3AAEB

Crystal structure of actin capping protein in complex with carmil fragment
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
264
structure length
264
Chain Sequence
DQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two distinct mechanisms for the regulation of actin capping protein-competitive or allosteric inhibitions
rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
total genus 80
structure length 264
sequence length 264
chains with identical sequence D, F, H, J
ec nomenclature
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aaeB01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aaeB02
3LK3B 3LK42 5AFUL 2KZ7A 4AKRA 1IZNA 3AA1A 4AKRB 3AA7A 1IZNB 3AAAB 3AAAA 3AA0B 3LK2A 5ADXK 3LK3A 5AFUK 3AAEB 2KZ7B 2KXPB 3LK41 3AA1B 2KXPA 3AA7B 3AA6B 3AA6A 3AA0A 3LK2B 3AAEA 5ADXL
chains in the Genus database with same CATH superfamily
4EEDA 4JEUB 5GONE 3AEGA 4AKRA 2BG9E 4D5UA 3UU2A 2XJ7A 4GF4A 4AI6A 3SY7A 1T72A 1T1LA 5LB7B 5FVNA 4UF0A 4ZXLA 1HNWT 4A5XA 3Q5EA 3EABA 2IAKA 3RC8A 2WP9A 2CXFA 4JI7T 2W81C 4AYID 1SUMB 1AJ3A 2F1VA 1YKEB 4BA9A 1OEDA 2C5JA 2WM9A 3POXA 3UFEA 1OEDC 3UUXB 4DR7T 4HWDA 2ODVA 4ZI3C 5LGUB 1BR0A 4UB6O 2ZMAA 2XTRA 4AKMA 4FESA 4JFBA 3PUYF 2VVNA 2CEAA 1LVKA 3KV5A 4BJMA 2X68A 5AQGB 5FKYA 3UULA 1XWMA 1YQ4A 4TV9E 3EMNX 3L39A 3TKLB 2VQFT 2WZIA 4FZMA 4K3BA 1KFYA 3FHNA 4X62T 1IBKT 4AKHA 3LBXB 1XZYA 1SE7A 2Q9QD 3IHRA 2BKOA 3UUBA 4ISTA 1R8IA 3UFGA 4OYKA 4CN4A 3CX8B 3QNUA 4UB8O 1G90A 1UCUA 5JVDE 2VB6A 2VASA 4UR9A 2BS3A 1T7SA 4P0BA 3RYIE 2CA5A 2JJ9A 3ZJ2A 2KSRA 7PRNA 2QRXA 3E22E 2UU9T 3ZMTB 3N2KE 4KBMB 4FRXA 3PDYA 5GTIO 2XE3A 4OYJA 2LSGA 4EV6A 2UXBT 1MMNA 3PUXF 3AA0A 4DUZT 2YU2A 1XMOT 3KINB 5M4YA 3LG7A 3V5SA 4DR5T 2BKNA 4NXNT 5LGTB 1Z0PA 2F1CX 1B7TA 1XDPA 4LFAT 2KXPB 4U7IA 3F57A 3RIUA 5LCYA 2M6IA 3FZLB 4B3MT 2LKGA 2R89A 2IDOB 4YT0A 4DR6T 2BS4A 3DZMA 3ZMZB 3TZGA 4U7YA 3WI5A 3UU4A 3PURA 4ILCA 3N9OA 2XMXA 3GP6A 3AE3A 3KV9A 3PGRA 2ODUA 2I6HA 1IBLT 5EK3A 2EHOA 4Z91A 3NJTA 4ADZA 5HXCA 2VKHA 2ODJA 1IJ6A 4DMVA 4IE7A 3N2OA 2AXTO 5L3GB 2XQYA 4DV4T 3QB5A 1D0XA 4GCSA 3HW9A 2RPAA 5AQJB 4D64A 4L9IA 5HEJA 2E9XB 3B13A 5LHIB 4X65T 3RF1A 4LF4T 2R4NA 5JRCA 4DBRA 3FB2A 5AFUL 2IIUA 2BVMA 5ABGA 3HKCE 4I50E 2QVAA 5LMUT 3ZLIA 4JI6T 2XAFB 1CHUA 1LKXA 4MALA 2NTXA 4UF0B 2UUAT 3UU3A 3VRBA 4YY3T 4DR3T 4XNLA 1J5WA 3K3NA 2CXLA 2AE9A 4PFOA 2L8KA 3UTKA 1M62A 2A72A 4X1IE 2J4GA 3VZUX 2CMRA 4O3XB 3MACA 3T20A 4X66T 2LJLA 4C00A 3AECA 2R4PA 2K4TA 2ZLDA 4LF9T 3OYZA 4LSFA 4GIWA 3FZKB 6PRNA 2BS2A 4LFCT 5PRNA 4IL6O 4UVBB 5BMVE 4O2BE 2LKHA 3ABVA 5EZYE 2J62A 2UXCT 2LOPA 2N2NA 1XNRT 4G75A 3NZPA 4IDQA 1G8XA 3ZMUB 4DR4T 3HOEA 2J1DG 3UU5A 2W66A 2O4VA 2NOXA 1S94A 2V6YB 3T8OA 2LLYA 4NUVA 2K3WA 4QH4A 3JC6D 3MXZA 2M06A 4DMWA 4Z3TA 2JQ9A 3TLTA 4C90A 4AQYT 3ZN1B 2UXXB 2C5IT 4EB6E 4Z8XA 3L09A 4CN6A 4DBQA 1ZV4X 5TAOA 2CLYC 3SY9A 1ZHWA 1T8BA 4KR8A 4O3WA 2C5KT 4Q25A 4J2CA 1KF6A 2X9KA 3AE4A 2N9DA 4C4VA 1YKHB 3ZYKA 2CPTA 3HWBA 3P50A 3TLVA 3AEDA 2YN6A 4EAHA 4ZI2C 5JDHA 2IWWA 3MK7C 3BQIA 1EZ3A 2CHNA 4I55E 3VR8A 3DTOA 4YTMA 3RRWA 4JCHA 5G38A 3VY9X 3NRYA 3ONLC 2KXPA 3AA7B 2EHOD 2CXDA 5IUXA 5L3DB 2YINA 2LOSA 2XY8B 4IDOA 2Y48B 2E9XA 3B5MA 2XM1A 4AQGA 4LSEA 5LG3A 4IE0A 5LBMA 3PUSA 4LMJA 2W67A 3N9QA 2WSSV 2CCQA 1HX1B 5T5FA 2CM0A 4UV8B 2M07A 5D5DA 2GE4A 5FY0A 2IHR1 3ZN0B 2XTQA 4XBFB 3SZDA 2XQ8A 4EIWA 3CX6B 2D9DA 2XPKA 3WAJA 2QYWA 3ZC1A 2X9XA 2W80C 2KT9A 1N33T 3AA6B 4PJ0O 3LK2B 4YSYA 3LFMA 2D5UA 5CA1E 4H63V 5IHYA 2K48A 1HF8A 3HKEE 5ADXK 1HTJF 5JDMA 3P4PA 2M6BA 4GYRA 3ZT5A 4COFA 2NR4A 1U4QA 2H89A 1X79A 4TV8E 3QRCA 5JDLA 1HXTA 1Q9FA 3EAMA 3POQA 4CXYA 4LF7T 4H63H 3RGLA 3AXJA 5DQWA 1BT9A 2MPKA 4DVDA 1UGOA 2G0UA 4HEAA 1BR1A 5LNKA 3AA1A 4O3ZA 1IAPA 5AQUB 3HI2A 5H6QB 1W09A 3CPZA 3VKGA 3ONJA 5JDGA 4LMKA 3ETUA 3ANWA 2WJQA 4YJ3E 3OYXA 4FMSA 3P4SA 1IJ5A 4HE8A 1N36T 2XQ3A 5HEUA 2MBGA 5FVKA 5F8PA 2RA1A 3QK6A 4LSIA 3RIAA 1YS5A 4CN1A 4AIUA 5BR8T 3O1HA 2WAUA 3CMLA 3H3AA 2VURA 5FXXA 4H9OC 1BR2A 5EK2A 3ESLA 2QA7A 2WWUA 2WDQA 2OMFA 2ZM8A 2HPJA 5LJNA 4RJXA 4AKRB 1OWAA 3AAAB 5HWYA 3K3QC 3KZIO 4U33A 2Y6XA 4PJJA 2YU1A 2KDYA 4GYSA 2J4UP 4DV5T 2W61A 5HXRA 4FQEA 1FMWA 5LMNT 2FGRA 4LF8T 3MZKB 5G3AA 3HA4A 1XNQT 2WBLA 3C4WA 4HFCA 3QB5K 5LG4A 1P4TA 3FXEB 4C91A 5L4EA 4IE6A 3AEEA 4TNVA 3PGSA 3BK9A 4ILAA 5B5EO 3PTRB 5FY1A 4P1NA 4B3RT 1JNZA 2XQ6A 5FL1A 2K5BB 1FIOA 2LE8A 1XMQT 2LHRA 4FJOA 3L3PA 2LFUA 2XASB 2XQ9A 5GTHO 1H7CA 2WMNA 4JBWF 3E0ZA 4G2AA 3BRZA 2PJQA 4A56A 3VRAA 1MNEA 4X5TA 1KK7A 2BG9B 2J47A 2MNHA 1ZHXA 3KVDD 3K1SA 1MIYA 5AQKB 3C51A 2ZLYA 2XQ4A 5L47A 5JDPA 5CGMA 1D1AA 4X1YE 4K3CA 2KLQA 4QH5A 4CI2B 4C4VB 2KWHA 4YXDA 3CWZB 3OPCA 2XM2A 4HWFA 3P4RA 4MHCA 2DI4A 4FSPA 2CE7A 1NENA 5L3FB 3EHZA 1BR4A 3KBUA 1E54A 4N58A 3SYBA 2DHRA 5KMGP 5KX5E 2X0LB 4U9CA 2BVLA 5J0ZA 1ZOYA 2E9XC 2KZ7B 2X9WA 4HWCA 4IDPA 5KDMC 3AE9A 5HXEA 3ZT7A 3P4WA 3LK41 3F2EA 2IC6A 1WYCA 2JQYA 3RLFF 3IF8B 4O4UA 2XHEB 3PU8A 2Y2XA 2JQKA 4WNKA 4PNIA 3RYFE 2V7JA 2N2MA 4O4HE 2PBIA 5CFBA 3T24A 5FMNA 3H37A 4DV6T 2IW5B 3DWOX 1H6S1 1WRDA 4U2ZA 3PGUA 1XDOA 4HFEA 3CQXC 3ZSSA 3KVBA 3GMIA 1ORMA 4KX6A 4PK4A 1YXRA 5C2TA 1QSDA 1HXUA 3AE8A 3VZWX 2X51A 3PQSA 3SYSA 1X9BA 4PFPA 3CIRA 2XTLA 3LK2A 4QXHB 2HH7A 5LXTE 2H7VC 5L3BB 4JI4T 2W63A 1N32T 3RQWA 1UK5A 4YTNA 4TN7B 2WZHA 2KC0A 1YQ3A 4ASKA 5LJMA 4JEHB 1IZNA 4I4TE 3QUJA 2EHOC 1D0YA 