3AAEB

Crystal structure of actin capping protein in complex with carmil fragment
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
264
structure length
264
Chain Sequence
b'DQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-1
publication title Two distinct mechanisms for the regulation of actin capping protein-competitive or allosteric inhibitions
rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 80
structure length 264
sequence length 264
chains with identical sequence D, F, H, J
ec nomenclature
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aaeB01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aaeB02
5ADXL 4AKRA 4AKRB 5ADXK 3AA7B 3AA1A 3AA7A 3LK2A 3LK2B 3AA1B 3AA0B 1IZNA 3AA0A 3AA6A 3LK3A 1IZNB 3LK3B 3AA6B 5AFUL 5AFUK 2KZ7B 2KZ7A 3AAEB 3LK42 3AAEA 3AAAA 3AAAB 2KXPB 2KXPA 3LK41
chains in the Genus database with same CATH superfamily
1KNRA 1OPFA 4EYYR 1KFYA 3PUYF 2DCFA 3RPUA 1UK5A 5TISO 1CHUA 4TWDA 3AE5A 3EMNX 1YXRA 2X9HA 2ERVA 3EVYA 2YU1A 1XWMA 3KV6A 2W80C 4AKMA 3RBHA 1GFQA 2DNXA 1OEDA 2JQHA 3ZC0A 5AQPB 1QJ9A 4AKGA 3KV4A 4EXTA 4MLKA 1XDPA 2W0GA 4LFBT 3QRCA 5FVNA 5JDGA 2P9BA 3IA3A 3RRWA 3NVOA 4O3XB 4IL4A 3C98B 3UUBA 2CM0A 2WZIA 3AECA 3KBTA 3PU3A 3OKQA 5L3CB 4FZMA 2BG9E 3ZPOA 2V6YB 1OEDC 3HKDE 4LF4T 5CJ5A 4EOZB 3N9LA 4A56A 3J7Yq 1X9BA 2CLYC 2X0YA 4FZLA 1MNDA 2HPLA 3ZMVB 3AA6A 3PJAJ 2BKOA 1LKXA 2WB5A 2W67A 3V5SA 4H63H 3CWZB 5JDHA 4WNKA 1HNWT 3RIUA 3C4WA 5LB7B 4FQEA 2UUAT 3K3QC 2N9DA 4H63V 3G7GA 4N58A 3ETUA 2F1CX 5FY0A 3LDQB 4ZZBA 1HX1B 5LBMA 4E7ZA 3L09A 4UB6O 1U5PA 3PUZF 2Y48B 4UEMA 2XJ7A 2WWUA 3RKGA 2LOSA 2IHR1 5AQTB 3SS1A 5JDNA 3A5XA 2E9XB 4C91A 2ZLDA 4ZI3C 3QK6A 4X5TA 3PQSA 2A3DA 2JQQA 4EZHA 2WMOA 4I55E 4KBMB 2FGRA 1LVFA 3AEDA 4OX9T 4FESA 1D0ZA 5JRCA 3VZUX 1WRDA 4PFOA 2OA5A 3O1HA 5BMVE 3C51A 1E7PA 4JYAT 3NRXA 3DZMA 3NZPA 1P4TA 4XNLA 3UU4A 4HFCA 3R6NA 4IDQA 4XZCA 4LF7T 4JFBA 3LSVA 1H7CA 4AXPA 5JDLA 5AQNB 1THQA 4EYUA 4B3MT 3I0QA 2XG6A 2BZBA 3L3PA 4FUVA 4G63A 2XM2A 5L3EB 2BG9A 5ABEA 1UX5A 3PURA 2CXFA 4LMLA 1W09A 2KLQA 2ZLYA 4OHFA 4QHOA 4JI7T 4NXNT 3RIAA 5EK3A 3IEEA 4AYNA 1BR4A 2XE2A 1BR1A 3JADA 2Y6XA 4G2AA 3VHLA 3AE1A 4QKNA 3RGLA 4ERRA 2LLYA 2XE3A 5HXRA 2ZM0A 2ZM2A 4HWCA 3LFMA 2R4NA 3AEBA 2V6YA 2ZM8A 4JI6T 4EZ4A 2WSSV 2YDRA 4QH4A 3HKCE 4FJOA 2DWGA 3KBUA 4AKLA 3SYSA 6PRNA 2VVNA 4JEHB 4QH1A 2WQYA 4AKRA 3AXJB 4TN7B 2XQ4A 4GHBA 5HEUA 5FL0A 3K3NA 3PTRB 5FY7A 4WYVA 4E7SA 1HX8A 1GQEA 3PUAA 3ZLIA 3WAJA 2VKDA 1SE7A 3UAQA 4IGUA 5LCYA 3OYXA 4AI6A 3FXDB 4V1Av 5L4HA 3ZMSB 3MACA 5GTIO 2QRXA 2WS3A 8PRNA 2V5DA 5KMGP 5IYUA 2VL8A 2ODUA 4TUYE 4M1PA 2VVSA 3IF8B 4ISSA 4HFEA 1US7B 3UUMA 2XTQA 4U9CA 2SPCA 3GN5B 4EB6E 1SA0E 3AAEB 4B3RT 4H9QC 5AQHB 4IE5A 3T20A 2LSKA 4DV5T 2M06A 3UU2A 2E9XA 3RLFF 2KT9A 4DVDA 4MHCA 5FXXA 4YSXA 5LGNB 5AQVB 5AFUK 2AE9A 2UXNB 2XE1A 2B76A 3M3ZB 2M67A 5EE2A 4ASKA 3P50A 2NOXA 2FBWA 4O4JE 2CBIA 4YHJA 1ZHTA 4PW8A 2KWIB 5LHHB 2ZM6T 1YQ3A 3PGSA 3Q5EA 1WLXA 3RC8A 5AQSB 2X9XA 3BRZA 4YXDA 1KF6A 4H9PC 2E9XC 4DR3T 4LSEA 4G75A 3KV5A 3PGUA 4LSIA 3QOFA 2XMXA 4PJ0O 3FZFB 4O4UA 1ZHXA 2XQAA 3MZKB 1HXTA 2MNHA 4JI5T 2XPKA 4IDPA 4FRXA 2LEHA 1QJ8A 2QYWA 1GFMA 4EIWA 1MIVA 3FZHB 3ZC1A 3WI3A 1VCSA 1Y64B 2ES0A 2YOEA 2CCQA 3E08A 2DWKA 4DV0T 5ABGA 3FBZA 1MM5A 4RJXA 4QXBB 2LSGA 2IAKA 4ZZCA 1VOMA 5M4YA 2FUPA 1N36T 3UFEA 4C90A 2QGSA 3RKOA 3SYBA 2LHNA 5C8YE 1UX4A 5F3JA 3A2SX 3P8CD 1YS5A 2M6IA 2BS4A 5FXWA 3PRNA 3UU8A 4L0RA 5L3BB 1IZNA 4AYMC 3ZT7A 3PUSA 4CI3B 4PJNA 3QC9A 5PRNA 1W0BA 2FJDA 5AQJB 4PUXA 3PJAA 3EI0A 4PR7A 3HR0A 1LVKA 2KWHA 3WAKA 3AA1A 3AA6B 4AUIA 2VQFT 4C4VA 3FBLA 3GP6A 4HFIA 2LE8A 5GTHO 4TWHA 3AE8A 2H7VC 3VKGA 1T7SA 3QB5A 1L0VA 2N1GA 1MIYA 3C50A 2IIUA 5LGUB 3A8YC 3UULA 4HGAA 1T8BA 4DV3T 1KNPA 3C4ZA 3LG7A 2QVAA 3AAEA 2Y0HA 4X1KE 2XQ3A 3EUHA 4BAYB 1LRZA 4D5UA 4L9IA 5AQGB 3ABVA 4MBQA 5JDPA 1ZEEA 1Q9FA 3AE2A 1MMDA 4HTEA 4P0AA 4KR4A 4DR6T 4UVCB 4PFPA 1N32T 3NRYA 5KX5E 3F57A 3VRAA 3EHZA 4E1TA 3TLSA 5J0ZA 2VKHA 2WAUA 1S35A 3FZLB 5L3FB 2WP9A 4RJWA 3AA0B 5E0OA 3W15B 4KP3C 5F5WA 2I0MA 3E22E 1ZKEA 2A72A 5JR9A 1WFDA 4CXYA 4FRTA 2D0TA 4A98A 2JMHA 4JBWF 5LJMA 1BR0A 3ANWB 3KDSE 4H9OC 3D0TA 4I50E 4U3CA 3P7IA 2CXDA 3NZQA 5AQLB 1T1LA 4U2ZA 4YTNA 4AKIA 2YDSA 2MBGA 2RPAA 3SY7A 2BG9B 2W81C 2CE7A 4JI1T 2XQYA 2ODVA 4Z8XA 2K0LA 2CMRA 3DJBA 5TAOA 3ONXA 4RLCA 3TLUA 4P0BA 3MK7C 3CPZA 4WBOA 3CQGB 3OTOT 2NW7A 3AEFA 2NTXA 4GYRA 1MPFA 2XAHB 3HL6A 5HWXA 3KFWX 3AE4A 1MMNA 1DU2A 4X1IE 2XM1A 4CN4A 2NWBA 1Q9GA 3LK3A 4AKHA 3L39A 2YEVC 1J5WA 2UXXB 4N74A 2JRKA 3K19A 3POUA 2DI4A 3LBXA 1SHZC 3AE6A 4L5GA 2NP9A 2I59A 2MTQA 4AKRB 4DBQA 1VCTA 2KNDA 2YN6A 3I0OA 3A0HO 4BJMA 2BS3A 3UQ7A 3ONLC 2E9XD 2VASA 2V7IA 4FSPA 2DHRA 2E8IA 2Y0KA 3ZT6A 4UF0A 3N9MA 4QH5A 2CHNA 4AFKA 4IREA 3BQIA 1E54A 3FZKB 4LSFA 4LMJA 2CXLA 2LM9A 4PK5A 1OSMA 2W63A 4YJ3E 4U74A 3X1DA 4C69X 2MOZA 3RYFE 3CQXC 4YT0A 2UUBT 4O4HE 4D65A 2I6HA 2W62A 2HH7A 2CRBA 4PJJA 3ZJ2A 3AB3B 3IBPA 3HKBE 1ZHCA 1HXXA 3VE1A 4HWIB 3RIUC 1NAFA 4U31A 2X0LB 4OYJA 4PJLA 5HWYA 1FJGT 3ZYKA 1GFNA 5HXEA 3A7MA 3AE3A 3LJCA 4NPPA 3O0EA 1HG5A 5HEHA 4ILUA 2LOPA 4HFHA 2N2MA 4Z3TA 1SUMB 3AA0A 2C0SA 3OBVE 2VKOA 4NIQA 2PRNA 3UPGA 2WU2A 2DLRA 4IHJE 2KZ7B 4N59A 2FJBA 3KVAA 4NUVA 2HN2A 5LHIB 3HOLA 3VE2A 2XSBA 3JTYA 3T0SA 3VY9X 2IC9A 1S5LO 2R89A 3JAFA 3ANWA 4O2BE 5H2FO 2Q9QA 1OXZA 3BS0A 5DQWA 2WWVA 2KMFA 