2ERVA

Crystal structure of the outer membrane enzyme pagl
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
ADVSAAVGATGQSGMTYRLGLSWDWDKSWWQTSTGRLTGYWDAGYTYWEGGDEGAGKHSLSFAPVFVYEFAGDSIKPFIEAGIGVAAFSGTRVGDQNLGSSLNFEDRIGAGLKFANGQSVGVRAIHYSNAGLKQPNDGIESYSLFYKIPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords hypothetical protein Paer03002360
publication title Crystal structure and catalytic mechanism of the LPS 3-O-deacylase PagL from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 36
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature ec 3.1.1.77: Acyloxyacyl hydrolase.
pdb deposition date 2005-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09411 PagL Lipid A 3-O-deacylase (PagL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2ervA00
2MHLA 2JMMA 2ERVA 1ORMA 3C5OA 2MNHA 1G90A 2F1VA 4RLCA 3GP6A 2F1TA 2X27X 2N2MA 1THQA 1QJ9A 1BXWA 2N2LA 1Q9GA 3QRCA 1QJ8A 2LHFA 2M07A 1P4TA 3G7GA 2M06A 1QJPA 4PUXA 1MM5A 1MM4A 1Q9FA 2GE4A 3QRAA 2K0LA
chains in the Genus database with same CATH superfamily
3JCUO 4FRTA 1S5LO 1HXUA 1BT9A 4O3XB 2MNHA 4XNKA 4FT6A 3SY9A 2F1VA 5AFUL 3KZIO 4O3WA 4BUMX 2R4PA 1G90A 3LK3B 2AXTO 2ODJA 4GHBA 1IZNA 4FZMA 4O4XA 4AKMA 2R88A 3LK2A 3LK2B 4K3BA 2OMFA 3AA0A 2F1CX 2X27X 3SZDA 1OPFA 4GCPA 4KRAA 5GV0A 2XTQA 4N74A 3VZUX 4AKRA 2K4TA 4LSEA 1BXWA 2WJRA 4LSFA 4PR7A 2YPVA 3QRCA 2XE3A 4QQ1A 2PRNA 2XMXA 2FGRA 2M07A 2QTKA 2XE5A 3DZMA 3NSGA 5KAIO 3SY7A 2XG6A 1QJPA 2PORA 3AAEB 4UB6O 3VY9X 1MM5A 3WU2O 4RJWA 3DA3A 2KXPB 3AAAA 1ZHXA 2WVPA 3WI4A 2O4VA 4AYNA 5TISO 1BH3A 1GFPA 4FUVA 4GCQA 2J1NA 8PRNA 3O0EA 3C5OA 4FOZA 1T16A 5AFUK 5H2FO 3RBHA 2IWWA 3HW9A 5B5EO 1ZHTA 2R89A 3GP6A 2KZ7A 1IZNB 2F1TA 2KC0A 2ZFGA 4RJXA 1PRNA 3EMNX 5D5DA 3AA1A 3AA0B 4O3YA 3PQUA 5G39A 4AZLA 2W80C 4C69X 3JTYA 3V8UA 4AKRB 2R4LA 4CTDA 3A0HO 3K19A 4G75A 3SYSA 4AYID 3UAQA 1HXXA 3T24A 1QJ8A 3VZTX 1P4TA 2J4UP 3VE2A 2M06A 3FYXA 4FSPA 4RL9A 4FZNA 5G26A 1MPFA 1GFNA 3T0SA 5DL7A 3AAAB 5G38A 3DWNA 4AUIA 2W81C 4LSHA 2JMMA 4FESA 3PRNA 4B61A 3HWBA 3UU2A 