3AAEB

Crystal structure of actin capping protein in complex with carmil fragment
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
264
structure length
264
Chain Sequence
DQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-1
publication title Two distinct mechanisms for the regulation of actin capping protein-competitive or allosteric inhibitions
rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 80
structure length 264
sequence length 264
chains with identical sequence D, F, H, J
ec nomenclature
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aaeB01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aaeB02
3AA1A 3LK42 2KZ7A 5ADXL 2KXPA 3AA6A 3AAAA 5ADXK 3LK3A 4AKRB 3AA7B 3LK2B 5AFUL 5AFUK 3AA0B 4AKRA 3AA7A 3LK2A 3AAEB 1IZNB 3AA0A 3AA1B 2KZ7B 3AAAB 3AAEA 1IZNA 2KXPB 3AA6B 3LK3B 3LK41
chains in the Genus database with same CATH superfamily
4ZI7E 4DR1T 4C4VA 3BQIA 3UULA 4DR5T 5L3EB 3VKGA 1ORMA 3OYZA 1IJ6A 3HL6A 1D1AA 2N2LA 4HWFA 1HNXT 4AKRA 4IDZA 1R8IA 1W9RA 2WMOA 2W80C 2XQYA 2OA5A 2K9AA 4YXDA 4C69X 3F2EA 4YT0A 4ZI2C 1XZYA 5LXTE 1WYBA 3U78A 3UT5E 4DV1T 4YTNA 5HYAA 4HFEA 4C91A 1HNWT 4YTPA 1QJ8A 4YY3T 5AQTB 4DV5T 4DV2T 2YN6A 4GK5E 4HFVA 5C8YE 2KZ7B 5KX5E 3I0QA 3IF8B 3FB2A 4UR9A 5CB4E 4HFDA 4HFHA 4CXYA 3EMNX 1YS5A 3RBHA 3FXDB 3A0BO 4GOUA 3TKLB 2KLQA 4ILBA 2HPLA 2XTRA 3CIRA 2ZMAA 3H37A 3ONXA 2W2UA 5JDHA 2Y2XA 2K4TA 5H6RB 1IBMT 3PUYF 2LSIA 1HNZT 1UX5A 2D9DA 4FT6A 3UAQA 2KWIB 5HWXA 5PRNA 3NRXA 1HFAA 2W66A 4ASKA 2PORA 2MBGA 3I9YA 4F4BA 4DV3T 2WAUA 4PK5A 3PUQA 4LMJA 3B5MA 2IHR1 5ABGA 3UU5A 2MNHA 4H63V 1OWAA 3ZKRA 2V1DB 5HXRA 1US7B 3GN5B 4X1IE 3QB5A 4JCHA 2WCAA 1LVKA 4A98A 3ZJ2A 5HCMA 5H6QB 4FUVA 4ZS3A 2BZBA 1YD8G 4NUUA 3ZT7A 3T20A 3A7MA 2L3LA 2WS3A 2Y8DA 4COFA 3WI5A 1U4QA 3ESLA 3ZT6A 2NTYA 3FHNA 1X79A 5FKYA 3IA3A 2VASA 2NOXA 2WU2A 4B3TT 2YINA 5CJ5A 3A2SX 3E0ZA 3T1HT 3C51A 4PK6A 2E5LT 4FOZA 2QRXA 1OSMA 2J62A 2ZM8A 2WDVA 2V7JA 4GCSA 4AQYT 1UURA 2YEVC 4QXBB 3SYSA 1KNPA 3T8OA 2R6GF 3PUVF 3RIAA 3RRWA 4DR6T 4ZI2D 4KBMB 3QUJA 3HKBE 4GCPA 3LK2B 4WZXA 1ZHZA 1ZP0A 5DQWA 3J9X1 2LT3A 2LE8A 1M62A 4H9NC 4NIQA 2EHOC 3ZPOA 3NRYA 5HXEA 2EHOA 3PF1A 2VKDA 4N59A 1T98A 5BR8T 1NAFA 3RF1A 2KC0A 4YJ2E 3SY9A 2NWBA 2V6YB 3KDSE 4RL9A 3ZMUB 2BG9C 4BA9A 5LJNA 2IW5B 2LSKA 2BG9A 3BRZA 2JPFA 4ZOLE 2NR4A 3CPZA 2XE3A 5AFUL 4OYKA 5LMNT 3SOLA 4EEBA 2PG8A 1OPFA 3BQKA 3AVRA 1GFNA 4TV9E 5JDMA 3KZIO 5JQGE 3O0EA 2YNKA 2RA1A 3LBXB 4IL9A 3E22E 3EDVA 3N2GE 2X9HA 4C00A 5DJQC 3T0SA 3EAMA 4DMWA 2WP9A 3IEEA 2G0UA 3SFEA 3WAKA 2V7LA 2UXNB 2IUBA 3AAEA 4U7IA 2CA5A 4HWHA 4NXNT 2HN1A 5L3CB 3VY9X 2VVSA 3U3IA 1XMQT 4O4IE 4YSZA 2R4NA 3TLTA 3JC6D 4JI2T 4Z8XA 4LF6T 5LJMA 4GYSA 1N34T 2VK9A 3M3ZB 3CQCB 2CHNA 4O3XB 4PJLA 2R4OA 5AQIB 2WDQA 2OMFA 3RPUA 4ZI3C 4FZNA 4A5XA 3KV5A 5LA6E 2F1VA 1IJ5A 3NBXX 4CXWA 1I6ZA 4EGWA 3POUA 1H6S1 4QKNA 1ZV4X 4QX8B 4HN9A 4CN1A 2CCQA 3DJBA 4EXTA 3AB3B 3OTOT 4TWHA 4AQGA 1D0XA 2VB6A 3RI5A 5B5EO 3I0OA 2WWUA 1OEDB 3LK3A 5F8PA 5AQOB 2V6XA 5AQKB 5J2TE 2CLYC 2WDRA 3UPGA 3R6NA 5E0OA 3PGUA 4H9RC 3VRAA 4P0BA 5AQGB 2L8KA 4CZZB 2JRKA 3PUXF 4IDNA 3H3AA 2XTLA 2WZIA 3P4SA 4EYYR 4NXMT 5TISO 1HG5A 3UTKA 2DHRA 4DR4T 3QNUA 5AQJB 4JI8T 2V8SV 5GV0A 1ZHXA 4KR8A 3VU7H 3RQUA 3P8CD 4C90A 1X9BA 1MMDA 3Q5DA 4OX9T 3PGRA 2QTKA 4D65A 1S35A 4GYRA 3N2OA 1YW0A 3TLUA 5LOVE 3TLWA 5LHIB 5AQVB 4Z91A 3AECA 3KV9A 1HS7A 5JR9B 3JCFA 3PRNA 5FVKA 5EE2A 1T8BA 3HKDE 4N75A 2KT9A 4JI1T 1LVFA 3RYHE 4X20E 2IC6A 1CHUA 1QJPA 4PJJA 1HR0T 2E9XB 1YKHB 2XM2A 4O4UA 1Y01A 4PJ0O 1VRBA 2XY8B 2BVMA 3OJAA 2K5BB 5AQUB 3MK7C 1HTJF 3ZLIA 2X9KA 2MOZA 3PDYA 3ZSSA 3K19A 2X0HA 2KWHA 1Z0PA 5CFBA 1HF8A 4IE7A 2DL1A 3CQXC 4FMSA 4DNDA 3I9WA 5G3AA 4X66T 4RLCA 4GCQA 1SA0E 4U3CA 2E5VA 3JADA 2WVPA 3AEGA 1S5LO 4ZI3D 3ONJA 3TLVA 2LRLA 2LOPA 3Q5WA 2UUAT 5JRCB 2W81C 3NSGA 2KXPB 3SZVA 1BXWA 4AYMC 2JIWA 3HOLA 5DL6A 4NUVA 5AQPB 1KEYA 5LGNB 3POQA 1GFPA 4OHFA 2MTQA 3JAFA 5IHYA 1VCTA 3HKEE 4UELA 2ZFGA 3GN5A 1THQA 4I43B 2ODUA 1N33T 4IL4A 4FSOA 4XZCA 1T1LA 2X0LB 4AUIA 1O3XA 5HCJA 4JLEA 3JAEA 2MPKA 3N9PA 3RQWA 2X51A 3QRCA 4LMKA 2CM0A 2KNDA 5FL0A 1J1JA 2LRKA 3A5XA 4BUMX 2F1TA 4DUZT 1UK5A 2M07A 3EHZA 3IHRA 2CHOA 4HTEA 2FJDA 2I6HA 3ZYKA 2Y7SA 3LDQB 2FUPA 1HXXA 3OPCA 3ONLC 1J5WA 2LJLA 2XSAA 2ZLDA 2IWWA 4LFAT 4IL6O 1WCRA 2WJRA 4QQ1A 3ZEFB 1W09A 4KUMB 2UXDT 5JDQA 3AA0B 1IBKT 3LK2A 3VZUX 2MAWA 4AYID 3N2KE 3PU3A 3VR9A 5HEGA 4OYJA 2CBIA 4D64A 3MXZA 3P4WA 3UU2A 3MKDA 4QH5A 4GIWA 2X0YA 4U9CA 4OK0A 3J7Yq 4QX7B 4I0UA 4ZXLA 4XBFB 3ZCIA 1XDPA 4F8HA 2C5KT 3S4UA 4AKIA 2R4LA 3LFMA 5FXWA 5FL1A 3M65A 1XNQT 5GTHO 4X1YE 4MALA 4UXNB 1ZHTA 2PFVA 3AE5A 4BJMA 4MBQA 5G26A 2D5UA 2X9XA 4YSYA 2ACZA 4YHJA 1FJGT 1N32T 2LSYA 3T1YT 5LG3A 4N74A 1M7KA 5HWYA 3NJTA 3PUWF 3DA4A 3DP7A 2J47A 1L0VA 3LBXA 5DABA 4KHPT 3AEFA 1WYCA 5FMNA 4P0AA 1JNZA 4UEMA 1B7TA 4CTDA 2XM1A 2PTFA 2H89A 3WI4A 3LSVA 3HW9A 2M67A 5KAIO 2WQYA 5ABEA 4U2YA 4LF5T 3JC6C 2V5CA 3B13A 3VRBA 4LF9T 4ZZBA 5L4EA 3VR8A 2VURA 2WWVA 4JYAT 5LNKA 1D0YA 2XQ3A 5JH7E 4AKMA 3MZKB 2K48A 2BKNA 4DR3T 3AAAB 5JVDE 2VVNA 3DWNA 2VKJA 2A2FX 1ZKEA 4IE4A 5DL7A 3HA4A 1HG2A 4L5GA 4HWIB 3PUGA 4EAHA 1T72A 2F1CX 1D1CA 4KP3C 3ZYMA 3PTRB 1VOMA 1XMOT 4X64T 2XAGB 4FQEA 3SFDA 3AEAA 2E2AA 1NWMX 4ILAA 1WRDA 1OEDC 2GK9A 4NPPA 1MMAA 5CA0E 5HXCA 4CXXA 2CBJA 5G39A 1OEDA 2LKGA 2Y48B 2H7OA 4Z90A 1ZHCA 5EZYE 3C4ZA 