4FZNA

Crystal structure of syringacin m mutant d232a from pseudomonas syringae pv. tomato dc3000
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
276
structure length
276
Chain Sequence
PIELPPTYITPYPEISAGGNGTYRGQDLSSGQSFPRGMQNPVATVLLLQGDLYCSPNCLATFQDQARRDSFGIQSKVALKTFAAADQREAEGRDLRTAYNEIATDIGRSQQINENIIKYPPGNHVLSGGLMTPFHALAHGMFGLGAPLTFPIQNVGLNVDIRGIPDVMNVIQSARPVGTSSLDVNFAYDVGKDSNASWLTLGNITLRLVGTIDKNASGAWTFSGEIRAFNAVYDANPSNHRGWLGENLTSLLSAVPFTSYSIEIPGSLPVTVSGNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacteriocin
publication title The Crystal Structure of the Lipid II-degrading Bacteriocin Syringacin M Suggests Unexpected Evolutionary Relationships between Colicin M-like Bacteriocins.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Antimicrobial protein
total genus 74
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.880 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4fznA01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4fznA02
4G76A 2XTRA 4FZLA 2XTQA 3DA3A 4N58A 4FZMA 3DA4A 2XMXA 4G75A 4N59A 4FZNA
chains in the Genus database with same CATH superfamily
4KTQA 2BHNA 5J8YC 1ZQDA 3SZDA 2DBYA 1ZQQA 4LSHA 3GU3A 5KFMA 3SV4A 4J9QA 3L3FX 3ETLA 7ICSA 5HR6A 3H40A 1X42A 3BZCA 1SV4A 3WKCA 1SWVA 1ZQYA 4NLCA 3BQ1A 2KTQA 2VANA 4QWBA 1DOQA 4C69X 1M6YA 3RR8A 4ECQA 4XNLA 2D8CA 3SAGA 4IC9A 3QUQA 1RM6C 4O3OA 4FZLA 5DBAA 1S8OA 2YB1A 4QWCA 4C8OA 4AFKA 2W7OA 3T0SA 2K8AA 2KK0A 2KMDA 3V6JA 2ERVA 3H8SA 4I2AA 9ICHA 5CHGA 4C7ZA 4LJXA 4IL6U 3CRXA 1CI4A 4AYNA 4RUAA 5KG7A 5ALOA 2YY6A 5HR7A 4AYDC 4QZIA 2LMRA 5ALFA 3KZXA 4RLBA 2GH1A 3U26A 5KFWA 3AQFA 3WK7A 4RU9A 4P4MA 4C4VB 3RBEA 1C7YA 1D9DA 5AI5A 9ICOA 2RRDA 2Y0SF 4RQ2A 3C1ZA 3T5LA 3TQ1A 1BGXT 3D2SA 3BRZA 2AH5A 3MDAA 4DQQA 4DQPA 3NVYA 2LBOA 4KLHA 1Z4OA 1NK8A 5KG2A 3A0HO 3PX0A 3BRYA 4ECYA 3UQ2A 1L5UA 1BPDA 1QJ8A 2XE5A 1X6IA 1RZTA 3ALRA 4FESA 2GOLA 3KFUF 3F2CA 4TQSA 2JEJA 3KOOA 2LKYA 1L3SA 2R8IA 4DSJA 1QSYA 5EWEA 1TVAA 1ORMA 1K5OA 3AMZA 1XO0A 3LWMA 2KJ9A 5ALGA 5HMMA 2XE3A 4RQMA 5AKJA 3RH5A 4I2GA 4C4VA 2H3VA 4F50A 4O3PA 3QU9A 1TK5A 5ALQA 2HCFA 1RDFA 4I2IA 5AI9A 4G3IA 1ECWA 4OJLA 4KLEA 5AI8A 4EEKA 4KX3A 4DEZA 5J2JA 4J9KA 3CNHA 3GZFA 3KKAA 2KZ7B 4F4YA 5DB9A 2ZUDA 8ICSA 9ICXA 4RNNA 2RDIA 1SGGA 1B4FA 1F5SA 4LSEA 2ISPA 5KAFU 5DB6A 4GC6A 1Z00A 1ZQAA 4O3YA 1CUKA 3QEAZ 5JRTA 4O3WA 4Y2TA 3IG8A 4MFAA 2E5SA 3ZDAA 3IM1A 3RJHA 1FEZA 3PX4A 3QZ8A 2M9NA 2KVSA 9ICGA 8ICBA 1S10A 3RB0A 4Z6EA 5ALVA 5C0YA 2LPEA 3OJUA 3HOLA 1KDHA 3MGVA 4F4KA 4UAUA 1K1QA 4KMOB 9ICUA 1MPFA 4DF8A 3V6KA 2XVTA 4EENA 8ICHA 1A6SA 2KZ7A 3I28A 3M8RA 2DQNB 4I27A 2BDUA 4KITB 4C0ZA 1NZBA 9ICEA 3BS7A 4M9GA 3RJGA 3QU2A 1VJ5A 1YZ6A 4KLFA 4LZGA 5KFCA 4J9MA 3G7GA 7ICLA 2A1AA 2PFOA 5TZVA 5F9NA 3QEBZ 4KN4A 1SXDA 1JN3A 2FMSA 1ZHYA 1KN5A 4AYEC 3CYMA 2FMQA 3BZKA 1N48A 5DLGA 3H8WA 3DEEA 3UXOA 4Z6CA 4YMOA 3AL0B 2PRNA 2W55A 1U47A 5J0UA 4GFJA 4O0IA 4QZBA 2OHFA 7ICKA 4FZNA 2AU0A 3TANA 3QU5A 3EPIA 5DLFA 3EYZA 1K1SA 3FM9A 5CJ7A 4YP3A 4JWNA 2C22A 5DG7A 4G76A 7PRNA 2EAPA 4C8KA 1ZD4A 4DS4A 3V7KA 3MDCA 2ALZA 9ICJA 3QUCA 8ICPA 4Q45A 1BPEA 2FPMA 3C5GA 3E2EA 2JMGA 1D8LA 4MFFA 4ECTA 1XSNA 2J4UP 5BPCA 2W8LA 4AKMA 7ICJA 3ED5A 4ED3A 2ESEA 1Q46A 2YQEA 5AKIA 4YCXA 3G6XA 2H3IA 4Z6FA 1ZYQA 4LZDA 1BH3A 2BCRA 4DLGA 4UB6U 4PGQA 5EE1A 3NJTA 5AKEA 4RQ8A 1OW5A 2EH9A 2OXOA 1S5LO 1NKCA 5J0TA 1ZJMA 2LYAA 9ICFA 2JR5A 1JIHA 5J0OA 2PMZF 3ZI4A 4CDGA 2Q0ZX 4MEYA 2HHUA 4QWDA 3PW5A 3HRDD 4F8RA 5B5EO 5DBCA 2DF4B 1HXTA 4QZ9A 4HAIA 3PR4A 1ZD3A 4O4UA 1BPBA 2WF9A 3WKAA 1COKA 3JPPA 1UQVA 5ADXL 3GIIA 2JXJA 2F1CX 4QW9A 4EZ6A 3FC4A 3POQA 4UB1A 4F93B 3PX6A 2K0LA 1U45A 4GF4A 5J2KA 2J1NA 1SZPA 4OJ5A 4Z3TA 4ZH4A 4UB5A 3F2BA 3SEIA 4YMNA 1WG8A 4RNMA 4IR1A 1KFSA 1ZQPA 3HWBA 1T8EA 4F5PA 4US8A 1ZQ1C 2AGPA 3TAPA 2OWOA 1ZQXA 9ICNA 1XO1A 4UBBA 1T16A 4FQEA 4PZOA 5T5FA 5KFOA 4UW9A 2KKVA 4EBDA 4JK1A 4Y2VA 5J2IA 4KR4A 7ICQA 2PFNA 1SL2A 3HP6A 3TFRA 2B0CA 2J6UA 2M0NA 4QWAA 2E8NA 2XCPA 3Q8RB 2LHTA 5L9XA 3ZD9A 9ICAA 4DQSA 4JFBA 4MFCA 4DS5A 3A2SX 2HHTA 5DG9A 4KX5A 1AQ6A 5L1MA 2YMQA 7ICEA 4YXJA 4QZEA 3VZUX 4RLCA 1PHOA 1COOA 3A0BU 3MABA 4Q8FA 2YMPA 4NY8A 2X9KA 1NI3A 2NYVA 3L4PA 8ICYA 1L8LA 4O3XB 5KFJA 4KR8A 1KFDA 8ICWA 3HKZF 2EAOA 2FI1A 1QCKA 1MQ2A 2XG6A 1X9WA 4F5NA 2CPRA 3GV8B 1ZQOA 3NGDA 3UPQA 5DKWA 1ZD2P 5DQGA 4UAZA 2O4VA 3AA1B 1L7MA 3Q8MA 5KFUA 3JPOA 3IN5A 4B9SA 3V7LA 3NVZA 4F91B 3BJYA 5GTHO 1ZQWA 