2J4UP 1HNZT 2V6XA 4HFVA 4AYEC 4JV5T 4I4TE 5HEOA 3EAMA 4IDOA 4I43B 5FVLA 1D1BA 2CHOA 3HOEA 2KDYA 2C5KT 4YLHA 5LMUT 4YHHT 4AQYT 4Z90A 1NEKA 3ETVA 2YINA 5JVDE 4DIDB 2LT3A 4B3TT 3SWHA 1IJ5A 3RQWA 3ZSTA 4N75A 3CX6B 2K48A 3H3MA 3SZDA 4HFBA 2WCAA 3N2KE 3F2EA 2BG9C 2UXDT 5CB4E 1UCUA 2XAJB 3N5LA 1IZNB 2EHOB 4YY3T 5AQKB 4DV6T 2F4VT 5FP3A 4K3BA 2KINB 3PUQA 3CMLA 4E1SA 5AQFB 4GCPA 2JQ9A 2X68A 2MPKA 4KI0F 1KNZA 4AQFA 3NJTA 4IL6O 2WDQA 3RF1A 4ZEYA 1HS7A 4X64T 3UQ4A 3BQLA 4TX5A 1FIOA 2J1DG 3CX8B 3AA1B 4ZXLA 3V8UA 5ABHA 4EGWA 3B5MA 4C4VB 4IL9A 1FEWA 4CTDA 5LGTB 2Y7SA 5FVKA 3EDUA 4DUZT 2PFVA 5HEJA 3UTKA 2BBJA 2IW5B 2HPJA 4DV1T 2X67A 4FSOA 4KRAA 4FZNA 1FMVA 2K9AA 3AVRA 3CIRA 4ADZA 4ZHQE 4F6RC 5CA1E 4IE0A 5LG4A 2D5UA 4U7YA 3S4UA 1HR0T 1XNRT 4CQIA 4FMSA 4HE8A 3C64A 4B6XA 2UU9T 2AXTO 2YKSA 3C4XA 4GIWA 4YSYA 2J47A 3AAIA 2WJRA 3NWIA 3QRAA 5KDMC 3JC6D 5L3DB 5JTGA 5HXCA 3PGRA 3ZCIA 3P4SA 5LBQB 3CVRA 2XHEB 2WZHA 4U72A 5JDFA 1E2AA 2IWWA 1G90A 2V8SV 1WYCA 4DR7T 2WU5A 2V1DB 3AEEA 3L8RA 4AZLA 3O1JA 1YKEB 3LK2A 3KZIO 2AXDS 4K0KT 2C5JA 3T1YT 1ORMA 1HF8A 3TKLB 2KZ7A 2XSAA 4COFA 2E2AA 3C5OA 5C3JA 2QTKA 4H9NC 4LF8T 2W00A 4HWDA 5E79O 5JR9B 2H7OA 1YW0A 4DR1T 1D1AA 4BJNA 4ZI2D 2BKPA 4AQGA 2H88A 2L9QA 4DV4T 1WYBA 2BBHA 2XE5A 4PK4A 1NENA 3RI5A 5G3AA 5EK2A 1JNRA 5LOVE 3HW9A 2F1TA 3RC3A 4X1YE 2VB6A 1Z0PA 4IDZA 2K3WA 4IE4A 5F8PA 3ZCJA 5AFUL 2HHHT 1KEYA 3SFDA 3O9XA 4CN1A 3NBXX 4YTPA 2X9YA 3UU6A 4X66T 4YSZA 2YPVA 4XAXB 4DR2T 4U33A 3LK3B 1T72A 2LFUA 2PORA 2R4OA 2EHOA 2WDVA 3ZSSA 2UXCT 2WBLA 1MM4A 3MKDA 2V7JA 2XZEA 4NUUA 2O4VA 2GE4A 2K4TA 5GV0A 1QSDA 3LBXB 3UUXB 3T8OA 5ADXK 3OPCA 4K3CA 3ZMTB 4DR5T 4UV8B 4I0UA 4ZOLE 1I94T 5LG3A 2K24A 2L8KA 3PUGA 2CWOA 3CQCB 1HCIA 2ZMAA 3K8PC 5HXHA 1UGOA 3F31A 4UF0B 4KR8A 1W0AA 4UIGA 1HNXT 4HWHA 4GF4A 3CKDA 3RX6A 2NR4A 4GYSA 1XNQT 2R8AA 5L47A 3JCFA 2Y0LA 2M6BA 4JI3T 3JAEA 5J1GA 4U7IA 4ILCA 4G76A 4P1NA 2YNKA 5BR8T 2LKGA 2V7KA 4JLEA 4K0UA 1HFAA 3I9WA 3ZMZB 3GA8A 4BA9A 1N33T 2VL0A 1UURA 2XUEA 4EAHA 3AE9A 3IHRA 5KAFO 5IUXA 1BH3A 2Q9QD 3RYHE 2V7LA 4A5XA 3AAAA 5H6QB 3VRBA 4YJ2E 3AEGA 2PG8A 3Q5WA 5LMNT 4CN6A 2MAWA 3RYIE 4AYID 4FOZA 2WY2A 5ADXL 2C5IT 4JI8T 2YU2A 4QQ1A 2CBJA 2LHRA 2XTRA 2IUBA 1PHOA 5AQQB 4UVBB 3ZJ1A 4CI1B 5FKYA 4DNDA 3FYXA 4JUYA 2XAQB 4DMVA 3FHNA 1YQ4A 5L4EA 3FZMB 4QX7B 5FMNA 3Q2MA 4IE7A 2Q9QB 5DL6A 5G39A 4O4LE 3R84B 3KVBA 4LMKA 1G8XA 2WM9A 1MNEA 3G06A 5HYAA 3ZMUB 2JQKA 3P4RA 2Z6EA 5JR9C 4PNIA 5B5EO 5FY1A 1VRBA 5DL8A 3TLVA 4DR4T 3BQKA 2W61A 5ABFB 3JC6C 3RYCE 3KV9A 3FXEB 2IMLA 1ZHWA 5LJNA 1XZYA 2CWYA 3MXZA 3ZYLA 5HCMA 4ZS2A 2WJQA 5JQGE 4UXNB 1BT9A 3U78A 2WDRA 2VQET 4NXMT 2BVMA 5KXJA 4UR9A 3MJXA 2GK9A 5J2UE 2X9WA 4LSHA 2CEAA 3ZN0B 3PUXF 3LK42 4XBFB 3SFEA 4H9SE 1BR2A 4ILBA 2XAFB 3TLWA 3ONJA 4ANJA 3KINB 2X0HA 4ZI2C 2JIWA 2VK9A 4Q25A 5G38A 3PV0F 4BUMX 4WW0A 4UB8O 2UUCT 4EEDA 2LSIA 3Q5DA 2XQ8A 3BRYA 4GCSA 1BXWA 2XQ9A 3PDYA 1D1CA 4GK5E 4TWFA 3FB2A 2W66A 3DWOX 2ACXA 5HXSA 4O8SA 2NW8A 3Q5XA 4U2YA 3V5UA 5IYZE 5JH7E 4GK0E 3E0ZA 1M62A 4CXXA 1D0YA 5HCJA 1OWAA 2X66A 2CA5A 3H3AA 3ZYMA 1MIWA 1T16A 4CXWA 2N2NA 1IBKT 4DO0A 4P09A 1V9DA 2IDOB 2XQ5A 1H6S1 4HWFA 3I9YA 1JNZA 1WCRA 2E5LT 4GCQA 4O3YA 2LRLA 4GOUA 2IC6A 4YFSA 2KC0A 2ZFGA 3P4QA 5G26A 4HN9A 4TNWA 1ZHZA 2Y2XA 5DQVA 3NKZA 5D5DA 2WVPA 3K1SA 4WZXA 2JMKA 4H9RC 2RA1A 3CX7B 5LNKA 3Q9DA 3LK2B 4WBNE 4O4XA 1W9RA 4X20E 3SRZA 3KVDD 2BKNA 3WI5A 4O49A 1E1HB 3PUVF 3RHWA 3ZKRA 2J62A 3EDVA 3SZVA 4LF9T 2H3RA 3DTOA 3AEAA 5JREA 3VR8A 1J5ET 2LKHA 3DA4A 4OFZA 1GFOA 3K3OA 5GONE 5T5FA 2NW9A 5ETWA 2EHOD 2CPTA 4CZZB 4KX6A 5LP6E 2UXBT 2MHLA 3N9QA 4ZS3A 5CA0E 4KHZF 2PJQA 5ABFA 3GWHA 1Z8UA 1J1JA 2E5VA 2Q9QC 1XDOA 3MA9A 3OJAA 4CI2B 3PE0A 4TZ4C 2JMMA 3VKHA 2A9UA 2XASB 3QB5K 5HEGA 5FL1A 5DL7A 4IDNA 1YD8G 3WU2O 5J2TE 2W2UA 2D2SA 5C2TA 2Y8DA 3BK9A 3RIFA 2KXPB 1I6ZA 4FT6A 3VU7H 2VURA 4F4BA 5FNVE 3M65A 2R4PA 5CFBA 4IIJE 3SOLA 5HAXA 3UU3A 5LYJE 2FGQX 1R8IA 3ZEFB 2IWVA 1XMOT 2WMNA 3QUJA 4OK0A 4KHPT 4EV6A 1O3XA 2DL1A 3P4PA 4J2CA 3TZGA 4XNKA 4EEBA 1T98A 4TV9E 3RRCA 2OMFA 2X27X 1ZHYA 5H6RB 2LSYA 5AQRB 4JI4T 4AQFC 2BS2A 1MMAA 1QLBA 1IBMT 3DWNA 3UT5E 3JCUO 1ZP0A 3UUNA 4QWNB 5AQUB 3HKEE 2MYSA 4HFDA 1GFPA 2FJAA 1HXUA 2LM2A 2JPFA 4LF6T 4IT4A 2J4GA 3VZTX 2PBIA 2XQ7A 1X79A 2XTLA 1CUNA 2JJ9A 3DP7A 3AAAB 1QJPA 4PJMA 4AIUA 1IJ6A 4N78D 4RL9A 4DUYT 4HEAA 1M7KA 1PRNA 3I1AA 4IE6A 4Z91A 5EK4A 4UV9B 5L2LA 1ZV4X 2B1EA 5DABA 1XMQT 2RP4A 1AJ3A 3RQUA 1YKHB 5FXZA 2NTYA 3N2GE 1KK7A 3AA7B 2KSRA 1HTJF 3UU5A 5JDMA 5IWAT 3O4XE 2J1NA 2OV9A 4ZI7E 1B7TA 1ZOYA 2A2FX 4UELA 1IAPA 4O3ZA 2L3LA 5FYMA 1EZ3A 2R88A 3HA4A 4ISTA 2VKJA 4PK6A 3RH3A 5L3GB 5LHGB 5AQMB 2D9DA 1NWMX 3OYZA 2LHFA 4OYKA 2XAGB 4QXHB 3UFGA 2YDQA 2X9KA 1OEDB 4O4IE 4O2AE 3POQA 3QNUA 3N2OA 2YK0A 4YTMA 4FI5A 2QA7A 4AYDC 4UVAB 3N9OA 3HI2A 4MFRA 2CLYB 2KXPA 3PORA 3LK41 4A97A 4JI2T 2LRKA 4C00A 4JI0T 4LFCT 4D64A 3TLTA 1D0XA 1WR0A 2BDEA 4ZI3D 2VWAA 2R6GF 4LFAT 1OEDE 3POXA 5AQOB 5KAIO 2HN1A 5IHYA 3ESLA 3AVSA 3P4WA 3O1IA 2EHOC 1FMWA 3AXJA 4PAGA 3N9NA 3PUWF 2XY8B 2ACZA 1S94A 5AQIB 2X51A 3AE7A 4LF5T 3NSGA 4B3ST 3PF1A 3ZN1B 4DV7T 2F1VA 2ODJA 2R4LA 1QUUA 5A1LA 4X62T 3EABA 1IBLT 3T1HT 1U4QA 3PQUA 2LSJA 3A0BO 4MALA 4TV8E 4HKAA 3B57A 3OVUA 3H37A 2OLTA 4QX8B 1G73A 4RLBA 3N9PA 2N2LA 5DJQC 4ILAA 4GKKT 3GN5A 4KMCA 3ZT5A 5CGMA 2FJEA 4X65T 2LJLA 2BVLA 1UUSA 3WI4A 1MMGA 2JQYA 5LA6E 4JEUB 2V7MA 2W4XA 3PU8A 2H89A 5B66O 5LXTE 2M07A 1WR6A 2V26A 3VR9A 3DA3A 4DBRA 2K5BB 4GKJT 1Y01A 4O3WA 3B13A 1N34T 4B61A 4F8HA 3U3IA 2G0UA 2V5CA 4QXCB 3VY8X 4DV2T 5JRCB 4DMWA 3J9X1 3SY9A 5DL5A 7PRNA 3AA7A 2XQ6A 3HWBA 3GMIA 3VZWX 1HG2A 4AISA 2D0UA 3T24A 4TNVA 5EZYE 5JDQA 4KUMB 3CK6A 5FXVA 4JCHA 2PTFA