4XNLA 2IWVA 5L3BB 3PJAA 5L3FB 2K0LA 3OKQA 4CN4A 5FVLA 2XJ7A 5LHGB 2PBIA 4I55E 3SZDA 2XAFB 3SS1A 3PJAJ 2IC9A 4UV9B 3PUSA 3RH3A 1WR6A 2A72A 1T7SA 2XTQA 4QXHB 4E1SA 5ADXL 3MACA 1XDOA 3KVDD 2V26A 4HWCA 2H88A 4H9SE 1ZEEA 4OFZA 2W63A 2N2NA 4KMCA 3N9MA 3NWIA 3O1HA 5JR9C 3AXJA 4KRAA 4WW0A 3X1DA 2CRBA 5JR9A 4B61A 4IDQA 3VZTX 5EK3A 2ODJA 2XQ6A 1ZOYA 2E8IA 3B57A 2E9XC 4N58A 4PJMA 1XNRT 2E9XA 4GKJT 2UUCT 3OBVE 3ABVA 2Z6EA 4JI3T 2LM2A 2PRNA 3Q5XA 2WZHA 4QH4A 1OXZA 8PRNA 5LP6E 4DMVA 1AJ3A 4FJOA 4O2BE 3HWBA 5L4HA 3PORA 4H9QC 4EZ4A 1D1BA 4DBRA 4ZZCA 1G90A 4B3ST 4Z3TA 2GE4A 2X68A 2LOSA 2JQHA 3RX6A 1GFQA 5HXSA 2M6IA 2HHHT 3UUBA 2D0TA 3UU4A 1Y64B 5TAOA 2BDEA 2YDRA 2N9DA 1HXTA 5FY7A 3ZC0A 1MMGA 3K3OA 2ZM2A 4FZLA 4L9IA 5AQNB 3RGLA 1E1HB 2J1NA 2XSBA 1Q9GA 5JRCA 5ABFB 2B76A 2D0UA 3KVAA 2W67A 3N9LA 4BAYB 2KXPA 4GK0E 4QHOA 5C2TA 5AQLB 4X62T 1HXUA 3WAJA 1GFMA 4GHBA 3RYFE 3KFWX 4IREA 2XAQB 4JBWF 4EIWA 1T16A 5LYJE 2VQET 3SYBA 2X9WA 3BK9A 2ES0A 1MM4A 4O3YA 4AXPA 2J1DG 2W00A 2K24A 4DUYT 5M4YA 1E7PA 1ZHWA 4HFBA 4ZHQE 5L47A 4U72A 2WSSV 3DA3A 4EV6A 2X66A 4CI3B 4HWDA 2BS3A 2UXCT 5LGTB 2EHOB 5J1GA 1QUUA 5HEUA 2C0SA 3FXEB 2BBHA 1FIOA 1WLXA 4FSPA 3QC9A 3O4XE 5E79O 5HEJA 1IZNB 1J5ET 4JI6T 2CXFA 3FZLB 3FZKB 3PURA 5ADXK 4B3MT 4UVBB 3PGSA 1MNEA 5ABHA 3EI0A 2B1EA 2MHLA 1N36T 2Y6XA 3CX6B 2FJBA 3CX8B 3ETVA 4IT4A 2E9XD 3C4WA 3K1SA 3RIUC 2CWOA 4EEDA 4G2AA 2WU5A 1I94T 2ERVA 5HXHA 3RIUA 2KZ7A 4I50E 1P4TA 4B3RT 5JDNA 2AXTO 2W61A 4ILUA 2JQYA 4JUYA 4AQFC 2NP9A 3AAEB 4FZMA 4ERRA 1Q9FA 4AQFA 3RIFA 3ZT5A 1JNRA 5FXVA 2I59A 5AQRB 4DV0T 1GQEA 2KDYA 2F4VT 3EUHA 4DV4T 5FNVE 2LLYA 2JQKA 3AVSA 4IHJE 5FY0A 3RYCE 1MMNA 2DCFA 2C5IT 4K0KT 3AA6B 4DBQA 1IBLT 4YTMA 4JV5T 3EABA 3KVBA 4O4JE 2BKPA 2Q9QB 2Q9QD 3UU8A 5FP3A 1LKXA 3AE8A 2BG9E 2DLRA 2QGSA 3EVYA 2XPKA 4UB8O 2QA7A 5LHHB 4ISTA 2YDQA 4UVAB 3UQ7A 4P09A 4QXCB 3LK3B 2XE5A 2IIUA 4PUXA 2VL0A 2NTXA 4JEUB 2XQ8A 4JEHB 4AI6A 4MFRA 3R84B 2DWGA 3CWZB 3Q9DA 4FI5A 2WBLA 5HEHA 2N1GA 3P4QA 2VL8A 3FBLA 3QB5K 1UCUA 4LSHA 2FJAA 4MHCA 3CQGB 2VQFT 3AA7B 2VKOA 4H63H 2NW8A 1IAPA 2Y0KA 2YU2A 4UF0B 4IDOA 2IMLA 4F6RC 4IIJE 4LFBT 5JTGA 2R4PA 4L0RA 3GA8A 1G8XA 3PUZF 3ZMVB 2KSRA 1WR0A 1YQ3A 2YPVA 3GWHA 3AA1B 2VKHA 4O4LE 2WY2A 4D5UA 3MA9A 3K3NA 1W0BA 3PV0F 5F5WA 5KXJA 4JI4T 4KR4A 4AISA 5FY1A 4TN7B 5AQMB 4UV8B 4YSXA 1MM5A 2OV9A 3T24A 2LEHA 4MLKA 4WBOA 1QLBA 4DVDA 2NW7A 4AKGA 4LSFA 4YJ3E 2H7VC 1Z8UA 2V6YA 2KINB 3V5UA 5LCYA 5FXZA 5IUXA 1WFDA 4H9OC 4IE6A 3KBUA 4TNVA 5JDGA 2XQ4A 3O9XA 3ANWB 2V7MA 1BR2A 3E08A 5FXXA 2XE2A 5D5DA 1BR4A 3QK6A 3FBZA 2J4UP 2DNXA 3UUNA 5CA1E 5KDMC 4DV7T 3AE6A 5DL5A 3A8YC 3ZMTB 4JI5T 3AE4A 5JDLA 3BRYA 2CE7A 2BKOA 4B6XA 2BVLA 2YK0A 4ISSA 2CXLA 1QSDA 5LG4A 3RYIE 3VE1A 1NENA 3QRAA 5AQSB 4WYVA 2Y0LA 4G76A 4TV8E 3CK6A 3AEEA 3O1IA 3AE3A 1GFOA 3G7GA 4AYEC 3RRCA 4UVCB 3VY8X 2OLTA 4G75A 1FMVA 1MIVA 3UQ4A 4DV6T 4JI7T 3O1JA 3HKCE 3UFGA 4O3WA 2LSJA 4HKAA 2LKHA 4CI2B 2WMNA 2IAKA 4FRTA 3C98B 2WM9A 5GONE 4ZEYA 5GTIO 3GMIA 2JQ9A 1E2AA 3ZCJA 2UU9T 4DR7T 4C4VB 2LSGA 2X67A 2YU1A 3BS0A 5ABFA 2XMXA 3RC8A 1MPFA 2LHFA 1W0AA 1U5PA 1G73A 4IE0A 4O8SA 2HN2A 2WB5A 4J2CA 4AKRB 4E1TA 3UFEA 5J0ZA 3V8UA 3SWHA 3DTOA 2H3RA 7PRNA 4X1KE 1KFYA 2XAHB 2L9QA 3PE0A 5T5FA 4LF4T 5AQQB 4I4TE 3AEBA 4TNWA 4P1NA 4TZ4C 2N2MA 2LFUA 4TX5A 4PAGA 4E7ZA 5JDPA 4TUYE 3IBPA 3D0TA 3TLSA 1YKEB 2NW9A 3PQSA 3KV4A 3JTYA 2IDOB 1CUNA 3LK42 2M06A 4A56A 4KX6A 1HX8A 4AZLA 4PK4A 1QJ9A 2A9UA 2XUEA 4HE8A 3K3QC 4DO0A 4PW8A 1KNRA 4G63A 1IZNA 2HH7A 4LF8T 3GP6A 5A1LA 4O49A 2AE9A 3BQLA 3P7IA 2XQ9A 4X65T 4FRXA 4K3BA 5L3DB 1KNZA 2LHRA 2C5JA 4YLHA 5CGMA 2AXDS 2PJQA 4YHHT 1LRZA 2QYWA 3FZMB 2RP4A 2O4VA 2J4GA 4TWDA 5EK2A 4K0UA 4HFIA 4U2ZA 2JMMA 3LJCA 2SPCA 4JFBA 1UX4A 2XAJB 2XG6A 2R89A 4N78D 5HAXA 4PNIA 3AAIA 1SE7A 5JDFA 4CQIA 4U31A 3CX7B 4WBNE 2FBWA 3ZSTA 4IE5A 3ZYLA 1KK7A 4YFSA 4E7SA 4AYDC 4ILCA 4GF4A 3UU3A 3L39A 1ZHYA 4X5TA 3VE2A 2CWYA 5KAFO 5LMUT 4JI0T 4LFCT 5DQVA 1BH3A 4XAXB 2V7IA 3WU2O 4A97A 3AEDA 3ETUA 2ZLYA 4QWNB 1HX1B 2ACXA 4EZHA 2LHNA 3JCUO 3N9OA 4H9PC 3W15B 1V9DA 3AA6A 4XNKA 2Q9QC 3ZJ1A 4LMLA 3VHLA 3ZN0B 1MIWA 2BS4A 4RLBA 4UB6O 2Q9QA 3RLFF 5F3JA 3A0HO 3VZWX 3H3MA 2XQ7A 2XASB 2XQ5A 2FGRA 4K3CA 3EDUA 3MJXA 5L2LA 2KMFA 3SRZA 2R8AA 3NZPA 3ZMZB 1PRNA 5IYZE 4AKHA 2X9YA 5AQHB 2XQAA 5LBQB 2R88A 2ZM6T 3P4PA 2ZM0A 3V5SA 2JJ9A 3HI2A 2JMHA 3OYXA 3RKOA 4AIUA 4O3ZA 3P4RA 5J2UE 4GKKT 1VCSA 2W4XA 5ETWA 3UUMA 1S94A 5LB7B 2YKSA 5H2FO 2UXXB 2BS2A 2JMKA 2ODVA 2EHOD 2D2SA 4O4HE 5LBMA 2HPJA 3VKHA 4WNKA 1XWMA 1HCIA 2YOEA 4EB6E 2Y0HA 4M1PA 3AA7A 2YDSA 4O2AE 1BR1A 4UIGA 1BT9A 4HEAA 4UF0A 4RJWA 4PFPA 2W0GA 4EOZB 3FZHB 3DZMA 2I0MA 2X27X 2BG9B 2CEAA 3KV6A 3LG7A 3WI3A 4PJNA 5AQFB 5BMVE 3HOEA 6PRNA 2V5DA 4U33A 4AFKA 4HFCA 1EZ3A 3SY7A 5FYMA 3AXJB 4RJXA 2FJEA 3PU8A 3AA0A 1MNDA 4Q25A 2FGQX 4CI1B 5JREA 3AA1A 5IWAT 5IYUA 3N9NA 3C4XA 3ZN1B 1FMWA 1D0ZA 1OEDE 4U74A 3K8PC 2K3WA 2UUBT 5AFUK 2M6BA 2JQQA 3N9QA 1DU2A 4EYUA 3L8RA 3Q2MA 2DI4A 4KHZF 4TWFA 5L3GB 2XHEB 3L3PA 1SUMB 4ANJA 3NZQA 4PR7A 1UUSA 3C50A 5G38A 3RC3A 4HGAA 2XE1A 3TZGA 3CMLA 4BJNA 4CN6A 1PHOA 3ANWA 4ZS2A 2BBJA 3LK41 5FVNA 3FZFB 1MIYA 1FEWA 2W62A 2XZEA 4KI0F 1YQ4A 3AE7A 3C64A 3QOFA 1SHZC 4PFOA 3F57A 3AE2A 4QH1A 5B66O 4FESA 2VWAA 2V7KA 5KMGP 3UU6A 3Q5EA 4DIDB 3CVRA 3RHWA 3AE9A 3F31A 3DWOX 4DR2T 3FYXA 4LSEA 3UUXB 4AKLA 3POXA 5LGUB 3RKGA 1YXRA 2CLYB 2CXDA 3G06A 1E54A 3CKDA 3HR0A 1H7CA 4V1Av 2RPAA 2LM9A 3I1AA 5C3JA 5DL8A 3NKZA 2MYSA 4LF7T 1BR0A 3L09A 4ADZA 1UGOA 4LSIA 3AAAA 5HEOA 1KF6A 2CPTA 2CMRA 3PUAA 4U7YA 4AYNA 3KBTA 2QVAA 3PQUA 4O4XA 1NEKA 3ZMSB 3C5OA 5EK4A 3ZC1A 3KINB 3NVOA 2A3DA 2WJQA 3N5LA 3OVUA 3AE1A 4IDPA 2DWKA 2P9BA 4IGUA 2UXBT 3P50A
