2ERVA

Crystal structure of the outer membrane enzyme pagl
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
b'ADVSAAVGATGQSGMTYRLGLSWDWDKSWWQTSTGRLTGYWDAGYTYWEGGDEGAGKHSLSFAPVFVYEFAGDSIKPFIEAGIGVAAFSGTRVGDQNLGSSLNFEDRIGAGLKFANGQSVGVRAIHYSNAGLKQPNDGIESYSLFYKIPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein Paer03002360
molecule tags Membrane protein
source organism Pseudomonas aeruginosa
publication title Crystal structure and catalytic mechanism of the LPS 3-O-deacylase PagL from Pseudomonas aeruginosa.
pubmed doi rcsb
total genus 36
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature ec 3.1.1.77: Acyloxyacyl hydrolase.
pdb deposition date 2005-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09411 PagL Lipid A 3-O-deacylase (PagL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2ervA00
1QJ9A 2LHFA 3G7GA 1G90A 2X27X 3QRAA 1QJPA 2MHLA 3C5OA 1Q9GA 2F1TA 2M06A 3QRCA 1ORMA 1THQA 1BXWA 2GE4A 2N2MA 4PUXA 2JMMA 1P4TA 4RLCA 2M07A 1QJ8A 2ERVA 2MNHA 1MM5A 1MM4A 3GP6A 1Q9FA 2K0LA 2F1VA 2N2LA
chains in the Genus database with same CATH superfamily
2XTRA 2R4NA 5G3AA 1OSMA 2FGRA 5DL6A 2Y0LA 3BS0A 4FRXA 3WI4A 5PRNA 5GV0A 5FVNA 2R4LA 3LK41 3SZDA 4AYID 2MHLA 4LSFA 3C5OA 3HOEA 3NJTA 3AAAB 3DA3A 4G75A 4AKRB 5B66O 3A0BO 5DL8A 4AUIA 2M06A 3LK42 3QRCA 5AFUK 3TZGA 4AYEC 4PJ0O 2JQYA 1T1LA 1THQA 3PQUA 1BXWA 4IL6O 3UU2A 2N2MA 2KC0A 4FESA 1OPFA 4QQ1A 2ZLDA 2X9KA 4RLCA 1QJ8A 3VZTX 4AKMA 4AZLA 5AFUL 5ADXL 2MNHA 1PRNA 1GFMA 5DL5A 1MM5A 1BT9A 1MM4A 1GFQA 3WU2O 1MPFA 1ZHYA 4RJXA 2WJQA 3POXA 2R4OA 2F1VA 3VY8X 4LSIA 4RJWA 3POUA 3JTYA 3AAEA 3AA1B 3O0EA 4E1TA 5JDPA 3BRZA 3G7GA 3SY9A 3WI5A 2X27X 3NSGA 3QRAA 4RLBA 4PR7A 3LK3A 4UB6O 2R89A 5DL7A 1YS5A 3HOLA 3KVDD 4JFBA 2R8AA 4FUVA 3RBHA 4AYDC 2F1CX 2XE5A 3PGSA 2Y7SA 1ORMA 3POQA 4FZLA 2PRNA 2XMXA 2KZ7A 3AA7B 3JCUO 3LK3B 2XG6A 4GHBA 3AA6A 5G26A 4AYMC 4D64A 2WJRA 2GE4A 3AA1A 1ZHTA 3SZVA 7PRNA 4KRAA 4O4UA 4RL9A 3VE2A 2M07A 3AA0B 2KZ7B 4FZMA 2XE3A 4F4BA 2QTKA 4KR8A 2W81C 1ZHZA 3T0SA 5G38A 3A0HO 4Z3TA 4N59A 