2ERVA

Crystal structure of the outer membrane enzyme pagl
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
ADVSAAVGATGQSGMTYRLGLSWDWDKSWWQTSTGRLTGYWDAGYTYWEGGDEGAGKHSLSFAPVFVYEFAGDSIKPFIEAGIGVAAFSGTRVGDQNLGSSLNFEDRIGAGLKFANGQSVGVRAIHYSNAGLKQPNDGIESYSLFYKIPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein Paer03002360
publication title Crystal structure and catalytic mechanism of the LPS 3-O-deacylase PagL from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
total genus 36
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature ec 3.1.1.77: Acyloxyacyl hydrolase.
pdb deposition date 2005-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09411 PagL Lipid A 3-O-deacylase (PagL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2ervA00
2JMMA 1Q9FA 3G7GA 2K0LA 2F1TA 2M06A 1MM4A 1MM5A 2GE4A 1ORMA 2LHFA 2MHLA 1THQA 2N2LA 1P4TA 3QRAA 1QJ9A 3C5OA 2F1VA 3QRCA 1QJ8A 1BXWA 2ERVA 2N2MA 4RLCA 1QJPA 2MNHA 2M07A 4PUXA 2X27X 1G90A 3GP6A 1Q9GA
chains in the Genus database with same CATH superfamily
2R4NA 4G75A 3K19A 3PRNA 3SZVA 1OSMA 3BRYA 3UAQA 3WI4A 2K0LA 2XE1A 1PHOA 3TZGA 3VZTX 4FMSA 4GF4A 5PRNA 1GFNA 4JFBA 5JDPA 3QRAA 3HW9A 4AZLA 2R89A 4O4XA 5AFUL 1QJ9A 2IWVA 3PQUA 4UB6O 5GTIO 2Y0KA 3DWOX 1GFMA 1GFPA 2ZLDA 2R4OA 2XG6A 3EMNX 4O4UA 4FZLA 4RLBA 5DL8A 2WJRA 4RLCA 5G39A 3VY9X 2J1NA 1IZNB 4GCPA 4AYNA 1HXUA 5G3AA 2MNHA 4KRAA 4AYEC 3POXA 1GFQA 1S5LO 3UU2A 4AYID 2Y2XA 2X27X 1BH3A 5G38A 1E54A 4RL9A 2KXPA 3VZUX 2KXPB 4AKMA 1Q9GA 2YNKA 2XE3A 3LK2A 3LK2B 1Q9FA 3VE1A 4N75A 4F4BA 2O4VA 3AAEB 1MPFA 4FZNA 3BRZA 5DL6A 4C69X 3AA0B 1MM4A 4O3ZA 3WI5A 4E1TA 4UB8O 4FQEA 2GE4A 2JQYA 2LHFA 3AAAB 3SY7A 2X9KA 2R4LA 1P4TA 2ZFGA 3NJTA 3POQA 5TISO 2W80C 4FOZA 4FESA 4N59A 3C5OA 3QRCA 1QJ8A 1T16A 2XTRA 1H6S1 3A0BO 1BXWA 3DA3A 2FGRA 4FUVA 5KAIO 3KVDD 4Z3TA 3BS0A 3LK3A 1IZNA 3LK42 3LK3B 5B66O 4C4VA 2XMXA 4C4VB 2ODJA 3UPGA 1HXTA 2KDYA 4PUXA 4PR7A 5AFUK 1PRNA 2LFUA 3SYSA 3V8UA 4CTDA 4PJ0O 2XE5A 5T5FA 4U9CA 2JMMA 3NSGA 3DZMA 3AA1A 4XNKA 3AA1B 3AA6A 3G7GA 