2XTRA 2FGQX 3AA6A 4C4VA 3POUA 4K3CA 4PJ0O 4C4VB 2Y0LA 1PHOA 4RLCA 5EE2A 2Y0KA 5JDPA 4FRXA 2IWVA 4GCSA 2ZLDA 2KZ7B 1ZHWA 2R8AA 3A2SX 2KDYA 1OSMA 4E1TA 3AA1B 1THQA 3UPGA 1QJ9A 2WJQA 1H6S1 5PRNA 3POXA 4AYMC 5GTHO 4G76A 3VY8X 3BRZA 1ZHZA 4XNLA 2N2LA 1ZHYA 3LK41 1Q9GA 4U9CA 5DL5A 2R4OA 3PGSA 5T5FA 3VE1A 3NJTA 2LHFA 4IL6O 2XE2A 3AA7A 2Y2XA 3BRYA 4C00A 5KAFO 4FSOA 4O49A 4O4UA 2YNKA 3PQSA 4N59A 4E1SA 2Y0HA 4KR8A 3DA4A 3SYBA 4O3ZA 3PF1A 4N75A 1YS5A 3QRAA 2K0LA 2MHLA 2ERVA 2XE1A 4AYDC 1ORMA 4GF4A 4N58A 5FVNA 4AYEC 4LSIA 4F4BA 3TZGA 3LK3A 5ADXL 2Y7SA 6PRNA 3AA6B 1HXTA 2JQYA 3POQA 4FMSA 2LFUA 4FZLA 4JCHA 4D64A 4Z3TA 7PRNA 3VZWX 3PORA 3HOLA 3T20A 2N2MA 3HOEA 5E79O 1GFOA 3KVDD 4JFBA 4RLBA 4FQEA 5IYUA 1GFQA 4KR4A 4D5UA 3PGRA 3PGUA 3A0BO 5DL6A 1T1LA 5B66O 3DWOX 3AAEA 3G7GA 4UB8O 5GTIO 3AA7B 4PUXA 4AFKA 2KXPA 3BS0A 5DL8A 1MM4A 2R4NA 2X9KA 1E54A 3WI5A 4D65A 1GFMA 1Q9FA 5G3AA 2GE4A 5ADXK 3LK42 3SZVA
chains in the Genus database with same CATH topology
4FRTA 1HXUA 1BT9A 4O3XB 2MNHA 4XNKA 4FT6A 3SY9A 2F1VA 5AFUL 4BUMX 4O3WA 5ADXK 1G90A 3LK3B 4O4XA 2ODJA 4GHBA 1IZNA 4FZMA 4AKMA 3LK2A 3LK2B 2OMFA 3AA0A 2X27X 3SZDA 1OPFA 4GCPA 4KRAA 5GV0A 2XTQA 3VZUX 4AKRA 2K4TA 4LSEA 1BXWA 4LSFA 2YPVA 3QRCA 2XE3A 4QQ1A 2PRNA 2XMXA 2FGRA 2M07A 2QTKA 2XE5A 3NSGA 3SY7A 2XG6A 1QJPA 2PORA 3AAEB 3VY9X 1MM5A 4RJWA 3DA3A 2KXPB 3AAAA 1ZHXA 3WI4A 2O4VA 4AYNA 1BH3A 1GFPA 4FUVA 4GCQA 2J1NA 8PRNA 3O0EA 3C5OA 4FOZA 5AFUK 3RBHA 3HW9A 1ZHTA 3GP6A 2KZ7A 1IZNB 2F1TA 2KC0A 2ZFGA 4RJXA 1PRNA 3EMNX 5D5DA 3AA1A 3AA0B 4O3YA 3PQUA 4C69X 3T20A 2W80C 3JTYA 3V8UA 4AKRB 3K19A 4G75A 3SYSA 4AYID 3UAQA 1HXXA 3T24A 1QJ8A 3VZTX 1P4TA 2J4UP 3VE2A 2M06A 3FYXA 4FSPA 4RL9A 4FZNA 5G26A 1MPFA 1GFNA 3T0SA 5DL7A 3AAAB 4AUIA 2W81C 4LSHA 2JMMA 4FESA 3PRNA 4B61A 3HWBA 3UU2A 2XTRA 2FGQX 3AA6A 3POUA 2Y0LA 1PHOA 4RLCA 5EE2A 2Y0KA 5JDPA 4FRXA 4GCSA 2ZLDA 2KZ7B 1ZHWA 3A2SX 2KDYA 1OSMA 3AA1B 1THQA 3UPGA 1QJ9A 5PRNA 1H6S1 3POXA 4AYMC 4G76A 3VY8X 1ZHZA 4XNLA 2N2LA 1ZHYA 3LK41 1Q9GA 4U9CA 5DL5A 5T5FA 4AZLA 4E1TA 3VE1A 