4Q44A 1QJPA 2V4QA 3I76A 2KHQA 2HBJA 4D64A 4UATA 2HHWA 2RDJA 4NL9C 4EEYA 1U4BA 2H3FA 3RH4A 1QH9A 1Z1BA 3M9OB 5EE0A 1DK2A 3PV8A 4XRHA 2C28A 5KAFO 2ES6A 1RXWA 1ZQSA 2OCEA 2G5HB 4O3RA 5KT5A 4KLOA 4DSLA 1BPYA 1MM5A 2ZIUB 5D4BA 4K4IA 5JUMA 1MN8A 4LSFA 1P4TA 1IIPA 4M47A 1UT8A 5J2BA 3AA1A 4U9CA 3SYZA 2R88A 3H7IA 4AYBF 2MUTB 1D9FA 3D2NA 3UXPA 3LVVA 4C7YA 2R8HA 4AYID 2JMMA 1V38A 3KKAC 5KG1A 5J0YA 1JXEA 4KLIA 4D65A 2JH7A 1WCLA 1FIQA 2WB1F 5KG3A 3N7PD 2DGZA 3K19A 2AGQA 3KHLA 2ZJAA 1ZHWA 2PI5A 4ELUA 1RXVA 4B9UA 2WHEA 2IA6A 2VKQA 2N2MA 3SYSA 2H3QA 3MGIA 3ISBA 4J9SA 4PHPA 4FRXA 1ZHXA 1XNSA 1ZHZA 1FFVA 1X6JA 2W9AA 2Y1JA 3WU2U 2GO7A 4RQNA 4LSIA 5DL7A 2RHFA 3DDHA 4ECXA 5IIJA 1IM4A 3JPNA 3SAFA 2VJ5A 2MUTA 3MR2A 5G5GA 2G08A 1GO3F 2W3SA 2WTFA 4JUZA 3PGSA 3THVA 4R8UB 4M9NA 3HJEA 1X9SA 1T3NA 3N97B 2HHQA 3RB4A 2G06A 2QB0A 3DZMA 2KSOA 4O3NA 3GV7B 3ZDBA 2GE4A 2B6GA 5AI0A 5B66U 1SZHA 3BDPA 5KFEA 1HUZA 1ZETA 2D3DA 4DF4A 4PGYA 2ZTDA 3ICXA 2BPCA 3WKEA 4NM2A 5ALYA 1IZNB 1IV8A 1ZQLA 5AKKA 4U6PA 2ZFGA 3ZDDA 4DQRA 4RQ6A 3PW7A 1D8YA 2HOFA 2Y0HA 4E1SA 3EMNX 2E8OA 4CF3A 1U48A 1YZ7A 5ALLA 1SV0A 4B6JA 4N59A 2BQRA 2NV3A 1PVPA 3IG5A 2K60A 4R8UA 3HILA 3PY8A 4AKRB 3QXGA 3GIMA 5E79O 4DSFA 4J03A 3SMVA 4ED6A 3IP4B 4YN4A 2UVRA 4XNKA 1OUQA 1YS5A 2XE2A 2IHNA 4PJ0O 5BOMA 4EZ9A 1TAUA 4YQWA 1WCNA 2KP7A 3WKDA 1S0NA 2I1QA 2W54A 4RPYA 4QIWF 1Q9FA 5HHIA 3LVWA 4BX9C 5KT2A 3RRHA 4PGXA 3MC1A 2XGPA 4G9BA 3IV6A 1ZQRA 7ICHA 4R65A 4F4ZA 2JEGA 1KTQA 3N4MB 4KRAA 2IOFK 1RYSA 1L3TA 3PZPA 4DL7A 2HBMA 1DGJA 1BPXA 3M7DA 3QX7A 1BPZA 5AM5A 4CNQA 3GP6A 4AKRA 1GFMA 4AZLA 5ALTA 1BT9A 3AA7B 4KLQA 1E54A 4NV0A 5AM2A 2R4OA 5FVNA 5IIMA 2J6TA 4TURA 2YX8A 5ALRA 2KZ3A 3M9NB 1TFRA 2A1JB 4KN7A 1CEZA 4N74A 2V9WA 3BS5B 4GHBA 4DFJA 5ALSA 4US9A 4CF5A 1TAMA 3MR6A 5KL1B 2WAQF 2NRWA 4Y2QA 1H6S1 5AI4A 2KEYA 7ICTA 4M6WB 3ISCA 2DKXA 1YT3A 1QQ5A 3NVWA 4M9LA 5D5DA 2DUYA 3UQ0A 3SZVA 2N2LA 4NLBA 1NKEA 1NJXA 5J2HA 3Q8QB 5DQHA 4NLZA 2JEIA 3EZ5A 3V6HA 3OGUA 5HP4A 2NRXA 2LI6A 4CE6A 9ICRA 3AA7A 4G75A 3BQ7A 1B43A 1JALA 5J2AA 3C2KA 5KFLA 3UPGA 2W03A 3A0BO 2BZFA 1JMSA 4EYIB 1T1LA 1LKYB 2A1JA 4UB2A 4BXOB 1KKXA 3BS5A 4DFPA 1A77A 1ZXIA 1D8BA 1UT5A 4DOCA 2BCUA 3TACB 4K3CA 2MNHA 3HW9A 4CCHA 4M6WA 4UAWA 5L1JA 1ZRNA 4P4OA 2ZIVB 2Y0KA 3GILA 4Q8EA 5AI6A 4NXZA 4F2SA 3ORYA 3DWOX 3T3FA 4F71A 1NOMA 4JB3A 4C4SA 2EANA 4K3BA 1N62A 7ICGA 4QZGA 3PGRA 4J9RA 1N60A 2F2AB 2WJQA 3TADC 3PQUA 3F5AA 4CTDA 3SY9A 1PK1B 4FE3A 4EYHB 1BVSA 2W43A 2KV2A 1LKYA 3RTVA 4NLGA 2FPLA 2OMFA 2FE9A 3QU4A 7ICOA 1TAQA 1BNOA 5L1KA 5AFUL 5J0XA 2Z7JA 3ETRA 5KFVA 4Z6DA 4I29A 2HHXA 5AK5A 4ECUA 3QUBA 4AP9A 3UMCA 2ZIVA 5IIKA 2F3NA 4UB3A 1ZQFA 1HUOA 4FSPA 5KAIO 8ICIA 5G5HA 1S0OA 2RLTA 4DL3A 5DGAA 2I9GA 2ZTEA 2EZXA 4UB8U 4PL1A 4KMUA 4ECSA 1BXWA 3NVVA 4RNOA 5AIAA 1OXJA 3OHBA 1KW4A 5KNIA 1PK1A 1V85A 5KFBA 2JV3A 1XU4A 1PVRA 4B9MA 3K75D 1L7OA 1JUDA 1L8OA 1QQ7A 5J2CA 4NLNA 2YNKA 4FS1A 2FLPA 2ISOA 3AU2A 2MRLA 4K4GA 4DL6A 5J2FA 2VA2A 3K1ZA 5ALWA 4FMSA 3PSIA 3UXNA 4E1TA 1UHUA 2IOFA 2BCVA 1ZQMA 1G90A 2XMXA 4MEXA 3WK5A 4FT6A 2QB1A 1WWVA 5GTIO 1A0PA 2CRXA 4ECWA 3SY7A 3FYHA 5H2FO 1HJPA 2PI4A 3RAXA 5JU5A 3SENA 1RYRA 2KDYA 2FPKA 9ICKA 2V4RA 2HBKA 5B66O 3BQ0A 4J9LA 4KLLA 3JCUO 2XIDA 2XTRA 4ECVA 2EZZA 3KBBA 8ICAA 4RL9A 1XWLA 5F9LA 2AQ4A 2A19A 4DSKA 4ACOA 4DWIA 2WVPA 2C2EA 3EWAA 4IS7A 1T94A 3AA0B 2W8KA 4DO9A 5DGBA 3PSTA 4PH5A 4RQ1A 1QQ6A 4I2EA 3RH6A 1T7PA 8PRNA 4HYKA 5J0RA 4M9HA 1RQLA 2H3ZA 5FP0A 2K8CB 4N58A 3LK2B 4DFKA 4AYMC 3PO4A 7ICMA 1F0MA 3VZWX 2XCAA 5DDMA 4EELA 2VJ4A 5D49A 8ICLA 4BUMX 4DFMA 3C21A 1J2NA 2BCQA 4IR9A 2F44A 2DL0A 1VDVA 1LVHA 1RYUA 5EWFA 5G26A 5T14A 1TV9A 5J2GA 4FBTA 1Q8KA 2DPIA 1MQ3A 4TUPA 5J0WA 3O0EA 4IL6O 1SV0C 2MU2A 3PW2A 4GCSA 4DSIA 5KFPA 2KIVA 3HOEA 3LK42 3RB3A 1N5XA 4YXMA 4M2YA 3G6YA 2QARB 1SKWA 5AKHA 4FBUA 1ZJNA 3VY9X 3WK9A 3A0HU 2QLTA 2BPFA 4YD2A 3FYXA 3RJKA 3T5KA 3RJIA 5ALKA 2BQUA 5AKGA 3H0LB 1IXRA 3PW4A 3PVXA 5AKXA 4O5EA 4Q43A 3B0YA 4R63A 1UCVA 2Y1IA 3RJEA 1KFTA 2DFLA 5EE9A 3OJSA 4Y2RA 1ZQBA 2JRZA 1PK3A 1GFOA 5ALJA 5IYUA 5AHXA 1BNPA 2BPGA 3D2QA 5EE2A 1NJYA 2QKQA 2VA3A 3GIKA 2LHFA 3IRUA 5KT3A 1FFUA 4YMMA 3WK4A 1Q3UA 4RQ7A 2P6RA 4F5OA 4CRXA 3D6JA 1NK5A 2O6KA 3LYSA 1PRNA 4RZRA 4TUSA 2IWVA 1KLNA 2K4EA 2ODGA 4P0PB 3NTUA 3LK3B 2I6XA 1FO4A 4NM1A 2E3TA 4IQVA 3MFHA 4F5QA 3Q8LA 2J6SA 5GV0A 4FZMA 3KHHA 3TKAA 2Y0SC 4C8NA 2ZTCA 4F92B 4I2FA 1NK7A 3AAAB 3C2MA 1NKBA 2HBLA 1EXNA 