4GF4A 2ODJA 5IYUA 3DWOX 5T5FA 4O3XB 3EMNX 2K0LA 3KZIO 3PORA 4E1SA 5H2FO 4AYNA 4O49A 2IWVA 4FT6A 2XE1A 3T20A 3VY9X 3V8UA 5TISO 5KAIO 1IZNA 2KXPA 2LHFA 2OMFA 4FSPA 4LSHA 3HW9A 5G39A 1GFNA 2K4TA 1GFOA 2R4PA 4CTDA 4K3BA 8PRNA 2WVPA 1HXXA 4FRTA 3HWBA 4UB8O 4XNKA 3VZWX 3VE1A 4C4VA 4FZNA 3SYBA 2FGQX 5ADXK 4KR4A 2Y2XA 2KXPB 3DZMA 1IZNB 1E54A 2Y0KA 4N75A 2LFUA 4JCHA 4C4VB 2YPVA 3AA6B 4U9CA 5GTHO 3PQSA 3FYXA 3UPGA 1HXUA 3GP6A 4FSOA 1Q9FA 6PRNA 1S5LO 1H6S1 4D5UA 3PF1A 3DA4A 4LSEA 4O4XA 1QJ9A 5GTIO 4BUMX 4C00A 2J4UP 3AAEB 4XNLA 1G90A 3PRNA 3AA7A 2YNKA 4C69X 3VZUX 4O3YA 4GCSA 3BRYA 1QJPA 4AFKA 3A2SX 1Q9GA 2O4VA 4GCPA 5EE2A 2XTQA 2AXTO 3AA0A 2F1TA 3K19A 4FMSA 4O3ZA 3DWNA 2W80C 4O3WA 4GCQA 1ZHXA 2PORA 1BH3A 2ZFGA 2Y0HA 4N74A 1T16A 2R88A 4K3CA 4PUXA 2JMMA 4N58A 5D5DA 5B5EO 3LK2A 4FQEA 2J1NA 5E79O 2XE2A 4B61A 4D65A 2IWWA 5KAFO 3T24A 4G76A 1PHOA 1GFPA 2KDYA 4FOZA 1HXTA 3AAAA 3PGUA 1ZHWA 3LK2B 3SYSA 3SY7A 4AKRA 1P4TA 3PGRA 3UAQA 2ERVA 2N2LA
chains in the Genus database with same CATH topology
2XTRA 1OSMA 2FGRA 5DL6A 2Y0LA 4FRXA 3WI4A 5PRNA 5GV0A 5FVNA 3LK41 3SZDA 4AYID 2MHLA 4LSFA 3C5OA 3HOEA 3AAAB 3DA3A 4G75A 4AKRB 5DL8A 4AUIA 2M06A 3LK42 3QRCA 5AFUK 3TZGA 4AYEC 3UU2A 3PQUA 1THQA 1BXWA 2N2MA 2KC0A 4FESA 1OPFA 2ZLDA 4RLCA 3VZTX 1QJ8A 4AKMA 4AZLA 5AFUL 5ADXL 2MNHA 1PRNA 1GFMA 5DL5A 1MM5A 1BT9A 1MM4A 1GFQA 1MPFA 1ZHYA 4RJXA 3POXA 2F1VA 3VY8X 4LSIA 4RJWA 3POUA 3JTYA 3AAEA 3AA1B 3O0EA 4E1TA 5JDPA 3G7GA 3SY9A 3WI5A 2X27X 3NSGA 3QRAA 4RLBA 3LK3A 5DL7A 1YS5A 3HOLA 3KVDD 4JFBA 4FUVA 3RBHA 4AYDC 2XE5A 3POQA 4FZLA 2Y7SA 1ORMA 4KRAA 2PRNA 2XMXA 2KZ7A 3AA7B 3LK3B 4GHBA 2XG6A 5G26A 3AA6A 4AYMC 4D64A 3AA1A 2GE4A 1ZHTA 3SZVA 7PRNA 4O4UA 4RL9A 3VE2A 2M07A 3AA0B 2KZ7B 4FZMA 2XE3A 4F4BA 2QTKA 4KR8A 2W81C 1ZHZA 3T0SA 4Z3TA 4N59A 4GF4A 2ODJA 5IYUA 5T5FA 4E1SA 4O3XB 3EMNX 2K0LA 3PORA 4AYNA 4O49A 4FT6A 2XE1A 3T20A 3VY9X 3V8UA 1IZNA 2KXPA 2LHFA 2OMFA 4FSPA 4LSHA 3HW9A 1GFNA 2K4TA 1GFOA 8PRNA 1HXXA 4FRTA 3HWBA 4XNKA 3VZWX 3VE1A 4FZNA 3SYBA 2FGQX 5ADXK 4KR4A 2Y2XA 2KXPB 1IZNB 1E54A 