chains in the Genus database with same CATH topology
3A2SX 2HPJA 3P8CD 2JMKA 2X67A 1YS5A 4FSOA 5FXWA 4H9RC 4KRAA 3PRNA 2RA1A 1OPFA 4FZNA 3CX7B 1FMVA 4EYYR 5LNKA 4L0RA 5L3BB 3Q9DA 2K9AA 3AVRA 3LK2B 1IZNA 4WBNE 4O4XA 4X20E 4ADZA 3SRZA 2DCFA 3RPUA 4ZHQE 3KVDD 4AYMC 4CI3B 3PUSA 4F6RC 4PJNA 3WI5A 3QC9A 5CA1E 4IE0A 5LG4A 4O49A 5PRNA 1E1HB 2D5UA 4PUXA 3EMNX 3S4UA 3EDVA 2X9HA 2ERVA 3EVYA 2YU1A 3SZVA 4CQIA 4FMSA 3KV6A 3HR0A 2W80C 4HE8A 3RBHA 2H3RA 3C64A 1GFQA 4AKMA 1LVKA 4B6XA 2DNXA 3DTOA 2KWHA 3C4XA 3WAKA 4GIWA 3ZC0A 3AAIA 1QJ9A 4AKGA 5JREA 3KV4A 3AA1A 4EXTA 3QRAA 5KDMC 3JC6D 4MLKA 3AA6B 4AUIA 5L3DB 2W0GA 5HXCA 3FBLA 3DA4A 3ZCIA 4OFZA 3QRCA 1GFOA 3K3OA 5GONE 5LBQB 5JDGA 2P9BA 2XHEB 3CVRA 4U72A 3GP6A 5FVNA 3RRWA 2LE8A 5JDFA 2NW9A 5T5FA 5ETWA 2EHOD 4O3XB 2H7VC 3VKGA 3C98B 1G90A 4CZZB 2CM0A 1WYCA 2N1GA 5FY1A 5LP6E 3KBTA 2V1DB 3PU3A 1MIYA 3C50A 3OKQA 2MHLA 4AZLA 5L3CB 5LGUB 4FZMA 3O1JA 3N9QA 4ZS3A 1YKEB 3ZPOA 3LK2A 5CA0E 3UULA 4HGAA 2C5JA 2PJQA 3GWHA 3C4ZA 3HKDE 1ORMA 3LG7A 1HF8A 3TKLB 2KZ7A 3AAEA 2Y0HA 4X1KE 4EOZB 2Q9QC 3MA9A 3OJAA 4CI2B 3EUHA 4H9NC 2W00A 4BAYB 3N9LA 4A56A 5JR9B 3J7Yq 1LRZA 4D5UA 3PE0A 2H7OA 4L9IA 4TZ4C 1YW0A 1D1AA 2CLYC 4MBQA 4BJNA 4ZI2D 2JMMA 4AQGA 3VKHA 4FZLA 5JDPA 1MNDA 1ZEEA 2HPLA 2XASB 1Q9FA 2L9QA 3ZMVB 3AA6A 5DL7A 1MMDA 1WYBA 4HTEA 1YD8G 1LKXA 5J2TE 4P0AA 2D2SA 3V5SA 2XE5A 2Y8DA 4KR4A 4H63H 4UVCB 3CWZB 4PK4A 4PFPA 3BK9A 5JDHA 2KXPB 3NRYA 5EK2A 4FT6A 3VU7H 5KX5E 4F4BA 5LOVE 3HW9A 3F57A 4WNKA 5FNVE 2F1TA 4E1TA 3RC3A 3M65A 3C4WA 4X1YE 2VKHA 2VB6A 1Z0PA 4IIJE 4IDZA 5HAXA 3SOLA 3K3QC 2WAUA 2N9DA 4H63V 1S35A 3G7GA 5L3FB 4IE4A 5F8PA 5LYJE 4N58A 3ETUA 4RJWA 3AA0B 2FGQX 5FY0A 3ZCJA 5E0OA 5AFUL 5LBMA 3W15B 3ZEFB 4E7ZA 3L09A 4KP3C 1U5PA 2WMNA 3QUJA 4OK0A 3E22E 2Y48B 3O9XA 1ZKEA 2A72A 5JR9A 4UEMA 1O3XA 3NBXX 4CXYA 4FRTA 2WWUA 2D0TA 2JMHA 2X9YA 4J2CA 3TZGA 4XNKA 1T98A 4TV9E 2LOSA 3RRCA 3SS1A 5JDNA 2OMFA 5LJMA 2X27X 1BR0A 2YPVA 3A5XA 3ANWB 5H6RB 2E9XB 1ZHYA 2LSYA 3KDSE 4XAXB 4AQFC 1MMAA 4H9OC 3D0TA 3LK3B 4C91A 4I50E 2LFUA 4ZI3C 2PORA 3QK6A 2EHOA 2ZLDA 3UT5E 3P7IA 2CXDA 3PQSA 2WBLA 3NZQA 1MM4A 3MKDA 2A3DA 2JQQA 2V7JA 4NUUA 4QWNB 3UUNA 4EZHA 2WMOA 2O4VA 4AKIA 2GE4A 2K4TA 3HKEE 5GV0A 2MBGA 4I55E 3SY7A 4KBMB 2FGRA 2W81C 1QSDA 2CE7A 1LVFA 2MYSA 1GFPA 3LBXB 2XQYA 2ODVA 4Z8XA 1HXUA 4FESA 2JPFA 3UUXB 1D0ZA 2K0LA 5JRCA 3VZUX 2CMRA 3DJBA 5TAOA 3T8OA 5ADXK 3ONXA 1WRDA 4RLCA 4PFOA 2OA5A 3O1HA 5BMVE 3C51A 3VZTX 2PBIA 4P0BA 3NRXA 3ZMTB 1X79A 3NZPA 3MK7C 1P4TA 4XNLA 3CPZA 4UV8B 4WBOA 2XTLA 4ZOLE 3CQGB 1CUNA 2K24A 2L8KA 2NW7A 2JJ9A 3DP7A 3PUGA 2CWOA 3R6NA 2NTXA 3CQCB 1HCIA 3AAAB 4XZCA 2ZMAA 4GYRA 1MPFA 1QJPA 3K8PC 5HXHA 4PJMA 4JFBA 3F31A 2XAHB 4UF0B 3HL6A 5HWXA 3KFWX 1MMNA 1IJ6A 1H7CA 4N78D 4X1IE 4AXPA 5JDLA 4KR8A 4RL9A 4UIGA 1THQA 4EYUA 4GF4A 4HEAA 1PRNA 3CKDA 3I1AA 3RX6A 4GYSA 2NWBA 1Q9GA 3LK3A 4IE6A 3I0QA 2XG6A 2BZBA 4AKHA 5EK4A 4UV9B 3L3PA 1ZV4X 5L2LA 2Y0LA 4FUVA 2YEVC 2B1EA 5DABA 4G63A 2UXXB 2JRKA 5J1GA 5L3EB 2RP4A 3K19A 3POUA 2DI4A 4G76A 3LBXA 1SHZC 1UX5A 3PURA 2NP9A 2I59A 2CXFA 4L5GA 2YNKA 1AJ3A 2V7KA 2MTQA 2KLQA 4JLEA 4AKRB 1YKHB 5FXZA 4DBQA 2NTYA 2ZLYA 4K0UA 1HFAA 2KNDA 4OHFA 3N2GE 3I9WA 3ZMZB 3GA8A 1KK7A 3AA7B 4QHOA 4BA9A 3I0OA 4BJMA 2XUEA 1HTJF 5EK3A 5JDMA 4EAHA 3O4XE 3IHRA 2E9XD 3IEEA 2VASA 2V7IA 4FSPA 4AYNA 1BR4A 1BH3A 2DHRA 2Q9QD 2E8IA 2V7LA 3RYHE 2J1NA 2Y0KA 2XE2A 5H6QB 3AAAA 4YJ2E 1BR1A 3C5OA 4ZI7E 2Y6XA 4G2AA 3VHLA 4QKNA 4UF0A 3N9MA 4ERRA 2XE3A 2PG8A 5HXRA 1B7TA 3Q5WA 2A2FX 2ZM0A 4UELA 3RYIE 4AFKA 4AYID 1IAPA 2ZM2A 5ADXL 4FOZA 2L3LA 4O3ZA 5FYMA 1EZ3A 3BQIA 1E54A 2C5IT 3LFMA 3HA4A 4ISTA 2VKJA 4LSFA 4PK6A 3RH3A 2YU2A 2CXLA 4QQ1A 2LM9A 2ZM8A 4PK5A 5L3GB 5LHGB 1OSMA 2LHRA 4EZ4A 2WSSV 2XTRA 3HKCE 4FJOA 2W63A 4YJ3E 4U74A 1PHOA 1NWMX 2DWGA 3OYZA 4UVBB 2LHFA 4OYKA 4C69X 2MOZA 3KBUA 3ZJ1A 4CI1B 2XAGB 4QXHB 4AKLA 3RYFE 3SYSA 6PRNA 3CQXC 4DNDA 3FYXA 4JEHB 4JUYA 4O4HE 4D65A 4AKRA 2XAQB 5DL8A 2W62A 4O4IE 2HH7A 4TN7B 4DMVA 4O2AE 3POQA 3N2OA 3FHNA 4PJJA 2YK0A 3ZJ2A 3AB3B 3IBPA 4GHBA 3HKBE 4QX7B 1ZHCA 5FMNA 4FI5A 1HXXA 3Q2MA 4IE7A 3K3NA 2QA7A 3PTRB 2Q9QB 5FY7A 4UVAB 3N9OA 3HI2A 3VE1A 4AYDC 1NAFA 4MFRA 2X0LB 4E7SA 1HX8A 3ZLIA 3PUAA 4OYJA 4PJLA 5HWYA 5DL6A 3WAJA 2VKDA 3ZYKA 2CLYB 4O4LE 3R84B 3UAQA 4IGUA 1GFNA 5HXEA 3KVBA 1G8XA 2WM9A 3LJCA 5LCYA 3OYXA 4AI6A 2KXPA 3O0EA 1HG5A 1MNEA 3FXDB 3PORA 3LK41 4V1Av 3ZMSB 3MACA 5HYAA 3ZMUB 4ILUA 2LOPA 2Z6EA 5JR9C 2N2MA 8PRNA 4PNIA 4D64A 4Z3TA 5KMGP 1D0XA 5IYUA 2BDEA 1VRBA 2ODUA 2VL8A 4TUYE 4M1PA 3BQKA 2C0SA 3IF8B 3OBVE 4ISSA 2VKOA 2VWAA 2W61A 2PRNA 3UUMA 1US7B 3JC6C 2XTQA 3UPGA 3RYCE 3KV9A 3FXEB 3AA0A 2DLRA 4U9CA 2SPCA 3GN5B 4IHJE 1ZHWA 2KZ7B 4EB6E 3POXA 1SA0E 3AAEB 2CWYA 5LJNA 4N59A 3MXZA 3KVAA 5IHYA 3ZYLA 4H9QC 4NUVA 4ZS2A 3ESLA 3AVSA 3O1IA 2EHOC 5LHIB 3HOLA 1FMWA 4IE5A 3T20A 3VE2A 3JTYA 5JQGE 2LSKA 4UXNB 1BT9A 3T0SA 3U78A 3VY9X 2IC9A 2BVMA 2M06A 3ANWA 3UU2A 2E9XA 2KT9A 4PAGA 3N9NA 4DVDA 4MHCA 4O2BE 5FXXA 1S94A 2GK9A 2X51A 3MJXA 5J2UE 3NSGA 2Q9QA 2X9WA 1OXZA 5LGNB 5DQWA 4LSHA 2CEAA 