3AA6B 2OMFA 4FRXA 4LSFA 4B61A 4O3XB 4RJWA 2F1TA 1ZHTA 3AAEA 5G26A 2M06A 4O3YA 1MM5A 2XE2A 3AA0A 1ORMA 2Y0LA 4FT6A 4N74A 2KZ7A 5KAFO 2KZ7B 1THQA 2N2LA 5ADXL 3PGRA 5IYUA 1ZHYA 4FRTA 3T24A 3PORA 4GHBA 7PRNA 4FSOA 3RBHA 5EE2A 2F1VA 4AKRA 4AKRB 5GV0A 5H2FO 1T1LA 4KR8A 4GCQA 4LSHA 4IL6O 1QJPA 2Y7SA 4GCSA 3SYBA 4RJXA 1BT9A 3VY8X 4AFKA 2M07A 4AYMC 2R8AA 3DA4A 3JCUO 4D5UA 3VZWX 3PQSA 3GP6A 2R4PA 4FZMA 4KR4A 2KC0A 4N58A 1YS5A 3HOEA 3O0EA 5DL5A 4D64A 4K3BA 3SZDA 1ZHZA 1ZHXA 3HOLA 3PGSA 4C00A 3FYXA 4LSIA 4JCHA 1ZHWA 4O49A 4QQ1A 2YPVA 5E79O 2MHLA 3SY9A 2IWWA 2R88A 2PRNA 6PRNA 2J4UP 2WJQA 4FSPA 2F1CX 1OPFA 3WU2O 5DL7A 3T20A 3A0HO 1HXXA 5D5DA 3T0SA 2XTQA 3AA7A 3KZIO 2ERVA 2FGQX 3AA7B 3HWBA 2N2MA 4K3CA 3PGUA 2QTKA 2WVPA 4LSEA 5B5EO 4G76A 4O3WA 4XNLA 3VE2A 4E1SA 4AYDC 4BUMX 4D65A 2AXTO 1GFOA 3LK41 3DWNA 5ADXK 3A2SX 2W81C 5FVNA 2Y0HA 3PF1A 3JTYA 1G90A 8PRNA 2K4TA 4AUIA 3AAAA 2PORA 5GTHO 3POUA
chains in the Genus database with same CATH topology
4G75A 3K19A 3PRNA 3SZVA 1OSMA 3UAQA 3WI4A 2K0LA 2XE1A 1PHOA 3VZTX 4FMSA 4GF4A 5PRNA 1GFNA 4JFBA 5JDPA 3QRAA 3HW9A 4AZLA 4O4XA 5AFUL 1QJ9A 3PQUA 2Y0KA 1GFMA 1GFPA 2ZLDA 3EMNX 2XG6A 4RLBA 4O4UA 4FZLA 5DL8A 3VY9X 4RLCA 2J1NA 1IZNB 4GCPA 4AYNA 1HXUA 2MNHA 4KRAA 4AYEC 3POXA 1GFQA 3UU2A 4AYID 2Y2XA 2X27X 1BH3A 1E54A 4RL9A 2KXPA 3VZUX 2KXPB 4AKMA 1Q9GA 2YNKA 2XE3A 3LK2A 3LK2B 1Q9FA 3VE1A 4F4BA 2O4VA 3AAEB 1MPFA 4FZNA 5DL6A 4C69X 3AA0B 1MM4A 4O3ZA 3WI5A 4E1TA 2GE4A 2LHFA 3AAAB 3SY7A 1P4TA 2ZFGA 3POQA 2W80C 4FOZA 4FESA 4N59A 3C5OA 3QRCA 1QJ8A 2XTRA 1H6S1 4FUVA 1BXWA 3DA3A 2FGRA 3KVDD 4Z3TA 3LK3A 1IZNA 3LK42 3LK3B 2XMXA 2ODJA 3UPGA 1HXTA 2KDYA 4PUXA 5AFUK 1PRNA 2LFUA 3SYSA 3V8UA 2XE5A 5T5FA 4U9CA 2JMMA 3NSGA 4XNKA 3AA1A 3AA1B 3AA6A 3G7GA 3AA6B 2OMFA 4FRXA 4LSFA 4B61A 4O3XB 4RJWA 2F1TA 1ZHTA 3AAEA 5G26A 2M06A 4O3YA 1MM5A 2XE2A 3AA0A 1ORMA 2Y0LA 4FT6A 5ADXL 2KZ7A 5IYUA 2KZ7B 1THQA 2N2LA 1ZHYA 4FRTA 3T24A 3PORA 4GHBA 7PRNA 4FSOA 3RBHA 5EE2A 2F1VA 4AKRA 4AKRB 5GV0A 4KR8A 4GCQA 4LSHA 1QJPA 2Y7SA 4GCSA 3SYBA 4RJXA 1BT9A 