chains in the Genus database with same CATH topology
4ZI7E 2PRNA 3BQIA 3Q5XA 3UULA 5L3EB 3VKGA 1OXZA 3O1JA 5EE2A 3HKCE 1ORMA 8PRNA 3OYZA 3HKDE 1IJ6A 2LSJA 3HL6A 5LP6E 2KT9A 4O3WA 4DMVA 1D1AA 4HKAA 1LVFA 3RYHE 4CI2B 1AJ3A 2N2LA 4X20E 2IC6A 2WMNA 4FJOA 2IAKA 4O2BE 4FRTA 3HWBA 3C98B 2WM9A 5GONE 3PORA 4H9QC 4EZ4A 4AKRA 1D1BA 4IDZA 1QJPA 4PJJA 2E9XB 4DBRA 1G90A 2WMOA 1YKHB 2W80C 3GMIA 2XQYA 4Z3TA 3ZCJA 2GE4A 2OA5A 2X68A 2LOSA 2K9AA 3RX6A 2LSGA 4C69X 1GFQA 2X67A 2YU1A 4O4UA 5HXSA 3F2EA 2D0TA 1VRBA 4ZI2C 2BVMA 1Y64B 3OJAA 5TAOA 5LXTE 2BDEA 3RC8A 2XMXA 1WYBA 2K5BB 3U78A 1MPFA 2LHFA 2N9DA 3UT5E 3MK7C 1HTJF 1U5PA 5FY7A 3ZC0A 3ZLIA 1G73A 1HXTA 2MOZA 3PDYA 4IE0A 1MMGA 4J2CA 4O8SA 4AKRB 3K3OA 2ZM2A 3UFEA 4C91A 3K19A 4E1TA 3V8UA 3SWHA 3DTOA 2KWHA 4FZLA 4L9IA 2H3RA 1Z0PA 1QJ8A 4X1KE 7PRNA 1HF8A 2XAHB 1E1HB 2J1NA 4IE7A 2L9QA 3CQXC 1Q9GA 4FMSA 4GK5E 3I9WA 3PE0A 4HFVA 4DNDA 5C8YE 5JRCA 5T5FA 2KZ7B 5KX5E 4I4TE 3I0QA 3IF8B 3FB2A 4RLCA 4TZ4C 2D0UA 2N2MA 1SA0E 2LFUA 4GCQA 5CB4E 3KVAA 3N9LA 4TX5A 4BAYB 2KXPA 4PAGA 4E7ZA 4GK0E 4QHOA 4CXYA 3EMNX 5JDPA 4TUYE 3IBPA 4ZI3D 1YS5A 3D0TA 1HXUA 3WAJA 1GFMA 2LOPA 3FXDB 3Q5WA 3RBHA 4GHBA 3RYFE 3KFWX 1YKEB 5JRCB 2NW9A 4GOUA 2W81C 3PQSA 3TKLB 2KLQA 3KV4A 2XAQB 3JTYA 2HPLA 2XTRA 4EIWA 3NSGA 2KXPB 3SZVA 2ZMAA 3H37A 1BXWA 1CUNA 5LYJE 3LK42 4AYMC 3ONXA 2M06A 3SYBA 2X9WA 5JDHA 3BK9A 3HOLA 2Y2XA 2ES0A 1MM4A 5DL6A 2K4TA 4A56A 4NUVA 5H6RB 4O3YA 4AXPA 2J1DG 2W00A 2K24A 1HX8A 5M4YA 2LSIA 5LGNB 4AZLA 1ZHWA 3POQA 1UX5A 1GFPA 4OHFA 4ZHQE 2MTQA 4PK4A 1QJ9A 5IHYA 2XUEA 4FT6A 4U72A 4HE8A 2WSSV 3HKEE 3K3QC 4PW8A 4UELA 4DO0A 2ZFGA 2KWIB 3UAQA 4G63A 1IZNA 3DA3A 3GN5A 2HH7A 2X66A 4CI3B 5HWXA 1THQA 5PRNA 3NRXA 3GP6A 1HFAA 5A1LA 4O49A 4I43B 2ODUA 5LGTB 2EHOB 4ASKA 3BQLA 2PORA 5J1GA 4FSOA 2MBGA 3P7IA 1QUUA 3I9YA 4F4BA 2WAUA 2C0SA 3FXEB 3PUQA 4PK5A 4XZCA 1FIOA 2X0LB 4FRXA 5L3DB 1WLXA 1KNZA 4FSPA 3QC9A 3O4XE 4AUIA 1O3XA 2C5JA 2LHRA 4YLHA 4JLEA 2PJQA 2MNHA 4H63V 1OWAA 1LRZA 2V1DB 3N9PA 3R6NA 5HXRA 1IZNB 1US7B 2RP4A 3GN5B 2O4VA 4X1IE 2CXFA 4JCHA 2X51A 3QRCA 2CM0A 2KNDA 5EK2A 1LVKA 3A5XA 3ZJ2A 4BUMX 4K0UA 2F1TA 5H6QB 4FUVA 4ZS3A 2JMMA 2BZBA 1YD8G 2M07A 3PURA 3IHRA 4NUUA 5ADXK 4UVBB 3T20A 3LJCA 2SPCA 1MNEA 2L3LA 2Y8DA 4HTEA 4JFBA 1UX4A 2XAJB 3WI5A 2B1EA 3ZYKA 2MHLA 1U4QA 3ESLA 2XG6A 2Y7SA 4N78D 5HAXA 2Y6XA 3CX6B 4PNIA 3AAIA 5JDFA 2NTYA 1HXXA 4CQIA 3CX8B 3ETVA 3FHNA 1X79A 2LJLA 3CX7B 4WBNE 2ZLDA 2E9XD 4IE5A 2VASA 3ZYLA 3C4WA 2CWOA 2NOXA 4G2AA 1KK7A 5HXHA 2ERVA 2YINA 3A2SX 3E0ZA 3C51A 4YFSA 4E7SA 4QQ1A 2KZ7A 4I50E 4AYDC 3ZEFB 4PK6A 1P4TA 4GF4A 5JDNA 4FOZA 2W61A 4ILUA 1ZHYA 4KUMB 4JUYA 3VE2A 2CWYA 1BH3A 5DQVA 5JDQA 1OSMA 4XAXB 4AQFC 2ZM8A 2V7IA 3AA0B 3LK2A 3VZUX 2NP9A 4AYID 3AAEB 4FZMA 3N2KE 3PU3A 4ERRA 1Q9FA 4AQFA 2V7JA 4OYJA 4GCSA 4D64A 3ETUA 2ZLYA 2YEVC 3MXZA 4QXBB 4QWNB 2ACXA 3SYSA 4EZHA 5FXVA 3UU2A 2LHNA 3T8OA 2I59A 3MKDA 3N9OA 4H9PC 3W15B 4GIWA 1V9DA 3AA6A 4XNKA 2Q9QC 4U9CA 3ZJ1A 4OK0A 3RRWA 3J7Yq 3VHLA 3ZN0B 4ZI2D 2KDYA 4KBMB 3QUJA 3HKBE 4QX7B 1MIWA 4GCPA 3EUHA 3LK2B 4RLBA 2Q9QA 1ZHZA 5FNVE 5F3JA 4XBFB 5DQWA 3VZWX 3ZCIA 3J9X1 2C5KT 3AVSA 4IHJE 3S4UA 2LT3A 5FY0A 4AKIA 3RYCE 1MMNA 2XASB 3LFMA 5FXWA 2DCFA 2C5IT 2FGRA 3M65A 2LE8A 4H9NC 3AA6B 3EDUA 4X1YE 4DBQA 4MALA 3MJXA 4UXNB 2PFVA 1ZHTA 5L2LA 2KMFA 4BJMA 4MBQA 3SRZA 3KVBA 5G26A 2EHOC 4O4JE 3ZPOA 3NZPA 2D5UA 3ZMZB 1PRNA 5IYZE 4AKHA 2Q9QB 3NRYA 2X9XA 2Q9QD 5HXEA 2X9YA 5FP3A 1LKXA 2EHOA 4YHJA 2DLRA 2QGSA 3EVYA 5LBQB 2LSYA 2VKDA 4N59A 2ZM0A 3V5SA 5HWYA 2JJ9A 2QA7A 2JMHA 3HI2A 3OYXA 3RKOA 4O3ZA 1T98A 2KC0A 1NAFA 5LHHB 5J2UE 4YJ2E 4ISTA 3SY9A 4UVAB 2NWBA 4P09A 4QXCB 5ETWA 3UUMA 1S94A 3KDSE 3LK3B 4RL9A 2XE5A 4PUXA 3DA4A 3ZMUB 2UXXB 3DP7A 4BA9A 2JMKA 2ODVA 2EHOD 2NTXA 4JEUB 4JEHB 5LJNA 2D2SA 4O4HE 5LBMA 2LSKA 3LBXA 5DABA 2IW5B 4AI6A 2HPJA 2JPFA 4ZOLE 4MFRA 3R84B 3VKHA 4WNKA 3CPZA 2DWGA 2XE3A 3CWZB 1HCIA 1WYCA 3Q9DA 5AFUL 4OYKA 4EB6E 2Y0HA 4FI5A 4M1PA 5FMNA 3SOLA 2WBLA 2PG8A 4P0AA 3AA7A 4O2AE 1BR1A 3BQKA 1OPFA 3AVRA 4UIGA 1GFNA 2N1GA 4TV9E 4UEMA 1B7TA 5JDMA 1BT9A 4HEAA 4UF0A 5JQGE 4RJWA 3O0EA 4PFPA 2W0GA 4EOZB 2VL8A 3FBLA 2YNKA 3WI4A 1UCUA 2RA1A 4LSHA 3LBXB 3HW9A 2X27X 2M67A 2CEAA 3KV6A 3LG7A 3E22E 4PJNA 3EDVA 3N2GE 3WI3A 5BMVE 3HOEA 6PRNA 2X9HA 4MHCA 3CQGB 3AA7B 4AFKA 2VKOA 3JC6C 1EZ3A 4H63H 2NW8A 3B13A 3SY7A 1IAPA 5DJQC 2Y0KA 3T0SA 4DMWA 5FYMA 3IEEA 2G0UA 2YU2A 4UF0B 3WAKA 5LNKA 1D0YA 5JH7E 4RJXA 2V7LA 4F6RC 2UXNB 4AKMA 3MZKB 2K48A 3PU8A 1MNDA 4IIJE 3AA0A 2FGQX 4CI1B 3AAAB 5JVDE 3AAEA 2CA5A 5JREA 2VKJA 3VY9X 2A2FX 4L0RA 5L3CB 3AA1A 1ZKEA 4IE4A 3GA8A 5DL7A 1G8XA 5IYUA 3HA4A 3ZMVB 3N9NA 1HG2A 3U3IA 3C4XA 4L5GA 4O4IE 3ZN1B 1FMWA 1D0ZA 4U74A 3K8PC 3JC6D 2YPVA 4Z8XA 5AFUK 3PUGA 4EAHA 5LJMA 3GWHA 2JQQA 1D1CA 3N9QA 4KP3C 4GYSA 3ZYMA 3PTRB 4EYUA 2VK9A 1VOMA 3Q2MA 3AA1B 2XAGB 3CQCB 2DI4A 2VKHA 4O3XB 4PJLA 4O4LE 4D5UA 1NWMX 3MA9A 3K3NA 5L3GB 2OMFA 2XHEB 1WRDA 3L3PA 2GK9A 3RPUA 1MMAA 4ZI3C 5FY1A 4ANJA 3NZQA 4FZNA 4KR4A 5CA0E 3C50A 5HXCA 4CXXA 3KV5A 4TN7B 5LA6E 3RC3A 2F1VA 4HGAA 4UV8B 