2Y0KA 2LFUA 4JCHA 2YPVA 3AA6B 4U9CA 3PQSA 3FYXA 3UPGA 1HXUA 3GP6A 4FSOA 1Q9FA 6PRNA 1H6S1 4D5UA 4LSEA 3DA4A 4O4XA 2J4UP 1QJ9A 4BUMX 3AAEB 4XNLA 1G90A 3PRNA 3AA7A 2YNKA 4C69X 3VZUX 4O3YA 4GCSA 4AFKA 1QJPA 3A2SX 1Q9GA 2O4VA 4GCPA 5EE2A 2XTQA 3AA0A 2F1TA 3K19A 4FMSA 4O3ZA 2W80C 4O3WA 4GCQA 1ZHXA 2PORA 1BH3A 2ZFGA 2Y0HA 4QQ1A 5D5DA 4PUXA 2JMMA 4N58A 3LK2A 2J1NA 2XE2A 4B61A 4D65A 3T24A 4G76A 1PHOA 1GFPA 2KDYA 4FOZA 1HXTA 3AAAA 3SYSA 1ZHWA 3LK2B 4AKRA 3SY7A 1P4TA 3UAQA 2ERVA 2N2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QJ9 A;  2LHF A;  3G7G A;  1G90 A;  2X27 X;  3QRA A;  1QJP A;  2MHL A;  3C5O A;  1Q9G A;  2F1T A;  2M06 A;  3QRC A;  1ORM A;  1THQ A;  1BXW A;  2GE4 A;  2N2M A;  4PUX A;  2JMM A;  1P4T A;  4RLC A;  2M07 A;  1QJ8 A;  2ERV A;  2MNH A;  1MM5 A;  1MM4 A;  3GP6 A;  1Q9F A;  2K0L A;  2F1V A;  2N2L A; 
#chains in the Genus database with same CATH topology
 2XTR A;  2R4N A;  5G3A A;  1OSM A;  2FGR A;  5DL6 A;  2Y0L A;  3BS0 A;  4FRX A;  3WI4 A;  5PRN A;  5GV0 A;  5FVN A;  2R4L A;  3LK4 1;  3SZD A;  4AYI D;  2MHL A;  4LSF A;  3C5O A;  3HOE A;  3NJT A;  3AAA B;  3DA3 A;  4G75 A;  4AKR B;  5B66 O;  3A0B O;  5DL8 A;  4AUI A;  2M06 A;  3LK4 2;  3QRC A;  5AFU K;  3TZG A;  4AYE C;  4PJ0 O;  2JQY A;  1T1L A;  1THQ A;  3PQU A;  1BXW A;  4IL6 O;  3UU2 A;  2N2M A;  2KC0 A;  4FES A;  1OPF A;  4QQ1 A;  2ZLD A;  2X9K A;  4RLC A;  1QJ8 A;  3VZT X;  4AKM A;  4AZL A;  5AFU L;  5ADX L;  2MNH A;  1PRN A;  1GFM A;  5DL5 A;  1MM5 A;  1BT9 A;  1MM4 A;  1GFQ A;  3WU2 O;  1MPF A;  1ZHY A;  4RJX A;  2WJQ A;  3POX A;  2R4O A;  2F1V A;  3VY8 X;  4LSI A;  4RJW A;  3POU A;  3JTY A;  3AAE A;  3AA1 B;  3O0E A;  4E1T A;  5JDP A;  3BRZ A;  3G7G A;  3SY9 A;  3WI5 A;  2X27 X;  3NSG A;  3QRA A;  4RLB A;  4PR7 A;  3LK3 A;  4UB6 O;  2R89 A;  5DL7 A;  1YS5 A;  3HOL A;  3KVD D;  4JFB A;  2R8A A;  4FUV A;  3RBH A;  4AYD C;  2F1C X;  2XE5 A;  3PGS A;  2Y7S A;  1ORM A;  3POQ A;  4FZL A;  2PRN A;  2XMX A;  2KZ7 A;  3AA7 B;  3JCU O;  3LK3 B;  2XG6 A;  4GHB A;  3AA6 A;  5G26 A;  