2ERVA

Crystal structure of the outer membrane enzyme pagl
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
ADVSAAVGATGQSGMTYRLGLSWDWDKSWWQTSTGRLTGYWDAGYTYWEGGDEGAGKHSLSFAPVFVYEFAGDSIKPFIEAGIGVAAFSGTRVGDQNLGSSLNFEDRIGAGLKFANGQSVGVRAIHYSNAGLKQPNDGIESYSLFYKIPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and catalytic mechanism of the LPS 3-O-deacylase PagL from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
molecule keywords hypothetical protein Paer03002360
total genus 36
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature ec 3.1.1.77: Acyloxyacyl hydrolase.
pdb deposition date 2005-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09411 PagL Lipid A 3-O-deacylase (PagL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2ervA00
1THQA 2JMMA 3C5OA 2F1TA 2M07A 3QRCA 2GE4A 2N2MA 1ORMA 1Q9FA 2LHFA 2N2LA 1P4TA 1G90A 1QJ9A 4PUXA 1MM5A 2MHLA 1BXWA 2ERVA 2X27X 2F1VA 1QJPA 3GP6A 3G7GA 2K0LA 2M06A 1Q9GA 1MM4A 4RLCA 1QJ8A 3QRAA 2MNHA
chains in the Genus database with same CATH superfamily
5B5EO 3T20A 5D5DA 2JMMA 3PGSA 2K4TA 2N2MA 1ORMA 1BH3A 2FGRA 2R8AA 4JCHA 5G38A 3WI5A 3AA7B 3AA7A 1GFOA 8PRNA 1ZHZA 1BT9A 3POQA 4AKMA 4K3BA 3WI4A 3PGRA 5G3AA 2QTKA 3LK41 2N2LA 1H6S1 5AFUL 2R4PA 4C69X 4N58A 1G90A 3KVDD 1S5LO 3AAEA 3PORA 3RBHA 3VY8X 3DA3A 4Z3TA 7PRNA 2JQYA 1OPFA 2WVPA 4O3ZA 4F4BA 3AA1A 2R4LA 2W81C 2Y0KA 3BRZA 3LK42 4N75A 3FYXA 2YPVA 3DZMA 3T24A 5B66O 3AAAB 2M06A 1Q9GA 4GCQA 3O0EA 4FSPA 1MPFA 4O4UA 5G39A 4UB6O 1E54A 1T1LA 2FGQX 3PF1A 4FRTA 2R4NA 4XNKA 1HXUA 4LSEA 3UU2A 2XE3A 4RJWA 3VZUX 5ADXK 2Y7SA 3SY7A 3C5OA 4FZLA 2OMFA 3EMNX 1OSMA 3A0BO 5GTHO 2PRNA 2GE4A 2PORA 4BUMX 4KRAA 1GFNA 4GCSA 4CTDA 4JFBA 2LHFA 3AA6A 4AYDC 3AA6B 4PJ0O 4RLBA 5DL5A 4AZLA 5ADXL 2IWVA 1P4TA 4FRXA 1IZNB 4O49A 1BXWA 2XTRA 2ERVA 4FT6A 3BS0A 2XE2A 3AA1B 5DL7A 2Y0LA 5KAFO 4D64A 4FUVA 3UPGA 2K0LA 3HW9A 5DL8A 3SYBA 2ZLDA 3VE2A 3A0HO 3AA0A 2J1NA 3V8UA 2KZ7B 3PRNA 2XMXA 4RLCA 5AFUK 1QJ8A 4AYID 4E1SA 3QRAA 3JCUO 4QQ1A 4FMSA 3NJTA 1T16A 4LSHA 4B61A 2F1TA 