5AFUK 3ZN0B 3ZN1B 3LK42 2UXNB 2XE1A 2F1VA 4XBFB 2ODJA 2KMFA 2J4UP 2M67A 5EE2A 1QUUA 4H9SE 1BR2A 4ASKA 4HFVA 5A1LA 2NOXA 2XAFB 4AYEC 4I4TE 4O4JE 1U4QA 4YHJA 4I43B 3PQUA 1ZHTA 4PW8A 4ANJA 3KINB 2LSJA 1D1BA 2KWIB 4ZI2C 4MALA 4TV8E 5LHHB 2VK9A 4HKAA 3HOEA 2KDYA 3B57A 1WLXA 2C5KT 3H37A 3RC8A 4BUMX 4QX8B 2X9XA 4YLHA 1G73A 4RLBA 3N9PA 4WW0A 2N2LA 5DJQC 4H9PC 3GN5A 4KMCA 2E9XC 3ETVA 4LSEA 4G75A 3KV5A 2YINA 5JVDE 2LSIA 2LT3A 2LJLA 3SWHA 1IJ5A 2BVLA 4LSIA 2XMXA 4GCSA 3WI4A 1MMGA 1BXWA 3PDYA 3CX6B 2K48A 5LA6E 4JEUB 1D1CA 2V7MA 3PU8A 4GK5E 3SZDA 5LXTE 2M07A 4O4UA 3N2KE 3FB2A 3F2EA 1ZHXA 1WR6A 3MZKB 1HXTA 2V26A 5CB4E 2ACXA 2MNHA 1UCUA 5HXSA 2XAJB 2NW8A 3Q5XA 4O8SA 2LEHA 4FRXA 3N5LA 1IZNB 5IYZE 3V5UA 1QJ8A 5JH7E 2EHOB 4GK0E 3E0ZA 4CXXA 3DA3A 4DBRA 4ZI3D 4EIWA 1D0YA 1GFMA 1MIVA 2K5BB 1OWAA 3ZC1A 5FP3A 2X66A 2KINB 2CA5A 3WI3A 3PUQA 3B13A 3H3AA 3ZYMA 4O3WA 1MIWA 4B61A 1Y64B 3CMLA 2QTKA 4CXWA 4E1SA 2N2NA 4GCPA 2X68A 3U3IA 1KNZA 2G0UA 4AQFA 2ES0A 2CCQA 4QXCB 4DO0A 3E08A 3VY8X 1HS7A 5JRCB 3BQLA 4TX5A 4DMWA 4P09A 3J9X1 2DWKA 1V9DA 3SY9A 5DL5A 3FBZA 1MM5A 7PRNA 1FIOA 3AA7A 1H6S1 2J1DG 3CX8B 3AA1B 3I9YA 4QXBB 4RJXA 3V8UA 2LSGA 2IAKA 3HWBA 1VOMA 5M4YA 4GCQA 4O3YA 1FEWA 3GMIA 4GOUA 2IC6A 3UFEA 4C90A 1HG2A 2QGSA 3VZWX 3RKOA 2D0UA 4YFSA 3SYBA 2LHNA 5C8YE 3T24A 5LGTB 2KC0A 2Y7SA 2ZFGA 5G26A 5EZYE 4HN9A 5JDQA 4KUMB 3EDUA 1ZHZA 2Y2XA 5DQVA 5FXVA 2PFVA 4JCHA 1UX4A 3UTKA 5F3JA 5D5DA 2IW5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ADX L;  4AKR A;  4AKR B;  5ADX K;  3AA7 B;  3AA1 A;  3AA7 A;  3LK2 A;  3LK2 B;  3AA1 B;  3AA0 B;  1IZN A;  3AA0 A;  3AA6 A;  3LK3 A;  1IZN B;  3LK3 B;  3AA6 B;  5AFU L;  5AFU K;  2KZ7 B;  2KZ7 A;  3AAE B;  3LK4 2;  3AAE A;  3AAA A;  3AAA B;  2KXP B;  2KXP A;  3LK4 1; 
#chains in the Genus database with same CATH topology
 1KNR A;  1OPF A;  4EYY R;  1KFY A;  3PUY F;  2DCF A;  3RPU A;  1UK5 A;  5TIS O;  1CHU A;  4TWD A;  3AE5 A;  3EMN X;  1YXR A;  2X9H A;  2ERV A;  3EVY A;  2YU1 A;  1XWM A;  3KV6 A;  2W80 C;  4AKM A;  3RBH A;  1GFQ A;  2DNX A;  1OED A;  2JQH A;  3ZC0 A;  5AQP B;  1QJ9 A;  4AKG A;  3KV4 A;  4EXT A;  4MLK A;  1XDP A;  2W0G A;  4LFB T;  3QRC A;  5FVN A;  5JDG A;  2P9B A;  3IA3 A;  3RRW A;  3NVO A;  4O3X B;  4IL4 A;  3C98 B;  3UUB A;  2CM0 A;  2WZI A;  3AEC A;  3KBT A;  3PU3 A;  3OKQ A;  5L3C B;  4FZM A;  2BG9 E;  3ZPO A;  2V6Y B;  1OED C;  3HKD E;  4LF4 T;  5CJ5 A;  4EOZ B;  3N9L A;  4A56 A;  3J7Y q;  1X9B A;  2CLY C;  2X0Y A;  4FZL A;  1MND A;  2HPL A;  3ZMV B;  3AA6 A;  3PJA J;  2BKO A;  1LKX A;  2WB5 A;  2W67 A;  3V5S A;  4H63 H;  3CWZ B;  5JDH A;  4WNK A;  1HNW T;  3RIU A;  3C4W A;  5LB7 B;  4FQE A;  2UUA T;  3K3Q C;  2N9D A;  4H63 V;  3G7G A;  4N58 A;  3ETU A;  2F1C X;  5FY0 A;  3LDQ B;  4ZZB A;  1HX1 B;  5LBM A;  4E7Z A;  3L09 A;  4UB6 O;  1U5P A;  3PUZ F;  2Y48 B;  4UEM A;  2XJ7 A;  2WWU A;  3RKG A;  2LOS A;  2IHR 1;  5AQT B;  3SS1 A;  5JDN A;  3A5X A;  2E9X B;  4C91 A;  2ZLD A;  4ZI3 C;  3QK6 A;  4X5T A;  3PQS A;  2A3D A;  2JQQ A;  4EZH A;  2WMO A;  4I55 E;  4KBM B;  2FGR A;  1LVF A;  3AED A;  4OX9 T;  4FES A;  1D0Z A;  5JRC A;  3VZU X;  1WRD A;  4PFO A;  2OA5 A;  3O1H A;  5BMV E;  3C51 A;  1E7P A;  4JYA T;  3NRX A;  3DZM A;  3NZP A;  1P4T A;  4XNL A;  3UU4 A;  4HFC A;  3R6N A;  4IDQ A;  4XZC A;  4LF7 T;  4JFB A;  3LSV A;  1H7C A;  4AXP A;  5JDL A;  5AQN B;  1THQ A;  4EYU A;  4B3M T;  3I0Q A;  2XG6 A;  2BZB A;  3L3P A;  4FUV A;  4G63 A;  2XM2 A;  5L3E B;  2BG9 A;  5ABE A;  1UX5 A;  3PUR A;  2CXF A;  4LML A;  1W09 A;  2KLQ A;  2ZLY A;  4OHF A;  4QHO A;  4JI7 T;  4NXN T;  3RIA A;  5EK3 A;  3IEE A;  4AYN A;  1BR4 A;  2XE2 A;  1BR1 A;  3JAD A;  2Y6X A;  4G2A A;  3VHL A;  3AE1 A;  4QKN A;  3RGL A;  4ERR A;  2LLY A;  2XE3 A;  5HXR A;  2ZM0 A;  2ZM2 A;  4HWC A;  3LFM A;  2R4N A;  3AEB A;  2V6Y A;  2ZM8 A;  4JI6 T;  4EZ4 A;  2WSS V;  2YDR A;  4QH4 A;  3HKC E;  4FJO A;  2DWG A;  3KBU A;  4AKL A;  3SYS A;  6PRN A;  2VVN A;  4JEH B;  4QH1 A;  2WQY A;  4AKR A;  3AXJ B;  4TN7 B;  2XQ4 A;  4GHB A;  5HEU A;  5FL0 A;  3K3N A;  3PTR B;  5FY7 A;  4WYV A;  4E7S A;  1HX8 A;  1GQE A;  3PUA A;  3ZLI A;  3WAJ A;  2VKD A;  1SE7 A;  3UAQ A;  4IGU A;  5LCY A;  3OYX A;  4AI6 A;  3FXD B;  4V1A v;  5L4H A;  3ZMS B;  3MAC A;  5GTI O;  2QRX A;  2WS3 A;  8PRN A;  2V5D A;  5KMG P;  5IYU A;  2VL8 A;  2ODU A;  4TUY E;  4M1P A;  2VVS A;  3IF8 B;  4ISS A;  4HFE A;  1US7 B;  3UUM A;  2XTQ A;  4U9C A;  2SPC A;  3GN5 B;  4EB6 E;  1SA0 E;  3AAE B;  4B3R T;  4H9Q C;  5AQH B;  4IE5 A;  3T20 A;  2LSK A;  4DV5 T;  2M06 A;  3UU2 A;  2E9X A;  3RLF F;  2KT9 A;  4DVD A;  4MHC A;  5FXX A;  4YSX A;  5LGN B;  5AQV B;  5AFU K;  2AE9 A;  2UXN B;  2XE1 A;  2B76 A;  3M3Z B;  2M67 A;  5EE2 A;  4ASK A;  3P50 A;  2NOX A;  2FBW A;  4O4J E;  2CBI A;  4YHJ A;  1ZHT A;  4PW8 A;  2KWI B;  5LHH B;  2ZM6 T;  1YQ3 A;  3PGS A;  3Q5E A;  1WLX A;  3RC8 A;  5AQS B;  2X9X A;  3BRZ A;  4YXD A;  1KF6 A;  4H9P C;  2E9X C;  4DR3 T;  4LSE A;  4G75 A;  3KV5 A;  3PGU A;  4LSI A;  3QOF A;  2XMX A;  4PJ0 O;  3FZF B;  4O4U A;  1ZHX A;  2XQA A;  3MZK B;  1HXT A;  2MNH A;  4JI5 T;  2XPK A;  4IDP A;  4FRX A;  2LEH A;  1QJ8 A;  2QYW A;  1GFM A;  4EIW A;  1MIV A;  3FZH B;  3ZC1 A;  3WI3 A;  1VCS A;  1Y64 B;  2ES0 A;  2YOE A;  2CCQ A;  3E08 A;  2DWK A;  