5JR9 B;  4AKI A;  2CXF A;  2ODV A;  4BJN A;  3ZCI A;  2KMF A;  1IZN A;  2KLQ A;  3OKQ A;  1O3X A;  3NRX A;  2ODJ A;  4O2B E;  4H63 V;  3N5L A;  3ZMV B;  4B61 A;  4G76 A;  3HL6 A;  3MAC A;  2X27 X;  2UXN B;  1FIO A;  3N9O A;  3WI3 A;  2LT3 A;  2X67 A;  3UFE A;  3TZG A;  5LGT B;  2LSG A;  3ZMZ B;  1H6S 1;  4TX5 A;  4UVB B;  2ZM2 A;  2M06 A;  4CXY A;  3POQ A;  3PRN A;  1OWA A;  5LCY A;  4L0R A;  2MHL A;  6PRN A;  3LK3 A;  4BUM X;  4HGA A;  3R6N A;  1MIY A;  5H6R B;  2ERV A;  1KK7 A;  3ZJ2 A;  1HXU A;  2WM9 A;  2PFV A;  4KMC A;  4KBM B;  4PK5 A;  5ADX L;  3T0S A;  1FMV A;  3PU8 A;  5DL5 A;  3A2S X;  5CB4 E;  3GN5 B;  4TZ4 C;  5LBQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...