3VY8X 4AFKA 2M07A 4AYMC 3DA4A 4D5UA 3VZWX 3PQSA 3GP6A 4FZMA 4KR4A 2KC0A 4N58A 1YS5A 3HOEA 3O0EA 5DL5A 4D64A 3SZDA 1ZHZA 1ZHXA 3HOLA 3FYXA 4LSIA 4JCHA 1ZHWA 4O49A 4QQ1A 2YPVA 3SY9A 2MHLA 2PRNA 6PRNA 2J4UP 4FSPA 1OPFA 5DL7A 3T20A 5D5DA 1HXXA 3T0SA 3TZGA 2XTQA 3AA7A 2ERVA 2FGQX 3AA7B 3HWBA 2N2MA 2QTKA 4LSEA 4G76A 4O3WA 4XNLA 3VE2A 4E1SA 4AYDC 4BUMX 4D65A 1GFOA 3LK41 5ADXK 3A2SX 2W81C 5FVNA 2Y0HA 1G90A 3JTYA 8PRNA 2K4TA 4AUIA 3AAAA 2PORA 3POUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMM A;  1Q9F A;  3G7G A;  2K0L A;  2F1T A;  2M06 A;  1MM4 A;  1MM5 A;  2GE4 A;  1ORM A;  2LHF A;  2MHL A;  1THQ A;  2N2L A;  1P4T A;  3QRA A;  1QJ9 A;  3C5O A;  2F1V A;  3QRC A;  1QJ8 A;  1BXW A;  2ERV A;  2N2M A;  4RLC A;  1QJP A;  2MNH A;  2M07 A;  4PUX A;  2X27 X;  1G90 A;  3GP6 A;  1Q9G A; 
#chains in the Genus database with same CATH topology
 2R4N A;  4G75 A;  3K19 A;  3PRN A;  3SZV A;  1OSM A;  3BRY A;  3UAQ A;  3WI4 A;  2K0L A;  2XE1 A;  1PHO A;  3TZG A;  3VZT X;  4FMS A;  4GF4 A;  5PRN A;  1GFN A;  4JFB A;  5JDP A;  3QRA A;  3HW9 A;  4AZL A;  2R89 A;  4O4X A;  5AFU L;  1QJ9 A;  2IWV A;  3PQU A;  4UB6 O;  5GTI O;  2Y0K A;  3DWO X;  1GFM A;  1GFP A;  2ZLD A;  2R4O A;  2XG6 A;  3EMN X;  4O4U A;  4FZL A;  4RLB A;  5DL8 A;  2WJR A;  4RLC A;  5G39 A;  3VY9 X;  2J1N A;  1IZN B;  4GCP A;  4AYN A;  1HXU A;  5G3A A;  2MNH A;  4KRA A;  4AYE C;  3POX A;  1GFQ A;  1S5L O;  3UU2 A;  4AYI D;  2Y2X A;  2X27 X;  1BH3 A;  5G38 A;  1E54 A;  4RL9 A;  2KXP A;  3VZU X;  2KXP B;  4AKM A;  1Q9G A;  2YNK A;  2XE3 A;  3LK2 A;  3LK2 B;  1Q9F A;  3VE1 A;  4N75 A;  4F4B A;  2O4V A;  3AAE B;  1MPF A;  4FZN A;  3BRZ A;  5DL6 A;  4C69 X;  3AA0 B;  1MM4 A;  4O3Z A;  3WI5 A;  4E1T A;  4UB8 O;  4FQE A;  2GE4 A;  2JQY A;  2LHF A;  3AAA B;  3SY7 A;  2X9K A;  2R4L A;  1P4T A;  2ZFG A;  3NJT A;  3POQ A;  5TIS O;  2W80 C;  4FOZ A;  4FES A;  4N59 A;  3C5O A;  3QRC A;  1QJ8 A;  1T16 A;  2XTR A;  1H6S 1;  3A0B O;  1BXW A;  3DA3 A;  2FGR A;  4FUV A;  5KAI O;  3KVD D;  4Z3T A;  3BS0 