4DV0 T;  5ABG A;  3FBZ A;  1MM5 A;  4RJX A;  4QXB B;  2LSG A;  2IAK A;  4ZZC A;  1VOM A;  5M4Y A;  2FUP A;  1N36 T;  3UFE A;  4C90 A;  2QGS A;  3RKO A;  3SYB A;  2LHN A;  5C8Y E;  1UX4 A;  5F3J A;  3A2S X;  3P8C D;  1YS5 A;  2M6I A;  2BS4 A;  5FXW A;  3PRN A;  3UU8 A;  4L0R A;  5L3B B;  1IZN A;  4AYM C;  3ZT7 A;  3PUS A;  4CI3 B;  4PJN A;  3QC9 A;  5PRN A;  1W0B A;  2FJD A;  5AQJ B;  4PUX A;  3PJA A;  3EI0 A;  4PR7 A;  3HR0 A;  1LVK A;  2KWH A;  3WAK A;  3AA1 A;  3AA6 B;  4AUI A;  2VQF T;  4C4V A;  3FBL A;  3GP6 A;  4HFI A;  2LE8 A;  5GTH O;  4TWH A;  3AE8 A;  2H7V C;  3VKG A;  1T7S A;  3QB5 A;  1L0V A;  2N1G A;  1MIY A;  3C50 A;  2IIU A;  5LGU B;  3A8Y C;  3UUL A;  4HGA A;  1T8B A;  4DV3 T;  1KNP A;  3C4Z A;  3LG7 A;  2QVA A;  3AAE A;  2Y0H A;  4X1K E;  2XQ3 A;  3EUH A;  4BAY B;  1LRZ A;  4D5U A;  4L9I A;  5AQG B;  3ABV A;  4MBQ A;  5JDP A;  1ZEE A;  1Q9F A;  3AE2 A;  1MMD A;  4HTE A;  4P0A A;  4KR4 A;  4DR6 T;  4UVC B;  4PFP A;  1N32 T;  3NRY A;  5KX5 E;  3F57 A;  3VRA A;  3EHZ A;  4E1T A;  3TLS A;  5J0Z A;  2VKH A;  2WAU A;  1S35 A;  3FZL B;  5L3F B;  2WP9 A;  4RJW A;  3AA0 B;  5E0O A;  3W15 B;  4KP3 C;  5F5W A;  2I0M A;  3E22 E;  1ZKE A;  2A72 A;  5JR9 A;  1WFD A;  4CXY A;  4FRT A;  2D0T A;  4A98 A;  2JMH A;  4JBW F;  5LJM A;  1BR0 A;  3ANW B;  3KDS E;  4H9O C;  3D0T A;  4I50 E;  4U3C A;  3P7I A;  2CXD A;  3NZQ A;  5AQL B;  1T1L A;  4U2Z A;  4YTN A;  4AKI A;  2YDS A;  2MBG A;  2RPA A;  3SY7 A;  2BG9 B;  2W81 C;  2CE7 A;  4JI1 T;  2XQY A;  2ODV A;  4Z8X A;  2K0L A;  2CMR A;  3DJB A;  5TAO A;  3ONX A;  4RLC A;  3TLU A;  4P0B A;  3MK7 C;  3CPZ A;  4WBO A;  3CQG B;  3OTO T;  2NW7 A;  3AEF A;  2NTX A;  4GYR A;  1MPF A;  2XAH B;  3HL6 A;  5HWX A;  3KFW X;  3AE4 A;  1MMN A;  1DU2 A;  4X1I E;  2XM1 A;  4CN4 A;  2NWB A;  1Q9G A;  3LK3 A;  4AKH A;  3L39 A;  2YEV C;  1J5W A;  2UXX B;  4N74 A;  2JRK A;  3K19 A;  3POU A;  2DI4 A;  3LBX A;  1SHZ C;  3AE6 A;  4L5G A;  2NP9 A;  2I59 A;  2MTQ A;  4AKR B;  4DBQ A;  1VCT A;  2KND A;  2YN6 A;  3I0O A;  3A0H O;  4BJM A;  2BS3 A;  3UQ7 A;  3ONL C;  2E9X D;  2VAS A;  2V7I A;  4FSP A;  2DHR A;  2E8I A;  2Y0K A;  3ZT6 A;  4UF0 A;  3N9M A;  4QH5 A;  2CHN A;  4AFK A;  4IRE A;  3BQI A;  1E54 A;  3FZK B;  4LSF A;  4LMJ A;  2CXL A;  2LM9 A;  4PK5 A;  1OSM A;  2W63 A;  4YJ3 E;  4U74 A;  3X1D A;  4C69 X;  2MOZ A;  3RYF E;  3CQX C;  4YT0 A;  2UUB T;  4O4H E;  4D65 A;  2I6H A;  2W62 A;  2HH7 A;  2CRB A;  4PJJ A;  3ZJ2 A;  3AB3 B;  3IBP A;  3HKB E;  1ZHC A;  1HXX A;  3VE1 A;  4HWI B;  3RIU C;  1NAF A;  4U31 A;  2X0L B;  4OYJ A;  4PJL A;  5HWY A;  1FJG T;  3ZYK A;  1GFN A;  5HXE A;  3A7M A;  3AE3 A;  3LJC A;  4NPP A;  3O0E A;  1HG5 A;  5HEH A;  4ILU A;  2LOP A;  4HFH A;  2N2M A;  4Z3T A;  1SUM B;  3AA0 A;  2C0S A;  3OBV E;  2VKO A;  4NIQ A;  2PRN A;  3UPG A;  2WU2 A;  2DLR A;  4IHJ E;  2KZ7 B;  4N59 A;  2FJB A;  3KVA A;  4NUV A;  2HN2 A;  5LHI B;  3HOL A;  3VE2 A;  2XSB A;  3JTY A;  3T0S A;  3VY9 X;  2IC9 A;  1S5L O;  2R89 A;  3JAF A;  3ANW A;  4O2B E;  5H2F O;  2Q9Q A;  1OXZ A;  3BS0 A;  5DQW A;  2WWV A;  2KMF A;  2J4U P;  1HNZ T;  2V6X A;  4HFV A;  4AYE C;  4JV5 T;  4I4T E;  5HEO A;  3EAM A;  4IDO A;  4I43 B;  5FVL A;  1D1B A;  2CHO A;  3HOE A;  2KDY A;  2C5K T;  4YLH A;  5LMU T;  4YHH T;  4AQY T;  4Z90 A;  1NEK A;  3ETV A;  2YIN A;  5JVD E;  4DID B;  2LT3 A;  4B3T T;  3SWH A;  1IJ5 A;  3RQW A;  3ZST A;  4N75 A;  3CX6 B;  2K48 A;  3H3M A;  3SZD A;  4HFB A;  2WCA A;  3N2K E;  3F2E A;  2BG9 C;  2UXD T;  5CB4 E;  1UCU A;  2XAJ B;  3N5L A;  1IZN B;  2EHO B;  4YY3 T;  5AQK B;  4DV6 T;  2F4V T;  5FP3 A;  4K3B A;  2KIN B;  3PUQ A;  3CML A;  4E1S A;  5AQF B;  4GCP A;  2JQ9 A;  2X68 A;  2MPK A;  4KI0 F;  1KNZ A;  4AQF A;  3NJT A;  4IL6 O;  2WDQ A;  3RF1 A;  4ZEY A;  1HS7 A;  4X64 T;  3UQ4 A;  3BQL A;  4TX5 A;  1FIO A;  2J1D G;  3CX8 B;  3AA1 B;  4ZXL A;  3V8U A;  5ABH A;  4EGW A;  3B5M A;  4C4V B;  4IL9 A;  1FEW A;  4CTD A;  5LGT B;  2Y7S A;  5FVK A;  3EDU A;  4DUZ T;  2PFV A;  5HEJ A;  3UTK A;  2BBJ A;  2IW5 B;  2HPJ A;  4DV1 T;  2X67 A;  4FSO A;  4KRA A;  4FZN A;  1FMV A;  2K9A A;  3AVR A;  3CIR A;  4ADZ A;  4ZHQ E;  4F6R C;  5CA1 E;  4IE0 A;  5LG4 A;  2D5U A;  4U7Y A;  3S4U A;  1HR0 T;  1XNR T;  4CQI A;  4FMS A;  4HE8 A;  3C64 A;  4B6X A;  2UU9 T;  2AXT O;  2YKS A;  3C4X A;  4GIW A;  4YSY A;  2J47 A;  3AAI A;  2WJR A;  3NWI A;  3QRA A;  5KDM C;  3JC6 D;  5L3D B;  5JTG A;  5HXC A;  3PGR A;  3ZCI A;  3P4S A;  5LBQ B;  3CVR A;  2XHE B;  2WZH A;  4U72 A;  5JDF A;  1E2A A;  2IWW A;  1G90 A;  2V8S V;  1WYC A;  4DR7 T;  2WU5 A;  2V1D B;  3AEE A;  3L8R A;  4AZL A;  3O1J A;  1YKE B;  3LK2 A;  3KZI O;  2AXD S;  4K0K T;  2C5J A;  3T1Y T;  1ORM A;  1HF8 A;  3TKL B;  2KZ7 A;  2XSA A;  4COF A;  2E2A A;  3C5O A;  5C3J A;  2QTK A;  4H9N C;  4LF8 T;  2W00 A;  4HWD A;  5E79 O;  5JR9 B;  2H7O A;  1YW0 A;  4DR1 T;  1D1A A;  4BJN A;  4ZI2 D;  2BKP A;  4AQG A;  2H88 A;  2L9Q A;  4DV4 T;  1WYB A;  2BBH A;  2XE5 A;  4PK4 A;  1NEN A;  3RI5 A;  5G3A A;  5EK2 A;  1JNR A;  5LOV E;  3HW9 A;  2F1T A;  3RC3 A;  4X1Y E;  2VB6 A;  1Z0P A;  4IDZ A;  2K3W A;  4IE4 A;  5F8P A;  3ZCJ A;  5AFU L;  2HHH T;  1KEY A;  3SFD A;  3O9X A;  4CN1 A;  3NBX X;  4YTP A;  2X9Y A;  3UU6 A;  4X66 T;  4YSZ A;  2YPV A;  4XAX B;  