4FQEA 5PRNA 5T5FA 3K19A 2LFUA 4U9CA 1ZHXA 3TZGA 4RL9A 5IYUA 4G75A 1PHOA 4FOZA 1HXTA 2KDYA 2XG6A 4FZNA 4AYEC 2KXPA 4K3CA 4KR4A 4PR7A 5DL6A 5EE2A 4AYNA 4D5UA 2IWWA 2KXPB 1QJ9A 4PUXA 1MM5A 3SY9A 4C00A 2XE5A 2F1VA 1QJPA 2XE1A 4GHBA 3GP6A 4KR8A 4C4VB 4E1TA 3UAQA 4C4VA 2Y0HA 3WU2O 4FZMA 5FVNA 3VZTX 3AA0B 4FESA 4LSFA 2X9KA 1ZHYA 3NSGA 2R4OA 2O4VA 3SZDA 3DWNA 2XTQA 3HWBA 3HOEA 1IZNA 3POXA 1GFPA 2F1CX 1THQA 5E79O 5G26A 4AKRB 4AYMC 2M07A 3LK2B 3QRCA 3LK2A 2R89A 4LSIA 4GCPA 4AKRA 4GF4A 3LK3A 5KAIO 1Q9FA 2WJRA 3LK3B 4RJXA 2J4UP 1ZHTA 3JTYA 4FSOA 3PGUA 4N59A 1ZHWA 5H2FO 2ODJA 2YNKA 4IL6O 4O4XA 3T0SA 4AUIA 4N74A 1GFMA 2KZ7A 3KZIO 2Y2XA 2MHLA 4XNLA 6PRNA 4O3WA 4UB8O 3SZVA 1YS5A 5GV0A 3DWOX 2WJQA 2X27X 4AFKA 5TISO 3G7GA 3HOLA 3A2SX 4O3XB 3POUA 4D65A 1PRNA 5JDPA 2W80C 2AXTO 5GTIO 3DA4A 3VY9X 1GFQA 4G76A 1HXXA 1MM4A 3AAAA 3SYSA 3VZWX 3PQUA 2R88A 3VE1A 4O3YA 3AAEB 2KC0A 3BRYA 2ZFGA 3PQSA 2MNHA
chains in the Genus database with same CATH topology
3T20A 5D5DA 2JMMA 2K4TA 2N2MA 1ORMA 1BH3A 2FGRA 4JCHA 3WI5A 3AA7B 3AA7A 1GFOA 8PRNA 1ZHZA 1BT9A 3POQA 4AKMA 3WI4A 2QTKA 3LK41 2N2LA 1H6S1 5AFUL 4C69X 4N58A 1G90A 3KVDD 3AAEA 3PORA 3RBHA 3VY8X 3DA3A 4Z3TA 7PRNA 1OPFA 4O3ZA 4F4BA 3AA1A 2W81C 2Y0KA 3LK42 3FYXA 2YPVA 3T24A 3AAAB 2M06A 1Q9GA 4GCQA 3O0EA 4FSPA 1MPFA 4O4UA 1E54A 4XNKA 2FGQX 4FRTA 3UU2A 1HXUA 4LSEA 2XE3A 4RJWA 3VZUX 5ADXK 2Y7SA 3SY7A 3C5OA 4FZLA 2OMFA 3EMNX 1OSMA 2PRNA 2GE4A 2PORA 4BUMX 4KRAA 1GFNA 4GCSA 4JFBA 2LHFA 3AA6A 4AYDC 3AA6B 4RLBA 5DL5A 4AZLA 5ADXL 1P4TA 4FRXA 1IZNB 4O49A 1BXWA 2XTRA 2ERVA 4FT6A 2XE2A 3AA1B 5DL7A 2Y0LA 4D64A 4FUVA 2K0LA 3HW9A 5DL8A 3SYBA 2ZLDA 3VE2A 3AA0A 2J1NA 3V8UA 2KZ7B 3PRNA 2XMXA 4RLCA 5AFUK 1QJ8A 4AYID 4E1SA 3QRAA 4QQ1A 4FMSA 4LSHA 4B61A 2F1TA 5PRNA 5T5FA 3K19A 2LFUA 4U9CA 1ZHXA 3TZGA 4RL9A 5IYUA 4G75A 1PHOA 4FOZA 1HXTA 2KDYA 2XG6A 4FZNA 4AYEC 2KXPA 4KR4A 5DL6A 5EE2A 4AYNA 4D5UA 2KXPB 1QJ9A 4PUXA 1MM5A 3SY9A 2XE5A 2F1VA 1QJPA 2XE1A 4GHBA 3GP6A 4KR8A 4E1TA 3UAQA 2Y0HA 4FZMA 5FVNA 3VZTX 3AA0B 4FESA 4LSFA 1ZHYA 3NSGA 