4BUGA 2KKPA 4C00A 4JV1A 1S76D 4QZHA 4IRCA 2PXIA 2K4HA 3OTQA 5KTQA 3T20A 5DG8A 3MR5A 1RQNA 3VE2A 3VY8X 2UVUA 2GWSA 2R8JA 1WWUA 7ICRA 5G38A 2VIXA 4USAA 4FUVA 3PSFA 2K89A 4I2JA 4ED7A 2G0AA 3T24A 4P0QB 3LK3A 4CGZA 4NWIA 2H5XA 1OPFA 2M06A 2LFUA 4KLDA 1S77D 1VLBA 3C5OA 4UBCA 5AICA 3HT3A 5DBBA 1URJA 2BR0A 2RQ5A 5AKLA 5CA7A 2FGRA 3AAAA 5KG0A 3WK8A 1QLNA 5KFQA 1S0MA 4NLKA 2YN4A 4X5VA 2ATLA 4PZNA 3C5FA 4OCZA 3JPSA 3RAQA 3N28A 2WF6A 2ZIUA 3AM9A 2L5YA 4KLSA 4EX6A 2F77X 2C2DA 4Y2YA 3PORA 4KLMA 5AIBA 2KOBA 5ALEA 3OPXA 2KICA 2AGOA 3K4GA 8ICFA 4ECRA 1SWWA 3UMBA 5KT4A 4P2HA 1X9MA 4M9JA 8ICKA 3PW0A 5AKYA 3AUOA 4UB4A 5J0SA 2W3RA 2ZJ8A 3RJFA 8ICGA 2Y9TA 2F1HA 1T4GA 4JV0A 8ICCA 1SKSA 5AK6A 3PO5A 2HHSA 4OO1J 3V8UA 4F2RA 1N56A 1S0VA 1SL0A 4IQWA 4RPZA 2UVWA 3PMLA 4XUSA 2ODJA 3C29A 2HVIA 3QNMA 2W7PA 4KLJA 3VC8A 5JDPA 5ALMA 4YR2A 3UM9A 4C4TA 1HXUA 2DKZA 3UAQA 3NS1A 4FRTA 2C2RA 2AJQA 5AM4A 4UAYA 2KZMA 2F1VA 1ZQEA 4F3OA 3B0XA 9ICBA 2HHVA 5KFDA 2Y7SA 4QZ8A 4YD1A 3N7RC 4FOZA 1ZQNA 3HX0A 4UB6O 5G39A 5KT6A 3H8MA 5AM1A 2FDRA 3M1YA 4DL4A 3C2LA 5B5EU 2NRTA 2MSNA 3SAHA 1PZNA 2MAXA 3SR6A 4GLXA 3HW8A 1V97A 2LYBA 2PORA 3SZ2A 2WF5A 1NK6A 1SKRA 4ED2A 1QSLA 2K4PA 1SIJA 1IZNA 5IIOA 1V9PA 1ZQGA 5DDYA 4M04A 4ELTA 4O4XA 2XGQA 8ICTA 2KFNA 1N63A 4RJXA 1L3UA 2W80C 4GCPA 1J97A 8ICJA 2F76X 4QZDA 2X27X 4DLEA 2BDPA 1ZQHA 3WKBA 2KZZA 4GC7A 4IRDA 1GFPA 2R4LA 2E8MA 3KVDD 3KHRA 3OSPA 3PRNA 4IRKA 1SXEA 3K1RB 2CN1A 3T79A 4OJ6A 1UPHA 3IDWA 4B9NA 2W81C 1RPLA 2KVCA 2BGWA 3MR3A 2WFAA 4F5RA 3GIJA 3UMGA 4KLTA 2R89A 4R64A 3M8SA 2P66A 5HNKA 2I5HA 3L5KA 4XA5A 4YFKA 4ICAA 3QUTA 3QYPA 1GFNA 1TKDA 3HWTA 1UA0A 3POUA 2NO4A 2E1FA 3KHGA 2PMZC 4QQ1A 3HPOA 4NJ8A 5A0LA 3ZDEA 1ZQTA 2YPVA 5KFAA 5K4LA 4O3MA 5DB7A 3GV5B 2FGQX 2P6UA 4B9TA 4DFDA 4O5KA 3LDAA 4RQ3A 4OJOA 4NL9A 2EDUA 7ICUA 1JROA 3H0RB 1Z00B 3PMNA 2W9CB 4FO6A 5ALXA 4B9VA 5KFSA 5J2DA 4P4PA 1NK4A 2ASJA 3UU2A 4E0DA 3KZIU 8ICQA 1KEJA 4LVSA 8ICVA 2R8GA 2KFZA 3H8JA 5EE3A 3M6KA 2HI0A 1IG6A 3PSPA 2BKEA 1SB3C 2YTUA 3TAQA 5GTHU 7ICPA 2JHDA 5CP2A 2ASLA 4F72A 4ECZA 5DL6A 5CWRA 2PKEA 5AK4A 5AKZA 4DSEA 8ICOA 2Y2XA 1WUDA 4RJWA 4MF2A 4DL2A 2HW3A 4QWEA 4DOBA 4EX7A 4R66A 3VZTX 5KFYA 3KD3A 5TISU 1Q3VA 3V7JA 5AFUK 1THQA 2NRVA 2W9CA 5ALDA 2XI9A 3RBDA 3DA3A 3O0FA 2XC9A 2XTQA 1Z1VA 1ED1A 4BXOA 2R4PA 4O5CA 4AUIA 3CP8A 3VE1A 1Q9GA 2ZIWB 4RT2A 3ONNA 1QTMA 2KIWA 2N1RA 2W9MA 2FJ6A 1LV5A 1KL9A 4O49A 1MA7A 2K4TA 1JX4A 2P35A 5CEHA 3ZDCA 4YR3A 2FMPA 3ISDA 1NK9A 2XY7A 1JRPA 4C8MA 2IBKA 2KG5A 5AM3A 3E58A 2QTKA 5F3XB 2KD1A 3F5EA 3MBYA 3G6VA 2F1JA 3HKZC 3PR5B 7ICFA 2AXTU 1L7PA 4BJQA 4UQGA 4RQ4A 2K4IA 2DPJA 1C20A 1O03A 4F4BA 5J0QA 2KNJA 5KFHA 4RPXA 2R8AA 8ICEA 2F8KA 4OJPA 3M9MB 5L1LA 3ZD8A 3WK6A 3RB6A 4O9MA 4A8EA 2Y9UA 3JPQA 8ICNA 2IWWA 3MFIA 1ZQZA 1L7NA 4QNLA 3BQTA 3JPRA 2ZIWA 3AAEB 5J8YA 3WU2O 2WF7A 9ICQA 1ZD5A 3AA6B 2ZIXB 1P7DA 1MC8A 9ICVA 1X66A 2XY6A 4PPXA 4RT3A 8ICUA 5KFFA 4F4WA 4B9LA 3NUQA 2DWQA 2IMWP 1KQQA 5KFZA 4Y2XA 3RR7A 3QRAA 1ZRMA 2AQ0A 4DL5A 4C80A 1LB2B 3F2DA 1O08A 5KFIA 1CRXA 1OSMA 4YG2A 4PHAA 3JPTA 1NJWA 3S6JA 2F1TA 4BWMA 4PUXA 2KHVA 7ICIA 2Y0LA 4AYBC 1HIWA 1B22A 3SYBA 1X9XA 2B21A 5ALPA 1B0XA 1XSLA 2D6FC 3KTQA 1SL1A 2ZJ5A 1ZQUA 4XQ8A 4RUCA 3POXA 2HOQA 3AAEA 2Q4TA 5KFXA 5ADXK 1H38A 3SI8A 3AA6A 7ICVA 2WB1C 2ZIXA 2FLNA 3PF1A 4ED8A 2YMMA 4YVZA 1HXXA 5E79U 1KSPA 2RP5A 2XICA 3GQCA 1N2XA 3PNCA 1MSWD 4RQ0A 4DOAA 1U9LA 2ASDA 5ALHA 4FFDA 3RRGA 2NO5A 2KJ5A 2A3VA 1ZOLA 4PJ0U 2F1IA 2G09A 4J9PA 2WJRA 2ZUBA 5C5JA 3OHAA 3AQEA 1DRGA 4QJFB 4TQRA 4QZCA 4GIBA 4C8LA 2XY5A 4Y2PA 2M07A 1ZQJA 9ICTA 4O3ZA 5JTIA 5KG4A 2UVVA 3NRWA 3AA0A 5ALZA 4BGDA 4PHDA 4MF8A 5EWGA 3JTYA 9ICIA 1J2MA 2KN7A 4YR0A 3SV3A 2OEHA 5AM0A 1TK0A 3SQIA 3LK2A 4O3SA 2BQ3A 5IINA 2MA1A 3NSGA 2AHOB 1NJZA 5KT7A 3OSNA 4GXIA 3E0FA 4J9NA 2JZBB 3EPGA 1L3VA 3TZGA 8ICZA 5J2EA 4BWJA 3AU6A 3AN1A 5IIIA 5KL8B 3WI4A 2HOIA 4JMUA 2W11A 2HDOA 5DB8A 2HSZA 2KJ8A 2R4NA 3C28A 2G5IB 3R9KA 1L6NA 3Q8SB 1KBUA 1HEKA 4BDPA 2EQYA 2LYHA 5KFKA 3T5JA 3AEVA 4DCCA 1AROP 1T3QA 2EAMA 3WI5A 8ICRA 7ICNA 4FS2A 3TARA 4QZAA 2XO7A 3BS0A 4I2BA 2QARA 6PRNA 2OH2A 1WYGA 8ICMA 2HVHA 4MHVA 3RFAA 1NK0A 3C1YA 3QRCA 2WF8A 3RF9A 4QIWC 3J81j 1RG6A 4CF4A 5KG6A 4GXKA 2PFQA 4GCQA 3QU7A 4ED1A 9ICWA 3TADA 2ZG6A 5DL5A 2JZBA 4WJ3B 1KRPA 4UARA 4OD0A 1ZHTA 2HMXA 1N61A 5KFNA 2E8PA 3KZIO 4B61A 4O3QA 4KLGA 4I28A 3T5HA 5HHHA 4KLUA 4F4XA 4PL2A 5G3AA 3C23A 3QZ7A 5L1IA 4TUQA 2KE7A 2YB4A 