1MM5A 1IJ5A 2XE1A 3NBXX 2Y48B 4CXWA 2H7OA 3TZGA 3T24A 2LEHA 3CMLA 4MLKA 4WBOA 1ZHCA 4BJNA 3POUA 1H6S1 5EZYE 4QKNA 1ZV4X 4QX8B 4HN9A 2CCQA 3DJBA 4EXTA 1PHOA 4DVDA 3AB3B 3C4ZA 3ANWA 2NW7A 4XNLA 4AQGA 4AKGA 1D0XA 2VB6A 5L3BB 4ZS2A 4LSFA 3LK41 4YJ3E 5FVNA 1MIYA 2H7VC 1FEWA 5L3FB 2K0LA 3I0OA 2WWUA 2W62A 3OKQA 2KINB 3LK3A 3V5UA 3C64A 5F8PA 5LCYA 5FXZA 4H9OC 4IE6A 1SHZC 5J2TE 2CLYC 3KBUA 5LHGB 2PBIA 4I55E 4PFOA 5JDGA 2XAFB 3SS1A 3SZDA 2IC9A 3F57A 4UV9B 3PUSA 3RH3A 4FESA 3O9XA 3UPGA 2VWAA 1WR6A 2A72A 2V7KA 3ANWB 5E0OA 2V7MA 1BR2A 3E08A 5FXXA 5KMGP 3CVRA 4H9RC 2XE2A 4P0BA 5D5DA 1BR4A 2L8KA 4CZZB 2XTQA 3F31A 4QXHB 3QK6A 2JRKA 3FBZA 2J4UP 2DNXA 3H3AA 3UUNA 2XTLA 5CA1E 5KDMC 4E1SA 5ADXL 3FYXA 3MACA 4LSEA 4EYYR 3UUXB 4AKLA 3POXA 5LGUB 1HG5A 2V26A 3KVDD 5DL5A 3ZMTB 3UTKA 4H9SE 2CLYB 2DHRA 1ZEEA 4OFZA 2CXDA 2W63A 5JDLA 2CE7A 4B6XA 2N2NA 5HYAA 4KMCA 1E54A 3N9MA 5GV0A 2BVLA 2YK0A 3CKDA 3O1HA 4ISSA 1ZHXA 3HR0A 4KR8A 1H7CA 4V1Av 3VU7H 2CXLA 5JR9C 1QSDA 2LM9A 3I1AA 3P8CD 5DL8A 5LG4A 4C90A 4KRAA 2MYSA 3RYIE 4WW0A 1BR0A 3L09A 1MMDA 4ADZA 3VE1A 4LSIA 3AAAA 5JR9A 4B61A 3PUAA 2CMRA 4AYNA 3KBTA 2QTKA 3QRAA 3VZTX 3PQUA 4D65A 5EK3A 4O4XA 1S35A 3ZMSB 2ODJA 2Y0LA 4G76A 4TV8E 3C5OA 4GYRA 3N2OA 1YW0A 3O1IA 5LOVE 2E8IA 3B57A 2E9XC 5EK4A 3ZC1A 1GFOA 5LHIB 3G7GA 4N58A 4AYEC 3KINB 2A3DA 3RRCA 3N5LA 3KV9A 4PJMA 4UVCB 1HS7A 2E9XA 3VY8X 4G75A 3OBVE 2DWKA 2P9BA 2Z6EA 5JR9B 1FMVA 1MIVA 4IGUA 3PRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AA1 A;  3LK4 2;  2KZ7 A;  5ADX L;  2KXP A;  3AA6 A;  3AAA A;  5ADX K;  3LK3 A;  4AKR B;  3AA7 B;  3LK2 B;  5AFU L;  5AFU K;  3AA0 B;  4AKR A;  3AA7 A;  3LK2 A;  3AAE B;  1IZN B;  3AA0 A;  3AA1 B;  2KZ7 B;  3AAA B;  3AAE A;  1IZN A;  2KXP B;  3AA6 B;  3LK3 B;  3LK4 1; 
#chains in the Genus database with same CATH topology
 4ZI7 E;  4DR1 T;  4C4V A;  3BQI A;  3UUL A;  4DR5 T;  5L3E B;  3VKG A;  1ORM A;  3OYZ A;  1IJ6 A;  3HL6 A;  1D1A A;  2N2L A;  4HWF A;  1HNX T;  4AKR A;  4IDZ A;  1R8I A;  1W9R A;  2WMO A;  2W80 C;  2XQY A;  2OA5 A;  2K9A A;  4YXD A;  4C69 X;  3F2E A;  4YT0 A;  4ZI2 C;  1XZY A;  5LXT E;  1WYB A;  3U78 A;  3UT5 E;  4DV1 T;  4YTN A;  5HYA A;  4HFE A;  4C91 A;  1HNW T;  4YTP A;  1QJ8 A;  4YY3 T;  5AQT B;  4DV5 T;  4DV2 T;  2YN6 A;  4GK5 E;  4HFV A;  5C8Y E;  2KZ7 B;  5KX5 E;  3I0Q A;  3IF8 B;  3FB2 A;  4UR9 A;  5CB4 E;  4HFD A;  4HFH A;  4CXY A;  3EMN X;  1YS5 A;  3RBH A;  3FXD B;  3A0B O;  4GOU A;  3TKL B;  2KLQ A;  4ILB A;  2HPL A;  2XTR A;  3CIR A;  2ZMA A;  3H37 A;  3ONX A;  2W2U A;  5JDH A;  2Y2X A;  2K4T A;  5H6R B;  1IBM T;  3PUY F;  2LSI A;  1HNZ T;  1UX5 A;  2D9D A;  4FT6 A;  3UAQ A;  2KWI B;  5HWX A;  5PRN A;  3NRX A;  1HFA A;  2W66 A;  4ASK A;  2POR A;  2MBG A;  3I9Y A;  4F4B A;  4DV3 T;  2WAU A;  4PK5 A;  3PUQ A;  4LMJ A;  3B5M A;  2IHR 1;  5ABG A;  3UU5 A;  2MNH A;  4H63 V;  1OWA A;  3ZKR A;  2V1D B;  5HXR A;  1US7 B;  3GN5 B;  4X1I E;  3QB5 A;  4JCH A;  2WCA A;  1LVK A;  4A98 A;  3ZJ2 A;  5HCM A;  5H6Q B;  4FUV A;  4ZS3 A;  2BZB A;  1YD8 G;  4NUU A;  3ZT7 A;  3T20 A;  3A7M A;  2L3L A;  2WS3 A;  2Y8D A;  4COF A;  3WI5 A;  1U4Q A;  3ESL A;  3ZT6 A;  2NTY A;  3FHN A;  1X79 A;  5FKY A;  3IA3 A;  2VAS A;  2NOX A;  2WU2 A;  4B3T T;  2YIN A;  5CJ5 A;  3A2S X;  3E0Z A;  3T1H T;  3C51 A;  4PK6 A;  2E5L T;  4FOZ A;  2QRX A;  1OSM A;  2J62 A;  2ZM8 A;  2WDV A;  2V7J A;  4GCS A;  4AQY T;  1UUR A;  2YEV C;  4QXB B;  3SYS A;  1KNP A;  3T8O A;  2R6G F;  3PUV F;  3RIA A;  3RRW A;  4DR6 T;  4ZI2 D;  4KBM B;  3QUJ A;  3HKB E;  4GCP A;  3LK2 B;  4WZX A;  1ZHZ A;  1ZP0 A;  5DQW A;  3J9X 1;  2LT3 A;  2LE8 A;  1M62 A;  4H9N C;  4NIQ A;  2EHO C;  3ZPO A;  3NRY A;  5HXE A;  2EHO A;  3PF1 A;  2VKD A;  4N59 A;  1T98 A;  5BR8 T;  1NAF A;  3RF1 A;  2KC0 A;  4YJ2 E;  3SY9 A;  2NWB A;  2V6Y B;  3KDS E;  4RL9 A;  3ZMU B;  2BG9 C;  4BA9 A;  5LJN A;  2IW5 B;  2LSK A;  2BG9 A;  3BRZ A;  2JPF A;  4ZOL E;  2NR4 A;  3CPZ A;  2XE3 A;  5AFU L;  4OYK A;  5LMN T;  3SOL A;  4EEB A;  2PG8 A;  1OPF A;  3BQK A;  3AVR A;  1GFN A;  4TV9 E;  5JDM A;  3KZI O;  5JQG E;  3O0E A;  2YNK A;  2RA1 A;  3LBX B;  4IL9 A;  3E22 E;  3EDV A;  3N2G E;  2X9H A;  4C00 A;  5DJQ C;  3T0S A;  3EAM A;  4DMW A;  2WP9 A;  3IEE A;  2G0U A;  3SFE A;  3WAK A;  2V7L A;  2UXN B;  2IUB A;  3AAE A;  4U7I A;  2CA5 A;  4HWH A;  4NXN T;  2HN1 A;  5L3C B;  3VY9 X;  2VVS A;  3U3I A;  1XMQ T;  4O4I E;  4YSZ A;  2R4N A;  3TLT A;  3JC6 D;  4JI2 T;  4Z8X A;  4LF6 T;  5LJM A;  4GYS A;  1N34 T;  2VK9 A;  3M3Z B;  3CQC B;  2CHN A;  4O3X B;  4PJL A;  2R4O A;  5AQI B;  2WDQ A;  2OMF A;  3RPU A;  4ZI3 C;  4FZN A;  4A5X A;  3KV5 A;  5LA6 E;  2F1V A;  1IJ5 A;  3NBX X;  4CXW A;  1I6Z A;  4EGW A;  3POU A;  1H6S 1;  4QKN A;  1ZV4 X;  4QX8 B;  4HN9 A;  4CN1 A;  2CCQ A;  3DJB A;  4EXT A;  3AB3 B;  3OTO T;  4TWH A;  4AQG A;  1D0X A;  2VB6 A;  3RI5 A;  5B5E O;  3I0O A;  2WWU A;  1OED B;  3LK3 A;  5F8P A;  5AQO B;  2V6X A;  5AQK B;  5J2T E;  2CLY C;  2WDR A;  3UPG A;  3R6N A;  5E0O A;  3PGU A;  4H9R C;  3VRA A;  4P0B A;  5AQG B;  2L8K A;  4CZZ B;  2JRK A;  3PUX F;  4IDN A;  3H3A A;  2XTL A;  2WZI A;  3P4S A;  4EYY R;  4NXM T;  5TIS O;  1HG5 A;  3UTK A;  2DHR A;  4DR4 T;  3QNU A;  5AQJ B;  4JI8 T;  2V8S V;  5GV0 A;  1ZHX A;  4KR8 A;  3VU7 H;  3RQU A;  3P8C D;  