4AYM C;  4D64 A;  2WJR A;  2GE4 A;  3AA1 A;  1ZHT A;  3SZV A;  7PRN A;  4KRA A;  4O4U A;  4RL9 A;  3VE2 A;  2M07 A;  3AA0 B;  2KZ7 B;  4FZM A;  2XE3 A;  4F4B A;  2QTK A;  4KR8 A;  2W81 C;  1ZHZ A;  3T0S A;  5G38 A;  3A0H O;  4Z3T A;  4N59 A;  4GF4 A;  2ODJ A;  5IYU A;  3DWO X;  5T5F A;  4O3X B;  3EMN X;  2K0L A;  3KZI O;  3POR A;  4E1S A;  5H2F O;  4AYN A;  4O49 A;  2IWV A;  4FT6 A;  2XE1 A;  3T20 A;  3VY9 X;  3V8U A;  5TIS O;  5KAI O;  1IZN A;  2KXP A;  2LHF A;  2OMF A;  4FSP A;  4LSH A;  3HW9 A;  5G39 A;  1GFN A;  2K4T A;  1GFO A;  2R4P A;  4CTD A;  4K3B A;  8PRN A;  2WVP A;  1HXX A;  4FRT A;  3HWB A;  4UB8 O;  4XNK A;  3VZW X;  3VE1 A;  4C4V A;  4FZN A;  3SYB A;  2FGQ X;  5ADX K;  4KR4 A;  2Y2X A;  2KXP B;  3DZM A;  1IZN B;  1E54 A;  2Y0K A;  4N75 A;  2LFU A;  4JCH A;  4C4V B;  2YPV A;  3AA6 B;  4U9C A;  5GTH O;  3PQS A;  3FYX A;  3UPG A;  1HXU A;  3GP6 A;  4FSO A;  1Q9F A;  6PRN A;  1S5L O;  1H6S 1;  4D5U A;  3PF1 A;  3DA4 A;  4LSE A;  4O4X A;  1QJ9 A;  5GTI O;  4BUM X;  4C00 A;  2J4U P;  3AAE B;  4XNL A;  1G90 A;  3PRN A;  3AA7 A;  2YNK A;  4C69 X;  3VZU X;  4O3Y A;  4GCS A;  3BRY A;  1QJP A;  4AFK A;  3A2S X;  1Q9G A;  2O4V A;  4GCP A;  5EE2 A;  2XTQ A;  2AXT O;  3AA0 A;  2F1T A;  3K19 A;  4FMS A;  4O3Z A;  3DWN A;  2W80 C;  4O3W A;  4GCQ A;  1ZHX A;  2POR A;  1BH3 A;  2ZFG A;  2Y0H A;  4N74 A;  1T16 A;  2R88 A;  4K3C A;  4PUX A;  2JMM A;  4N58 A;  5D5D A;  5B5E O;  3LK2 A;  4FQE A;  2J1N A;  5E79 O;  2XE2 A;  4B61 A;  4D65 A;  2IWW A;  5KAF O;  3T24 A;  4G76 A;  1PHO A;  1GFP A;  2KDY A;  4FOZ A;  1HXT A;  3AAA A;  3PGU A;  1ZHW A;  3LK2 B;  3SYS A;  3SY7 A;  4AKR A;  1P4T A;  3PGR A;  3UAQ A;  2ERV A;  2N2L A; 
#chains in the Genus database with same CATH homology