1Z4NA 3NASA 3H4DA 2OYYA 1DK3A 3Q8KA 9ICCA 4RQ5A 4JV2A 4U7CA 3QE9Y 3RBHA 1NZPA 1NNLA 3PQSA 4JWMA 3SD7A 5CRXA 4I2HA 2G07A 4J9OA 1UA1A 5DL8A 1DXSA 2JGAA 1N5WA 1S97A 2JEFA 3CW2C 9ICMA 3DA4A 5HMLA 2F8LA 2LM1A 4Y2JA 1ZQIA 3TFSA 2KXPB 2ZUCA 5BOLA 1Z3EB 3IHQB 4DQIA 4K4HA 5TISO 4GXJA 5CB1A 5KFRA 1GFQA 2WAQC 1S9FA 4P0PA 4JCHA 3MGHA 2ZXHA 3BQ2A 4ED0A 5PRNA 2KC0A 1PVQA 1TE2A 1JXLA 2R8KA 2OM6A 3H0MB 8ICXA 5KFGA 9ICSA 4N75A 5IILA 3H4BA 3VCBA 1TK8A 1ZQCA 5KAIU 4EBEA 5ALNA 2ZLDA 1X40A 5ALIA 3FDSA 1X2IA 2QB0B 2NRZA 2BCSA 2KSOB 2LM4A 1MM4A 2E1EA 3RJJA 2W9BB 5J0PA 4C4RA 3GDXA 3V72A 4QZFA 3LK9A 2KXPA 4Y2UA 4UB8O 2AXTO 3N7SC 1U49A 2CXYA 2JH1A 1PUZA 5KG5A 2R18A 1F44A 1Y88A 4P0QA 3DWNA 3LK41 1DGSA 2YMLA 5ALUA 4ELVA 3F53A 2K8BB 5AK3A 2IHMA 2XE1A 4Y2SA 4ZOHC 2FLLA 1XSPA 5D46A 4M0AA 9ICLA 1Z19A 2PFPA 3FAHA 4EBCA 4UASA 3B9JA 2ZXIA 1QSSA 2MHLA 2JQYA 2IOHA 4QW8A 2GLEA 3LWLA 5J29A 4PR7A 5GTIU 1QJ9A 2VA8A 5DQIA 5H2FU 3Q8PB 4I2CA 3PGUA 2EZYA 1ZQVA 2W9BA 4FSOA 1JI7A 3EW9A 4IQUA 1ZQKA 3GFKB 3I1YA 3M6ZA 5KFTA 4I2DA 4IQTA 5EOZA 9ICPA 3DV9A 4PHEA 4D5UA 4UAVA 1XS9D 1S5LU 3TI0A 1XC9A 5CR0A 3NRZA 3EUB2 1A76A 2W04A
chains in the Genus database with same CATH topology
5DL6A 4RL9A 4ACOA 3SZDA 1QJPA 4LSHA 3GU3A 1T94A 3AA0B 3PSTA 3L3FX 2KHQA 2Y2XA 1WUDA 2HBJA 5HR6A 4RJWA 4D64A 2H3FA 8PRNA 3VZTX 4NLCA 1Z1BA 1Q3VA 2H3ZA 4C69X 5AFUK 4XNLA 1THQA 2K8CB 4N58A 3LK2B 4AYMC 2XI9A 3SAGA 3DA3A 4IC9A 3VZWX 2G5HB 3O0FA 1MM5A 2ZIUB 2VJ4A 4FZLA 2XTQA 4BUMX 2YB1A 1ED1A 4LSFA 4AUIA 3CP8A 1IIPA 1P4TA 3VE1A 2W7OA 4AFKA 3T0SA 1Q9GA 2ZIWB 2K8AA 3ONNA 2ERVA 2KIWA 2N1RA 3AA1A 4U9CA 4AYBF 5G26A 5T14A 4O49A 1MA7A 2K4TA 3D2NA 3CRXA 3LVVA 4AYNA 4AYID 5HR7A 2JMMA 4AYDC 3O0EA 3KZXA 4GCSA 4RLBA 4D65A 2GH1A 2JH7A 2QTKA 3HOEA 3AQFA 2KD1A 2WB1F 3F5EA 3LK42 3HKZC 3N7PD 4BJQA 2DGZA 3K19A 2K4IA 2RRDA 2Y0SF 4F4BA 1ZHWA 2KNJA 3D2SA 2VKQA 2N2MA 3SYSA 4OJPA 3VY9X 2H3QA 2LBOA 3FYXA 4FRXA 1ZHXA 4A8EA 1XNSA 3H0LB 1ZHZA 4LSIA 4QNLA 2RHFA 5DL7A 2ZIWA 3AAEB 3SAFA 1QJ8A 2VJ5A 2XE5A 3AA6B 2ZIXB 3ALRA 4FESA 2G08A 1P7DA 1GO3F 2GOLA 3KFUF 3F2CA 2LKYA 1GFOA 1ORMA 5IYUA 2G06A 3NUQA 1XO0A 3D2QA 5EE2A 2KJ9A 3QRAA 2XE3A 2GE4A 3F2DA 2LHFA 2H3VA 1CRXA 1OSMA 1SZHA 4PUXA 2F1TA 1Q3UA 3ICXA 2KHVA 2Y0LA 4AYBC 1HIWA 4CRXA 1IZNB 3SYBA 4U6PA 2ZFGA 1ECWA 4OJLA 3LYSA 2D6FC 1PRNA 2K4EA 4KX3A 4P0PB 3LK3B 3POXA 2HOQA 2HOFA 3AAEA 2Q4TA 2Y0HA 4E1SA 5ADXK 3GZFA 3EMNX 2KZ7B 3AA6A 4N59A 2WB1C 2ZIXA 2NV3A 1PVPA 5GV0A 3IG5A 4FZMA 1HXXA 2Y0SC 4LSEA 3AAAB 2RP5A 2XICA 4AKRB 4O3YA 4BUGA 2KKPA 4O3WA 3SMVA 2KJ5A 3IG8A 2E5SA 2A3VA 3IP4B 2K4HA 3T20A 4XNKA 1OUQA 2G09A 1YS5A 2XE2A 3VE2A 3VY8X 3AQEA 1DRGA 4QJFB 5C0YA 4QIWF 1Q9FA 2VIXA 3LVWA 3HOLA 4FUVA 3MGVA 3PSFA 4BX9C 1MPFA 4KMOB 2K89A 2G0AA 2XVTA 2M07A 3T24A 4P0QB 3LK3A 4O3ZA 4CGZA 4NWIA 3NRWA 3AA0A 1A6SA 1OPFA 2KZ7A 2M06A 2LFUA 4KRAA 2DQNB 3C5OA 3JTYA 3PZPA 2BDUA 2HBMA 4C0ZA 1NZBA 1URJA 3M7DA 2FGRA 3AAAA 3GP6A 4AKRA 1GFMA 4AZLA 3SQIA 3LK2A 3G7GA 1BT9A 3AA7B 2MA1A 3NSGA 1E54A 1ZHYA 4NV0A 5FVNA 4AYEC 3CYMA 3E0FA 2ZIUA 2YX8A 3TZGA 2F77X 3DEEA 3AL0B 5KL8B 2PRNA 3PORA 4GFJA 2HOIA 3WI4A 2KOBA 4JMUA 4GHBA 4FZNA 2KJ8A 2G5IB 3OPXA 1TAMA 3C28A 2KICA 1L6NA 1KBUA 1HEKA 5KL1B 2WAQF 1H6S1 2KEYA 1YT3A 5D5DA 4G76A 3WI5A 7PRNA 3SZVA 2N2LA 4NLBA 6PRNA 2OH2A 4OO1J 3V8UA 3RFAA 2JMGA 3AA7A 3QRCA 3RF9A 4QIWC 4G75A 4GCQA 2J4UP 4AKMA 2ZG6A 5DL5A 2ODJA 3UPGA 3C29A 4WJ3B 2W03A 2W7PA 1ZHTA 3VC8A 2HMXA 2H3IA 5JDPA 1BH3A 1HXUA 3UAQA 4FRTA 4B61A 2F1VA 1D8BA 2Y7SA 4PL2A 2MNHA 3HW9A 3N7RC 4FOZA 2YB4A 2OXOA 2LYAA 2OYYA 2ZIVB 2Y0KA 2PMZF 4U7CA 4CDGA 3SAHA 3RBHA 3PQSA 2LYBA 5CRXA 2G07A 2DF4B 1HXTA 2PORA 5DL8A 2JGAA 4O4UA 3DA4A 2F8LA 2F2AB 2KXPB 1IZNA 3PQUA 3F5AA 5ADXL 3SY9A 4FE3A 1GFQA 2WAQC 3POQA 4P0PA 4JCHA 2KV2A 4O4XA 2ZXHA 2OMFA 5PRNA 2KC0A 2K0LA 1PVQA 4GF4A 4RJXA 5AFUL 2J1NA 4OJ5A 2Z7JA 2OM6A 3H0MB 4Z3TA 2W80C 4GCPA 3F2BA 3VCBA 2F76X 3HWBA 2ZIVA 2X27X 1ZQ1C 2ZLDA 1GFPA 4FSPA 3KVDD 1MM4A 3PRNA 2E1EA 2CN1A 3T79A 5T5FA 4OJ6A 4PL1A 2KKVA 1UPHA 1BXWA 4KR4A 2W81C 2KVCA 2KXPA 3N7SC 2JH1A 1PVRA 2M0NA 2R18A 1F44A 4ICAA 2LHTA 1GFNA 2YNKA 4P0QA 3LK41 3POUA 2E1FA 2K8BB 3F53A 2MRLA 2PMZC 4JFBA 4QQ1A 2XE1A 5A0LA 3K1ZA 2YPVA 3A2SX 4O3MA 4FMSA 3PSIA 1Z19A 2FGQX 2ZXIA 2MHLA 4KX5A 4E1TA 3VZUX 1G90A 4OJOA 4RLCA 2XMXA 1QJ9A 1PHOA 3H0RB 4FT6A 1A0PA 2CRXA 4O3XB 3SY7A 4KR8A 4FSOA 3UU2A 3HKZF 3M6ZA 2KDYA 2XG6A 3M6KA 2CPRA 2HBKA 3PSPA 4D5UA 2XIDA 2O4VA 3AA1B 2XTRA 3IN5A 2JHDA 2HBLA 2W04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G76 A;  2XTR A;  4FZL A;  2XTQ A;  3DA3 A;  4N58 A;  4FZM A;  3DA4 A;  2XMX A;  4G75 A;  4N59 A;  4FZN A; 