4O4XA 3Q9DA 2LRKA 3WI4A 5JDFA 4JI1T 4B61A 3RKOA 1UX5A 3ZMVB 4AYMC 5HEGA 1PRNA 1HG2A 4OFZA 4EZ4A 1SA0E 2W0GA 1KNZA 4D65A 3SWHA 3S4UA 1WR6A 2BKPA 2V1DB 3U3IA 1WR0A 4EZHA 5HYAA 4QH1A 3U78A 2MAWA 3FYXA 5LA6E 5AFUK 1MM4A 2HPLA 3SRZA 5FXZA 1KNPA 4BUMX 3O0EA 3ZEFB 2BDEA 2A2FX 1FJGT 4HWIB 3SFDA 3AE1A 3JCFA 3PRNA 4AYDC 4E7SA 2YK0A 4FZNA 3RYCE 4ZZCA 3PF1A 3M3ZB 5E0OA 4FOZA 3JCUO 3A7MA 2VL8A 5AQNB 2AXDS 1GFMA 3AVSA 4HTEA 2ACZA 2Y0KA 3O1JA 2PRNA 3JAEA 4F4BA 4XAXB 5DL5A 3I9YA 4JI5T 3AA7A 3JC6C 4ZI7E 4AFKA 5JR9C 5KAFO 4M1PA 4I0UA 2WDVA 2YOEA 2B76A 1MM5A 2BBHA 3K8PC 3VY8X 3KBTA 4QWNB 2WU2A 3NBXX 3VE1A 1W0BA 3Q5XA 4U74A 2VQET 4RLBA 2QGSA 3FZHB 1HXXA 3RIUC 4UV9B 3G06A 4LFBT 2IC9A 1KEYA 2ZFGA 4H9NC 2UUBT 5A1LA 1UX4A 5HCMA 2H3RA 2HN1A 4G63A 3RI5A 2H7OA 5IYUA 5JTGA 2XE5A 5AQHB 3OBVE 4X1KE 4EGWA 1GFQA 4E1SA 4WZXA 5AQPB 4HN9A 4KHPT 5JR9B 4ZS2A 3HOLA 4C69X 4EEBA 2W4XA 4K0KT 3VE2A 1I94T 2V5CA 4CXWA 4CZZB 1ZEEA 5LOVE 4O3YA 2YDQA 5E79O 5AQVB 3RX6A 2LT3A 1L0VA 1MPFA 3W15B 5AQMB 2LHFA 4QX7B 4PAGA 2PG8A 4WW0A 4G76A 4L5GA 2ES0A 4ILUA 2BZBA 4KRAA 4B6XA 1M7KA 2KINB 1MMGA 4AXPA 4QXBB 2J1NA 4QHOA 2CWOA 3VZTX 3AA1B 3K19A 4AQFC 5C3JA 2CHOA 4IIJE 3AAEA 3UUMA 5FL0A 3P7IA 1MMAA 2PFVA 2LSJA 2Q9QA 4JI2T 5G39A 2P9BA 3A0BO 5LBQB 4B3ST 1OXZA 2XE2A 4OX9T 4ZEYA 4ZI2D 2R6GF 3BQKA 8PRNA 3AEBA 2DNXA 3ZC0A 5ETWA 5FXWA 2KMFA 2W00A 2XSAA 2WDRA 4YSZA 2LSYA 2KZ7A 4IE5A 3C98B 4I43B 1VCTA 1G73A 1E1HB 1IZNB 4ZI3D 2N1GA 2HN2A 3LDQB 5AQFB 2XAQB 2A9UA 3ZKRA 3ZCIA 3IA3A 2VL0A 4AUIA 4PJLA 4FI5A 3RKGA 3C50A 5HCJA 4DV2T 4FUVA 3RPUA 5AQRB 5CB4E 2XQ7A 1HFAA 3CVRA 3R6NA 1ZHZA 3PUVF 5DL8A 4PK5A 3MJXA 5LHHB 4NXMT 3GN5B 4N75A 4U72A 5ABEA 4HFHA 4HWHA 5LYJE 3P4QA 4ILBA 3R84B 5G26A 3IBPA 2X9HA 4IL9A 2EHOB 1BXWA 2A3DA 2X66A 4OHFA 5F5WA 4GHBA 4N74A 2XUEA 1T16A 3KV6A 5J2TE 1Y01A 3VU7H 3ETVA 4O4LE 3UUNA 3A5XA 5LP6E 1GFNA 4JUYA 1HX8A 4CI1B 3N9LA 2I0MA 1Q9GA 1LRZA 3J9X1 2LM2A 5FVLA 1VCSA 1U5PA 5JDNA 3EDUA 2IMLA 3CX7B 4TUYE 2PTFA 2XG6A 4O2AE 3PE0A 1UURA 3AE2A 3SZVA 3OKQA 3RBHA 3DA4A 3ZCJA 4TZ4C 1QJ8A 5DL7A 4NIQA 5HEOA 4IREA 1ZKEA 3SS1A 3SFEA 1NWMX 2R4OA 2XZEA 2JRKA 4F6RC 5C8YE 2V7KA 1D1BA 1WFDA 4KR4A 5HAXA 2E9XD 3EI0A 4TWDA 3V8UA 1MMDA 3AA6A 2WVPA 2V6XA 2FUPA 2MYSA 3LK42 3I9WA 2R88A 5DQVA 3ZT6A 3N9MA 5DL6A 3ANWB 2R8AA 4BAYB 1WCRA 4HGAA 1T98A 3LK3A 3AE7A 4YLHA 2Y0LA 2BBJA 2LRLA 4ANJA 4O8SA 2V5DA 2WY2A 4IE4A 4RJWA 2LEHA 3NRXA 2NW9A 1WLXA 3A2SX 4JYAT 2YPVA 5DJQC 2OA5A 5AQOB 3GA8A 2K9AA 2V6YA 2FGQX 1NAFA 2LSKA 4X20E 3O4XE 4PK6A 3CQGB 3NVOA 2DCFA 4EXTA 1OSMA 2NWBA 4XNKA 2K0LA 2X67A 5JQGE 2Z6EA 2HHHT 4EYUA 4N59A 2Q9QB 3N5LA 4DV7T 4QXCB 3X1DA 5J1GA 3HR0A 2YNKA 3LSVA 3RYHE 3ZYLA 4H9PC 5FP3A 2W62A 4UXNB 3AAIA 4UELA 1WYBA 3N2GE 1I6ZA 4F8HA 3PUWF 1W0AA 2H88A 4EYYR 5LGNB 5EK4A 5FNVE 2DWKA 4ZS3A 3T1HT 3DP7A 5J2UE 4TX5A 5LHGB 5CJ5A 2RP4A 5L3EB 5JRCB 2XQ5A 4GCPA 5ABFB 1ZHYA 2F1TA 2CLYB 3B57A 2ZM6T 3BRYA 2JIWA 5L4HA 4WYVA 2KWIB 1IBMT 3RQUA 2WQYA 4UIGA 4CI3B 4RLCA 5H2FO 2VKDA 5TISO 3GWHA 2GK9A 3P8CD 4AYNA 4HFIA 3I0OA 2VVSA 4GK5E 3BS0A 3QC9A 3K3OA 3RIFA 1THQA 2E8IA 3PU3A 5HEHA 4DR1T 2UXNB 2ZM2A 4E7ZA 2CBIA 5F3JA 3FZMB 1HS7A 3AE6A 4YHHT 2B1EA 4IL4A 3Q5WA 2NW7A 5KAIO 5HWXA 3Q2MA 3POUA 2KNDA 3CKDA 3O9XA 2NTYA 2NW8A 3HKDE 4MLKA 1E7PA 4DR2T 5ABFA 5JR9A 1CUNA 3QOFA 3C64A 3T1YT 2VWAA 3LBXA 1ZHTA 3EDVA 2MOZA 3CQCB 1FEWA 2D2SA 4LF5T 2E2AA 2BG9C 4KI0F 4LF6T 4L0RA 2BG9A 4GCQA 3UU8A 4YHJA 3J7Yq 3NSGA 1E2AA 3C4XA 2NP9A 3QRAA 3DWNA 4K0UA 3RRCA 3OTOT 5JDQA 2K24A 4PJMA 3EUHA 1US7B 1OEDE 4O49A 3IEEA 1YW0A 2FJEA 3C5OA 3RC3A 4AYEC 4LMLA 4XZCA 2FJBA 4YJ2E 2UUCT 2VK9A 1HCIA 1VRBA 4KHZF 5EE2A 4CTDA 3KV4A 2Q9QC 2E5VA 3ZSTA 1OEDB 2WS3A 4O4IE 4ERRA 3RH3A 2JMMA 1J1JA 4TWHA 3WI3A 5AQIB 3PJAJ 1MIVA 4NPPA 3D0TA 3EVYA 4JI8T 3ZJ1A 4N78D 5B66O 3CK6A 4DNDA 1S35A 2CRBA 2DLRA 2V7IA 4IDNA 2C0SA 2D0TA 2XQAA 3AEAA 1J5ET 1Y64B 3UT5E 1YD8G 4Z90A 3WAKA 1HR0T 2X27X 3VR9A 2V26A 4DIDB 3PUQA 4IT4A 5GV0A 4X64T 2JQQA 3KVAA 3UQ7A 2WU5A 4WBOA 1ZHCA 4AQFA 3UPGA 5ABHA 3NWIA 2PORA 3MA9A 3HL6A 3A0HO 2W2UA 2N2LA 4U31A 4JLEA 4AZLA 5L3CB 2CBJA 3AB3B 3LK3B 2DWGA 2IUBA 4KP3C 3T0SA 3DJBA 1NEKA 3FBLA 5HXHA 4QQ1A 3SOLA 4JI3T 3FBZA 4FSOA 3ZPOA 2ZM0A 4YSXA 4IDZA 3O1IA 2VKJA 4PJNA 3MKDA 1QUUA 2Y7SA 2OLTA 4AKIA 1GQEA 4DUYT 2XE1A 3AXJB 2UXDT 4ZZBA 2X0HA 2ACXA 1QJ9A 4A98A 3TLWA 2JQHA 2I59A 4A97A 5KXJA 2JMKA 2WCAA 4FRTA 3JADA 2FJDA 4HFDA 4YFSA 4V1Av 1BH3A 1PHOA 5IYZE 4H9QC 4HKAA 2X9YA 2ERVA 4TWFA 2V7LA 4UEMA 2JPFA 2FJAA 4IGUA 5FXVA 3WU2O 1O3XA 4DV0T 1OPFA 4PW8A 4IHJE 4GOUA 3OVUA 2MHLA 4U2YA 3UQ4A 3N9PA 2MTQA 5AQLB 4AISA 3VHLA 3AVRA 4ZHQE 3DA3A 1FMVA 2WJRA 4CQIA 2VKOA 5CA0E 1KNRA 3H3MA 2XAHB 3OJAA 3I0QA 4NUUA 3PUGA 3AE5A 3Q5DA 4GKKT 4MBQA 2LHNA 4B3TT 5ADXL 5AQQB 2E5LT 2X0YA 2L3LA 4WBNE 1GFOA 5FYMA 4P09A 4QX8B 3AAAA 4LSHA 2XSBA 2YEVC 3RHWA 4AKLA 1JNRA 3GN5A 4OK0A 2F4VT 2LM9A 3BQLA 2IWVA 4JV5T 3HKBE 1D1CA 2WWVA 3NZQA 3V5UA 2L9QA 3I1AA 4O4JE 4DV1T 3M65A 4DV3T 3PUAA 5DABA 2V8SV 1MNDA 3AAEB 1HNZT 3A8YC 1S5LO 2JMHA 3ZYMA 3F31A 1V9DA 1W9RA 3E08A 3UU6A 2XAGB 3KDSE 2M67A 4FZLA 3PQUA 4U3CA 3LJCA 4JI0T 1GFPA 1N34T 4UVCB 3ONXA 2QTKA 4PR7A 5FY7A 3TLUA 2LSIA 2CWYA 1LVFA 4GK0E 2Y8DA 3FZFB 3UAQA 4HFBA 1UUSA 1MIWA 4P0AA 3G7GA 3JTYA 5L2LA 4KMCA 5H6RB 4KUMB 2Y0HA 4E1TA 4DO0A 2D0UA 4MFRA 3TLSA 3NKZA 2V7MA 4EOZB 5JREA 2OV9A 4YTPA 4AKGA 5JH7E 4TNWA 1QJPA 2YKSA 3JAFA 2DL1A 3AEFA 1VOMA 3VKHA 5AQSB 4H9SE 2SPCA 3FXDB 4H9RC 3PORA 4QKNA 1SHZC 5IWAT 4ZOLE 4BJNA 1HG5A 3PV0F 3PUZF 4RL9A 2YDRA 2XAJB 1ZP0A 4CXXA 4UVAB 1Z8UA 4ISSA 1DU2A 3C4ZA 3AA0B 4PUXA 3ZMSB 1D0ZA 1QLBA 4HFVA 2YDSA 3PJAA 2R4LA 5AQTB 3KFWX 2WB5A 4FT6A 3N9NA 3L8RA 2WMOA 1HNXT 2FBWA 5HXSA 4GKJT