4DR2 T;  4U33 A;  3LK3 B;  1T72 A;  2LFU A;  2POR A;  2R4O A;  2EHO A;  2WDV A;  3ZSS A;  2UXC T;  2WBL A;  1MM4 A;  3MKD A;  2V7J A;  2XZE A;  4NUU A;  2O4V A;  2GE4 A;  2K4T A;  5GV0 A;  1QSD A;  3LBX B;  3UUX B;  3T8O A;  5ADX K;  3OPC A;  4K3C A;  3ZMT B;  4DR5 T;  4UV8 B;  4I0U A;  4ZOL E;  1I94 T;  5LG3 A;  2K24 A;  2L8K A;  3PUG A;  2CWO A;  3CQC B;  1HCI A;  2ZMA A;  3K8P C;  5HXH A;  1UGO A;  3F31 A;  4UF0 B;  4KR8 A;  1W0A A;  4UIG A;  1HNX T;  4HWH A;  4GF4 A;  3CKD A;  3RX6 A;  2NR4 A;  4GYS A;  1XNQ T;  2R8A A;  5L47 A;  3JCF A;  2Y0L A;  2M6B A;  4JI3 T;  3JAE A;  5J1G A;  4U7I A;  4ILC A;  4G76 A;  4P1N A;  2YNK A;  5BR8 T;  2LKG A;  2V7K A;  4JLE A;  4K0U A;  1HFA A;  3I9W A;  3ZMZ B;  3GA8 A;  4BA9 A;  1N33 T;  2VL0 A;  1UUR A;  2XUE A;  4EAH A;  3AE9 A;  3IHR A;  5KAF O;  5IUX A;  1BH3 A;  2Q9Q D;  3RYH E;  2V7L A;  4A5X A;  3AAA A;  5H6Q B;  3VRB A;  4YJ2 E;  3AEG A;  2PG8 A;  3Q5W A;  5LMN T;  4CN6 A;  2MAW A;  3RYI E;  4AYI D;  4FOZ A;  2WY2 A;  5ADX L;  2C5I T;  4JI8 T;  2YU2 A;  4QQ1 A;  2CBJ A;  2LHR A;  2XTR A;  2IUB A;  1PHO A;  5AQQ B;  4UVB B;  3ZJ1 A;  4CI1 B;  5FKY A;  4DND A;  3FYX A;  4JUY A;  2XAQ B;  4DMV A;  3FHN A;  1YQ4 A;  5L4E A;  3FZM B;  4QX7 B;  5FMN A;  3Q2M A;  4IE7 A;  2Q9Q B;  5DL6 A;  5G39 A;  4O4L E;  3R84 B;  3KVB A;  4LMK A;  1G8X A;  2WM9 A;  1MNE A;  3G06 A;  5HYA A;  3ZMU B;  2JQK A;  3P4R A;  2Z6E A;  5JR9 C;  4PNI A;  5B5E O;  5FY1 A;  1VRB A;  5DL8 A;  3TLV A;  4DR4 T;  3BQK A;  2W61 A;  5ABF B;  3JC6 C;  3RYC E;  3KV9 A;  3FXE B;  2IML A;  1ZHW A;  5LJN A;  1XZY A;  2CWY A;  3MXZ A;  3ZYL A;  5HCM A;  4ZS2 A;  2WJQ A;  5JQG E;  4UXN B;  1BT9 A;  3U78 A;  2WDR A;  2VQE T;  4NXM T;  2BVM A;  5KXJ A;  4UR9 A;  3MJX A;  2GK9 A;  5J2U E;  2X9W A;  4LSH A;  2CEA A;  3ZN0 B;  3PUX F;  3LK4 2;  4XBF B;  3SFE A;  4H9S E;  1BR2 A;  4ILB A;  2XAF B;  3TLW A;  3ONJ A;  4ANJ A;  3KIN B;  2X0H A;  4ZI2 C;  2JIW A;  2VK9 A;  4Q25 A;  5G38 A;  3PV0 F;  4BUM X;  4WW0 A;  4UB8 O;  2UUC T;  4EED A;  2LSI A;  3Q5D A;  2XQ8 A;  3BRY A;  4GCS A;  1BXW A;  2XQ9 A;  3PDY A;  1D1C A;  4GK5 E;  4TWF A;  3FB2 A;  2W66 A;  3DWO X;  2ACX A;  5HXS A;  4O8S A;  2NW8 A;  3Q5X A;  4U2Y A;  3V5U A;  5IYZ E;  5JH7 E;  4GK0 E;  3E0Z A;  1M62 A;  4CXX A;  1D0Y A;  5HCJ A;  1OWA A;  2X66 A;  2CA5 A;  3H3A A;  3ZYM A;  1MIW A;  1T16 A;  4CXW A;  2N2N A;  1IBK T;  4DO0 A;  4P09 A;  1V9D A;  2IDO B;  2XQ5 A;  1H6S 1;  4HWF A;  3I9Y A;  1JNZ A;  1WCR A;  2E5L T;  4GCQ A;  4O3Y A;  2LRL A;  4GOU A;  2IC6 A;  4YFS A;  2KC0 A;  2ZFG A;  3P4Q A;  5G26 A;  4HN9 A;  4TNW A;  1ZHZ A;  2Y2X A;  5DQV A;  3NKZ A;  5D5D A;  2WVP A;  3K1S A;  4WZX A;  2JMK A;  4H9R C;  2RA1 A;  3CX7 B;  5LNK A;  3Q9D A;  3LK2 B;  4WBN E;  4O4X A;  1W9R A;  4X20 E;  3SRZ A;  3KVD D;  2BKN A;  3WI5 A;  4O49 A;  1E1H B;  3PUV F;  3RHW A;  3ZKR A;  2J62 A;  3EDV A;  3SZV A;  4LF9 T;  2H3R A;  3DTO A;  3AEA A;  5JRE A;  3VR8 A;  1J5E T;  2LKH A;  3DA4 A;  4OFZ A;  1GFO A;  3K3O A;  5GON E;  5T5F A;  2NW9 A;  5ETW A;  2EHO D;  2CPT A;  4CZZ B;  4KX6 A;  5LP6 E;  2UXB T;  2MHL A;  3N9Q A;  4ZS3 A;  5CA0 E;  4KHZ F;  2PJQ A;  5ABF A;  3GWH A;  1Z8U A;  1J1J A;  2E5V A;  2Q9Q C;  1XDO A;  3MA9 A;  3OJA A;  4CI2 B;  3PE0 A;  4TZ4 C;  2JMM A;  3VKH A;  2A9U A;  2XAS B;  3QB5 K;  5HEG A;  5FL1 A;  5DL7 A;  4IDN A;  1YD8 G;  3WU2 O;  5J2T E;  2W2U A;  2D2S A;  5C2T A;  2Y8D A;  3BK9 A;  3RIF A;  2KXP B;  1I6Z A;  4FT6 A;  3VU7 H;  2VUR A;  4F4B A;  5FNV E;  3M65 A;  2R4P A;  5CFB A;  4IIJ E;  3SOL A;  5HAX A;  3UU3 A;  5LYJ E;  2FGQ X;  1R8I A;  3ZEF B;  2IWV A;  1XMO T;  2WMN A;  3QUJ A;  4OK0 A;  4KHP T;  4EV6 A;  1O3X A;  2DL1 A;  3P4P A;  4J2C A;  3TZG A;  4XNK A;  4EEB A;  1T98 A;  4TV9 E;  3RRC A;  2OMF A;  2X27 X;  1ZHY A;  5H6R B;  2LSY A;  5AQR B;  4JI4 T;  4AQF C;  2BS2 A;  1MMA A;  1QLB A;  1IBM T;  3DWN A;  3UT5 E;  3JCU O;  1ZP0 A;  3UUN A;  4QWN B;  5AQU B;  3HKE E;  2MYS A;  4HFD A;  1GFP A;  2FJA A;  1HXU A;  2LM2 A;  2JPF A;  4LF6 T;  4IT4 A;  2J4G A;  3VZT X;  2PBI A;  2XQ7 A;  1X79 A;  2XTL A;  1CUN A;  2JJ9 A;  3DP7 A;  3AAA B;  1QJP A;  4PJM A;  4AIU A;  1IJ6 A;  4N78 D;  4RL9 A;  4DUY T;  4HEA A;  1M7K A;  1PRN A;  3I1A A;  4IE6 A;  4Z91 A;  5EK4 A;  4UV9 B;  5L2L A;  1ZV4 X;  2B1E A;  5DAB A;  1XMQ T;  2RP4 A;  1AJ3 A;  3RQU A;  1YKH B;  5FXZ A;  2NTY A;  3N2G E;  1KK7 A;  3AA7 B;  2KSR A;  1HTJ F;  3UU5 A;  5JDM A;  5IWA T;  3O4X E;  2J1N A;  2OV9 A;  4ZI7 E;  1B7T A;  1ZOY A;  2A2F X;  4UEL A;  1IAP A;  4O3Z A;  2L3L A;  5FYM A;  1EZ3 A;  2R88 A;  3HA4 A;  4IST A;  2VKJ A;  4PK6 A;  3RH3 A;  5L3G B;  5LHG B;  5AQM B;  2D9D A;  1NWM X;  3OYZ A;  2LHF A;  4OYK A;  2XAG B;  4QXH B;  3UFG A;  2YDQ A;  2X9K A;  1OED B;  4O4I E;  4O2A E;  3POQ A;  3QNU A;  3N2O A;  2YK0 A;  4YTM A;  4FI5 A;  2QA7 A;  4AYD C;  4UVA B;  3N9O A;  3HI2 A;  4MFR A;  2CLY B;  2KXP A;  3POR A;  3LK4 1;  4A97 A;  4JI2 T;  2LRK A;  4C00 A;  4JI0 T;  4LFC T;  4D64 A;  3TLT A;  1D0X A;  1WR0 A;  2BDE A;  4ZI3 D;  2VWA A;  2R6G F;  4LFA T;  1OED E;  3POX A;  5AQO B;  5KAI O;  2HN1 A;  5IHY A;  3ESL A;  3AVS A;  3P4W A;  3O1I A;  2EHO C;  1FMW A;  3AXJ A;  4PAG A;  3N9N A;  3PUW F;  2XY8 B;  2ACZ A;  1S94 A;  5AQI B;  2X51 A;  