#chains in the Genus database with same CATH topology
 4KTQ A;  2BHN A;  5J8Y C;  1ZQD A;  3SZD A;  2DBY A;  1ZQQ A;  4LSH A;  3GU3 A;  5KFM A;  3SV4 A;  4J9Q A;  3L3F X;  3ETL A;  7ICS A;  5HR6 A;  3H40 A;  1X42 A;  3BZC A;  1SV4 A;  3WKC A;  1SWV A;  1ZQY A;  4NLC A;  3BQ1 A;  2KTQ A;  2VAN A;  4QWB A;  1DOQ A;  4C69 X;  1M6Y A;  3RR8 A;  4ECQ A;  4XNL A;  2D8C A;  3SAG A;  4IC9 A;  3QUQ A;  1RM6 C;  4O3O A;  4FZL A;  5DBA A;  1S8O A;  2YB1 A;  4QWC A;  4C8O A;  4AFK A;  2W7O A;  3T0S A;  2K8A A;  2KK0 A;  2KMD A;  3V6J A;  2ERV A;  3H8S A;  4I2A A;  9ICH A;  5CHG A;  4C7Z A;  4LJX A;  4IL6 U;  3CRX A;  1CI4 A;  4AYN A;  4RUA A;  5KG7 A;  5ALO A;  2YY6 A;  5HR7 A;  4AYD C;  4QZI A;  2LMR A;  5ALF A;  3KZX A;  4RLB A;  2GH1 A;  3U26 A;  5KFW A;  3AQF A;  3WK7 A;  4RU9 A;  4P4M A;  4C4V B;  3RBE A;  1C7Y A;  1D9D A;  5AI5 A;  9ICO A;  2RRD A;  2Y0S F;  4RQ2 A;  3C1Z A;  3T5L A;  3TQ1 A;  1BGX T;  3D2S A;  3BRZ A;  2AH5 A;  3MDA A;  4DQQ A;  4DQP A;  3NVY A;  2LBO A;  4KLH A;  1Z4O A;  1NK8 A;  5KG2 A;  3A0H O;  3PX0 A;  3BRY A;  4ECY A;  3UQ2 A;  1L5U A;  1BPD A;  1QJ8 A;  2XE5 A;  1X6I A;  1RZT A;  3ALR A;  4FES A;  2GOL A;  3KFU F;  3F2C A;  4TQS A;  2JEJ A;  3KOO A;  2LKY A;  1L3S A;  2R8I A;  4DSJ A;  1QSY A;  5EWE A;  1TVA A;  1ORM A;  1K5O A;  3AMZ A;  1XO0 A;  3LWM A;  2KJ9 A;  5ALG A;  5HMM A;  2XE3 A;  4RQM A;  5AKJ A;  3RH5 A;  4I2G A;  4C4V A;  2H3V A;  4F50 A;  4O3P A;  3QU9 A;  1TK5 A;  5ALQ A;  2HCF A;  1RDF A;  4I2I A;  5AI9 A;  4G3I A;  1ECW A;  4OJL A;  4KLE A;  5AI8 A;  4EEK A;  4KX3 A;  4DEZ A;  5J2J A;  4J9K A;  3CNH A;  3GZF A;  3KKA A;  2KZ7 B;  4F4Y A;  5DB9 A;  2ZUD A;  8ICS A;  9ICX A;  4RNN A;  2RDI A;  1SGG A;  1B4F A;  1F5S A;  4LSE A;  2ISP A;  5KAF U;  5DB6 A;  4GC6 A;  1Z00 A;  1ZQA A;  4O3Y A;  1CUK A;  3QEA Z;  5JRT A;  4O3W A;  4Y2T A;  3IG8 A;  4MFA A;  2E5S A;  3ZDA A;  3IM1 A;  3RJH A;  1FEZ A;  3PX4 A;  3QZ8 A;  2M9N A;  2KVS A;  9ICG A;  8ICB A;  1S10 A;  3RB0 A;  4Z6E A;  5ALV A;  5C0Y A;  2LPE A;  3OJU A;  3HOL A;  1KDH A;  3MGV A;  4F4K A;  4UAU A;  1K1Q A;  4KMO B;  9ICU A;  1MPF A;  4DF8 A;  3V6K A;  2XVT A;  4EEN A;  8ICH A;  1A6S A;  2KZ7 A;  3I28 A;  3M8R A;  2DQN B;  4I27 A;  2BDU A;  4KIT B;  4C0Z A;  1NZB A;  9ICE A;  3BS7 A;  4M9G A;  3RJG A;  3QU2 A;  1VJ5 A;  1YZ6 A;  4KLF A;  4LZG A;  5KFC A;  4J9M A;  3G7G A;  7ICL A;  2A1A A;  2PFO A;  5TZV A;  5F9N A;  3QEB Z;  4KN4 A;  1SXD A;  1JN3 A;  2FMS A;  1ZHY A;  1KN5 A;  4AYE C;  3CYM A;  2FMQ A;  3BZK A;  1N48 A;  5DLG A;  3H8W A;  3DEE A;  3UXO A;  4Z6C A;  4YMO A;  3AL0 B;  2PRN A;  2W55 A;  1U47 A;  5J0U A;  4GFJ A;  4O0I A;  4QZB A;  2OHF A;  7ICK A;  4FZN A;  2AU0 A;  3TAN A;  3QU5 A;  3EPI A;  5DLF A;  3EYZ A;  1K1S A;  3FM9 A;  5CJ7 A;  4YP3 A;  4JWN A;  2C22 A;  5DG7 A;  4G76 A;  7PRN A;  2EAP A;  4C8K A;  1ZD4 A;  4DS4 A;  3V7K A;  3MDC A;  2ALZ A;  9ICJ A;  3QUC A;  8ICP A;  4Q45 A;  1BPE A;  2FPM A;  3C5G A;  3E2E A;  2JMG A;  1D8L A;  4MFF A;  4ECT A;  1XSN A;  2J4U P;  5BPC A;  2W8L A;  4AKM A;  7ICJ A;  3ED5 A;  4ED3 A;  2ESE A;  1Q46 A;  2YQE A;  5AKI A;  4YCX A;  3G6X A;  2H3I A;  4Z6F A;  1ZYQ A;  4LZD A;  1BH3 A;  2BCR A;  4DLG A;  4UB6 U;  4PGQ A;  5EE1 A;  3NJT A;  5AKE A;  4RQ8 A;  1OW5 A;  2EH9 A;  2OXO A;  1S5L O;  1NKC A;  5J0T A;  1ZJM A;  2LYA A;  9ICF A;  2JR5 A;  1JIH A;  5J0O A;  2PMZ F;  3ZI4 A;  4CDG A;  2Q0Z X;  4MEY A;  2HHU A;  4QWD A;  3PW5 A;  3HRD D;  4F8R A;  5B5E O;  5DBC A;  2DF4 B;  1HXT A;  4QZ9 A;  4HAI A;  3PR4 A;  1ZD3 A;  4O4U A;  1BPB A;  2WF9 A;  3WKA A;  1COK A;  3JPP A;  1UQV A;  5ADX L;  3GII A;  2JXJ A;  2F1C X;  4QW9 A;  4EZ6 A;  3FC4 A;  3POQ A;  4UB1 A;  4F93 B;  3PX6 A;  2K0L A;  1U45 A;  4GF4 A;  5J2K A;  2J1N A;  1SZP A;  4OJ5 A;  4Z3T A;  4ZH4 A;  4UB5 A;  3F2B A;  3SEI A;  4YMN A;  1WG8 A;  4RNM A;  4IR1 A;  1KFS A;  1ZQP A;  3HWB A;  1T8E A;  4F5P A;  4US8 A;  1ZQ1 C;  2AGP A;  3TAP A;  2OWO A;  1ZQX A;  9ICN A;  1XO1 A;  4UBB A;  1T16 A;  4FQE A;  4PZO A;  5T5F A;  5KFO A;  4UW9 A;  2KKV A;  4EBD A;  4JK1 A;  4Y2V A;  5J2I A;  4KR4 A;  7ICQ A;  2PFN A;  1SL2 A;  3HP6 