chains in the Genus database with same CATH topology
4H63V 4JEUB 5GONE 5IHYA 4XAXB 4AKRA 2K48A 5DL5A 3I9YA 1HF8A 3AA7A 5JR9A 4D5UA 1CUNA 3UU2A 3HKEE 3C64A 3JC6C 4ZI7E 4AFKA 1HTJF 5JDMA 5ADXK 5JR9C 4GF4A 4AI6A 2VWAA 3SY7A 3LBXA 1ZHTA 4M1PA 5FVNA 3EDVA 4UF0A 1MM5A 2MOZA 3CQCB 3K8PC 3VY8X 3KBTA 1FEWA 2IAKA 4GYRA 2D2SA 3RC8A 2CXFA 2W81C 4QWNB 4AYID 1U4QA 3NBXX 3VE1A 1X79A 1AJ3A 3Q5XA 2F1VA 4TV8E 1YKEB 4L0RA 3QRCA 5JDLA 4U74A 1HXTA 4BA9A 4RLBA 1Q9FA 2QGSA 4GCQA 3POQA 2C5JA 2WM9A 1HXXA 4UV9B 3POXA 3UFEA 3UUXB 4YHJA 3J7Yq 2IC9A 4CXYA 2ODVA 4ZI3C 4H63H 5LGUB 3NSGA 1BR0A 2ZMAA 4H9NC 2ZFGA 5A1LA 2XTRA 4AKMA 1UX4A 3C4XA 2H3RA 2NP9A 5DQWA 3QRAA 4FESA 4JFBA 4G63A 1BT9A 4K0UA 2H7OA 3RRCA 5IYUA 4DVDA 5JDQA 2G0UA 2XE5A 4HEAA 2K24A 4PJMA 3EUHA 3OBVE 4X1KE 1GFQA 1BR1A 2CEAA 1US7B 4E1SA 5LNKA 4HN9A 1LVKA 5JR9B 3AA1A 4ZS2A 4O49A 3IEEA 3HOLA 4C69X 4O3ZA 3KV5A 1IAPA 4BJMA 1YW0A 2X68A 3UULA 3C5OA 3HI2A 5H6QB 3RC3A 4AYEC 4TV9E 3CPZA 4XZCA 3EMNX 3VE2A 3TKLB 3VKGA 5JDGA 4YJ2E 4FZMA 3ETUA 3ANWA 4CXWA 2VK9A 4YJ3E 4CZZB 1HCIA 1VRBA 3OYXA 4FMSA 5EE2A 3FHNA 1ZEEA 5LOVE 3KV4A 2Q9QC 4AKHA 4O3YA 3LBXB 3RX6A 4HE8A 1IJ5A 2LT3A 1MPFA 3W15B 2LHFA 2MBGA 2Q9QD 3IHRA 4QX7B 4O4IE 4PAGA 2PG8A 4ERRA 4WW0A 4G76A 4ISTA 3RH3A 2JMMA 5F8PA 2RA1A 4L5GA 2ES0A 4ILUA 2BZBA 3QK6A 4B6XA 4KRAA 4OYKA 3CX8B 2KINB 3WI3A 4LSIA 1MIVA 3D0TA 3EVYA 1YS5A 1G90A 1MMGA 4AXPA 1UCUA 4QXBB 5JVDE 2J1NA 2VB6A 4QHOA 3ZJ1A 2CWOA 3O1HA 2VASA 4N78D 3AA1B 3VZTX 2WAUA 3CMLA 3H3AA 3K19A 4P0BA 3RYIE 4AQFC 5FXXA 4IIJE 4H9OC 3AAEA 1BR2A 4DNDA 5EK2A 1S35A 2CA5A 3ESLA 2JJ9A 2QA7A 2WWUA 2DLRA 2V7IA 3ZJ2A 2C0SA 3UUMA 2D0TA 2OMFA 2ZM8A 1MMAA 2HPJA 2PFVA 2LSJA 3P7IA 5LJNA 1Y64B 3UT5E 2Q9QA 1YD8G 4AKRB 7PRNA 1OWAA 3AAAB 3E22E 5HWYA 3K3QC 3WAKA 3ZMTB 2Y6XA 3N2KE 4PJJA 2X27X 2P9BA 2YU1A 4KBMB 2KDYA 2V26A 4FRXA 4GYSA 5LBQB 3PDYA 1OXZA 3PUQA 2XE3A 2XE2A 2W61A 2J4UP 4OYJA 2LSGA 5GV0A 5HXRA 4ZI2D 3BQKA 1FMWA 2FGRA 8PRNA 2JQQA 1MMNA 2DNXA 3ZC0A 3MZKB 3KVAA 5ETWA 5FXWA 3AA0A 2KMFA 2W00A 3HA4A 2YU2A 2WBLA 1ZHCA 2LSYA 3C4WA 4WBOA 5LG4A 2KZ7A 4AQFA 3KINB 3C98B 4IE5A 4I43B 5M4YA 3FXEB 1P4TA 3UPGA 1G73A 1E1HB 1IZNB 4C91A 4ZI3D 2N1GA 3LG7A 3V5SA 4IE6A 5LGTB 2PORA 3MA9A 3HL6A 1Z0PA 2XAQB 3BK9A 1B7TA 2N2LA 3ZCIA 2KXPB 3PTRB 5FY1A 4AUIA 3F57A 4JLEA 4PJLA 4FI5A 4AZLA 5L3CB 5LCYA 4BUMX 3AB3B 3LK3B 3C50A 2DWGA 4FUVA 4KP3C 2K5BB 3RPUA 5CB4E 3T0SA 1FIOA 1HFAA 2LE8A 3CVRA 2LHRA 4FJOA 3R6NA 3DJBA 3L3PA 3ZMZB 3FBLA 1ZHZA 5HXHA 4QQ1A 2LFUA 5DL8A 3TZGA 2XASB 3WI5A 4PK5A 3MJXA 3PURA 3SOLA 5LHHB 3FBZA 3GN5B 3N9OA 4U72A 2XMXA 4FSOA 3ZPOA 3GP6A 5LYJE 2ZM0A 3KV9A 1H7CA 4IDZA 2WMNA 3R84B 5G26A 3O1IA 3IBPA 3E0ZA 2X9HA 2VKJA 4G2AA 2PJQA 2ODUA 4PJNA 3MKDA 4A56A 2EHOB 1BXWA 5EK3A 2EHOA 4ADZA 2A3DA 1QUUA 2X66A 4OHFA 5HXCA 2Y7SA 1MNEA 2VKHA 4AKIA 1KK7A 2ODJA 1IJ6A 4DMVA 4GHBA 4IE7A 2XUEA 3N2OA 5L3GB 2MNHA 2XQYA 1ZHXA 3KVDD 3KV6A 5J2TE 1D0XA 3VU7H 2XE1A 3ETVA 4O4LE 3UUNA 3A5XA 1MIYA 5LP6E 1GFNA 3HW9A 4JUYA 4GCSA 4D64A 1HX8A 3C51A 4L9IA 4CI1B 2E9XB 3N9LA 3B13A 2ACXA 2ZLYA 5LHIB 1Q9GA 1QJ9A 1LRZA 3J9X1 5JDPA 2I59A 1U5PA 2JMKA 5JDNA 5JRCA 1D1AA 4X1YE 4DBRA 3EDUA 4FRTA 3FB2A 5AFUL 3CX7B 4TUYE 4V1Av 4YFSA 2KLQA 3LFMA 2BVMA 3HKCE 4I50E 4CI2B 2KWHA 1BH3A 1PHOA 2XG6A 3CWZB 5IYZE 4O2AE 3ZLIA 4H9QC 4HKAA 3PE0A 2X9YA 2ERVA 2V7LA 4UEMA 3SZVA 2XAFB 3OKQA 2JPFA 4IGUA 1LKXA 5FXVA 1O3XA 4MHCA 1OPFA 2DI4A 4MALA 4PW8A 3RBHA 2NTXA 4UF0B 3DA4A 4IHJE 4FSPA 3ZCJA 4GOUA 2CE7A 4TZ4C 5L3FB 2MHLA 1QJ8A 4XNLA 5DL7A 3K3NA 2CXLA 3N9PA 2MTQA 4PFOA 1BR4A 1ZKEA 3KBUA 2L8KA 3VHLA 1E54A 3AVRA 3SS1A 4N58A 4ZHQE 3DA3A 1NWMX 1FMVA 3SYBA 3UTKA 4CQIA 2A72A 2DHRA 5KMGP 2VKOA 5KX5E 2X0LB 4U9CA 2BVLA 2JRKA 5CA0E 4F6RC 4X1IE 3VZUX 5C8YE 2E9XC 2XAHB 2CMRA 2KZ7B 1D1BA 2V7KA 3I0QA 2X9WA 3OJAA 4O3XB 4NUUA 3MACA 5KDMC 5HAXA 4KR4A 3PUGA 2E9XD 5HXEA 3T20A 3LK41 3V8UA 3F2EA 2LJLA 2IC6A 4MBQA 1MMDA 2LHNA 1WYCA 3AA6A 5ADXL 2K4TA 2ZLDA 2MYSA 3LK42 3OYZA 2L3LA 3IF8B 3I9WA 4LSFA 3SY9A 4O4UA 5DQVA 4WBNE 4GIWA 3N9MA 1GFOA 5FYMA 2XHEB 6PRNA 4P09A 5DL6A 3ANWB 5PRNA 4QX8B 3AAAA 3PU8A 4BAYB 4HGAA 4LSHA 2Y2XA 2YEVC 4UVBB 5BMVE 1T98A 3LK3A 4O2BE 4AKLA 4WNKA 4PNIA 3RYFE 4YLHA 5EZYE 2Y0LA 3GN5A 2LOPA 2N2NA 4OK0A 4G75A 2V7JA 2N2MA 3NZPA 4ANJA 4O8SA 2LM9A 1G8XA 4O4HE 2PBIA 3BQLA 3ZMUB 4IE4A 3T24A 5FMNA 3H37A 3HKBE 1D1CA 4RJWA 2LEHA 3NRXA 2IW5B 2NW9A 3HOEA 2J1DG 1WLXA 3NZQA 3V5UA 2L9QA 3I1AA 3A2SX 2O4VA 4O4JE 2YPVA 3M65A 2NOXA 5DJQC 2OA5A 3PUAA 1S94A 5DABA 3GA8A 2K9AA 5AFUK 3T8OA 1H6S1 1MNDA 2FGQX 3AAEB 1WRDA 1NAFA 2LSKA 4NUVA 4X20E 3CQXC 2JMHA 3JC6D 3MXZA 3O4XE 2M06A 4PK6A 3KVBA 3ZYMA 3F31A 3CQGB 1V9DA 3GMIA 1ORMA 3E08A 4DMWA 2DCFA 4EXTA 4PK4A 1OSMA 4Z3TA 2NWBA 2XAGB 1QSDA 1HXUA 4C90A 3KDSE 2K0LA 4XNKA 2X67A 5JQGE 3VZWX 2Z6EA 3ZN1B 2M67A 2X51A 2UXXB 2C5IT 3PQSA 4FZLA 3PQUA 3SYSA 4EB6E 4Z8XA 4PFPA 4EYUA 4N59A 3L09A 2Q9QB 2XTLA 4DBQA 3N5LA 1ZV4X 3LJCA 2CLYC 4QXHB 5TAOA 2HH7A 1GFPA 1ZHWA 3LK2A 4KR8A 4O3WA 2C5KT 4QXCB 5LXTE 2H7VC 3ONXA 4UVCB 5J1GA 3HR0A 5L3BB 2QTKA 5FY7A 2YNKA 4J2CA 2W63A 2N9DA 3RYHE 2LSIA 