 2XTR A;  1OSM A;  2FGR A;  5DL6 A;  2Y0L A;  4FRX A;  3WI4 A;  5PRN A;  5GV0 A;  5FVN A;  3LK4 1;  3SZD A;  4AYI D;  2MHL A;  4LSF A;  3C5O A;  3HOE A;  3AAA B;  3DA3 A;  4G75 A;  4AKR B;  5DL8 A;  4AUI A;  2M06 A;  3LK4 2;  3QRC A;  5AFU K;  3TZG A;  4AYE C;  3UU2 A;  3PQU A;  1THQ A;  1BXW A;  2N2M A;  2KC0 A;  4FES A;  1OPF A;  2ZLD A;  4RLC A;  3VZT X;  1QJ8 A;  4AKM A;  4AZL A;  5AFU L;  5ADX L;  2MNH A;  1PRN A;  1GFM A;  5DL5 A;  1MM5 A;  1BT9 A;  1MM4 A;  1GFQ A;  1MPF A;  1ZHY A;  4RJX A;  3POX A;  2F1V A;  3VY8 X;  4LSI A;  4RJW A;  3POU A;  3JTY A;  3AAE A;  3AA1 B;  3O0E A;  4E1T A;  5JDP A;  3G7G A;  3SY9 A;  3WI5 A;  2X27 X;  3NSG A;  3QRA A;  4RLB A;  3LK3 A;  5DL7 A;  1YS5 A;  3HOL A;  3KVD D;  4JFB A;  4FUV A;  3RBH A;  4AYD C;  2XE5 A;  3POQ A;  4FZL A;  2Y7S A;  1ORM A;  4KRA A;  2PRN A;  2XMX A;  2KZ7 A;  3AA7 B;  3LK3 B;  4GHB A;  2XG6 A;  5G26 A;  3AA6 A;  4AYM C;  4D64 A;  3AA1 A;  2GE4 A;  1ZHT A;  3SZV A;  7PRN A;  4O4U A;  4RL9 A;  3VE2 A;  2M07 A;  3AA0 B;  2KZ7 B;  4FZM A;  2XE3 A;  4F4B A;  2QTK A;  4KR8 A;  2W81 C;  1ZHZ A;  3T0S A;  4Z3T A;  4N59 A;  4GF4 A;  2ODJ A;  5IYU A;  5T5F A;  4E1S A;  4O3X B;  3EMN X;  2K0L A;  3POR A;  4AYN A;  4O49 A;  4FT6 A;  2XE1 A;  3T20 A;  3VY9 X;  3V8U A;  1IZN A;  2KXP A;  2LHF A;  2OMF A;  4FSP A;  4LSH A;  3HW9 A;  1GFN A;  2K4T A;  1GFO A;  8PRN A;  1HXX A;  4FRT A;  3HWB A;  4XNK A;  3VZW X;  3VE1 A;  4FZN A;  3SYB A;  2FGQ X;  5ADX K;  4KR4 A;  2Y2X A;  2KXP B;  1IZN B;  1E54 A;  2Y0K A;  2LFU A;  4JCH A;  2YPV A;  3AA6 B;  4U9C A;  3PQS A;  3FYX A;  3UPG A;  1HXU A;  3GP6 A;  4FSO A;  1Q9F A;  6PRN A;  1H6S 1;  4D5U A;  4LSE A;  3DA4 A;  4O4X A;  2J4U P;  1QJ9 A;  4BUM X;  3AAE B;  4XNL A;  1G90 A;  3PRN A;  3AA7 A;  2YNK A;  4C69 X;  3VZU X;  4O3Y A;  4GCS A;  4AFK A;  1QJP A;  3A2S X;  1Q9G A;  2O4V A;  4GCP A;  5EE2 A;  2XTQ A;  3AA0 A;  2F1T A;  3K19 A;  4FMS A;  4O3Z A;  2W80 C;  4O3W A;  4GCQ A;  1ZHX A;  2POR A;  1BH3 A;  2ZFG A;  2Y0H A;  4QQ1 A;  5D5D A;  4PUX A;  2JMM A;  4N58 A;  3LK2 A;  2J1N A;  2XE2 A;  4B61 A;  4D65 A;  3T24 A;  4G76 A;  1PHO A;  1GFP A;  2KDY A;  4FOZ A;  1HXT A;  3AAA A;  3SYS A;  1ZHW A;  3LK2 B;  4AKR A;  3SY7 A;  1P4T A;  3UAQ A;  2ERV A;  2N2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...