A;  3TFR A;  2B0C A;  2J6U A;  2M0N A;  4QWA A;  2E8N A;  2XCP A;  3Q8R B;  2LHT A;  5L9X A;  3ZD9 A;  9ICA A;  4DQS A;  4JFB A;  4MFC A;  4DS5 A;  3A2S X;  2HHT A;  5DG9 A;  4KX5 A;  1AQ6 A;  5L1M A;  2YMQ A;  7ICE A;  4YXJ A;  4QZE A;  3VZU X;  4RLC A;  1PHO A;  1COO A;  3A0B U;  3MAB A;  4Q8F A;  2YMP A;  4NY8 A;  2X9K A;  1NI3 A;  2NYV A;  3L4P A;  8ICY A;  1L8L A;  4O3X B;  5KFJ A;  4KR8 A;  1KFD A;  8ICW A;  3HKZ F;  2EAO A;  2FI1 A;  1QCK A;  1MQ2 A;  2XG6 A;  1X9W A;  4F5N A;  2CPR A;  3GV8 B;  1ZQO A;  3NGD A;  3UPQ A;  5DKW A;  1ZD2 P;  5DQG A;  4UAZ A;  2O4V A;  3AA1 B;  1L7M A;  3Q8M A;  5KFU A;  3JPO A;  3IN5 A;  4B9S A;  3V7L A;  3NVZ A;  4F91 B;  3BJY A;  5GTH O;  1ZQW A;  4Q44 A;  1QJP A;  2V4Q A;  3I76 A;  2KHQ A;  2HBJ A;  4D64 A;  4UAT A;  2HHW A;  2RDJ A;  4NL9 C;  4EEY A;  1U4B A;  2H3F A;  3RH4 A;  1QH9 A;  1Z1B A;  3M9O B;  5EE0 A;  1DK2 A;  3PV8 A;  4XRH A;  2C28 A;  5KAF O;  2ES6 A;  1RXW A;  1ZQS A;  2OCE A;  2G5H B;  4O3R A;  5KT5 A;  4KLO A;  4DSL A;  1BPY A;  1MM5 A;  2ZIU B;  5D4B A;  4K4I A;  5JUM A;  1MN8 A;  4LSF A;  1P4T A;  1IIP A;  4M47 A;  1UT8 A;  5J2B A;  3AA1 A;  4U9C A;  3SYZ A;  2R88 A;  3H7I A;  4AYB F;  2MUT B;  1D9F A;  3D2N A;  3UXP A;  3LVV A;  4C7Y A;  2R8H A;  4AYI D;  2JMM A;  1V38 A;  3KKA C;  5KG1 A;  5J0Y A;  1JXE A;  4KLI A;  4D65 A;  2JH7 A;  1WCL A;  1FIQ A;  2WB1 F;  5KG3 A;  3N7P D;  2DGZ A;  3K19 A;  2AGQ A;  3KHL A;  2ZJA A;  1ZHW A;  2PI5 A;  4ELU A;  1RXV A;  4B9U A;  2WHE A;  2IA6 A;  2VKQ A;  2N2M A;  3SYS A;  2H3Q A;  3MGI A;  3ISB A;  4J9S A;  4PHP A;  4FRX A;  1ZHX A;  1XNS A;  1ZHZ A;  1FFV A;  1X6J A;  2W9A A;  2Y1J A;  3WU2 U;  2GO7 A;  4RQN A;  4LSI A;  5DL7 A;  2RHF A;  3DDH A;  4ECX A;  5IIJ A;  1IM4 A;  3JPN A;  3SAF A;  2VJ5 A;  2MUT A;  3MR2 A;  5G5G A;  2G08 A;  1GO3 F;  2W3S A;  2WTF A;  4JUZ A;  3PGS A;  3THV A;  4R8U B;  4M9N A;  3HJE A;  1X9S A;  1T3N A;  3N97 B;  2HHQ A;  3RB4 A;  2G06 A;  2QB0 A;  3DZM A;  2KSO A;  4O3N A;  3GV7 B;  3ZDB A;  2GE4 A;  2B6G A;  5AI0 A;  5B66 U;  1SZH A;  3BDP A;  5KFE A;  1HUZ A;  1ZET A;  2D3D A;  4DF4 A;  4PGY A;  2ZTD A;  3ICX A;  2BPC A;  3WKE A;  4NM2 A;  5ALY A;  1IZN B;  1IV8 A;  1ZQL A;  5AKK A;  4U6P A;  2ZFG A;  3ZDD A;  4DQR A;  4RQ6 A;  3PW7 A;  1D8Y A;  2HOF A;  2Y0H A;  4E1S A;  3EMN X;  2E8O A;  4CF3 A;  1U48 A;  1YZ7 A;  5ALL A;  1SV0 A;  4B6J A;  4N59 A;  2BQR A;  2NV3 A;  1PVP A;  3IG5 A;  2K60 A;  4R8U A;  3HIL A;  3PY8 A;  4AKR B;  3QXG A;  3GIM A;  5E79 O;  4DSF A;  4J03 A;  3SMV A;  4ED6 A;  3IP4 B;  4YN4 A;  2UVR A;  4XNK A;  1OUQ A;  1YS5 A;  2XE2 A;  2IHN A;  4PJ0 O;  5BOM A;  4EZ9 A;  1TAU A;  4YQW A;  1WCN A;  2KP7 A;  3WKD A;  1S0N A;  2I1Q A;  2W54 A;  4RPY A;  4QIW F;  1Q9F A;  5HHI A;  3LVW A;  4BX9 C;  5KT2 A;  3RRH A;  4PGX A;  3MC1 A;  2XGP A;  4G9B A;  3IV6 A;  1ZQR A;  7ICH A;  4R65 A;  4F4Z A;  2JEG A;  1KTQ A;  3N4M B;  4KRA A;  2IOF K;  1RYS A;  1L3T A;  3PZP A;  4DL7 A;  2HBM A;  1DGJ A;  1BPX A;  3M7D A;  3QX7 A;  1BPZ A;  5AM5 A;  4CNQ A;  3GP6 A;  4AKR A;  1GFM A;  4AZL A;  5ALT A;  1BT9 A;  3AA7 B;  4KLQ A;  1E54 A;  4NV0 A;  5AM2 A;  2R4O A;  5FVN A;  5IIM A;  2J6T A;  4TUR A;  2YX8 A;  5ALR A;  2KZ3 A;  3M9N B;  1TFR A;  2A1J B;  4KN7 A;  1CEZ A;  4N74 A;  2V9W A;  3BS5 B;  4GHB A;  4DFJ A;  5ALS A;  4US9 A;  4CF5 A;  1TAM A;  3MR6 A;  5KL1 B;  2WAQ F;  2NRW A;  4Y2Q A;  1H6S 1;  5AI4 A;  2KEY A;  7ICT A;  4M6W B;  3ISC A;  2DKX A;  1YT3 A;  1QQ5 A;  3NVW A;  4M9L A;  5D5D A;  2DUY A;  3UQ0 A;  3SZV A;  2N2L A;  4NLB A;  1NKE A;  1NJX A;  5J2H A;  3Q8Q B;  5DQH A;  4NLZ A;  2JEI A;  3EZ5 A;  3V6H A;  3OGU A;  5HP4 A;  2NRX A;  2LI6 A;  4CE6 A;  9ICR A;  3AA7 A;  4G75 A;  3BQ7 A;  1B43 A;  1JAL A;  5J2A A;  3C2K A;  5KFL A;  3UPG A;  2W03 A;  3A0B O;  2BZF A;  1JMS A;  4EYI B;  1T1L A;  1LKY B;  2A1J A;  4UB2 A;  4BXO B;  1KKX A;  3BS5 A;  4DFP A;  1A77 A;  1ZXI A;  1D8B A;  1UT5 A;  4DOC A;  2BCU A;  3TAC B;  4K3C A;  2MNH A;  3HW9 A;  4CCH A;  4M6W A;  4UAW A;  5L1J A;  1ZRN A;  4P4O A;  2ZIV B;  2Y0K A;  3GIL A;  4Q8E A;  5AI6 A;  4NXZ A;  4F2S A;  3ORY A;  3DWO X;  3T3F A;  4F71 A;  1NOM A;  4JB3 A;  4C4S A;  2EAN A;  4K3B A;  1N62 A;  7ICG A;  4QZG A;  3PGR A;  4J9R A;  1N60 A;  2F2A B;  2WJQ A;  3TAD C;  3PQU A;  3F5A A;  4CTD A;  3SY9 A;  1PK1 B;  4FE3 A;  