4C90 A;  1X9B A;  1MMD A;  3Q5D A;  4OX9 T;  3PGR A;  2QTK A;  4D65 A;  1S35 A;  4GYR A;  3N2O A;  1YW0 A;  3TLU A;  5LOV E;  3TLW A;  5LHI B;  5AQV B;  4Z91 A;  3AEC A;  3KV9 A;  1HS7 A;  5JR9 B;  3JCF A;  3PRN A;  5FVK A;  5EE2 A;  1T8B A;  3HKD E;  4N75 A;  2KT9 A;  4JI1 T;  1LVF A;  3RYH E;  4X20 E;  2IC6 A;  1CHU A;  1QJP A;  4PJJ A;  1HR0 T;  2E9X B;  1YKH B;  2XM2 A;  4O4U A;  1Y01 A;  4PJ0 O;  1VRB A;  2XY8 B;  2BVM A;  3OJA A;  2K5B B;  5AQU B;  3MK7 C;  1HTJ F;  3ZLI A;  2X9K A;  2MOZ A;  3PDY A;  3ZSS A;  3K19 A;  2X0H A;  2KWH A;  1Z0P A;  5CFB A;  1HF8 A;  4IE7 A;  2DL1 A;  3CQX C;  4FMS A;  4DND A;  3I9W A;  5G3A A;  4X66 T;  4RLC A;  4GCQ A;  1SA0 E;  4U3C A;  2E5V A;  3JAD A;  2WVP A;  3AEG A;  1S5L O;  4ZI3 D;  3ONJ A;  3TLV A;  2LRL A;  2LOP A;  3Q5W A;  2UUA T;  5JRC B;  2W81 C;  3NSG A;  2KXP B;  3SZV A;  1BXW A;  4AYM C;  2JIW A;  3HOL A;  5DL6 A;  4NUV A;  5AQP B;  1KEY A;  5LGN B;  3POQ A;  1GFP A;  4OHF A;  2MTQ A;  3JAF A;  5IHY A;  1VCT A;  3HKE E;  4UEL A;  2ZFG A;  3GN5 A;  1THQ A;  4I43 B;  2ODU A;  1N33 T;  4IL4 A;  4FSO A;  4XZC A;  1T1L A;  2X0L B;  4AUI A;  1O3X A;  5HCJ A;  4JLE A;  3JAE A;  2MPK A;  3N9P A;  3RQW A;  2X51 A;  3QRC A;  4LMK A;  2CM0 A;  2KND A;  5FL0 A;  1J1J A;  2LRK A;  3A5X A;  4BUM X;  2F1T A;  4DUZ T;  1UK5 A;  2M07 A;  3EHZ A;  3IHR A;  2CHO A;  4HTE A;  2FJD A;  2I6H A;  3ZYK A;  2Y7S A;  3LDQ B;  2FUP A;  1HXX A;  3OPC A;  3ONL C;  1J5W A;  2LJL A;  2XSA A;  2ZLD A;  2IWW A;  4LFA T;  4IL6 O;  1WCR A;  2WJR A;  4QQ1 A;  3ZEF B;  1W09 A;  4KUM B;  2UXD T;  5JDQ A;  3AA0 B;  1IBK T;  3LK2 A;  3VZU X;  2MAW A;  4AYI D;  3N2K E;  3PU3 A;  3VR9 A;  5HEG A;  4OYJ A;  2CBI A;  4D64 A;  3MXZ A;  3P4W A;  3UU2 A;  3MKD A;  4QH5 A;  4GIW A;  2X0Y A;  4U9C A;  4OK0 A;  3J7Y q;  4QX7 B;  4I0U A;  4ZXL A;  4XBF B;  3ZCI A;  1XDP A;  4F8H A;  2C5K T;  3S4U A;  4AKI A;  2R4L A;  3LFM A;  5FXW A;  5FL1 A;  3M65 A;  1XNQ T;  5GTH O;  4X1Y E;  4MAL A;  4UXN B;  1ZHT A;  2PFV A;  3AE5 A;  4BJM A;  4MBQ A;  5G26 A;  2D5U A;  2X9X A;  4YSY A;  2ACZ A;  4YHJ A;  1FJG T;  1N32 T;  2LSY A;  3T1Y T;  5LG3 A;  4N74 A;  1M7K A;  5HWY A;  3NJT A;  3PUW F;  3DA4 A;  3DP7 A;  2J47 A;  1L0V A;  3LBX A;  5DAB A;  4KHP T;  3AEF A;  1WYC A;  5FMN A;  4P0A A;  1JNZ A;  4UEM A;  1B7T A;  4CTD A;  2XM1 A;  2PTF A;  2H89 A;  3WI4 A;  3LSV A;  3HW9 A;  2M67 A;  5KAI O;  2WQY A;  5ABE A;  4U2Y A;  4LF5 T;  3JC6 C;  2V5C A;  3B13 A;  3VRB A;  4LF9 T;  4ZZB A;  5L4E A;  3VR8 A;  2VUR A;  2WWV A;  4JYA T;  5LNK A;  1D0Y A;  2XQ3 A;  5JH7 E;  4AKM A;  3MZK B;  2K48 A;  2BKN A;  4DR3 T;  3AAA B;  5JVD E;  2VVN A;  3DWN A;  2VKJ A;  2A2F X;  1ZKE A;  4IE4 A;  5DL7 A;  3HA4 A;  1HG2 A;  4L5G A;  4HWI B;  3PUG A;  4EAH A;  1T72 A;  2F1C X;  1D1C A;  4KP3 C;  3ZYM A;  3PTR B;  1VOM A;  1XMO T;  4X64 T;  2XAG B;  4FQE A;  3SFD A;  3AEA A;  2E2A A;  1NWM X;  4ILA A;  1WRD A;  1OED C;  2GK9 A;  4NPP A;  1MMA A;  5CA0 E;  5HXC A;  4CXX A;  2CBJ A;  5G39 A;  1OED A;  2LKG A;  2Y48 B;  2H7O A;  4Z90 A;  1ZHC A;  5EZY E;  3C4Z A;  4XNL A;  2IWV A;  5L3B B;  3PJA A;  5L3F B;  2K0L A;  3OKQ A;  4CN4 A;  5FVL A;  2XJ7 A;  5LHG B;  2PBI A;  4I55 E;  3SZD A;  2XAF B;  3SS1 A;  3PJA J;  2IC9 A;  4UV9 B;  3PUS A;  3RH3 A;  1WR6 A;  2A72 A;  1T7S A;  2XTQ A;  4QXH B;  4E1S A;  5ADX L;  3MAC A;  1XDO A;  3KVD D;  2V26 A;  4HWC A;  2H88 A;  4H9S E;  1ZEE A;  4OFZ A;  2W63 A;  2N2N A;  4KMC A;  3N9M A;  3NWI A;  3O1H A;  5JR9 C;  3AXJ A;  4KRA A;  4WW0 A;  3X1D A;  2CRB A;  5JR9 A;  4B61 A;  4IDQ A;  3VZT X;  5EK3 A;  2ODJ A;  2XQ6 A;  1ZOY A;  2E8I A;  3B57 A;  2E9X C;  4N58 A;  4PJM A;  1XNR T;  2E9X A;  4GKJ T;  2UUC T;  3OBV E;  3ABV A;  2Z6E A;  4JI3 T;  2LM2 A;  2PRN A;  3Q5X A;  2WZH A;  4QH4 A;  1OXZ A;  8PRN A;  5LP6 E;  4DMV A;  1AJ3 A;  4FJO A;  4O2B E;  3HWB A;  5L4H A;  3POR A;  4H9Q C;  4EZ4 A;  1D1B A;  4DBR A;  4ZZC A;  1G90 A;  4B3S T;  4Z3T A;  2GE4 A;  2X68 A;  2LOS A;  2JQH A;  3RX6 A;  1GFQ A;  5HXS A;  2M6I A;  2HHH T;  3UUB A;  2D0T A;  3UU4 A;  1Y64 B;  5TAO A;  2BDE A;  2YDR A;  2N9D A;  1HXT A;  5FY7 A;  3ZC0 A;  1MMG A;  3K3O A;  2ZM2 A;  4FZL A;  4L9I A;  5AQN B;  3RGL A;  1E1H B;  2J1N A;  2XSB A;  1Q9G A;  5JRC A;  5ABF B;  2B76 A;  2D0U A;  3KVA A;  2W67 A;  3N9L A;  4BAY B;  2KXP A;  4GK0 E;  4QHO A;  5C2T A;  5AQL B;  4X62 T;  1HXU A;  3WAJ A;  1GFM A;  4GHB A;  3RYF E;  3KFW X;  4IRE A;  2XAQ B;  4JBW F;  4EIW A;  1T16 A;  5LYJ E;  2VQE T;  3SYB A;  2X9W A;  3BK9 A;  2ES0 A;  1MM4 A;  4O3Y A;  4AXP A;  2J1D G;  2W00 A;  2K24 A;  4DUY T;  5M4Y A;  1E7P A;  1ZHW A;  4HFB A;  4ZHQ E;  5L47 A;  4U72 A;  2WSS V;  3DA3 A;  4EV6 A;  2X66 A;  4CI3 B;  4HWD A;  2BS3 A;  2UXC T;  5LGT B;  2EHO B;  5J1G A;  1QUU A;  5HEU A;  2C0S A;  3FXE B;  2BBH A;  1FIO A;  1WLX A;  4FSP A;  3QC9 A;  3O4X E;  5E79 O;  5HEJ A;  1IZN B;  1J5E T;  4JI6 T;  2CXF A;  3FZL B;  3FZK B;  3PUR A;  5ADX K;  4B3M T;  4UVB B;  3PGS A;  1MNE A;  5ABH A;  3EI0 A;  2B1E A;  2MHL A;  1N36 T;  2Y6X A;  3CX6 B;  2FJB A;  3CX8 B;  3ETV A;  4IT4 A;  2E9X D;  3C4W A;  3K1S A;  3RIU C;  2CWO A;  4EED A;  4G2A A;  2WU5 A;  1I94 T;  2ERV A;  5HXH A;  3RIU A;  2KZ7 A;  4I50 E;  1P4T A;  4B3R T;  5JDN A;  2AXT O;  