2CWYA 3ZYLA 4H9PC 1YKHB 3ZYKA 3HWBA 1LVFA 5FP3A 2W62A 4UXNB 4GK0E 3AAIA 4TN7B 2Y8DA 4UELA 4EAHA 1WYBA 3N2GE 4ZI2C 3UAQA 1MIWA 4P0AA 5JDHA 2KC0A 3MK7C 3G7GA 4ASKA 5LJMA 4JEHB 1IZNA 4I4TE 4EYYR 5LGNB 3BQIA 3QUJA 5EK4A 3JTYA 2EHOC 1D0YA 5FNVE 4O4XA 1EZ3A 3Q9DA 5L2LA 5JDFA 2DWKA 3WI4A 3RKOA 4B61A 4I55E 1UX5A 4ZS3A 3ZMVB 4KMCA 4AYMC 3DP7A 5H6RB 4KUMB 2Y0HA 4E1TA 1PRNA 1HG2A 5J2UE 3DTOA 4DO0A 4OFZA 2D0UA 4EZ4A 4MFRA 3RRWA 1SA0E 2V7MA 4TX5A 4JCHA 5LHGB 4EOZB 3VY9X 2W0GA 3NRYA 5JREA 2RP4A 2KXPA 1KNZA 3AA7B 2EHOD 4D65A 3SWHA 2CXDA 3S4UA 5L3DB 5L3EB 5JRCB 2YINA 2LOSA 1WR6A 4GCPA 1ZHYA 4AKGA 2F1TA 2CLYB 2V1DB 3B57A 3U3IA 5JH7E 1QJPA 2Y48B 2E9XA 4AQGA 3VKHA 4EZHA 1VOMA 5HYAA 4LSEA 4IE0A 5LBMA 3U78A 3PUSA 3FYXA 4H9SE 3N9QA 2SPCA 2CCQA 2KWIB 2WSSV 3FXDB 4H9RC 5LA6E 1MM4A 2HPLA 3SRZA 3PORA 4QKNA 5T5FA 5FXZA 1SHZC 4UIGA 2CM0A 4ZOLE 4UV8B 4CI3B 3O0EA 3ZEFB 2BDEA 2VKDA 4RLCA 2A2FX 2M07A 4BJNA 1HG5A 5D5DA 2GE4A 3GWHA 2GK9A 3P8CD 3PRNA 4AYDC 4AYNA 4E7SA 5FY0A 4RL9A 3ZN0B 2YK0A 4FZNA 3I0OA 4GK5E 2XAJB 3RYCE 3QC9A 3K3OA 4UVAB 4CXXA 1THQA 4XBFB 2E8IA 2XTQA 4ISSA 3SZDA 3C4ZA 3PU3A 4EIWA 3CX6B 3AA0B 4PUXA 5E0OA 4RJXA 2UXNB 3ZMSB 2ZM2A 1D0ZA 4E7ZA 5F3JA 4FOZA 3WAJA 4HFVA 3ZC1A 1HS7A 2B1EA 3Q5WA 2X9XA 2NW7A 3KFWX 5HWXA 2VL8A 3Q2MA 3POUA 4FT6A 2KT9A 3N9NA 3CKDA 2KNDA 2NTYA 3AVSA 2NW8A 2WMOA 3AA6B 4HTEA 5HXSA 3O9XA 1GFMA 3HKDE 2Y0KA 3O1JA 4MLKA 2PRNA 3LK2B 2D5UA 2W80C 5CA1E 4F4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LK3 B;  3LK4 2;  5AFU L;  2KZ7 A;  4AKR A;  1IZN A;  3AA1 A;  4AKR B;  3AA7 A;  1IZN B;  3AAA B;  3AAA A;  3AA0 B;  3LK2 A;  5ADX K;  3LK3 A;  5AFU K;  3AAE B;  2KZ7 B;  2KXP B;  3LK4 1;  3AA1 B;  2KXP A;  3AA7 B;  3AA6 B;  3AA6 A;  3AA0 A;  3LK2 B;  3AAE A;  5ADX L; 
#chains in the Genus database with same CATH topology
 4EED A;  4JEU B;  5GON E;  3AEG A;  4AKR A;  2BG9 E;  4D5U A;  3UU2 A;  2XJ7 A;  4GF4 A;  4AI6 A;  3SY7 A;  1T72 A;  1T1L A;  5LB7 B;  5FVN A;  4UF0 A;  4ZXL A;  1HNW T;  4A5X A;  3Q5E A;  3EAB A;  2IAK A;  3RC8 A;  2WP9 A;  2CXF A;  4JI7 T;  2W81 C;  4AYI D;  1SUM B;  1AJ3 A;  2F1V A;  1YKE B;  4BA9 A;  1OED A;  2C5J A;  2WM9 A;  3POX A;  3UFE A;  1OED C;  3UUX B;  4DR7 T;  4HWD A;  2ODV A;  4ZI3 C;  5LGU B;  1BR0 A;  4UB6 O;  2ZMA A;  2XTR A;  4AKM A;  4FES A;  4JFB A;  3PUY F;  2VVN A;  2CEA A;  1LVK A;  3KV5 A;  4BJM A;  2X68 A;  5AQG B;  5FKY A;  3UUL A;  1XWM A;  1YQ4 A;  4TV9 E;  3EMN X;  3L39 A;  3TKL B;  2VQF T;  2WZI A;  4FZM A;  4K3B A;  1KFY A;  3FHN A;  4X62 T;  1IBK T;  4AKH A;  3LBX B;  1XZY A;  1SE7 A;  2Q9Q D;  3IHR A;  2BKO A;  3UUB A;  4IST A;  1R8I A;  3UFG A;  4OYK A;  4CN4 A;  3CX8 B;  3QNU A;  4UB8 O;  1G90 A;  1UCU A;  5JVD E;  2VB6 A;  2VAS A;  4UR9 A;  2BS3 A;  1T7S A;  4P0B A;  3RYI E;  2CA5 A;  2JJ9 A;  3ZJ2 A;  2KSR A;  7PRN A;  2QRX A;  3E22 E;  2UU9 T;  3ZMT B;  3N2K E;  4KBM B;  4FRX A;  3PDY A;  5GTI O;  2XE3 A;  4OYJ A;  2LSG A;  4EV6 A;  2UXB T;  1MMN A;  3PUX F;  3AA0 A;  4DUZ T;  2YU2 A;  1XMO T;  3KIN B;  5M4Y A;  3LG7 A;  3V5S A;  4DR5 T;  2BKN A;  4NXN T;  5LGT B;  1Z0P A;  2F1C X;  1B7T A;  1XDP A;  4LFA T;  2KXP B;  4U7I A;  3F57 A;  3RIU A;  5LCY A;  2M6I A;  3FZL B;  4B3M T;  2LKG A;  2R89 A;  2IDO B;  4YT0 A;  4DR6 T;  2BS4 A;  3DZM A;  3ZMZ B;  3TZG A;  4U7Y A;  3WI5 A;  3UU4 A;  3PUR A;  4ILC A;  3N9O A;  2XMX A;  3GP6 A;  3AE3 A;  3KV9 A;  3PGR A;  2ODU A;  2I6H A;  1IBL T;  5EK3 A;  2EHO A;  4Z91 A;  3NJT A;  4ADZ A;  5HXC A;  2VKH A;  2ODJ A;  1IJ6 A;  4DMV A;  4IE7 A;  3N2O A;  2AXT O;  5L3G B;  2XQY A;  4DV4 T;  3QB5 A;  1D0X A;  4GCS A;  3HW9 A;  2RPA A;  5AQJ B;  4D64 A;  4L9I A;  5HEJ A;  2E9X B;  3B13 A;  5LHI B;  4X65 T;  3RF1 A;  4LF4 T;  2R4N A;  5JRC A;  4DBR A;  3FB2 A;  5AFU L;  2IIU A;  2BVM A;  5ABG A;  3HKC E;  4I50 E;  2QVA A;  5LMU T;  3ZLI A;  4JI6 T;  2XAF B;  1CHU A;  1LKX A;  4MAL A;  2NTX A;  4UF0 B;  2UUA T;  3UU3 A;  3VRB A;  4YY3 T;  4DR3 T;  4XNL A;  1J5W A;  3K3N A;  2CXL A;  2AE9 A;  4PFO A;  2L8K A;  3UTK A;  1M62 A;  2A72 A;  4X1I E;  2J4G A;  3VZU X;  2CMR A;  4O3X B;  3MAC A;  3T20 A;  4X66 T;  2LJL A;  4C00 A;  3AEC A;  2R4P A;  2K4T A;  2ZLD A;  4LF9 T;  3OYZ A;  4LSF A;  4GIW A;  3FZK B;  6PRN A;  2BS2 A;  4LFC T;  5PRN A;  4IL6 O;  4UVB B;  5BMV E;  4O2B E;  2LKH A;  3ABV A;  5EZY E;  2J62 A;  2UXC T;  2LOP A;  2N2N A;  1XNR T;  4G75 A;  3NZP A;  4IDQ A;  1G8X A;  3ZMU B;  4DR4 T;  3HOE A;  2J1D G;  3UU5 A;  2W66 A;  2O4V A;  2NOX A;  1S94 A;  2V6Y B;  3T8O A;  2LLY A;  4NUV A;  2K3W A;  4QH4 A;  3JC6 D;  3MXZ A;  2M06 A;  4DMW A;  4Z3T A;  2JQ9 A;  3TLT A;  4C90 A;  4AQY T;  3ZN1 B;  2UXX B;  2C5I T;  4EB6 E;  4Z8X A;  3L09 A;  4CN6 A;  4DBQ A;  1ZV4 X;  5TAO A;  2CLY C;  3SY9 A;  1ZHW A;  1T8B A;  4KR8 A;  4O3W A;  2C5K T;  4Q25 A;  4J2C A;  1KF6 A;  2X9K A;  3AE4 A;  2N9D A;  4C4V A;  1YKH B;  3ZYK A;  2CPT A;  3HWB A;  3P50 A;  3TLV A;  3AED A;  2YN6 A;  4EAH A;  4ZI2 C;  5JDH A;  2IWW A;  3MK7 C;  3BQI A;  1EZ3 A;  2CHN A;  4I55 E;  3VR8 A;  3DTO A;  4YTM A;  3RRW A;  4JCH A;  5G38 A;  3VY9 X;  3NRY A;  3ONL C;  2KXP A;  3AA7 B;  2EHO D;  2CXD A;  5IUX A;  5L3D B;  2YIN A;  2LOS A;  2XY8 B;  4IDO A;  2Y48 B;  2E9X A;  3B5M A;  2XM1 A;  4AQG A;  4LSE A;  5LG3 A;  4IE0 A;  5LBM A;  3PUS