4EYH B;  1BVS A;  2W43 A;  2KV2 A;  1LKY A;  3RTV A;  4NLG A;  2FPL A;  2OMF A;  2FE9 A;  3QU4 A;  7ICO A;  1TAQ A;  1BNO A;  5L1K A;  5AFU L;  5J0X A;  2Z7J A;  3ETR A;  5KFV A;  4Z6D A;  4I29 A;  2HHX A;  5AK5 A;  4ECU A;  3QUB A;  4AP9 A;  3UMC A;  2ZIV A;  5IIK A;  2F3N A;  4UB3 A;  1ZQF A;  1HUO A;  4FSP A;  5KAI O;  8ICI A;  5G5H A;  1S0O A;  2RLT A;  4DL3 A;  5DGA A;  2I9G A;  2ZTE A;  2EZX A;  4UB8 U;  4PL1 A;  4KMU A;  4ECS A;  1BXW A;  3NVV A;  4RNO A;  5AIA A;  1OXJ A;  3OHB A;  1KW4 A;  5KNI A;  1PK1 A;  1V85 A;  5KFB A;  2JV3 A;  1XU4 A;  1PVR A;  4B9M A;  3K75 D;  1L7O A;  1JUD A;  1L8O A;  1QQ7 A;  5J2C A;  4NLN A;  2YNK A;  4FS1 A;  2FLP A;  2ISO A;  3AU2 A;  2MRL A;  4K4G A;  4DL6 A;  5J2F A;  2VA2 A;  3K1Z A;  5ALW A;  4FMS A;  3PSI A;  3UXN A;  4E1T A;  1UHU A;  2IOF A;  2BCV A;  1ZQM A;  1G90 A;  2XMX A;  4MEX A;  3WK5 A;  4FT6 A;  2QB1 A;  1WWV A;  5GTI O;  1A0P A;  2CRX A;  4ECW A;  3SY7 A;  3FYH A;  5H2F O;  1HJP A;  2PI4 A;  3RAX A;  5JU5 A;  3SEN A;  1RYR A;  2KDY A;  2FPK A;  9ICK A;  2V4R A;  2HBK A;  5B66 O;  3BQ0 A;  4J9L A;  4KLL A;  3JCU O;  2XID A;  2XTR A;  4ECV A;  2EZZ A;  3KBB A;  8ICA A;  4RL9 A;  1XWL A;  5F9L A;  2AQ4 A;  2A19 A;  4DSK A;  4ACO A;  4DWI A;  2WVP A;  2C2E A;  3EWA A;  4IS7 A;  1T94 A;  3AA0 B;  2W8K A;  4DO9 A;  5DGB A;  3PST A;  4PH5 A;  4RQ1 A;  1QQ6 A;  4I2E A;  3RH6 A;  1T7P A;  8PRN A;  4HYK A;  5J0R A;  4M9H A;  1RQL A;  2H3Z A;  5FP0 A;  2K8C B;  4N58 A;  3LK2 B;  4DFK A;  4AYM C;  3PO4 A;  7ICM A;  1F0M A;  3VZW X;  2XCA A;  5DDM A;  4EEL A;  2VJ4 A;  5D49 A;  8ICL A;  4BUM X;  4DFM A;  3C21 A;  1J2N A;  2BCQ A;  4IR9 A;  2F44 A;  2DL0 A;  1VDV A;  1LVH A;  1RYU A;  5EWF A;  5G26 A;  5T14 A;  1TV9 A;  5J2G A;  4FBT A;  1Q8K A;  2DPI A;  1MQ3 A;  4TUP A;  5J0W A;  3O0E A;  4IL6 O;  1SV0 C;  2MU2 A;  3PW2 A;  4GCS A;  4DSI A;  5KFP A;  2KIV A;  3HOE A;  3LK4 2;  3RB3 A;  1N5X A;  4YXM A;  4M2Y A;  3G6Y A;  2QAR B;  1SKW A;  5AKH A;  4FBU A;  1ZJN A;  3VY9 X;  3WK9 A;  3A0H U;  2QLT A;  2BPF A;  4YD2 A;  3FYX A;  3RJK A;  3T5K A;  3RJI A;  5ALK A;  2BQU A;  5AKG A;  3H0L B;  1IXR A;  3PW4 A;  3PVX A;  5AKX A;  4O5E A;  4Q43 A;  3B0Y A;  4R63 A;  1UCV A;  2Y1I A;  3RJE A;  1KFT A;  2DFL A;  5EE9 A;  3OJS A;  4Y2R A;  1ZQB A;  2JRZ A;  1PK3 A;  1GFO A;  5ALJ A;  5IYU A;  5AHX A;  1BNP A;  2BPG A;  3D2Q A;  5EE2 A;  1NJY A;  2QKQ A;  2VA3 A;  3GIK A;  2LHF A;  3IRU A;  5KT3 A;  1FFU A;  4YMM A;  3WK4 A;  1Q3U A;  4RQ7 A;  2P6R A;  4F5O A;  4CRX A;  3D6J A;  1NK5 A;  2O6K A;  3LYS A;  1PRN A;  4RZR A;  4TUS A;  2IWV A;  1KLN A;  2K4E A;  2ODG A;  4P0P B;  3NTU A;  3LK3 B;  2I6X A;  1FO4 A;  4NM1 A;  2E3T A;  4IQV A;  3MFH A;  4F5Q A;  3Q8L A;  2J6S A;  5GV0 A;  4FZM A;  3KHH A;  3TKA A;  2Y0S C;  4C8N A;  2ZTC A;  4F92 B;  4I2F A;  1NK7 A;  3AAA B;  3C2M A;  1NKB A;  2HBL A;  1EXN A;  4BUG A;  2KKP A;  4C00 A;  4JV1 A;  1S76 D;  4QZH A;  4IRC A;  2PXI A;  2K4H A;  3OTQ A;  5KTQ A;  3T20 A;  5DG8 A;  3MR5 A;  1RQN A;  3VE2 A;  3VY8 X;  2UVU A;  2GWS A;  2R8J A;  1WWU A;  7ICR A;  5G38 A;  2VIX A;  4USA A;  4FUV A;  3PSF A;  2K89 A;  4I2J A;  4ED7 A;  2G0A A;  3T24 A;  4P0Q B;  3LK3 A;  4CGZ A;  4NWI A;  2H5X A;  1OPF A;  2M06 A;  2LFU A;  4KLD A;  1S77 D;  1VLB A;  3C5O A;  4UBC A;  5AIC A;  3HT3 A;  5DBB A;  1URJ A;  2BR0 A;  2RQ5 A;  5AKL A;  5CA7 A;  2FGR A;  3AAA A;  5KG0 A;  3WK8 A;  1QLN A;  5KFQ A;  1S0M A;  4NLK A;  2YN4 A;  4X5V A;  2ATL A;  4PZN A;  3C5F A;  4OCZ A;  3JPS A;  3RAQ A;  3N28 A;  2WF6 A;  2ZIU A;  3AM9 A;  2L5Y A;  4KLS A;  4EX6 A;  2F77 X;  2C2D A;  4Y2Y A;  3POR A;  4KLM A;  5AIB A;  2KOB A;  5ALE A;  3OPX A;  2KIC A;  2AGO A;  3K4G A;  8ICF A;  4ECR A;  1SWW A;  3UMB A;  5KT4 A;  4P2H A;  1X9M A;  4M9J A;  8ICK A;  3PW0 A;  5AKY A;  3AUO A;  4UB4 A;  5J0S A;  2W3R A;  2ZJ8 A;  3RJF A;  8ICG A;  2Y9T A;  2F1H A;  1T4G A;  4JV0 A;  8ICC A;  1SKS A;  5AK6 A;  3PO5 A;  2HHS A;  4OO1 J;  3V8U A;  4F2R A;  1N56 A;  1S0V A;  1SL0 A;  4IQW A;  4RPZ A;  2UVW A;  3PML A;  4XUS A;  2ODJ A;  3C29 A;  2HVI A;  3QNM A;  2W7P A;  4KLJ A;  3VC8 A;  5JDP A;  5ALM A;  4YR2 A;  3UM9 A;  4C4T A;  1HXU A;  2DKZ A;  3UAQ A;  3NS1 A;  4FRT A;  2C2R A;  2AJQ A;  5AM4 A;  4UAY A;  2KZM A;  2F1V A;  1ZQE A;  4F3O A;  3B0X A;  9ICB A;  2HHV A;  5KFD A;  2Y7S A;  4QZ8 