2W61 A;  4ILU A;  2JQY A;  4JUY A;  4AQF C;  2NP9 A;  3AAE B;  4FZM A;  4ERR A;  1Q9F A;  4AQF A;  3RIF A;  3ZT5 A;  1JNR A;  5FXV A;  2I59 A;  5AQR B;  4DV0 T;  1GQE A;  2KDY A;  2F4V T;  3EUH A;  4DV4 T;  5FNV E;  2LLY A;  2JQK A;  3AVS A;  4IHJ E;  5FY0 A;  3RYC E;  1MMN A;  2DCF A;  2C5I T;  4K0K T;  3AA6 B;  4DBQ A;  1IBL T;  4YTM A;  4JV5 T;  3EAB A;  3KVB A;  4O4J E;  2BKP A;  2Q9Q B;  2Q9Q D;  3UU8 A;  5FP3 A;  1LKX A;  3AE8 A;  2BG9 E;  2DLR A;  2QGS A;  3EVY A;  2XPK A;  4UB8 O;  2QA7 A;  5LHH B;  4IST A;  2YDQ A;  4UVA B;  3UQ7 A;  4P09 A;  4QXC B;  3LK3 B;  2XE5 A;  2IIU A;  4PUX A;  2VL0 A;  2NTX A;  4JEU B;  2XQ8 A;  4JEH B;  4AI6 A;  4MFR A;  3R84 B;  2DWG A;  3CWZ B;  3Q9D A;  4FI5 A;  2WBL A;  5HEH A;  2N1G A;  3P4Q A;  2VL8 A;  3FBL A;  3QB5 K;  1UCU A;  4LSH A;  2FJA A;  4MHC A;  3CQG B;  2VQF T;  3AA7 B;  2VKO A;  4H63 H;  2NW8 A;  1IAP A;  2Y0K A;  2YU2 A;  4UF0 B;  4IDO A;  2IML A;  4F6R C;  4IIJ E;  4LFB T;  5JTG A;  2R4P A;  4L0R A;  3GA8 A;  1G8X A;  3PUZ F;  3ZMV B;  2KSR A;  1WR0 A;  1YQ3 A;  2YPV A;  3GWH A;  3AA1 B;  2VKH A;  4O4L E;  2WY2 A;  4D5U A;  3MA9 A;  3K3N A;  1W0B A;  3PV0 F;  5F5W A;  5KXJ A;  4JI4 T;  4KR4 A;  4AIS A;  5FY1 A;  4TN7 B;  5AQM B;  4UV8 B;  4YSX A;  1MM5 A;  2OV9 A;  3T24 A;  2LEH A;  4MLK A;  4WBO A;  1QLB A;  4DVD A;  2NW7 A;  4AKG A;  4LSF A;  4YJ3 E;  2H7V C;  1Z8U A;  2V6Y A;  2KIN B;  3V5U A;  5LCY A;  5FXZ A;  5IUX A;  1WFD A;  4H9O C;  4IE6 A;  3KBU A;  4TNV A;  5JDG A;  2XQ4 A;  3O9X A;  3ANW B;  2V7M A;  1BR2 A;  3E08 A;  5FXX A;  2XE2 A;  5D5D A;  1BR4 A;  3QK6 A;  3FBZ A;  2J4U P;  2DNX A;  3UUN A;  5CA1 E;  5KDM C;  4DV7 T;  3AE6 A;  5DL5 A;  3A8Y C;  3ZMT B;  4JI5 T;  3AE4 A;  5JDL A;  3BRY A;  2CE7 A;  2BKO A;  4B6X A;  2BVL A;  2YK0 A;  4ISS A;  2CXL A;  1QSD A;  5LG4 A;  3RYI E;  3VE1 A;  1NEN A;  3QRA A;  5AQS B;  4WYV A;  2Y0L A;  4G76 A;  4TV8 E;  3CK6 A;  3AEE A;  3O1I A;  3AE3 A;  1GFO A;  3G7G A;  4AYE C;  3RRC A;  4UVC B;  3VY8 X;  2OLT A;  4G75 A;  1FMV A;  1MIV A;  3UQ4 A;  4DV6 T;  4JI7 T;  3O1J A;  3HKC E;  3UFG A;  4O3W A;  2LSJ A;  4HKA A;  2LKH A;  4CI2 B;  2WMN A;  2IAK A;  4FRT A;  3C98 B;  2WM9 A;  5GON E;  4ZEY A;  5GTI O;  3GMI A;  2JQ9 A;  1E2A A;  3ZCJ A;  2UU9 T;  4DR7 T;  4C4V B;  2LSG A;  2X67 A;  2YU1 A;  3BS0 A;  5ABF A;  2XMX A;  3RC8 A;  1MPF A;  2LHF A;  1W0A A;  1U5P A;  1G73 A;  4IE0 A;  4O8S A;  2HN2 A;  2WB5 A;  4J2C A;  4AKR B;  4E1T A;  3UFE A;  5J0Z A;  3V8U A;  3SWH A;  3DTO A;  2H3R A;  7PRN A;  4X1K E;  1KFY A;  2XAH B;  2L9Q A;  3PE0 A;  5T5F A;  4LF4 T;  5AQQ B;  4I4T E;  3AEB A;  4TNW A;  4P1N A;  4TZ4 C;  2N2M A;  2LFU A;  4TX5 A;  4PAG A;  4E7Z A;  5JDP A;  4TUY E;  3IBP A;  3D0T A;  3TLS A;  1YKE B;  2NW9 A;  3PQS A;  3KV4 A;  3JTY A;  2IDO B;  1CUN A;  3LK4 2;  2M06 A;  4A56 A;  4KX6 A;  1HX8 A;  4AZL A;  4PK4 A;  1QJ9 A;  2A9U A;  2XUE A;  4HE8 A;  3K3Q C;  4DO0 A;  4PW8 A;  1KNR A;  4G63 A;  1IZN A;  2HH7 A;  4LF8 T;  3GP6 A;  5A1L A;  4O49 A;  2AE9 A;  3BQL A;  3P7I A;  2XQ9 A;  4X65 T;  4FRX A;  4K3B A;  5L3D B;  1KNZ A;  2LHR A;  2C5J A;  4YLH A;  5CGM A;  2AXD S;  2PJQ A;  4YHH T;  1LRZ A;  2QYW A;  3FZM B;  2RP4 A;  2O4V A;  2J4G A;  4TWD A;  5EK2 A;  4K0U A;  4HFI A;  4U2Z A;  2JMM A;  3LJC A;  2SPC A;  4JFB A;  1UX4 A;  2XAJ B;  2XG6 A;  2R89 A;  4N78 D;  5HAX A;  4PNI A;  3AAI A;  1SE7 A;  5JDF A;  4CQI A;  4U31 A;  3CX7 B;  4WBN E;  2FBW A;  3ZST A;  4IE5 A;  3ZYL A;  1KK7 A;  4YFS A;  4E7S A;  4AYD C;  4ILC A;  4GF4 A;  3UU3 A;  3L39 A;  1ZHY A;  4X5T A;  3VE2 A;  2CWY A;  5KAF O;  5LMU T;  4JI0 T;  4LFC T;  5DQV A;  1BH3 A;  4XAX B;  2V7I A;  3WU2 O;  4A97 A;  3AED A;  3ETU A;  2ZLY A;  4QWN B;  1HX1 B;  2ACX A;  4EZH A;  2LHN A;  3JCU O;  3N9O A;  4H9P C;  3W15 B;  1V9D A;  3AA6 A;  4XNK A;  2Q9Q C;  3ZJ1 A;  4LML A;  3VHL A;  3ZN0 B;  1MIW A;  2BS4 A;  4RLB A;  4UB6 O;  2Q9Q A;  3RLF F;  5F3J A;  3A0H O;  3VZW X;  3H3M A;  2XQ7 A;  2XAS B;  2XQ5 A;  2FGR A;  4K3C A;  3EDU A;  3MJX A;  5L2L A;  2KMF A;  3SRZ A;  2R8A A;  3NZP A;  3ZMZ B;  1PRN A;  5IYZ E;  4AKH A;  2X9Y A;  5AQH B;  2XQA A;  5LBQ B;  2R88 A;  2ZM6 T;  3P4P A;  2ZM0 A;  3V5S A;  2JJ9 A;  3HI2 A;  2JMH A;  3OYX A;  3RKO A;  4AIU A;  4O3Z A;  3P4R A;  5J2U E;  4GKK T;  1VCS A;  2W4X A;  5ETW A;  3UUM A;  1S94 A;  5LB7 B;  2YKS A;  5H2F O;  2UXX B;  2BS2 A;  2JMK A;  2ODV A;  2EHO D;  2D2S A;  4O4H E;  5LBM A;  2HPJ A;  3VKH A;  4WNK A;  1XWM A;  1HCI A;  2YOE A;  4EB6 E;  2Y0H A;  4M1P A;  3AA7 A;  2YDS A;  4O2A E;  1BR1 A;  4UIG A;  1BT9 A;  4HEA A;  4UF0 A;  4RJW A;  4PFP A;  2W0G A;  4EOZ B;  3FZH B;  3DZM A;  2I0M A;  2X27 X;  2BG9 B;  2CEA A;  3KV6 A;  3LG7 A;  3WI3 A;  4PJN A;  5AQF B;  5BMV E;  3HOE A;  6PRN A;  2V5D A;  4U33 A;  4AFK A;  4HFC A;  1EZ3 A;  3SY7 A;  5FYM A;  3AXJ B;  4RJX A;  2FJE A;  3PU8 A;  3AA0 A;  1MND A;  4Q25 A;  2FGQ X;  4CI1 B;  5JRE A;  3AA1 A;  5IWA T;  5IYU A;  3N9N A;  3C4X A;  3ZN1 B;  1FMW A;  1D0Z A;  1OED E;  4U74 A;  3K8P C;  2K3W A;  2UUB T;  5AFU K;  2M6B A;  2JQQ A;  3N9Q A;  1DU2 A;  4EYU A;  3L8R A;  3Q2M A;  2DI4 A;  4KHZ F;  4TWF A;  5L3G B;  2XHE B;  3L3P A;  1SUM B;  4ANJ A;  3NZQ A;  4PR7 A;  1UUS A;  3C50 A;  5G38 A;  3RC3 A;  4HGA A;  2XE1 A;  