2LHFA 2XE2A 3AA7A 2Y2XA 4FSOA 4O49A 4O4UA 2YNKA 3PQSA 4N59A 4E1SA 2Y0HA 4KR8A 3DA4A 3SYBA 4O3ZA 1YS5A 3QRAA 2K0LA 2MHLA 2ERVA 2XE1A 4AYDC 1ORMA 4GF4A 4N58A 5FVNA 4AYEC 4LSIA 4F4BA 3TZGA 3LK3A 5ADXL 2Y7SA 6PRNA 3AA6B 1HXTA 3POQA 4FMSA 4FZLA 2LFUA 4JCHA 4D64A 7PRNA 4Z3TA 3VZWX 3PORA 3HOLA 2N2MA 3HOEA 1GFOA 3KVDD 4JFBA 4RLBA 5IYUA 1GFQA 4KR4A 4D5UA 5DL6A 3AAEA 3G7GA 3AA7B 4PUXA 4AFKA 2KXPA 5DL8A 1MM4A 3WI5A 1E54A 4D65A 1GFMA 1Q9FA 2GE4A 3LK42 3SZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MHL A;  2JMM A;  2ERV A;  1ORM A;  3C5O A;  2MNH A;  1G90 A;  2F1V A;  4RLC A;  3GP6 A;  2F1T A;  2X27 X;  2N2M A;  1THQ A;  1QJ9 A;  1BXW A;  2N2L A;  1Q9G A;  3QRC A;  1QJ8 A;  2LHF A;  2M07 A;  1P4T A;  3G7G A;  2M06 A;  1QJP A;  4PUX A;  1MM5 A;  1MM4 A;  1Q9F A;  2GE4 A;  3QRA A;  2K0L A; 
#chains in the Genus database with same CATH topology
 3JCU O;  4FRT A;  1S5L O;  1HXU A;  1BT9 A;  4O3X B;  2MNH A;  4XNK A;  4FT6 A;  3SY9 A;  2F1V A;  5AFU L;  3KZI O;  4O3W A;  4BUM X;  2R4P A;  1G90 A;  3LK3 B;  2AXT O;  2ODJ A;  4GHB A;  1IZN A;  4FZM A;  4O4X A;  4AKM A;  2R88 A;  3LK2 A;  3LK2 B;  4K3B A;  2OMF A;  3AA0 A;  2F1C X;  2X27 X;  3SZD A;  1OPF A;  4GCP A;  4KRA A;  5GV0 A;  2XTQ A;  4N74 A;  3VZU X;  4AKR A;  2K4T A;  4LSE A;  1BXW A;  2WJR A;  4LSF A;  4PR7 A;  2YPV A;  3QRC A;  2XE3 A;  4QQ1 A;  2PRN A;  2XMX A;  2FGR A;  2M07 A;  2QTK A;  2XE5 A;  3DZM A;  3NSG A;  5KAI O;  3SY7 A;  2XG6 A;  1QJP A;  2POR A;  3AAE B;  4UB6 O;  3VY9 X;  1MM5 A;  3WU2 O;  4RJW A;  3DA3 A;  2KXP B;  3AAA A;  1ZHX A;  2WVP A;  3WI4 A;  2O4V A;  4AYN A;  5TIS O;  1BH3 A;  1GFP A;  4FUV A;  4GCQ A;  2J1N A;  8PRN A;  3O0E A;  3C5O A;  4FOZ A;  1T16 A;  5AFU K;  5H2F O;  3RBH A;  2IWW A;  3HW9 A;  5B5E O;  1ZHT A;  2R89 A;  3GP6 A;  2KZ7 A;  1IZN B;  2F1T A;  2KC0 A;  2ZFG A;  4RJX A;  1PRN A;  3EMN X;  5D5D A;  3AA1 A;  3AA0 B;  4O3Y A;  3PQU A;  5G39 A;  4AZL A;  2W80 C;  4C69 X;  3JTY A;  3V8U A;  4AKR B;  2R4L A;  4CTD A;  3A0H O;  3K19 A;  4G75 A;  