2O4VA 3SZDA 2XTQA 3HWBA 3HOEA 1IZNA 3POXA 1GFPA 1THQA 5G26A 4AKRB 4AYMC 2M07A 3LK2B 3QRCA 3LK2A 4LSIA 4GCPA 4AKRA 4GF4A 3LK3A 1Q9FA 3LK3B 4RJXA 2J4UP 1ZHTA 3JTYA 4FSOA 4N59A 1ZHWA 2ODJA 2YNKA 4O4XA 3T0SA 4AUIA 1GFMA 2KZ7A 2Y2XA 2MHLA 4XNLA 6PRNA 4O3WA 3SZVA 1YS5A 5GV0A 4AFKA 2X27X 3G7GA 3HOLA 3A2SX 4O3XB 3POUA 4D65A 1PRNA 5JDPA 2W80C 3UPGA 3VY9X 3DA4A 1GFQA 4G76A 1HXXA 1MM4A 3AAAA 3SYSA 3VZWX 3PQUA 3VE1A 4O3YA 3AAEB 2KC0A 2ZFGA 3PQSA 2MNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1THQ A;  2JMM A;  3C5O A;  2F1T A;  2M07 A;  3QRC A;  2GE4 A;  2N2M A;  1ORM A;  1Q9F A;  2LHF A;  2N2L A;  1P4T A;  1G90 A;  1QJ9 A;  4PUX A;  1MM5 A;  2MHL A;  1BXW A;  2ERV A;  2X27 X;  2F1V A;  1QJP A;  3GP6 A;  3G7G A;  2K0L A;  2M06 A;  1Q9G A;  1MM4 A;  4RLC A;  1QJ8 A;  3QRA A;  2MNH A; 
#chains in the Genus database with same CATH topology
 5B5E O;  3T20 A;  5D5D A;  2JMM A;  3PGS A;  2K4T A;  2N2M A;  1ORM A;  1BH3 A;  2FGR A;  2R8A A;  4JCH A;  5G38 A;  3WI5 A;  3AA7 B;  3AA7 A;  1GFO A;  8PRN A;  1ZHZ A;  1BT9 A;  3POQ A;  4AKM A;  4K3B A;  3WI4 A;  3PGR A;  5G3A A;  2QTK A;  3LK4 1;  2N2L A;  1H6S 1;  5AFU L;  2R4P A;  4C69 X;  4N58 A;  1G90 A;  3KVD D;  1S5L O;  3AAE A;  3POR A;  3RBH A;  3VY8 X;  3DA3 A;  4Z3T A;  7PRN A;  2JQY A;  1OPF A;  2WVP A;  4O3Z A;  4F4B A;  3AA1 A;  2R4L A;  2W81 C;  2Y0K A;  3BRZ A;  3LK4 2;  4N75 A;  3FYX A;  2YPV A;  3DZM A;  3T24 A;  5B66 O;  3AAA B;  2M06 A;  1Q9G A;  4GCQ A;  3O0E A;  4FSP A;  1MPF A;  4O4U A;  5G39 A;  4UB6 O;  1E54 A;  1T1L A;  2FGQ X;  3PF1 A;  4FRT A;  2R4N A;  4XNK A;  1HXU A;  4LSE A;  3UU2 A;  2XE3 A;  4RJW A;  3VZU X;  5ADX K;  2Y7S A;  3SY7 A;  3C5O A;  4FZL A;  2OMF A;  3EMN X;  1OSM A;  3A0B O;  5GTH O;  2PRN A;  2GE4 A;  2POR A;  4BUM X;  4KRA A;  1GFN A;  4GCS A;  4CTD A;  4JFB A;  2LHF A;  3AA6 A;  4AYD C;  3AA6 B;  4PJ0 O;  4RLB A;  5DL5 A;  4AZL A;  5ADX L;  2IWV A;  1P4T A;  4FRX A;  1IZN B;  4O49 A;  1BXW A;  2XTR A;  2ERV A;  4FT6 A;  3BS0 A;  2XE2 A;  3AA1 B;  5DL7 