3TZG A;  3CML A;  4BJN A;  4CN6 A;  1PHO A;  3ANW A;  4ZS2 A;  2BBJ A;  3LK4 1;  5FVN A;  3FZF B;  1MIY A;  1FEW A;  2W62 A;  2XZE A;  4KI0 F;  1YQ4 A;  3AE7 A;  3C64 A;  3QOF A;  1SHZ C;  4PFO A;  3F57 A;  3AE2 A;  4QH1 A;  5B66 O;  4FES A;  2VWA A;  2V7K A;  5KMG P;  3UU6 A;  3Q5E A;  4DID B;  3CVR A;  3RHW A;  3AE9 A;  3F31 A;  3DWO X;  4DR2 T;  3FYX A;  4LSE A;  3UUX B;  4AKL A;  3POX A;  5LGU B;  3RKG A;  1YXR A;  2CLY B;  2CXD A;  3G06 A;  1E54 A;  3CKD A;  3HR0 A;  1H7C A;  4V1A v;  2RPA A;  2LM9 A;  3I1A A;  5C3J A;  5DL8 A;  3NKZ A;  2MYS A;  4LF7 T;  1BR0 A;  3L09 A;  4ADZ A;  1UGO A;  4LSI A;  3AAA A;  5HEO A;  1KF6 A;  2CPT A;  2CMR A;  3PUA A;  4U7Y A;  4AYN A;  3KBT A;  2QVA A;  3PQU A;  4O4X A;  1NEK A;  3ZMS B;  3C5O A;  5EK4 A;  3ZC1 A;  3KIN B;  3NVO A;  2A3D A;  2WJQ A;  3N5L A;  3OVU A;  3AE1 A;  4IDP A;  2DWK A;  2P9B A;  4IGU A;  2UXB T;  3P50 A; 
#chains in the Genus database with same CATH homology
 4ZI7 E;  2PRN A;  3BQI A;  3Q5X A;  3UUL A;  5L3E B;  3VKG A;  1OXZ A;  3O1J A;  5EE2 A;  3HKC E;  1ORM A;  8PRN A;  3OYZ A;  3HKD E;  1IJ6 A;  2LSJ A;  3HL6 A;  5LP6 E;  2KT9 A;  4O3W A;  4DMV A;  1D1A A;  4HKA A;  1LVF A;  3RYH E;  4CI2 B;  1AJ3 A;  2N2L A;  4X20 E;  2IC6 A;  2WMN A;  4FJO A;  2IAK A;  4O2B E;  4FRT A;  3HWB A;  3C98 B;  2WM9 A;  5GON E;  3POR A;  4H9Q C;  4EZ4 A;  4AKR A;  1D1B A;  4IDZ A;  1QJP A;  4PJJ A;  2E9X B;  4DBR A;  1G90 A;  2WMO A;  1YKH B;  2W80 C;  3GMI A;  2XQY A;  4Z3T A;  3ZCJ A;  2GE4 A;  2OA5 A;  2X68 A;  2LOS A;  2K9A A;  3RX6 A;  2LSG A;  4C69 X;  1GFQ A;  2X67 A;  2YU1 A;  4O4U A;  5HXS A;  3F2E A;  2D0T A;  1VRB A;  4ZI2 C;  2BVM A;  1Y64 B;  3OJA A;  5TAO A;  5LXT E;  2BDE A;  3RC8 A;  2XMX A;  1WYB A;  2K5B B;  3U78 A;  1MPF A;  2LHF A;  2N9D A;  3UT5 E;  3MK7 C;  1HTJ F;  1U5P A;  5FY7 A;  3ZC0 A;  3ZLI A;  1G73 A;  1HXT A;  2MOZ A;  3PDY A;  4IE0 A;  1MMG A;  4J2C A;  4O8S A;  4AKR B;  3K3O A;  2ZM2 A;  3UFE A;  4C91 A;  3K19 A;  4E1T A;  3V8U A;  3SWH A;  3DTO A;  2KWH A;  4FZL A;  4L9I A;  2H3R A;  1Z0P A;  1QJ8 A;  4X1K E;  7PRN A;  1HF8 A;  2XAH B;  1E1H B;  2J1N A;  4IE7 A;  2L9Q A;  3CQX C;  1Q9G A;  4FMS A;  4GK5 E;  3I9W A;  3PE0 A;  4HFV A;  4DND A;  5C8Y E;  5JRC A;  5T5F A;  2KZ7 B;  5KX5 E;  4I4T E;  3I0Q A;  3IF8 B;  3FB2 A;  4RLC A;  4TZ4 C;  2D0U A;  2N2M A;  1SA0 E;  2LFU A;  4GCQ A;  5CB4 E;  3KVA A;  3N9L A;  4TX5 A;  4BAY B;  2KXP A;  4PAG A;  4E7Z A;  4GK0 E;  4QHO A;  4CXY A;  3EMN X;  5JDP A;  4TUY E;  3IBP A;  4ZI3 D;  1YS5 A;  3D0T A;  1HXU A;  3WAJ A;  1GFM A;  2LOP A;  3FXD B;  3Q5W A;  3RBH A;  4GHB A;  3RYF E;  3KFW X;  1YKE B;  5JRC B;  2NW9 A;  4GOU A;  2W81 C;  3PQS A;  3TKL B;  2KLQ A;  3KV4 A;  2XAQ B;  3JTY A;  2HPL A;  2XTR A;  4EIW A;  3NSG A;  2KXP B;  3SZV A;  2ZMA A;  3H37 A;  1BXW A;  1CUN A;  5LYJ E;  3LK4 2;  4AYM C;  3ONX A;  2M06 A;  3SYB A;  2X9W A;  5JDH A;  3BK9 A;  3HOL A;  2Y2X A;  2ES0 A;  1MM4 A;  5DL6 A;  2K4T A;  4A56 A;  4NUV A;  5H6R B;  4O3Y A;  4AXP A;  2J1D G;  2W00 A;  2K24 A;  1HX8 A;  5M4Y A;  2LSI A;  5LGN B;  4AZL A;  1ZHW A;  3POQ A;  1UX5 A;  1GFP A;  4OHF A;  4ZHQ E;  2MTQ A;  4PK4 A;  1QJ9 A;  5IHY A;  2XUE A;  4FT6 A;  4U72 A;  4HE8 A;  2WSS V;  3HKE E;  3K3Q C;  4PW8 A;  4UEL A;  4DO0 A;  2ZFG A;  2KWI B;  3UAQ A;  4G63 A;  1IZN A;  3DA3 A;  3GN5 A;  2HH7 A;  2X66 A;  4CI3 B;  5HWX A;  1THQ A;  5PRN A;  3NRX A;  3GP6 A;  1HFA A;  5A1L A;  4O49 A;  4I43 B;  2ODU A;  5LGT B;  2EHO B;  4ASK A;  3BQL A;  2POR A;  5J1G A;  4FSO A;  2MBG A;  3P7I A;  1QUU A;  3I9Y A;  4F4B A;  2WAU A;  2C0S A;  3FXE B;  3PUQ A;  4PK5 A;  4XZC A;  1FIO A;  2X0L B;  4FRX A;  5L3D B;  1WLX A;  1KNZ A;  4FSP A;  3QC9 A;  3O4X E;  4AUI A;  1O3X A;  2C5J A;  2LHR A;  4YLH A;  4JLE A;  2PJQ A;  2MNH A;  4H63 V;  1OWA A;  1LRZ A;  2V1D B;  3N9P A;  3R6N A;  5HXR A;  1IZN B;  1US7 B;  2RP4 A;  3GN5 B;  2O4V A;  4X1I E;  2CXF A;  4JCH A;  2X51 A;  3QRC A;  2CM0 A;  2KND A;  5EK2 A;  1LVK A;  3A5X A;  3ZJ2 A;  4BUM X;  4K0U A;  2F1T A;  5H6Q B;  4FUV A;  4ZS3 A;  2JMM A;  2BZB A;  1YD8 G;  2M07 A;  3PUR A;  3IHR A;  4NUU A;  5ADX K;  4UVB B;  3T20 A;  3LJC A;  2SPC A;  1MNE A;  2L3L A;  2Y8D A;  4HTE A;  4JFB A;  1UX4 A;  2XAJ B;  3WI5 A;  2B1E A;  3ZYK A;  2MHL A;  1U4Q A;  3ESL A;  2XG6 A;  2Y7S A;  4N78 D;  5HAX A;  2Y6X A;  3CX6 B;  4PNI A;  3AAI A;  5JDF A;  2NTY A;  1HXX A;  4CQI A;  3CX8 B;  3ETV A;  3FHN A;  1X79 A;  2LJL A;  3CX7 B;  4WBN E;  2ZLD A;  2E9X D;  4IE5 A;  2VAS A;  3ZYL A;  3C4W A;  2CWO A;  2NOX A;  4G2A A;  1KK7 A;  5HXH A;  2ERV A;  2YIN A;  3A2S X;  3E0Z A;  3C51 A;  4YFS A;  4E7S A;  4QQ1 A;  2KZ7 A;  4I50 E;  4AYD C;  3ZEF B;  4PK6 A;  1P4T A;  4GF4 A;  5JDN A;  4FOZ A;  2W61 A;  4ILU A;  1ZHY A;  4KUM B;  4JUY A;  3VE2 A;  2CWY A;  1BH3 A;  5DQV A;  5JDQ A;  1OSM A;  4XAX B;  4AQF C;  2ZM8 A;  2V7I A;  3AA0 B;  3LK2 A;  3VZU X;  2NP9 A;  4AYI D;  3AAE B;  4FZM A;  3N2K E;  3PU3 A;  4ERR A;  1Q9F A;  4AQF A;  2V7J A;  4OYJ A;  4GCS A;  4D64 A;  3ETU A;  2ZLY A;  2YEV C;  3MXZ A;  4QXB B;  4QWN B;  2ACX A;  3SYS A;  4EZH A;  5FXV A;  3UU2 A;  2LHN A;  3T8O A;  2I59 A;  3MKD A;  3N9O A;  4H9P C;  3W15 B;  4GIW A;  1V9D A;  3AA6 A;  4XNK A;  2Q9Q C;  4U9C A;  3ZJ1 