A;  4LMJ A;  2W67 A;  3N9Q A;  2WSS V;  2CCQ A;  1HX1 B;  5T5F A;  2CM0 A;  4UV8 B;  2M07 A;  5D5D A;  2GE4 A;  5FY0 A;  2IHR 1;  3ZN0 B;  2XTQ A;  4XBF B;  3SZD A;  2XQ8 A;  4EIW A;  3CX6 B;  2D9D A;  2XPK A;  3WAJ A;  2QYW A;  3ZC1 A;  2X9X A;  2W80 C;  2KT9 A;  1N33 T;  3AA6 B;  4PJ0 O;  3LK2 B;  4YSY A;  3LFM A;  2D5U A;  5CA1 E;  4H63 V;  5IHY A;  2K48 A;  1HF8 A;  3HKE E;  5ADX K;  1HTJ F;  5JDM A;  3P4P A;  2M6B A;  4GYR A;  3ZT5 A;  4COF A;  2NR4 A;  1U4Q A;  2H89 A;  1X79 A;  4TV8 E;  3QRC A;  5JDL A;  1HXT A;  1Q9F A;  3EAM A;  3POQ A;  4CXY A;  4LF7 T;  4H63 H;  3RGL A;  3AXJ A;  5DQW A;  1BT9 A;  2MPK A;  4DVD A;  1UGO A;  2G0U A;  4HEA A;  1BR1 A;  5LNK A;  3AA1 A;  4O3Z A;  1IAP A;  5AQU B;  3HI2 A;  5H6Q B;  1W09 A;  3CPZ A;  3VKG A;  3ONJ A;  5JDG A;  4LMK A;  3ETU A;  3ANW A;  2WJQ A;  4YJ3 E;  3OYX A;  4FMS A;  3P4S A;  1IJ5 A;  4HE8 A;  1N36 T;  2XQ3 A;  5HEU A;  2MBG A;  5FVK A;  5F8P A;  2RA1 A;  3QK6 A;  4LSI A;  3RIA A;  1YS5 A;  4CN1 A;  4AIU A;  5BR8 T;  3O1H A;  2WAU A;  3CML A;  3H3A A;  2VUR A;  5FXX A;  4H9O C;  1BR2 A;  5EK2 A;  3ESL A;  2QA7 A;  2WWU A;  2WDQ A;  2OMF A;  2ZM8 A;  2HPJ A;  5LJN A;  4RJX A;  4AKR B;  1OWA A;  3AAA B;  5HWY A;  3K3Q C;  3KZI O;  4U33 A;  2Y6X A;  4PJJ A;  2YU1 A;  2KDY A;  4GYS A;  2J4U P;  4DV5 T;  2W61 A;  5HXR A;  4FQE A;  1FMW A;  5LMN T;  2FGR A;  4LF8 T;  3MZK B;  5G3A A;  3HA4 A;  1XNQ T;  2WBL A;  3C4W A;  4HFC A;  3QB5 K;  5LG4 A;  1P4T A;  3FXE B;  4C91 A;  5L4E A;  4IE6 A;  3AEE A;  4TNV A;  3PGS A;  3BK9 A;  4ILA A;  5B5E O;  3PTR B;  5FY1 A;  4P1N A;  4B3R T;  1JNZ A;  2XQ6 A;  5FL1 A;  2K5B B;  1FIO A;  2LE8 A;  1XMQ T;  2LHR A;  4FJO A;  3L3P A;  2LFU A;  2XAS B;  2XQ9 A;  5GTH O;  1H7C A;  2WMN A;  4JBW F;  3E0Z A;  4G2A A;  3BRZ A;  2PJQ A;  4A56 A;  3VRA A;  1MNE A;  4X5T A;  1KK7 A;  2BG9 B;  2J47 A;  2MNH A;  1ZHX A;  3KVD D;  3K1S A;  1MIY A;  5AQK B;  3C51 A;  2ZLY A;  2XQ4 A;  5L47 A;  5JDP A;  5CGM A;  1D1A A;  4X1Y E;  4K3C A;  2KLQ A;  4QH5 A;  4CI2 B;  4C4V B;  2KWH A;  4YXD A;  3CWZ B;  3OPC A;  2XM2 A;  4HWF A;  3P4R A;  4MHC A;  2DI4 A;  4FSP A;  2CE7 A;  1NEN A;  5L3F B;  3EHZ A;  1BR4 A;  3KBU A;  1E54 A;  4N58 A;  3SYB A;  2DHR A;  5KMG P;  5KX5 E;  2X0L B;  4U9C A;  2BVL A;  5J0Z A;  1ZOY A;  2E9X C;  2KZ7 B;  2X9W A;  4HWC A;  4IDP A;  5KDM C;  3AE9 A;  5HXE A;  3ZT7 A;  3P4W A;  3LK4 1;  3F2E A;  2IC6 A;  1WYC A;  2JQY A;  3RLF F;  3IF8 B;  4O4U A;  2XHE B;  3PU8 A;  2Y2X A;  2JQK A;  4WNK A;  4PNI A;  3RYF E;  2V7J A;  2N2M A;  4O4H E;  2PBI A;  5CFB A;  3T24 A;  5FMN A;  3H37 A;  4DV6 T;  2IW5 B;  3DWO X;  1H6S 1;  1WRD A;  4U2Z A;  3PGU A;  1XDO A;  4HFE A;  3CQX C;  3ZSS A;  3KVB A;  3GMI A;  1ORM A;  4KX6 A;  4PK4 A;  1YXR A;  5C2T A;  1QSD A;  1HXU A;  3AE8 A;  3VZW X;  2X51 A;  3PQS A;  3SYS A;  1X9B A;  4PFP A;  3CIR A;  2XTL A;  3LK2 A;  4QXH B;  2HH7 A;  5LXT E;  2H7V C;  5L3B B;  4JI4 T;  2W63 A;  1N32 T;  3RQW A;  1UK5 A;  4YTN A;  4TN7 B;  2WZH A;  2KC0 A;  1YQ3 A;  4ASK A;  5LJM A;  4JEH B;  1IZN A;  4I4T E;  3QUJ A;  2EHO C;  1D0Y A;  4O4X A;  3Q9D A;  2LRK A;  3WI4 A;  5JDF A;  4JI1 T;  4B61 A;  3RKO A;  1UX5 A;  3ZMV B;  4AYM C;  5HEG A;  1PRN A;  1HG2 A;  4OFZ A;  4EZ4 A;  1SA0 E;  2W0G A;  1KNZ A;  4D65 A;  3SWH A;  3S4U A;  1WR6 A;  2BKP A;  2V1D B;  3U3I A;  1WR0 A;  4EZH A;  5HYA A;  4QH1 A;  3U78 A;  2MAW A;  3FYX A;  5LA6 E;  5AFU K;  1MM4 A;  2HPL A;  3SRZ A;  5FXZ A;  1KNP A;  4BUM X;  3O0E A;  3ZEF B;  2BDE A;  2A2F X;  1FJG T;  4HWI B;  3SFD A;  3AE1 A;  3JCF A;  3PRN A;  4AYD C;  4E7S A;  2YK0 A;  4FZN A;  3RYC E;  4ZZC A;  3PF1 A;  3M3Z B;  5E0O A;  4FOZ A;  3JCU O;  3A7M A;  2VL8 A;  5AQN B;  2AXD S;  1GFM A;  3AVS A;  4HTE A;  2ACZ A;  2Y0K A;  3O1J A;  2PRN A;  3JAE A;  4F4B A;  4XAX B;  5DL5 A;  3I9Y A;  4JI5 T;  3AA7 A;  3JC6 C;  4ZI7 E;  4AFK A;  5JR9 C;  5KAF O;  4M1P A;  4I0U A;  2WDV A;  2YOE A;  2B76 A;  1MM5 A;  2BBH A;  3K8P C;  3VY8 X;  3KBT A;  4QWN B;  2WU2 A;  3NBX X;  3VE1 A;  1W0B A;  3Q5X A;  4U74 A;  2VQE T;  4RLB A;  2QGS A;  3FZH B;  1HXX A;  3RIU C;  4UV9 B;  3G06 A;  4LFB T;  2IC9 A;  1KEY A;  2ZFG A;  4H9N C;  2UUB T;  5A1L A;  1UX4 A;  5HCM A;  2H3R A;  2HN1 A;  4G63 A;  3RI5 A;  2H7O A;  5IYU A;  5JTG A;  2XE5 A;  5AQH B;  3OBV E;  4X1K E;  4EGW A;  1GFQ A;  4E1S A;  4WZX A;  5AQP B;  4HN9 A;  4KHP T;  5JR9 B;  4ZS2 A;  3HOL A;  4C69 X;  4EEB A;  2W4X A;  4K0K T;  3VE2 A;  1I94 T;  2V5C A;  4CXW A;  4CZZ B;  1ZEE A;  5LOV E;  4O3Y A;  2YDQ A;  5E79 O;  5AQV B;  3RX6 A;  2LT3 A;  1L0V A;  1MPF A;  3W15 B;  5AQM B;  2LHF A;  4QX7 B;  4PAG A;  2PG8 A;  4WW0 A;  4G76 A;  4L5G A;  2ES0 A;  4ILU A;  2BZB A;  4KRA A;  4B6X A;  1M7K A;  2KIN B;  1MMG A;  4AXP A;  4QXB B;  2J1N A;  4QHO A;  2CWO A;  3VZT X;  3AA1 B;  3K19 A;  4AQF C;  5C3J A;  2CHO A;  4IIJ E;  3AAE A;  3UUM A;  5FL0 A;  3P7I A;  1MMA A;  2PFV A;  2LSJ A;  2Q9Q A;  4JI2 T;  5G39 A;  2P9B A;  3A0B O;  5LBQ B;  4B3S T;  1OXZ A;  2XE2 A;  4OX9 T;  4ZEY A;  4ZI2 D;  2R6G F;  3BQK A;  8PRN A;  3AEB A;  2DNX A;  3ZC0 A;  5ETW A;  5FXW A;  2KMF A;  2W00 A;  2XSA A;  2WDR A;  4YSZ A;  2LSY A;  2KZ7 A;  4IE5 A;  3C98 B;  4I43 B;  1VCT A;  1G73 A;  1E1H B;  1IZN B;  4ZI3 D;  2N1G A;  2HN2 