A;  2Y0L A;  5KAF O;  4D64 A;  4FUV A;  3UPG A;  2K0L A;  3HW9 A;  5DL8 A;  3SYB A;  2ZLD A;  3VE2 A;  3A0H O;  3AA0 A;  2J1N A;  3V8U A;  2KZ7 B;  3PRN A;  2XMX A;  4RLC A;  5AFU K;  1QJ8 A;  4AYI D;  4E1S A;  3QRA A;  3JCU O;  4QQ1 A;  4FMS A;  3NJT A;  1T16 A;  4LSH A;  4B61 A;  2F1T A;  4FQE A;  5PRN A;  5T5F A;  3K19 A;  2LFU A;  4U9C A;  1ZHX A;  3TZG A;  4RL9 A;  5IYU A;  4G75 A;  1PHO A;  4FOZ A;  1HXT A;  2KDY A;  2XG6 A;  4FZN A;  4AYE C;  2KXP A;  4K3C A;  4KR4 A;  4PR7 A;  5DL6 A;  5EE2 A;  4AYN A;  4D5U A;  2IWW A;  2KXP B;  1QJ9 A;  4PUX A;  1MM5 A;  3SY9 A;  4C00 A;  2XE5 A;  2F1V A;  1QJP A;  2XE1 A;  4GHB A;  3GP6 A;  4KR8 A;  4C4V B;  4E1T A;  3UAQ A;  4C4V A;  2Y0H A;  3WU2 O;  4FZM A;  5FVN A;  3VZT X;  3AA0 B;  4FES A;  4LSF A;  2X9K A;  1ZHY A;  3NSG A;  2R4O A;  2O4V A;  3SZD A;  3DWN A;  2XTQ A;  3HWB A;  3HOE A;  1IZN A;  3POX A;  1GFP A;  2F1C X;  1THQ A;  5E79 O;  5G26 A;  4AKR B;  4AYM C;  2M07 A;  3LK2 B;  3QRC A;  3LK2 A;  2R89 A;  4LSI A;  4GCP A;  4AKR A;  4GF4 A;  3LK3 A;  5KAI O;  1Q9F A;  2WJR A;  3LK3 B;  4RJX A;  2J4U P;  1ZHT A;  3JTY A;  4FSO A;  3PGU A;  4N59 A;  1ZHW A;  5H2F O;  2ODJ A;  2YNK A;  4IL6 O;  4O4X A;  3T0S A;  4AUI A;  4N74 A;  1GFM A;  2KZ7 A;  3KZI O;  2Y2X A;  2MHL A;  4XNL A;  6PRN A;  4O3W A;  4UB8 O;  3SZV A;  1YS5 A;  5GV0 A;  3DWO X;  2WJQ A;  2X27 X;  4AFK A;  5TIS O;  3G7G A;  3HOL A;  3A2S X;  4O3X B;  3POU A;  4D65 A;  1PRN A;  5JDP A;  2W80 C;  2AXT O;  5GTI O;  3DA4 A;  3VY9 X;  1GFQ A;  4G76 A;  1HXX A;  1MM4 A;  3AAA A;  3SYS A;  3VZW X;  3PQU A;  2R88 A;  3VE1 A;  4O3Y A;  3AAE B;  2KC0 A;  3BRY A;  2ZFG A;  3PQS A;  2MNH A; 
#chains in the Genus database with same CATH homology