A;  3LK3 A;  1IZN A;  3LK4 2;  3LK3 B;  5B66 O;  4C4V A;  2XMX A;  4C4V B;  2ODJ A;  3UPG A;  1HXT A;  2KDY A;  4PUX A;  4PR7 A;  5AFU K;  1PRN A;  2LFU A;  3SYS A;  3V8U A;  4CTD A;  4PJ0 O;  2XE5 A;  5T5F A;  4U9C A;  2JMM A;  3NSG A;  3DZM A;  3AA1 A;  4XNK A;  3AA1 B;  3AA6 A;  3G7G A;  3AA6 B;  2OMF A;  4FRX A;  4LSF A;  4B61 A;  4O3X B;  4RJW A;  2F1T A;  1ZHT A;  3AAE A;  5G26 A;  2M06 A;  4O3Y A;  1MM5 A;  2XE2 A;  3AA0 A;  1ORM A;  2Y0L A;  4FT6 A;  4N74 A;  2KZ7 A;  5KAF O;  2KZ7 B;  1THQ A;  2N2L A;  5ADX L;  3PGR A;  5IYU A;  1ZHY A;  4FRT A;  3T24 A;  3POR A;  4GHB A;  7PRN A;  4FSO A;  3RBH A;  5EE2 A;  2F1V A;  4AKR A;  4AKR B;  5GV0 A;  5H2F O;  1T1L A;  4KR8 A;  4GCQ A;  4LSH A;  4IL6 O;  1QJP A;  2Y7S A;  4GCS A;  3SYB A;  4RJX A;  1BT9 A;  3VY8 X;  4AFK A;  2M07 A;  4AYM C;  2R8A A;  3DA4 A;  3JCU O;  4D5U A;  3VZW X;  3PQS A;  3GP6 A;  2R4P A;  4FZM A;  4KR4 A;  2KC0 A;  4N58 A;  1YS5 A;  3HOE A;  3O0E A;  5DL5 A;  4D64 A;  4K3B A;  3SZD A;  1ZHZ A;  1ZHX A;  3HOL A;  3PGS A;  4C00 A;  3FYX A;  4LSI A;  4JCH A;  1ZHW A;  4O49 A;  4QQ1 A;  2YPV A;  5E79 O;  2MHL A;  3SY9 A;  2IWW A;  2R88 A;  2PRN A;  6PRN A;  2J4U P;  2WJQ A;  4FSP A;  2F1C X;  1OPF A;  3WU2 O;  5DL7 A;  3T20 A;  3A0H O;  1HXX A;  5D5D A;  3T0S A;  2XTQ A;  3AA7 A;  3KZI O;  2ERV A;  2FGQ X;  3AA7 B;  3HWB A;  2N2M A;  4K3C A;  3PGU A;  2QTK A;  2WVP A;  4LSE A;  5B5E O;  4G76 A;  4O3W A;  4XNL A;  3VE2 A;  4E1S A;  4AYD C;  4BUM X;  4D65 A;  2AXT O;  1GFO A;  3LK4 1;  3DWN A;  5ADX K;  3A2S X;  2W81 C;  5FVN A;  2Y0H A;  3PF1 A;  3JTY A;  1G90 A;  8PRN A;  2K4T A;  4AUI A;  3AAA A;  2POR A;  5GTH O;  3POU A; 
#chains in the Genus database with same CATH homology