A;  3LDQ B;  5AQF B;  2XAQ B;  2A9U A;  3ZKR A;  3ZCI A;  3IA3 A;  2VL0 A;  4AUI A;  4PJL A;  4FI5 A;  3RKG A;  3C50 A;  5HCJ A;  4DV2 T;  4FUV A;  3RPU A;  5AQR B;  5CB4 E;  2XQ7 A;  1HFA A;  3CVR A;  3R6N A;  1ZHZ A;  3PUV F;  5DL8 A;  4PK5 A;  3MJX A;  5LHH B;  4NXM T;  3GN5 B;  4N75 A;  4U72 A;  5ABE A;  4HFH A;  4HWH A;  5LYJ E;  3P4Q A;  4ILB A;  3R84 B;  5G26 A;  3IBP A;  2X9H A;  4IL9 A;  2EHO B;  1BXW A;  2A3D A;  2X66 A;  4OHF A;  5F5W A;  4GHB A;  4N74 A;  2XUE A;  1T16 A;  3KV6 A;  5J2T E;  1Y01 A;  3VU7 H;  3ETV A;  4O4L E;  3UUN A;  3A5X A;  5LP6 E;  1GFN A;  4JUY A;  1HX8 A;  4CI1 B;  3N9L A;  2I0M A;  1Q9G A;  1LRZ A;  3J9X 1;  2LM2 A;  5FVL A;  1VCS A;  1U5P A;  5JDN A;  3EDU A;  2IML A;  3CX7 B;  4TUY E;  2PTF A;  2XG6 A;  4O2A E;  3PE0 A;  1UUR A;  3AE2 A;  3SZV A;  3OKQ A;  3RBH A;  3DA4 A;  3ZCJ A;  4TZ4 C;  1QJ8 A;  5DL7 A;  4NIQ A;  5HEO A;  4IRE A;  1ZKE A;  3SS1 A;  3SFE A;  1NWM X;  2R4O A;  2XZE A;  2JRK A;  4F6R C;  5C8Y E;  2V7K A;  1D1B A;  1WFD A;  4KR4 A;  5HAX A;  2E9X D;  3EI0 A;  4TWD A;  3V8U A;  1MMD A;  3AA6 A;  2WVP A;  2V6X A;  2FUP A;  2MYS A;  3LK4 2;  3I9W A;  2R88 A;  5DQV A;  3ZT6 A;  3N9M A;  5DL6 A;  3ANW B;  2R8A A;  4BAY B;  1WCR A;  4HGA A;  1T98 A;  3LK3 A;  3AE7 A;  4YLH A;  2Y0L A;  2BBJ A;  2LRL A;  4ANJ A;  4O8S A;  2V5D A;  2WY2 A;  4IE4 A;  4RJW A;  2LEH A;  3NRX A;  2NW9 A;  1WLX A;  3A2S X;  4JYA T;  2YPV A;  5DJQ C;  2OA5 A;  5AQO B;  3GA8 A;  2K9A A;  2V6Y A;  2FGQ X;  1NAF A;  2LSK A;  4X20 E;  3O4X E;  4PK6 A;  3CQG B;  3NVO A;  2DCF A;  4EXT A;  1OSM A;  2NWB A;  4XNK A;  2K0L A;  2X67 A;  5JQG E;  2Z6E A;  2HHH T;  4EYU A;  4N59 A;  2Q9Q B;  3N5L A;  4DV7 T;  4QXC B;  3X1D A;  5J1G A;  3HR0 A;  2YNK A;  3LSV A;  3RYH E;  3ZYL A;  4H9P C;  5FP3 A;  2W62 A;  4UXN B;  3AAI A;  4UEL A;  1WYB A;  3N2G E;  1I6Z A;  4F8H A;  3PUW F;  1W0A A;  2H88 A;  4EYY R;  5LGN B;  5EK4 A;  5FNV E;  2DWK A;  4ZS3 A;  3T1H T;  3DP7 A;  5J2U E;  4TX5 A;  5LHG B;  5CJ5 A;  2RP4 A;  5L3E B;  5JRC B;  2XQ5 A;  4GCP A;  5ABF B;  1ZHY A;  2F1T A;  2CLY B;  3B57 A;  2ZM6 T;  3BRY A;  2JIW A;  5L4H A;  4WYV A;  2KWI B;  1IBM T;  3RQU A;  2WQY A;  4UIG A;  4CI3 B;  4RLC A;  5H2F O;  2VKD A;  5TIS O;  3GWH A;  2GK9 A;  3P8C D;  4AYN A;  4HFI A;  3I0O A;  2VVS A;  4GK5 E;  3BS0 A;  3QC9 A;  3K3O A;  3RIF A;  1THQ A;  2E8I A;  3PU3 A;  5HEH A;  4DR1 T;  2UXN B;  2ZM2 A;  4E7Z A;  2CBI A;  5F3J A;  3FZM B;  1HS7 A;  3AE6 A;  4YHH T;  2B1E A;  4IL4 A;  3Q5W A;  2NW7 A;  5KAI O;  5HWX A;  3Q2M A;  3POU A;  2KND A;  3CKD A;  3O9X A;  2NTY A;  2NW8 A;  3HKD E;  4MLK A;  1E7P A;  4DR2 T;  5ABF A;  5JR9 A;  1CUN A;  3QOF A;  3C64 A;  3T1Y T;  2VWA A;  3LBX A;  1ZHT A;  3EDV A;  2MOZ A;  3CQC B;  1FEW A;  2D2S A;  4LF5 T;  2E2A A;  2BG9 C;  4KI0 F;  4LF6 T;  4L0R A;  2BG9 A;  4GCQ A;  3UU8 A;  4YHJ A;  3J7Y q;  3NSG A;  1E2A A;  3C4X A;  2NP9 A;  3QRA A;  3DWN A;  4K0U A;  3RRC A;  3OTO T;  5JDQ A;  2K24 A;  4PJM A;  3EUH A;  1US7 B;  1OED E;  4O49 A;  3IEE A;  1YW0 A;  2FJE A;  3C5O A;  3RC3 A;  4AYE C;  4LML A;  4XZC A;  2FJB A;  4YJ2 E;  2UUC T;  2VK9 A;  1HCI A;  1VRB A;  4KHZ F;  5EE2 A;  4CTD A;  3KV4 A;  2Q9Q C;  2E5V A;  3ZST A;  1OED B;  2WS3 A;  4O4I E;  4ERR A;  3RH3 A;  2JMM A;  1J1J A;  4TWH A;  3WI3 A;  5AQI B;  3PJA J;  1MIV A;  4NPP A;  3D0T A;  3EVY A;  4JI8 T;  3ZJ1 A;  4N78 D;  5B66 O;  3CK6 A;  4DND A;  1S35 A;  2CRB A;  2DLR A;  2V7I A;  4IDN A;  2C0S A;  2D0T A;  2XQA A;  3AEA A;  1J5E T;  1Y64 B;  3UT5 E;  1YD8 G;  4Z90 A;  3WAK A;  1HR0 T;  2X27 X;  3VR9 A;  2V26 A;  4DID B;  3PUQ A;  4IT4 A;  5GV0 A;  4X64 T;  2JQQ A;  3KVA A;  3UQ7 A;  2WU5 A;  4WBO A;  1ZHC A;  4AQF A;  3UPG A;  5ABH A;  3NWI A;  2POR A;  3MA9 A;  3HL6 A;  3A0H O;  2W2U A;  2N2L A;  4U31 A;  4JLE A;  4AZL A;  5L3C B;  2CBJ A;  3AB3 B;  3LK3 B;  2DWG A;  2IUB A;  4KP3 C;  3T0S A;  3DJB A;  1NEK A;  3FBL A;  5HXH A;  4QQ1 A;  3SOL A;  4JI3 T;  3FBZ A;  4FSO A;  3ZPO A;  2ZM0 A;  4YSX A;  4IDZ A;  3O1I A;  2VKJ A;  4PJN A;  3MKD A;  1QUU A;  2Y7S A;  2OLT A;  4AKI A;  1GQE A;  4DUY T;  2XE1 A;  3AXJ B;  2UXD T;  4ZZB A;  2X0H A;  2ACX A;  1QJ9 A;  4A98 A;  3TLW A;  2JQH A;  2I59 A;  4A97 A;  5KXJ A;  2JMK A;  2WCA A;  4FRT A;  3JAD A;  2FJD A;  4HFD A;  4YFS A;  4V1A v;  1BH3 A;  1PHO A;  5IYZ E;  4H9Q C;  4HKA A;  2X9Y A;  2ERV A;  4TWF A;  2V7L A;  4UEM A;  2JPF A;  2FJA A;  4IGU A;  5FXV A;  3WU2 O;  1O3X A;  4DV0 T;  1OPF A;  4PW8 A;  4IHJ E;  4GOU A;  3OVU A;  2MHL A;  4U2Y A;  3UQ4 A;  3N9P A;  2MTQ A;  5AQL B;  4AIS A;  3VHL A;  3AVR A;  4ZHQ E;  3DA3 A;  1FMV A;  2WJR A;  4CQI A;  2VKO A;  5CA0 E;  1KNR A;  3H3M A;  2XAH B;  3OJA A;  3I0Q A;  4NUU A;  3PUG A;  3AE5 A;  3Q5D A;  4GKK T;  4MBQ A;  2LHN A;  4B3T T;  5ADX L;  5AQQ B;  2E5L T;  2X0Y A;  2L3L A;  4WBN E;  1GFO A;  5FYM A;  4P09 A;  4QX8 B;  3AAA A;  4LSH A;  2XSB A;  2YEV C;  3RHW A;  4AKL A;  1JNR A;  3GN5 A;  4OK0 A;  2F4V T;  2LM9 A;  3BQL A;  2IWV A;  4JV5 T;  3HKB E;  1D1C A;  2WWV A;  3NZQ A;  3V5U A;  2L9Q A;  3I1A A;  4O4J E;  4DV1 T;  3M65 A;  4DV3 T;  3PUA A;  5DAB A;  2V8S V;  1MND A;  3AAE B;  1HNZ T;  3A8Y C;  1S5L O;  2JMH A;  3ZYM A;  3F31 A;  1V9D A;  1W9R A;  3E08 A;  3UU6 A;  2XAG B;  