 3T20 A;  5D5D A;  2JMM A;  2K4T A;  2N2M A;  1ORM A;  1BH3 A;  2FGR A;  4JCH A;  3WI5 A;  3AA7 B;  3AA7 A;  1GFO A;  8PRN A;  1ZHZ A;  1BT9 A;  3POQ A;  4AKM A;  3WI4 A;  2QTK A;  3LK4 1;  2N2L A;  1H6S 1;  5AFU L;  4C69 X;  4N58 A;  1G90 A;  3KVD D;  3AAE A;  3POR A;  3RBH A;  3VY8 X;  3DA3 A;  4Z3T A;  7PRN A;  1OPF A;  4O3Z A;  4F4B A;  3AA1 A;  2W81 C;  2Y0K A;  3LK4 2;  3FYX A;  2YPV A;  3T24 A;  3AAA B;  2M06 A;  1Q9G A;  4GCQ A;  3O0E A;  4FSP A;  1MPF A;  4O4U A;  1E54 A;  4XNK A;  2FGQ X;  4FRT A;  3UU2 A;  1HXU A;  4LSE A;  2XE3 A;  4RJW A;  3VZU X;  5ADX K;  2Y7S A;  3SY7 A;  3C5O A;  4FZL A;  2OMF A;  3EMN X;  1OSM A;  2PRN A;  2GE4 A;  2POR A;  4BUM X;  4KRA A;  1GFN A;  4GCS A;  4JFB A;  2LHF A;  3AA6 A;  4AYD C;  3AA6 B;  4RLB A;  5DL5 A;  4AZL A;  5ADX L;  1P4T A;  4FRX A;  1IZN B;  4O49 A;  1BXW A;  2XTR A;  2ERV A;  4FT6 A;  2XE2 A;  3AA1 B;  5DL7 A;  2Y0L A;  4D64 A;  4FUV A;  2K0L A;  3HW9 A;  5DL8 A;  3SYB A;  2ZLD A;  3VE2 A;  3AA0 A;  2J1N A;  3V8U A;  2KZ7 B;  3PRN A;  2XMX A;  4RLC A;  5AFU K;  1QJ8 A;  4AYI D;  4E1S A;  3QRA A;  4QQ1 A;  4FMS A;  4LSH A;  4B61 A;  2F1T A;  5PRN A;  5T5F A;  3K19 A;  2LFU A;  4U9C A;  1ZHX A;  3TZG A;  4RL9 A;  5IYU A;  4G75 A;  1PHO A;  4FOZ A;  1HXT A;  2KDY A;  2XG6 A;  4FZN A;  4AYE C;  2KXP A;  4KR4 A;  5DL6 A;  5EE2 A;  4AYN A;  4D5U A;  2KXP B;  1QJ9 A;  4PUX A;  1MM5 A;  3SY9 A;  2XE5 A;  2F1V A;  1QJP A;  2XE1 A;  4GHB A;  3GP6 A;  4KR8 A;  4E1T A;  3UAQ A;  2Y0H A;  4FZM A;  5FVN A;  3VZT X;  3AA0 B;  4FES A;  4LSF A;  1ZHY A;  3NSG A;  2O4V A;  3SZD A;  2XTQ A;  3HWB A;  3HOE A;  1IZN A;  3POX A;  1GFP A;  1THQ A;  5G26 A;  4AKR B;  4AYM C;  2M07 A;  3LK2 B;  3QRC A;  3LK2 A;  4LSI A;  4GCP A;  4AKR A;  4GF4 A;  3LK3 A;  1Q9F A;  3LK3 B;  4RJX A;  2J4U P;  1ZHT A;  3JTY A;  4FSO A;  4N59 A;  1ZHW A;  2ODJ A;  2YNK A;  4O4X A;  3T0S A;  4AUI A;  1GFM A;  2KZ7 A;  2Y2X A;  2MHL A;  4XNL A;  6PRN A;  4O3W A;  3SZV A;  1YS5 A;  5GV0 A;  4AFK A;  2X27 X;  3G7G A;  3HOL A;  3A2S X;  4O3X B;  3POU A;  4D65 A;  1PRN A;  5JDP A;  2W80 C;  3UPG A;  3VY9 X;  3DA4 A;  1GFQ A;  4G76 A;  1HXX A;  1MM4 A;  3AAA A;  3SYS A;  3VZW X;  3PQU A;  3VE1 A;  4O3Y A;  3AAE B;  2KC0 A;  2ZFG A;  3PQS A;  2MNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...