3SYS A;  4AYI D;  3UAQ A;  1HXX A;  3T24 A;  1QJ8 A;  3VZT X;  1P4T A;  2J4U P;  3VE2 A;  2M06 A;  3FYX A;  4FSP A;  4RL9 A;  4FZN A;  5G26 A;  1MPF A;  1GFN A;  3T0S A;  5DL7 A;  3AAA B;  5G38 A;  3DWN A;  4AUI A;  2W81 C;  4LSH A;  2JMM A;  4FES A;  3PRN A;  4B61 A;  3HWB A;  3UU2 A;  2XTR A;  2FGQ X;  3AA6 A;  4C4V A;  3POU A;  4K3C A;  4PJ0 O;  4C4V B;  2Y0L A;  1PHO A;  4RLC A;  5EE2 A;  2Y0K A;  5JDP A;  4FRX A;  2IWV A;  4GCS A;  2ZLD A;  2KZ7 B;  1ZHW A;  2R8A A;  3A2S X;  2KDY A;  1OSM A;  4E1T A;  3AA1 B;  1THQ A;  3UPG A;  1QJ9 A;  2WJQ A;  1H6S 1;  5PRN A;  3POX A;  4AYM C;  5GTH O;  4G76 A;  3VY8 X;  3BRZ A;  1ZHZ A;  4XNL A;  2N2L A;  1ZHY A;  3LK4 1;  1Q9G A;  4U9C A;  5DL5 A;  2R4O A;  3PGS A;  5T5F A;  3VE1 A;  3NJT A;  2LHF A;  4IL6 O;  2XE2 A;  3AA7 A;  2Y2X A;  3BRY A;  4C00 A;  5KAF O;  4FSO A;  4O49 A;  4O4U A;  2YNK A;  3PQS A;  4N59 A;  4E1S A;  2Y0H A;  4KR8 A;  3DA4 A;  3SYB A;  4O3Z A;  3PF1 A;  4N75 A;  1YS5 A;  3QRA A;  2K0L A;  2MHL A;  2ERV A;  2XE1 A;  4AYD C;  1ORM A;  4GF4 A;  4N58 A;  5FVN A;  4AYE C;  4LSI A;  4F4B A;  3TZG A;  3LK3 A;  5ADX L;  2Y7S A;  6PRN A;  3AA6 B;  1HXT A;  2JQY A;  3POQ A;  4FMS A;  2LFU A;  4FZL A;  4JCH A;  4D64 A;  4Z3T A;  7PRN A;  3VZW X;  3POR A;  3HOL A;  3T20 A;  2N2M A;  3HOE A;  5E79 O;  1GFO A;  3KVD D;  4JFB A;  4RLB A;  4FQE A;  5IYU A;  1GFQ A;  4KR4 A;  4D5U A;  3PGR A;  3PGU A;  3A0B O;  5DL6 A;  1T1L A;  5B66 O;  3DWO X;  3AAE A;  3G7G A;  4UB8 O;  5GTI O;  3AA7 B;  4PUX A;  4AFK A;  2KXP A;  3BS0 A;  5DL8 A;  1MM4 A;  2R4N A;  2X9K A;  1E54 A;  3WI5 A;  4D65 A;  1GFM A;  1Q9F A;  5G3A A;  2GE4 A;  5ADX K;  3LK4 2;  3SZV A; 
#chains in the Genus database with same CATH homology