3KDS E;  2M67 A;  4FZL A;  3PQU A;  4U3C A;  3LJC A;  4JI0 T;  1GFP A;  1N34 T;  4UVC B;  3ONX A;  2QTK A;  4PR7 A;  5FY7 A;  3TLU A;  2LSI A;  2CWY A;  1LVF A;  4GK0 E;  2Y8D A;  3FZF B;  3UAQ A;  4HFB A;  1UUS A;  1MIW A;  4P0A A;  3G7G A;  3JTY A;  5L2L A;  4KMC A;  5H6R B;  4KUM B;  2Y0H A;  4E1T A;  4DO0 A;  2D0U A;  4MFR A;  3TLS A;  3NKZ A;  2V7M A;  4EOZ B;  5JRE A;  2OV9 A;  4YTP A;  4AKG A;  5JH7 E;  4TNW A;  1QJP A;  2YKS A;  3JAF A;  2DL1 A;  3AEF A;  1VOM A;  3VKH A;  5AQS B;  4H9S E;  2SPC A;  3FXD B;  4H9R C;  3POR A;  4QKN A;  1SHZ C;  5IWA T;  4ZOL E;  4BJN A;  1HG5 A;  3PV0 F;  3PUZ F;  4RL9 A;  2YDR A;  2XAJ B;  1ZP0 A;  4CXX A;  4UVA B;  1Z8U A;  4ISS A;  1DU2 A;  3C4Z A;  3AA0 B;  4PUX A;  3ZMS B;  1D0Z A;  1QLB A;  4HFV A;  2YDS A;  3PJA A;  2R4L A;  5AQT B;  3KFW X;  2WB5 A;  4FT6 A;  3N9N A;  3L8R A;  2WMO A;  1HNX T;  2FBW A;  5HXS A;  4GKJ T; 
#chains in the Genus database with same CATH homology
 4H63 V;  4JEU B;  5GON E;  5IHY A;  4XAX B;  4AKR A;  2K48 A;  5DL5 A;  3I9Y A;  1HF8 A;  3AA7 A;  5JR9 A;  4D5U A;  1CUN A;  3UU2 A;  3HKE E;  3C64 A;  3JC6 C;  4ZI7 E;  4AFK A;  1HTJ F;  5JDM A;  5ADX K;  5JR9 C;  4GF4 A;  4AI6 A;  2VWA A;  3SY7 A;  3LBX A;  1ZHT A;  4M1P A;  5FVN A;  3EDV A;  4UF0 A;  1MM5 A;  2MOZ A;  3CQC B;  3K8P C;  3VY8 X;  3KBT A;  1FEW A;  2IAK A;  4GYR A;  2D2S A;  3RC8 A;  2CXF A;  2W81 C;  4QWN B;  4AYI D;  1U4Q A;  3NBX X;  3VE1 A;  1X79 A;  1AJ3 A;  3Q5X A;  2F1V A;  4TV8 E;  1YKE B;  4L0R A;  3QRC A;  5JDL A;  4U74 A;  1HXT A;  4BA9 A;  4RLB A;  1Q9F A;  2QGS A;  4GCQ A;  3POQ A;  2C5J A;  2WM9 A;  1HXX A;  4UV9 B;  3POX A;  3UFE A;  3UUX B;  4YHJ A;  3J7Y q;  2IC9 A;  4CXY A;  2ODV A;  4ZI3 C;  4H63 H;  5LGU B;  3NSG A;  1BR0 A;  2ZMA A;  4H9N C;  2ZFG A;  5A1L A;  2XTR A;  4AKM A;  1UX4 A;  3C4X A;  2H3R A;  2NP9 A;  5DQW A;  3QRA A;  4FES A;  4JFB A;  4G63 A;  1BT9 A;  4K0U A;  2H7O A;  3RRC A;  5IYU A;  4DVD A;  5JDQ A;  2G0U A;  2XE5 A;  4HEA A;  2K24 A;  4PJM A;  3EUH A;  3OBV E;  4X1K E;  1GFQ A;  1BR1 A;  2CEA A;  1US7 B;  4E1S A;  5LNK A;  4HN9 A;  1LVK A;  5JR9 B;  3AA1 A;  4ZS2 A;  4O49 A;  3IEE A;  3HOL A;  4C69 X;  4O3Z A;  3KV5 A;  1IAP A;  4BJM A;  1YW0 A;  2X68 A;  3UUL A;  3C5O A;  3HI2 A;  5H6Q B;  3RC3 A;  4AYE C;  4TV9 E;  3CPZ A;  4XZC A;  3EMN X;  3VE2 A;  3TKL B;  3VKG A;  5JDG A;  4YJ2 E;  4FZM A;  3ETU A;  3ANW A;  4CXW A;  2VK9 A;  4YJ3 E;  4CZZ B;  1HCI A;  1VRB A;  3OYX A;  4FMS A;  5EE2 A;  3FHN A;  1ZEE A;  5LOV E;  3KV4 A;  2Q9Q C;  4AKH A;  4O3Y A;  3LBX B;  3RX6 A;  4HE8 A;  1IJ5 A;  2LT3 A;  1MPF A;  3W15 B;  2LHF A;  2MBG A;  2Q9Q D;  3IHR A;  4QX7 B;  4O4I E;  4PAG A;  2PG8 A;  4ERR A;  4WW0 A;  4G76 A;  4IST A;  3RH3 A;  2JMM A;  5F8P A;  2RA1 A;  4L5G A;  2ES0 A;  4ILU A;  2BZB A;  3QK6 A;  4B6X A;  4KRA A;  4OYK A;  3CX8 B;  2KIN B;  3WI3 A;  4LSI A;  1MIV A;  3D0T A;  3EVY A;  1YS5 A;  1G90 A;  1MMG A;  4AXP A;  1UCU A;  4QXB B;  5JVD E;  2J1N A;  2VB6 A;  4QHO A;  3ZJ1 A;  2CWO A;  3O1H A;  2VAS A;  4N78 D;  3AA1 B;  3VZT X;  2WAU A;  3CML A;  3H3A A;  3K19 A;  4P0B A;  3RYI E;  4AQF C;  5FXX A;  4IIJ E;  4H9O C;  3AAE A;  1BR2 A;  4DND A;  5EK2 A;  1S35 A;  2CA5 A;  3ESL A;  2JJ9 A;  2QA7 A;  2WWU A;  2DLR A;  2V7I A;  3ZJ2 A;  2C0S A;  3UUM A;  2D0T A;  2OMF A;  2ZM8 A;  1MMA A;  2HPJ A;  2PFV A;  2LSJ A;  3P7I A;  5LJN A;  1Y64 B;  3UT5 E;  2Q9Q A;  1YD8 G;  4AKR B;  7PRN A;  1OWA A;  3AAA B;  3E22 E;  5HWY A;  3K3Q C;  3WAK A;  3ZMT B;  2Y6X A;  3N2K E;  4PJJ A;  2X27 X;  2P9B A;  2YU1 A;  4KBM B;  2KDY A;  2V26 A;  4FRX A;  4GYS A;  5LBQ B;  3PDY A;  1OXZ A;  3PUQ A;  2XE3 A;  2XE2 A;  2W61 A;  2J4U P;  4OYJ A;  2LSG A;  5GV0 A;  5HXR A;  4ZI2 D;  3BQK A;  1FMW A;  2FGR A;  8PRN A;  2JQQ A;  1MMN A;  2DNX A;  3ZC0 A;  3MZK B;  3KVA A;  5ETW A;  5FXW A;  3AA0 A;  2KMF A;  2W00 A;  3HA4 A;  2YU2 A;  2WBL A;  1ZHC A;  2LSY A;  3C4W A;  4WBO A;  5LG4 A;  2KZ7 A;  4AQF A;  3KIN B;  3C98 B;  4IE5 A;  4I43 B;  5M4Y A;  3FXE B;  1P4T A;  3UPG A;  1G73 A;  1E1H B;  1IZN B;  4C91 A;  4ZI3 D;  2N1G A;  3LG7 A;  3V5S A;  4IE6 A;  5LGT B;  2POR A;  3MA9 A;  3HL6 A;  1Z0P A;  2XAQ B;  3BK9 A;  1B7T A;  2N2L A;  3ZCI A;  2KXP B;  3PTR B;  5FY1 A;  4AUI A;  3F57 A;  4JLE A;  4PJL A;  4FI5 A;  4AZL A;  5L3C B;  5LCY A;  4BUM X;  3AB3 B;  3LK3 B;  3C50 A;  2DWG A;  4FUV A;  4KP3 C;  2K5B B;  3RPU A;  5CB4 E;  3T0S A;  1FIO A;  1HFA A;  2LE8 A;  3CVR A;  2LHR A;  4FJO A;  3R6N A;  3DJB A;  3L3P A;  3ZMZ B;  3FBL A;  1ZHZ A;  5HXH A;  4QQ1 A;  2LFU A;  5DL8 A;  3TZG A;  2XAS B;  3WI5 A;  4PK5 A;  3MJX A;  3PUR A;  3SOL A;  5LHH B;  3FBZ A;  3GN5 B;  3N9O A;  4U72 A;  2XMX A;  4FSO A;  3ZPO A;  3GP6 A;  5LYJ E;  2ZM0 A;  3KV9 A;  1H7C A;  4IDZ A;  2WMN A;  3R84 B;  5G26 A;  3O1I A;  3IBP A;  3E0Z A;  2X9H A;  2VKJ A;  4G2A A;  2PJQ A;  2ODU A;  4PJN A;  3MKD A;  4A56 A;  2EHO B;  1BXW A;  5EK3 A;  2EHO A;  4ADZ A;  2A3D A;  1QUU A;  2X66 A;  4OHF A;  5HXC A;  2Y7S A;  1MNE A;  2VKH A;  4AKI A;  1KK7 A;  2ODJ A;  1IJ6 A;  4DMV A;  4GHB A;  4IE7 A;  2XUE A;  3N2O A;  5L3G B;  2MNH A;  2XQY A;  1ZHX A;  3KVD D;  3KV6 A;  5J2T E;  1D0X A;  3VU7 H;  2XE1 A;  3ETV A;  4O4L E;  3UUN A;  3A5X A;  1MIY A;  5LP6 E;  1GFN A;  