 4G75 A;  3K19 A;  3PRN A;  3SZV A;  1OSM A;  3UAQ A;  3WI4 A;  2K0L A;  2XE1 A;  1PHO A;  3VZT X;  4FMS A;  4GF4 A;  5PRN A;  1GFN A;  4JFB A;  5JDP A;  3QRA A;  3HW9 A;  4AZL A;  4O4X A;  5AFU L;  1QJ9 A;  3PQU A;  2Y0K A;  1GFM A;  1GFP A;  2ZLD A;  3EMN X;  2XG6 A;  4RLB A;  4O4U A;  4FZL A;  5DL8 A;  3VY9 X;  4RLC A;  2J1N A;  1IZN B;  4GCP A;  4AYN A;  1HXU A;  2MNH A;  4KRA A;  4AYE C;  3POX A;  1GFQ A;  3UU2 A;  4AYI D;  2Y2X A;  2X27 X;  1BH3 A;  1E54 A;  4RL9 A;  2KXP A;  3VZU X;  2KXP B;  4AKM A;  1Q9G A;  2YNK A;  2XE3 A;  3LK2 A;  3LK2 B;  1Q9F A;  3VE1 A;  4F4B A;  2O4V A;  3AAE B;  1MPF A;  4FZN A;  5DL6 A;  4C69 X;  3AA0 B;  1MM4 A;  4O3Z A;  3WI5 A;  4E1T A;  2GE4 A;  2LHF A;  3AAA B;  3SY7 A;  1P4T A;  2ZFG A;  3POQ A;  2W80 C;  4FOZ A;  4FES A;  4N59 A;  3C5O A;  3QRC A;  1QJ8 A;  2XTR A;  1H6S 1;  4FUV A;  1BXW A;  3DA3 A;  2FGR A;  3KVD D;  4Z3T A;  3LK3 A;  1IZN A;  3LK4 2;  3LK3 B;  2XMX A;  2ODJ A;  3UPG A;  1HXT A;  2KDY A;  4PUX A;  5AFU K;  1PRN A;  2LFU A;  3SYS A;  3V8U A;  2XE5 A;  5T5F A;  4U9C A;  2JMM A;  3NSG A;  4XNK A;  3AA1 A;  3AA1 B;  3AA6 A;  3G7G A;  3AA6 B;  2OMF A;  4FRX A;  4LSF A;  4B61 A;  4O3X B;  4RJW A;  2F1T A;  1ZHT A;  3AAE A;  5G26 A;  2M06 A;  4O3Y A;  1MM5 A;  2XE2 A;  3AA0 A;  1ORM A;  2Y0L A;  4FT6 A;  5ADX L;  2KZ7 A;  5IYU A;  2KZ7 B;  1THQ A;  2N2L A;  1ZHY A;  4FRT A;  3T24 A;  3POR A;  4GHB A;  7PRN A;  4FSO A;  3RBH A;  5EE2 A;  2F1V A;  4AKR A;  4AKR B;  5GV0 A;  4KR8 A;  4GCQ A;  4LSH A;  1QJP A;  2Y7S A;  4GCS A;  3SYB A;  4RJX A;  1BT9 A;  3VY8 X;  4AFK A;  2M07 A;  4AYM C;  3DA4 A;  4D5U A;  3VZW X;  3PQS A;  3GP6 A;  4FZM A;  4KR4 A;  2KC0 A;  4N58 A;  1YS5 A;  3HOE A;  3O0E A;  5DL5 A;  4D64 A;  3SZD A;  1ZHZ A;  1ZHX A;  3HOL A;  3FYX A;  4LSI A;  4JCH A;  1ZHW A;  4O49 A;  4QQ1 A;  2YPV A;  3SY9 A;  2MHL A;  2PRN A;  6PRN A;  2J4U P;  4FSP A;  1OPF A;  5DL7 A;  3T20 A;  5D5D A;  1HXX A;  3T0S A;  3TZG A;  2XTQ A;  3AA7 A;  2ERV A;  2FGQ X;  3AA7 B;  3HWB A;  2N2M A;  2QTK A;  4LSE A;  4G76 A;  4O3W A;  4XNL A;  3VE2 A;  4E1S A;  4AYD C;  4BUM X;  4D65 A;  1GFO A;  3LK4 1;  5ADX K;  3A2S X;  2W81 C;  5FVN A;  2Y0H A;  1G90 A;  3JTY A;  8PRN A;  2K4T A;  4AUI A;  3AAA A;  2POR A;  3POU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...