3AE7 A;  4LF5 T;  3NSG A;  4B3S T;  3PF1 A;  3ZN1 B;  4DV7 T;  2F1V A;  2ODJ A;  2R4L A;  1QUU A;  5A1L A;  4X62 T;  3EAB A;  1IBL T;  3T1H T;  1U4Q A;  3PQU A;  2LSJ A;  3A0B O;  4MAL A;  4TV8 E;  4HKA A;  3B57 A;  3OVU A;  3H37 A;  2OLT A;  4QX8 B;  1G73 A;  4RLB A;  3N9P A;  2N2L A;  5DJQ C;  4ILA A;  4GKK T;  3GN5 A;  4KMC A;  3ZT5 A;  5CGM A;  2FJE A;  4X65 T;  2LJL A;  2BVL A;  1UUS A;  3WI4 A;  1MMG A;  2JQY A;  5LA6 E;  4JEU B;  2V7M A;  2W4X A;  3PU8 A;  2H89 A;  5B66 O;  5LXT E;  2M07 A;  1WR6 A;  2V26 A;  3VR9 A;  3DA3 A;  4DBR A;  2K5B B;  4GKJ T;  1Y01 A;  4O3W A;  3B13 A;  1N34 T;  4B61 A;  4F8H A;  3U3I A;  2G0U A;  2V5C A;  4QXC B;  3VY8 X;  4DV2 T;  5JRC B;  4DMW A;  3J9X 1;  3SY9 A;  5DL5 A;  7PRN A;  3AA7 A;  2XQ6 A;  3HWB A;  3GMI A;  3VZW X;  1HG2 A;  4AIS A;  2D0U A;  3T24 A;  4TNV A;  5EZY E;  5JDQ A;  4KUM B;  3CK6 A;  5FXV A;  4JCH A;  2PTF A; 
#chains in the Genus database with same CATH homology
 3A2S X;  2HPJ A;  3P8C D;  2JMK A;  2X67 A;  1YS5 A;  4FSO A;  5FXW A;  4H9R C;  4KRA A;  3PRN A;  2RA1 A;  1OPF A;  4FZN A;  3CX7 B;  1FMV A;  4EYY R;  5LNK A;  4L0R A;  5L3B B;  3Q9D A;  2K9A A;  3AVR A;  3LK2 B;  1IZN A;  4WBN E;  4O4X A;  4X20 E;  4ADZ A;  3SRZ A;  2DCF A;  3RPU A;  4ZHQ E;  3KVD D;  4AYM C;  4CI3 B;  3PUS A;  4F6R C;  4PJN A;  3WI5 A;  3QC9 A;  5CA1 E;  4IE0 A;  5LG4 A;  4O49 A;  5PRN A;  1E1H B;  2D5U A;  4PUX A;  3EMN X;  3S4U A;  3EDV A;  2X9H A;  2ERV A;  3EVY A;  2YU1 A;  3SZV A;  4CQI A;  4FMS A;  3KV6 A;  3HR0 A;  2W80 C;  4HE8 A;  3RBH A;  2H3R A;  3C64 A;  1GFQ A;  4AKM A;  1LVK A;  4B6X A;  2DNX A;  3DTO A;  2KWH A;  3C4X A;  3WAK A;  4GIW A;  3ZC0 A;  3AAI A;  1QJ9 A;  4AKG A;  5JRE A;  3KV4 A;  3AA1 A;  4EXT A;  3QRA A;  5KDM C;  3JC6 D;  4MLK A;  3AA6 B;  4AUI A;  5L3D B;  2W0G A;  5HXC A;  3FBL A;  3DA4 A;  3ZCI A;  4OFZ A;  3QRC A;  1GFO A;  3K3O A;  5GON E;  5LBQ B;  5JDG A;  2P9B A;  2XHE B;  3CVR A;  4U72 A;  3GP6 A;  5FVN A;  3RRW A;  2LE8 A;  5JDF A;  2NW9 A;  5T5F A;  5ETW A;  2EHO D;  4O3X B;  2H7V C;  3VKG A;  3C98 B;  1G90 A;  4CZZ B;  2CM0 A;  1WYC A;  2N1G A;  5FY1 A;  5LP6 E;  3KBT A;  2V1D B;  3PU3 A;  1MIY A;  3C50 A;  3OKQ A;  2MHL A;  4AZL A;  5L3C B;  5LGU B;  4FZM A;  3O1J A;  3N9Q A;  4ZS3 A;  1YKE B;  3ZPO A;  3LK2 A;  5CA0 E;  3UUL A;  4HGA A;  2C5J A;  2PJQ A;  3GWH A;  3C4Z A;  3HKD E;  1ORM A;  3LG7 A;  1HF8 A;  3TKL B;  2KZ7 A;  3AAE A;  2Y0H A;  4X1K E;  4EOZ B;  2Q9Q C;  3MA9 A;  3OJA A;  4CI2 B;  3EUH A;  4H9N C;  2W00 A;  4BAY B;  3N9L A;  4A56 A;  5JR9 B;  3J7Y q;  1LRZ A;  4D5U A;  3PE0 A;  2H7O A;  4L9I A;  4TZ4 C;  1YW0 A;  1D1A A;  2CLY C;  4MBQ A;  4BJN A;  4ZI2 D;  2JMM A;  4AQG A;  3VKH A;  4FZL A;  5JDP A;  1MND A;  1ZEE A;  2HPL A;  2XAS B;  1Q9F A;  2L9Q A;  3ZMV B;  3AA6 A;  5DL7 A;  1MMD A;  1WYB A;  4HTE A;  1YD8 G;  1LKX A;  5J2T E;  4P0A A;  2D2S A;  3V5S A;  2XE5 A;  2Y8D A;  4KR4 A;  4H63 H;  4UVC B;  3CWZ B;  4PK4 A;  4PFP A;  3BK9 A;  5JDH A;  2KXP B;  3NRY A;  5EK2 A;  4FT6 A;  3VU7 H;  5KX5 E;  4F4B A;  5LOV E;  3HW9 A;  3F57 A;  4WNK A;  5FNV E;  2F1T A;  4E1T A;  3RC3 A;  3M65 A;  3C4W A;  4X1Y E;  2VKH A;  2VB6 A;  1Z0P A;  4IIJ E;  4IDZ A;  5HAX A;  3SOL A;  3K3Q C;  2WAU A;  2N9D A;  4H63 V;  1S35 A;  3G7G A;  5L3F B;  4IE4 A;  5F8P A;  5LYJ E;  4N58 A;  3ETU A;  4RJW A;  3AA0 B;  2FGQ X;  5FY0 A;  3ZCJ A;  5E0O A;  5AFU L;  5LBM A;  3W15 B;  3ZEF B;  4E7Z A;  3L09 A;  4KP3 C;  1U5P A;  2WMN A;  3QUJ A;  4OK0 A;  3E22 E;  2Y48 B;  3O9X A;  1ZKE A;  2A72 A;  5JR9 A;  4UEM A;  1O3X A;  3NBX X;  4CXY A;  4FRT A;  2WWU A;  2D0T A;  2JMH A;  2X9Y A;  4J2C A;  3TZG A;  4XNK A;  1T98 A;  4TV9 E;  2LOS A;  3RRC A;  3SS1 A;  5JDN A;  2OMF A;  5LJM A;  2X27 X;  1BR0 A;  2YPV A;  3A5X A;  3ANW B;  5H6R B;  2E9X B;  1ZHY A;  2LSY A;  3KDS E;  4XAX B;  4AQF C;  1MMA A;  4H9O C;  3D0T A;  3LK3 B;  4C91 A;  4I50 E;  2LFU A;  4ZI3 C;  2POR A;  3QK6 A;  2EHO A;  2ZLD A;  3UT5 E;  3P7I A;  2CXD A;  3PQS A;  2WBL A;  3NZQ A;  1MM4 A;  3MKD A;  2A3D A;  2JQQ A;  2V7J A;  4NUU A;  4QWN B;  3UUN A;  4EZH A;  2WMO A;  2O4V A;  4AKI A;  2GE4 A;  2K4T A;  3HKE E;  5GV0 A;  2MBG A;  4I55 E;  3SY7 A;  4KBM B;  2FGR A;  2W81 C;  1QSD A;  2CE7 A;  1LVF A;  2MYS A;  1GFP A;  3LBX B;  2XQY A;  2ODV A;  4Z8X A;  1HXU A;  4FES A;  2JPF A;  3UUX B;  1D0Z A;  2K0L A;  5JRC A;  3VZU X;  2CMR A;  3DJB A;  5TAO A;  3T8O A;  5ADX K;  3ONX A;  1WRD A;  4RLC A;  4PFO A;  2OA5 A;  3O1H A;  5BMV E;  3C51 A;  3VZT X;  2PBI A;  4P0B A;  3NRX A;  3ZMT B;  1X79 A;  3NZP A;  3MK7 C;  1P4T A;  4XNL A;  3CPZ A;  4UV8 B;  4WBO A;  2XTL A;  4ZOL E;  3CQG B;  1CUN A;  2K24 A;  2L8K A;  2NW7 A;  2JJ9 A;  3DP7 A;  3PUG A;  2CWO A;  3R6N A;  2NTX A;  3CQC B;  1HCI A;  3AAA B;  4XZC A;  2ZMA A;  4GYR A;  1MPF A;  1QJP A;  3K8P C;  5HXH A;  4PJM A;  4JFB A;  3F31 A;  2XAH B;  4UF0 B;  3HL6 A;  5HWX A;  3KFW X;  1MMN A;  1IJ6 A;  1H7C A;  4N78 D;  4X1I E;  4AXP A;  5JDL A;  4KR8 A;  4RL9 A;  4UIG A;  1THQ A;  4EYU A;  4GF4 A;  4HEA A;  1PRN A;  3CKD A;  3I1A A;  3RX6 A;  4GYS A;  2NWB A;  1Q9G A;  3LK3 A;  4IE6 A;  3I0Q A;  2XG6 A;  2BZB A;  4AKH A;  5EK4 A;  4UV9 B;  3L3P A;  1ZV4 X;  5L2L A;  2Y0L A;  4FUV A;  2YEV C;  2B1E A;  5DAB