 4FRT A;  1HXU A;  1BT9 A;  4O3X B;  2MNH A;  4XNK A;  4FT6 A;  3SY9 A;  2F1V A;  5AFU L;  4BUM X;  4O3W A;  5ADX K;  1G90 A;  3LK3 B;  4O4X A;  2ODJ A;  4GHB A;  1IZN A;  4FZM A;  4AKM A;  3LK2 A;  3LK2 B;  2OMF A;  3AA0 A;  2X27 X;  3SZD A;  1OPF A;  4GCP A;  4KRA A;  5GV0 A;  2XTQ A;  3VZU X;  4AKR A;  2K4T A;  4LSE A;  1BXW A;  4LSF A;  2YPV A;  3QRC A;  2XE3 A;  4QQ1 A;  2PRN A;  2XMX A;  2FGR A;  2M07 A;  2QTK A;  2XE5 A;  3NSG A;  3SY7 A;  2XG6 A;  1QJP A;  2POR A;  3AAE B;  3VY9 X;  1MM5 A;  4RJW A;  3DA3 A;  2KXP B;  3AAA A;  1ZHX A;  3WI4 A;  2O4V A;  4AYN A;  1BH3 A;  1GFP A;  4FUV A;  4GCQ A;  2J1N A;  8PRN A;  3O0E A;  3C5O A;  4FOZ A;  5AFU K;  3RBH A;  3HW9 A;  1ZHT A;  3GP6 A;  2KZ7 A;  1IZN B;  2F1T A;  2KC0 A;  2ZFG A;  4RJX A;  1PRN A;  3EMN X;  5D5D A;  3AA1 A;  3AA0 B;  4O3Y A;  3PQU A;  4C69 X;  3T20 A;  2W80 C;  3JTY A;  3V8U A;  4AKR B;  3K19 A;  4G75 A;  3SYS A;  4AYI D;  3UAQ A;  1HXX A;  3T24 A;  1QJ8 A;  3VZT X;  1P4T A;  2J4U P;  3VE2 A;  2M06 A;  3FYX A;  4FSP A;  4RL9 A;  4FZN A;  5G26 A;  1MPF A;  1GFN A;  3T0S A;  5DL7 A;  3AAA B;  4AUI A;  2W81 C;  4LSH A;  2JMM A;  4FES A;  3PRN A;  4B61 A;  3HWB A;  3UU2 A;  2XTR A;  2FGQ X;  3AA6 A;  3POU A;  2Y0L A;  1PHO A;  4RLC A;  5EE2 A;  2Y0K A;  5JDP A;  4FRX A;  4GCS A;  2ZLD A;  2KZ7 B;  1ZHW A;  3A2S X;  2KDY A;  1OSM A;  3AA1 B;  1THQ A;  3UPG A;  1QJ9 A;  5PRN A;  1H6S 1;  3POX A;  4AYM C;  4G76 A;  3VY8 X;  1ZHZ A;  4XNL A;  2N2L A;  1ZHY A;  3LK4 1;  1Q9G A;  4U9C A;  5DL5 A;  5T5F A;  4AZL A;  4E1T A;  3VE1 A;  2LHF A;  2XE2 A;  3AA7 A;  2Y2X A;  4FSO A;  4O49 A;  4O4U A;  2YNK A;  3PQS A;  4N59 A;  4E1S A;  2Y0H A;  4KR8 A;  3DA4 A;  3SYB A;  4O3Z A;  1YS5 A;  3QRA A;  2K0L A;  2MHL A;  2ERV A;  2XE1 A;  4AYD C;  1ORM A;  4GF4 A;  4N58 A;  5FVN A;  4AYE C;  4LSI A;  4F4B A;  3TZG A;  3LK3 A;  5ADX L;  2Y7S A;  6PRN A;  3AA6 B;  1HXT A;  3POQ A;  4FMS A;  4FZL A;  2LFU A;  4JCH A;  4D64 A;  7PRN A;  4Z3T A;  3VZW X;  3POR A;  3HOL A;  2N2M A;  3HOE A;  1GFO A;  3KVD D;  4JFB A;  4RLB A;  5IYU A;  1GFQ A;  4KR4 A;  4D5U A;  5DL6 A;  3AAE A;  3G7G A;  3AA7 B;  4PUX A;  4AFK A;  2KXP A;  5DL8 A;  1MM4 A;  3WI5 A;  1E54 A;  4D65 A;  1GFM A;  1Q9F A;  2GE4 A;  3LK4 2;  3SZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...