3HW9 A;  4JUY A;  4GCS A;  4D64 A;  1HX8 A;  3C51 A;  4L9I A;  4CI1 B;  2E9X B;  3N9L A;  3B13 A;  2ACX A;  2ZLY A;  5LHI B;  1Q9G A;  1QJ9 A;  1LRZ A;  3J9X 1;  5JDP A;  2I59 A;  1U5P A;  2JMK A;  5JDN A;  5JRC A;  1D1A A;  4X1Y E;  4DBR A;  3EDU A;  4FRT A;  3FB2 A;  5AFU L;  3CX7 B;  4TUY E;  4V1A v;  4YFS A;  2KLQ A;  3LFM A;  2BVM A;  3HKC E;  4I50 E;  4CI2 B;  2KWH A;  1BH3 A;  1PHO A;  2XG6 A;  3CWZ B;  5IYZ E;  4O2A E;  3ZLI A;  4H9Q C;  4HKA A;  3PE0 A;  2X9Y A;  2ERV A;  2V7L A;  4UEM A;  3SZV A;  2XAF B;  3OKQ A;  2JPF A;  4IGU A;  1LKX A;  5FXV A;  1O3X A;  4MHC A;  1OPF A;  2DI4 A;  4MAL A;  4PW8 A;  3RBH A;  2NTX A;  4UF0 B;  3DA4 A;  4IHJ E;  4FSP A;  3ZCJ A;  4GOU A;  2CE7 A;  4TZ4 C;  5L3F B;  2MHL A;  1QJ8 A;  4XNL A;  5DL7 A;  3K3N A;  2CXL A;  3N9P A;  2MTQ A;  4PFO A;  1BR4 A;  1ZKE A;  3KBU A;  2L8K A;  3VHL A;  1E54 A;  3AVR A;  3SS1 A;  4N58 A;  4ZHQ E;  3DA3 A;  1NWM X;  1FMV A;  3SYB A;  3UTK A;  4CQI A;  2A72 A;  2DHR A;  5KMG P;  2VKO A;  5KX5 E;  2X0L B;  4U9C A;  2BVL A;  2JRK A;  5CA0 E;  4F6R C;  4X1I E;  3VZU X;  5C8Y E;  2E9X C;  2XAH B;  2CMR A;  2KZ7 B;  1D1B A;  2V7K A;  3I0Q A;  2X9W A;  3OJA A;  4O3X B;  4NUU A;  3MAC A;  5KDM C;  5HAX A;  4KR4 A;  3PUG A;  2E9X D;  5HXE A;  3T20 A;  3LK4 1;  3V8U A;  3F2E A;  2LJL A;  2IC6 A;  4MBQ A;  1MMD A;  2LHN A;  1WYC A;  3AA6 A;  5ADX L;  2K4T A;  2ZLD A;  2MYS A;  3LK4 2;  3OYZ A;  2L3L A;  3IF8 B;  3I9W A;  4LSF A;  3SY9 A;  4O4U A;  5DQV A;  4WBN E;  4GIW A;  3N9M A;  1GFO A;  5FYM A;  2XHE B;  6PRN A;  4P09 A;  5DL6 A;  3ANW B;  5PRN A;  4QX8 B;  3AAA A;  3PU8 A;  4BAY B;  4HGA A;  4LSH A;  2Y2X A;  2YEV C;  4UVB B;  5BMV E;  1T98 A;  3LK3 A;  4O2B E;  4AKL A;  4WNK A;  4PNI A;  3RYF E;  4YLH A;  5EZY E;  2Y0L A;  3GN5 A;  2LOP A;  2N2N A;  4OK0 A;  4G75 A;  2V7J A;  2N2M A;  3NZP A;  4ANJ A;  4O8S A;  2LM9 A;  1G8X A;  4O4H E;  2PBI A;  3BQL A;  3ZMU B;  4IE4 A;  3T24 A;  5FMN A;  3H37 A;  3HKB E;  1D1C A;  4RJW A;  2LEH A;  3NRX A;  2IW5 B;  2NW9 A;  3HOE A;  2J1D G;  1WLX A;  3NZQ A;  3V5U A;  2L9Q A;  3I1A A;  3A2S X;  2O4V A;  4O4J E;  2YPV A;  3M65 A;  2NOX A;  5DJQ C;  2OA5 A;  3PUA A;  1S94 A;  5DAB A;  3GA8 A;  2K9A A;  5AFU K;  3T8O A;  1H6S 1;  1MND A;  2FGQ X;  3AAE B;  1WRD A;  1NAF A;  2LSK A;  4NUV A;  4X20 E;  3CQX C;  2JMH A;  3JC6 D;  3MXZ A;  3O4X E;  2M06 A;  4PK6 A;  3KVB A;  3ZYM A;  3F31 A;  3CQG B;  1V9D A;  3GMI A;  1ORM A;  3E08 A;  4DMW A;  2DCF A;  4EXT A;  4PK4 A;  1OSM A;  4Z3T A;  2NWB A;  2XAG B;  1QSD A;  1HXU A;  4C90 A;  3KDS E;  2K0L A;  4XNK A;  2X67 A;  5JQG E;  3VZW X;  2Z6E A;  3ZN1 B;  2M67 A;  2X51 A;  2UXX B;  2C5I T;  3PQS A;  4FZL A;  3PQU A;  3SYS A;  4EB6 E;  4Z8X A;  4PFP A;  4EYU A;  4N59 A;  3L09 A;  2Q9Q B;  2XTL A;  4DBQ A;  3N5L A;  1ZV4 X;  3LJC A;  2CLY C;  4QXH B;  5TAO A;  2HH7 A;  1GFP A;  1ZHW A;  3LK2 A;  4KR8 A;  4O3W A;  2C5K T;  4QXC B;  5LXT E;  2H7V C;  3ONX A;  4UVC B;  5J1G A;  3HR0 A;  5L3B B;  2QTK A;  5FY7 A;  2YNK A;  4J2C A;  2W63 A;  2N9D A;  3RYH E;  2LSI A;  2CWY A;  3ZYL A;  4H9P C;  1YKH B;  3ZYK A;  3HWB A;  1LVF A;  5FP3 A;  2W62 A;  4UXN B;  4GK0 E;  3AAI A;  4TN7 B;  2Y8D A;  4UEL A;  4EAH A;  1WYB A;  3N2G E;  4ZI2 C;  3UAQ A;  1MIW A;  4P0A A;  5JDH A;  2KC0 A;  3MK7 C;  3G7G A;  4ASK A;  5LJM A;  4JEH B;  1IZN A;  4I4T E;  4EYY R;  5LGN B;  3BQI A;  3QUJ A;  5EK4 A;  3JTY A;  2EHO C;  1D0Y A;  5FNV E;  4O4X A;  1EZ3 A;  3Q9D A;  5L2L A;  5JDF A;  2DWK A;  3WI4 A;  3RKO A;  4B61 A;  4I55 E;  1UX5 A;  4ZS3 A;  3ZMV B;  4KMC A;  4AYM C;  3DP7 A;  5H6R B;  4KUM B;  2Y0H A;  4E1T A;  1PRN A;  1HG2 A;  5J2U E;  3DTO A;  4DO0 A;  4OFZ A;  2D0U A;  4EZ4 A;  4MFR A;  3RRW A;  1SA0 E;  2V7M A;  4TX5 A;  4JCH A;  5LHG B;  4EOZ B;  3VY9 X;  2W0G A;  3NRY A;  5JRE A;  2RP4 A;  2KXP A;  1KNZ A;  3AA7 B;  2EHO D;  4D65 A;  3SWH A;  2CXD A;  3S4U A;  5L3D B;  5L3E B;  5JRC B;  2YIN A;  2LOS A;  1WR6 A;  4GCP A;  1ZHY A;  4AKG A;  2F1T A;  2CLY B;  2V1D B;  3B57 A;  3U3I A;  5JH7 E;  1QJP A;  2Y48 B;  2E9X A;  4AQG A;  3VKH A;  4EZH A;  1VOM A;  5HYA A;  4LSE A;  4IE0 A;  5LBM A;  3U78 A;  3PUS A;  3FYX A;  4H9S E;  3N9Q A;  2SPC A;  2CCQ A;  2KWI B;  2WSS V;  3FXD B;  4H9R C;  5LA6 E;  1MM4 A;  2HPL A;  3SRZ A;  3POR A;  4QKN A;  5T5F A;  5FXZ A;  1SHZ C;  4UIG A;  2CM0 A;  4ZOL E;  4UV8 B;  4CI3 B;  3O0E A;  3ZEF B;  2BDE A;  2VKD A;  4RLC A;  2A2F X;  2M07 A;  4BJN A;  1HG5 A;  5D5D A;  2GE4 A;  3GWH A;  2GK9 A;  3P8C D;  3PRN A;  4AYD C;  4AYN A;  4E7S A;  5FY0 A;  4RL9 A;  3ZN0 B;  2YK0 A;  4FZN A;  3I0O A;  4GK5 E;  2XAJ B;  3RYC E;  3QC9 A;  3K3O A;  4UVA B;  4CXX A;  1THQ A;  4XBF B;  2E8I A;  2XTQ A;  4ISS A;  3SZD A;  3C4Z A;  3PU3 A;  4EIW A;  3CX6 B;  3AA0 B;  4PUX A;  5E0O A;  4RJX A;  2UXN B;  3ZMS B;  2ZM2 A;  1D0Z A;  4E7Z A;  5F3J A;  4FOZ A;  3WAJ A;  4HFV A;  3ZC1 A;  1HS7 A;  2B1E A;  3Q5W A;  2X9X A;  2NW7 A;  3KFW X;  5HWX A;  2VL8 A;  3Q2M A;  3POU A;  4FT6 A;  2KT9 A;  3N9N A;  3CKD A;  2KND A;  2NTY A;  3AVS A;  2NW8 A;  2WMO A;  3AA6 B;  4HTE A;  5HXS A;  3O9X A;  1GFM A;  3HKD E;  2Y0K A;  3O1J A;  4MLK A;  2PRN A;  3LK2 B;  2D5U A;  2W80 C;  5CA1 E;  4F4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...