A;  4G63 A;  2UXX B;  2JRK A;  5J1G A;  5L3E B;  2RP4 A;  3K19 A;  3POU A;  2DI4 A;  4G76 A;  3LBX A;  1SHZ C;  1UX5 A;  3PUR A;  2NP9 A;  2I59 A;  2CXF A;  4L5G A;  2YNK A;  1AJ3 A;  2V7K A;  2MTQ A;  2KLQ A;  4JLE A;  4AKR B;  1YKH B;  5FXZ A;  4DBQ A;  2NTY A;  2ZLY A;  4K0U A;  1HFA A;  2KND A;  4OHF A;  3N2G E;  3I9W A;  3ZMZ B;  3GA8 A;  1KK7 A;  3AA7 B;  4QHO A;  4BA9 A;  3I0O A;  4BJM A;  2XUE A;  1HTJ F;  5EK3 A;  5JDM A;  4EAH A;  3O4X E;  3IHR A;  2E9X D;  3IEE A;  2VAS A;  2V7I A;  4FSP A;  4AYN A;  1BR4 A;  1BH3 A;  2DHR A;  2Q9Q D;  2E8I A;  2V7L A;  3RYH E;  2J1N A;  2Y0K A;  2XE2 A;  5H6Q B;  3AAA A;  4YJ2 E;  1BR1 A;  3C5O A;  4ZI7 E;  2Y6X A;  4G2A A;  3VHL A;  4QKN A;  4UF0 A;  3N9M A;  4ERR A;  2XE3 A;  2PG8 A;  5HXR A;  1B7T A;  3Q5W A;  2A2F X;  2ZM0 A;  4UEL A;  3RYI E;  4AFK A;  4AYI D;  1IAP A;  2ZM2 A;  5ADX L;  4FOZ A;  2L3L A;  4O3Z A;  5FYM A;  1EZ3 A;  3BQI A;  1E54 A;  2C5I T;  3LFM A;  3HA4 A;  4IST A;  2VKJ A;  4LSF A;  4PK6 A;  3RH3 A;  2YU2 A;  2CXL A;  4QQ1 A;  2LM9 A;  2ZM8 A;  4PK5 A;  5L3G B;  5LHG B;  1OSM A;  2LHR A;  4EZ4 A;  2WSS V;  2XTR A;  3HKC E;  4FJO A;  2W63 A;  4YJ3 E;  4U74 A;  1PHO A;  1NWM X;  2DWG A;  3OYZ A;  4UVB B;  2LHF A;  4OYK A;  4C69 X;  2MOZ A;  3KBU A;  3ZJ1 A;  4CI1 B;  2XAG B;  4QXH B;  4AKL A;  3RYF E;  3SYS A;  6PRN A;  3CQX C;  4DND A;  3FYX A;  4JEH B;  4JUY A;  4O4H E;  4D65 A;  4AKR A;  2XAQ B;  5DL8 A;  2W62 A;  4O4I E;  2HH7 A;  4TN7 B;  4DMV A;  4O2A E;  3POQ A;  3N2O A;  3FHN A;  4PJJ A;  2YK0 A;  3ZJ2 A;  3AB3 B;  3IBP A;  4GHB A;  3HKB E;  4QX7 B;  1ZHC A;  5FMN A;  4FI5 A;  1HXX A;  3Q2M A;  4IE7 A;  3K3N A;  2QA7 A;  3PTR B;  2Q9Q B;  5FY7 A;  4UVA B;  3N9O A;  3HI2 A;  3VE1 A;  4AYD C;  1NAF A;  4MFR A;  2X0L B;  4E7S A;  1HX8 A;  3ZLI A;  3PUA A;  4OYJ A;  4PJL A;  5HWY A;  5DL6 A;  3WAJ A;  2VKD A;  3ZYK A;  2CLY B;  4O4L E;  3R84 B;  3UAQ A;  4IGU A;  1GFN A;  5HXE A;  3KVB A;  1G8X A;  2WM9 A;  3LJC A;  5LCY A;  3OYX A;  4AI6 A;  2KXP A;  3O0E A;  1HG5 A;  1MNE A;  3FXD B;  3POR A;  3LK4 1;  4V1A v;  3ZMS B;  3MAC A;  5HYA A;  3ZMU B;  4ILU A;  2LOP A;  2Z6E A;  5JR9 C;  2N2M A;  8PRN A;  4PNI A;  4D64 A;  4Z3T A;  5KMG P;  1D0X A;  5IYU A;  2BDE A;  1VRB A;  2ODU A;  2VL8 A;  4TUY E;  4M1P A;  3BQK A;  2C0S A;  3IF8 B;  3OBV E;  4ISS A;  2VKO A;  2VWA A;  2W61 A;  2PRN A;  3UUM A;  1US7 B;  3JC6 C;  2XTQ A;  3UPG A;  3RYC E;  3KV9 A;  3FXE B;  3AA0 A;  2DLR A;  4U9C A;  2SPC A;  3GN5 B;  4IHJ E;  1ZHW A;  2KZ7 B;  4EB6 E;  3POX A;  1SA0 E;  3AAE B;  2CWY A;  5LJN A;  4N59 A;  3MXZ A;  3KVA A;  5IHY A;  3ZYL A;  4H9Q C;  4NUV A;  4ZS2 A;  3ESL A;  3AVS A;  3O1I A;  2EHO C;  5LHI B;  3HOL A;  1FMW A;  4IE5 A;  3T20 A;  3VE2 A;  3JTY A;  5JQG E;  2LSK A;  4UXN B;  1BT9 A;  3T0S A;  3U78 A;  3VY9 X;  2IC9 A;  2BVM A;  2M06 A;  3ANW A;  3UU2 A;  2E9X A;  2KT9 A;  4PAG A;  3N9N A;  4DVD A;  4MHC A;  4O2B E;  5FXX A;  1S94 A;  2GK9 A;  2X51 A;  3MJX A;  5J2U E;  3NSG A;  2Q9Q A;  2X9W A;  1OXZ A;  5LGN B;  5DQW A;  4LSH A;  2CEA A;  5AFU K;  3ZN0 B;  3ZN1 B;  3LK4 2;  2UXN B;  2XE1 A;  2F1V A;  4XBF B;  2ODJ A;  2KMF A;  2J4U P;  2M67 A;  5EE2 A;  1QUU A;  4H9S E;  1BR2 A;  4ASK A;  4HFV A;  5A1L A;  2NOX A;  2XAF B;  4AYE C;  4I4T E;  4O4J E;  1U4Q A;  4YHJ A;  4I43 B;  3PQU A;  1ZHT A;  4PW8 A;  4ANJ A;  3KIN B;  2LSJ A;  1D1B A;  2KWI B;  4ZI2 C;  4MAL A;  4TV8 E;  5LHH B;  2VK9 A;  4HKA A;  3HOE A;  2KDY A;  3B57 A;  1WLX A;  2C5K T;  3H37 A;  3RC8 A;  4BUM X;  4QX8 B;  2X9X A;  4YLH A;  1G73 A;  4RLB A;  3N9P A;  4WW0 A;  2N2L A;  5DJQ C;  4H9P C;  3GN5 A;  4KMC A;  2E9X C;  3ETV A;  4LSE A;  4G75 A;  3KV5 A;  2YIN A;  5JVD E;  2LSI A;  2LT3 A;  2LJL A;  3SWH A;  1IJ5 A;  2BVL A;  4LSI A;  2XMX A;  4GCS A;  3WI4 A;  1MMG A;  1BXW A;  3PDY A;  3CX6 B;  2K48 A;  5LA6 E;  4JEU B;  1D1C A;  2V7M A;  3PU8 A;  4GK5 E;  3SZD A;  5LXT E;  2M07 A;  4O4U A;  3N2K E;  3FB2 A;  3F2E A;  1ZHX A;  1WR6 A;  3MZK B;  1HXT A;  2V26 A;  5CB4 E;  2ACX A;  2MNH A;  1UCU A;  5HXS A;  2XAJ B;  2NW8 A;  3Q5X A;  4O8S A;  2LEH A;  4FRX A;  3N5L A;  1IZN B;  5IYZ E;  3V5U A;  1QJ8 A;  5JH7 E;  2EHO B;  4GK0 E;  3E0Z A;  4CXX A;  3DA3 A;  4DBR A;  4ZI3 D;  4EIW A;  1D0Y A;  1GFM A;  1MIV A;  2K5B B;  1OWA A;  3ZC1 A;  5FP3 A;  2X66 A;  2KIN B;  2CA5 A;  3WI3 A;  3PUQ A;  3B13 A;  3H3A A;  3ZYM A;  4O3W A;  1MIW A;  4B61 A;  1Y64 B;  3CML A;  2QTK A;  4CXW A;  4E1S A;  2N2N A;  4GCP A;  2X68 A;  3U3I A;  1KNZ A;  2G0U A;  4AQF A;  2ES0 A;  2CCQ A;  4QXC B;  4DO0 A;  3E08 A;  3VY8 X;  1HS7 A;  5JRC B;  3BQL A;  4TX5 A;  4DMW A;  4P09 A;  3J9X 1;  2DWK A;  1V9D A;  3SY9 A;  5DL5 A;  3FBZ A;  1MM5 A;  7PRN A;  1FIO A;  3AA7 A;  1H6S 1;  2J1D G;  3CX8 B;  3AA1 B;  3I9Y A;  4QXB B;  4RJX A;  3V8U A;  2LSG A;  2IAK A;  3HWB A;  1VOM A;  5M4Y A;  4GCQ A;  4O3Y A;  1FEW A;  3GMI A;  4GOU A;  2IC6 A;  3UFE A;  4C90 A;  1HG2 A;  2QGS A;  3VZW X;  3RKO A;  2D0U A;  4YFS A;  3SYB A;  2LHN A;  5C8Y E;  3T24 A;  5LGT B;  2KC0 A;  2Y7S A;  2ZFG A;  5G26 A;  5EZY E;  4HN9 A;  5JDQ A;  4KUM B;  3EDU A;  1ZHZ A;  2Y2X A;  5DQV A;  5FXV A;  2PFV A;  4JCH A;  1UX4 A;  3UTK A;  5F3J A;  5D5D A;  2IW5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...