A;  4OK0 A;  3RRW A;  3J7Y q;  3VHL A;  3ZN0 B;  4ZI2 D;  2KDY A;  4KBM B;  3QUJ A;  3HKB E;  4QX7 B;  1MIW A;  4GCP A;  3EUH A;  3LK2 B;  4RLB A;  2Q9Q A;  1ZHZ A;  5FNV E;  5F3J A;  4XBF B;  5DQW A;  3VZW X;  3ZCI A;  3J9X 1;  2C5K T;  3AVS A;  4IHJ E;  3S4U A;  2LT3 A;  5FY0 A;  4AKI A;  3RYC E;  1MMN A;  2XAS B;  3LFM A;  5FXW A;  2DCF A;  2C5I T;  2FGR A;  3M65 A;  2LE8 A;  4H9N C;  3AA6 B;  3EDU A;  4X1Y E;  4DBQ A;  4MAL A;  3MJX A;  4UXN B;  2PFV A;  1ZHT A;  5L2L A;  2KMF A;  4BJM A;  4MBQ A;  3SRZ A;  3KVB A;  5G26 A;  2EHO C;  4O4J E;  3ZPO A;  3NZP A;  2D5U A;  3ZMZ B;  1PRN A;  5IYZ E;  4AKH A;  2Q9Q B;  3NRY A;  2X9X A;  2Q9Q D;  5HXE A;  2X9Y A;  5FP3 A;  1LKX A;  2EHO A;  4YHJ A;  2DLR A;  2QGS A;  3EVY A;  5LBQ B;  2LSY A;  2VKD A;  4N59 A;  2ZM0 A;  3V5S A;  5HWY A;  2JJ9 A;  2QA7 A;  2JMH A;  3HI2 A;  3OYX A;  3RKO A;  4O3Z A;  1T98 A;  2KC0 A;  1NAF A;  5LHH B;  5J2U E;  4YJ2 E;  4IST A;  3SY9 A;  4UVA B;  2NWB A;  4P09 A;  4QXC B;  5ETW A;  3UUM A;  1S94 A;  3KDS E;  3LK3 B;  4RL9 A;  2XE5 A;  4PUX A;  3DA4 A;  3ZMU B;  2UXX B;  3DP7 A;  4BA9 A;  2JMK A;  2ODV A;  2EHO D;  2NTX A;  4JEU B;  4JEH B;  5LJN A;  2D2S A;  4O4H E;  5LBM A;  2LSK A;  3LBX A;  5DAB A;  2IW5 B;  4AI6 A;  2HPJ A;  2JPF A;  4ZOL E;  4MFR A;  3R84 B;  3VKH A;  4WNK A;  3CPZ A;  2DWG A;  2XE3 A;  3CWZ B;  1HCI A;  1WYC A;  3Q9D A;  5AFU L;  4OYK A;  4EB6 E;  2Y0H A;  4FI5 A;  4M1P A;  5FMN A;  3SOL A;  2WBL A;  2PG8 A;  4P0A A;  3AA7 A;  4O2A E;  1BR1 A;  3BQK A;  1OPF A;  3AVR A;  4UIG A;  1GFN A;  2N1G A;  4TV9 E;  4UEM A;  1B7T A;  5JDM A;  1BT9 A;  4HEA A;  4UF0 A;  5JQG E;  4RJW A;  3O0E A;  4PFP A;  2W0G A;  4EOZ B;  2VL8 A;  3FBL A;  2YNK A;  3WI4 A;  1UCU A;  2RA1 A;  4LSH A;  3LBX B;  3HW9 A;  2X27 X;  2M67 A;  2CEA A;  3KV6 A;  3LG7 A;  3E22 E;  4PJN A;  3EDV A;  3N2G E;  3WI3 A;  5BMV E;  3HOE A;  6PRN A;  2X9H A;  4MHC A;  3CQG B;  3AA7 B;  4AFK A;  2VKO A;  3JC6 C;  1EZ3 A;  4H63 H;  2NW8 A;  3B13 A;  3SY7 A;  1IAP A;  5DJQ C;  2Y0K A;  3T0S A;  4DMW A;  5FYM A;  3IEE A;  2G0U A;  2YU2 A;  4UF0 B;  3WAK A;  5LNK A;  1D0Y A;  5JH7 E;  4RJX A;  2V7L A;  4F6R C;  2UXN B;  4AKM A;  3MZK B;  2K48 A;  3PU8 A;  1MND A;  4IIJ E;  3AA0 A;  2FGQ X;  4CI1 B;  3AAA B;  5JVD E;  3AAE A;  2CA5 A;  5JRE A;  2VKJ A;  3VY9 X;  2A2F X;  4L0R A;  5L3C B;  3AA1 A;  1ZKE A;  4IE4 A;  3GA8 A;  5DL7 A;  1G8X A;  5IYU A;  3HA4 A;  3ZMV B;  3N9N A;  1HG2 A;  3U3I A;  3C4X A;  4L5G A;  4O4I E;  3ZN1 B;  1FMW A;  1D0Z A;  4U74 A;  3K8P C;  3JC6 D;  2YPV A;  4Z8X A;  5AFU K;  3PUG A;  4EAH A;  5LJM A;  3GWH A;  2JQQ A;  1D1C A;  3N9Q A;  4KP3 C;  4GYS A;  3ZYM A;  3PTR B;  4EYU A;  2VK9 A;  1VOM A;  3Q2M A;  3AA1 B;  2XAG B;  3CQC B;  2DI4 A;  2VKH A;  4O3X B;  4PJL A;  4O4L E;  4D5U A;  1NWM X;  3MA9 A;  3K3N A;  5L3G B;  2OMF A;  2XHE B;  1WRD A;  3L3P A;  2GK9 A;  3RPU A;  1MMA A;  4ZI3 C;  5FY1 A;  4ANJ A;  3NZQ A;  4FZN A;  4KR4 A;  5CA0 E;  3C50 A;  5HXC A;  4CXX A;  3KV5 A;  4TN7 B;  5LA6 E;  3RC3 A;  2F1V A;  4HGA A;  4UV8 B;  1MM5 A;  1IJ5 A;  2XE1 A;  3NBX X;  2Y48 B;  4CXW A;  2H7O A;  3TZG A;  3T24 A;  2LEH A;  3CML A;  4MLK A;  4WBO A;  1ZHC A;  4BJN A;  3POU A;  1H6S 1;  5EZY E;  4QKN A;  1ZV4 X;  4QX8 B;  4HN9 A;  2CCQ A;  3DJB A;  4EXT A;  1PHO A;  4DVD A;  3AB3 B;  3C4Z A;  3ANW A;  2NW7 A;  4XNL A;  4AQG A;  4AKG A;  1D0X A;  2VB6 A;  5L3B B;  4ZS2 A;  4LSF A;  3LK4 1;  4YJ3 E;  5FVN A;  1MIY A;  2H7V C;  1FEW A;  5L3F B;  2K0L A;  3I0O A;  2WWU A;  2W62 A;  3OKQ A;  2KIN B;  3LK3 A;  3V5U A;  3C64 A;  5F8P A;  5LCY A;  5FXZ A;  4H9O C;  4IE6 A;  1SHZ C;  5J2T E;  2CLY C;  3KBU A;  5LHG B;  2PBI A;  4I55 E;  4PFO A;  5JDG A;  2XAF B;  3SS1 A;  3SZD A;  2IC9 A;  3F57 A;  4UV9 B;  3PUS A;  3RH3 A;  4FES A;  3O9X A;  3UPG A;  2VWA A;  1WR6 A;  2A72 A;  2V7K A;  3ANW B;  5E0O A;  2V7M A;  1BR2 A;  3E08 A;  5FXX A;  5KMG P;  3CVR A;  4H9R C;  2XE2 A;  4P0B A;  5D5D A;  1BR4 A;  2L8K A;  4CZZ B;  2XTQ A;  3F31 A;  4QXH B;  3QK6 A;  2JRK A;  3FBZ A;  2J4U P;  2DNX A;  3H3A A;  3UUN A;  2XTL A;  5CA1 E;  5KDM C;  4E1S A;  5ADX L;  3FYX A;  3MAC A;  4LSE A;  4EYY R;  3UUX B;  4AKL A;  3POX A;  5LGU B;  1HG5 A;  2V26 A;  3KVD D;  5DL5 A;  3ZMT B;  3UTK A;  4H9S E;  2CLY B;  2DHR A;  1ZEE A;  4OFZ A;  2CXD A;  2W63 A;  5JDL A;  2CE7 A;  4B6X A;  2N2N A;  5HYA A;  4KMC A;  1E54 A;  3N9M A;  5GV0 A;  2BVL A;  2YK0 A;  3CKD A;  3O1H A;  4ISS A;  1ZHX A;  3HR0 A;  4KR8 A;  1H7C A;  4V1A v;  3VU7 H;  2CXL A;  5JR9 C;  1QSD A;  2LM9 A;  3I1A A;  3P8C D;  5DL8 A;  5LG4 A;  4C90 A;  4KRA A;  2MYS A;  3RYI E;  4WW0 A;  1BR0 A;  3L09 A;  1MMD A;  4ADZ A;  3VE1 A;  4LSI A;  3AAA A;  5JR9 A;  4B61 A;  3PUA A;  2CMR A;  4AYN A;  3KBT A;  2QTK A;  3QRA A;  3VZT X;  3PQU A;  4D65 A;  5EK3 A;  4O4X A;  1S35 A;  3ZMS B;  2ODJ A;  2Y0L A;  4G76 A;  4TV8 E;  3C5O A;  4GYR A;  3N2O A;  1YW0 A;  3O1I A;  5LOV E;  2E8I A;  3B57 A;  2E9X C;  5EK4 A;  3ZC1 A;  1GFO A;  5LHI B;  3G7G A;  4N58 A;  4AYE C;  3KIN B;  2A3D A;  3RRC A;  3N5L A;  3KV9 A;  4PJM A;  4UVC B;  1HS7 A;  2E9X A;  3VY8 X;  4G75 A;  3OBV E;  2DWK A;  2P9B A;  2Z6E A;  5JR9 B;  1FMV A;  1MIV A;  4IGU A;  3PRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...