A;  4YD1 A;  3N7R C;  4FOZ A;  1ZQN A;  3HX0 A;  4UB6 O;  5G39 A;  5KT6 A;  3H8M A;  5AM1 A;  2FDR A;  3M1Y A;  4DL4 A;  3C2L A;  5B5E U;  2NRT A;  2MSN A;  3SAH A;  1PZN A;  2MAX A;  3SR6 A;  4GLX A;  3HW8 A;  1V97 A;  2LYB A;  2POR A;  3SZ2 A;  2WF5 A;  1NK6 A;  1SKR A;  4ED2 A;  1QSL A;  2K4P A;  1SIJ A;  1IZN A;  5IIO A;  1V9P A;  1ZQG A;  5DDY A;  4M04 A;  4ELT A;  4O4X A;  2XGQ A;  8ICT A;  2KFN A;  1N63 A;  4RJX A;  1L3U A;  2W80 C;  4GCP A;  1J97 A;  8ICJ A;  2F76 X;  4QZD A;  2X27 X;  4DLE A;  2BDP A;  1ZQH A;  3WKB A;  2KZZ A;  4GC7 A;  4IRD A;  1GFP A;  2R4L A;  2E8M A;  3KVD D;  3KHR A;  3OSP A;  3PRN A;  4IRK A;  1SXE A;  3K1R B;  2CN1 A;  3T79 A;  4OJ6 A;  1UPH A;  3IDW A;  4B9N A;  2W81 C;  1RPL A;  2KVC A;  2BGW A;  3MR3 A;  2WFA A;  4F5R A;  3GIJ A;  3UMG A;  4KLT A;  2R89 A;  4R64 A;  3M8S A;  2P66 A;  5HNK A;  2I5H A;  3L5K A;  4XA5 A;  4YFK A;  4ICA A;  3QUT A;  3QYP A;  1GFN A;  1TKD A;  3HWT A;  1UA0 A;  3POU A;  2NO4 A;  2E1F A;  3KHG A;  2PMZ C;  4QQ1 A;  3HPO A;  4NJ8 A;  5A0L A;  3ZDE A;  1ZQT A;  2YPV A;  5KFA A;  5K4L A;  4O3M A;  5DB7 A;  3GV5 B;  2FGQ X;  2P6U A;  4B9T A;  4DFD A;  4O5K A;  3LDA A;  4RQ3 A;  4OJO A;  4NL9 A;  2EDU A;  7ICU A;  1JRO A;  3H0R B;  1Z00 B;  3PMN A;  2W9C B;  4FO6 A;  5ALX A;  4B9V A;  5KFS A;  5J2D A;  4P4P A;  1NK4 A;  2ASJ A;  3UU2 A;  4E0D A;  3KZI U;  8ICQ A;  1KEJ A;  4LVS A;  8ICV A;  2R8G A;  2KFZ A;  3H8J A;  5EE3 A;  3M6K A;  2HI0 A;  1IG6 A;  3PSP A;  2BKE A;  1SB3 C;  2YTU A;  3TAQ A;  5GTH U;  7ICP A;  2JHD A;  5CP2 A;  2ASL A;  4F72 A;  4ECZ A;  5DL6 A;  5CWR A;  2PKE A;  5AK4 A;  5AKZ A;  4DSE A;  8ICO A;  2Y2X A;  1WUD A;  4RJW A;  4MF2 A;  4DL2 A;  2HW3 A;  4QWE A;  4DOB A;  4EX7 A;  4R66 A;  3VZT X;  5KFY A;  3KD3 A;  5TIS U;  1Q3V A;  3V7J A;  5AFU K;  1THQ A;  2NRV A;  2W9C A;  5ALD A;  2XI9 A;  3RBD A;  3DA3 A;  3O0F A;  2XC9 A;  2XTQ A;  1Z1V A;  1ED1 A;  4BXO A;  2R4P A;  4O5C A;  4AUI A;  3CP8 A;  3VE1 A;  1Q9G A;  2ZIW B;  4RT2 A;  3ONN A;  1QTM A;  2KIW A;  2N1R A;  2W9M A;  2FJ6 A;  1LV5 A;  1KL9 A;  4O49 A;  1MA7 A;  2K4T A;  1JX4 A;  2P35 A;  5CEH A;  3ZDC A;  4YR3 A;  2FMP A;  3ISD A;  1NK9 A;  2XY7 A;  1JRP A;  4C8M A;  2IBK A;  2KG5 A;  5AM3 A;  3E58 A;  2QTK A;  5F3X B;  2KD1 A;  3F5E A;  3MBY A;  3G6V A;  2F1J A;  3HKZ C;  3PR5 B;  7ICF A;  2AXT U;  1L7P A;  4BJQ A;  4UQG A;  4RQ4 A;  2K4I A;  2DPJ A;  1C20 A;  1O03 A;  4F4B A;  5J0Q A;  2KNJ A;  5KFH A;  4RPX A;  2R8A A;  8ICE A;  2F8K A;  4OJP A;  3M9M B;  5L1L A;  3ZD8 A;  3WK6 A;  3RB6 A;  4O9M A;  4A8E A;  2Y9U A;  3JPQ A;  8ICN A;  2IWW A;  3MFI A;  1ZQZ A;  1L7N A;  4QNL A;  3BQT A;  3JPR A;  2ZIW A;  3AAE B;  5J8Y A;  3WU2 O;  2WF7 A;  9ICQ A;  1ZD5 A;  3AA6 B;  2ZIX B;  1P7D A;  1MC8 A;  9ICV A;  1X66 A;  2XY6 A;  4PPX A;  4RT3 A;  8ICU A;  5KFF A;  4F4W A;  4B9L A;  3NUQ A;  2DWQ A;  2IMW P;  1KQQ A;  5KFZ A;  4Y2X A;  3RR7 A;  3QRA A;  1ZRM A;  2AQ0 A;  4DL5 A;  4C80 A;  1LB2 B;  3F2D A;  1O08 A;  5KFI A;  1CRX A;  1OSM A;  4YG2 A;  4PHA A;  3JPT A;  1NJW A;  3S6J A;  2F1T A;  4BWM A;  4PUX A;  2KHV A;  7ICI A;  2Y0L A;  4AYB C;  1HIW A;  1B22 A;  3SYB A;  1X9X A;  2B21 A;  5ALP A;  1B0X A;  1XSL A;  2D6F C;  3KTQ A;  1SL1 A;  2ZJ5 A;  1ZQU A;  4XQ8 A;  4RUC A;  3POX A;  2HOQ A;  3AAE A;  2Q4T A;  5KFX A;  5ADX K;  1H38 A;  3SI8 A;  3AA6 A;  7ICV A;  2WB1 C;  2ZIX A;  2FLN A;  3PF1 A;  4ED8 A;  2YMM A;  4YVZ A;  1HXX A;  5E79 U;  1KSP A;  2RP5 A;  2XIC A;  3GQC A;  1N2X A;  3PNC A;  1MSW D;  4RQ0 A;  4DOA A;  1U9L A;  2ASD A;  5ALH A;  4FFD A;  3RRG A;  2NO5 A;  2KJ5 A;  2A3V A;  1ZOL A;  4PJ0 U;  2F1I A;  2G09 A;  4J9P A;  2WJR A;  2ZUB A;  5C5J A;  3OHA A;  3AQE A;  1DRG A;  4QJF B;  4TQR A;  4QZC A;  4GIB A;  4C8L A;  2XY5 A;  4Y2P A;  2M07 A;  1ZQJ A;  9ICT A;  4O3Z A;  5JTI A;  5KG4 A;  2UVV A;  3NRW A;  3AA0 A;  5ALZ A;  4BGD A;  4PHD A;  4MF8 A;  5EWG A;  3JTY A;  9ICI A;  1J2M A;  2KN7 A;  4YR0 A;  3SV3 A;  2OEH A;  5AM0 A;  1TK0 A;  3SQI A;  3LK2 A;  4O3S A;  2BQ3 A;  5IIN A;  2MA1 A;  3NSG A;  2AHO B;  1NJZ A;  5KT7 A;  3OSN A;  4GXI A;  3E0F A;  4J9N A;  2JZB B;  3EPG A;  1L3V A;  3TZG A;  8ICZ A;  5J2E A;  4BWJ A;  3AU6 A;  3AN1 A;  5III A;  5KL8 B;  3WI4 A;  2HOI A;  4JMU A;  2W11 A;  2HDO A;  5DB8 A;  2HSZ A;  2KJ8 A;  2R4N A;  3C28 A;  2G5I B;  3R9K A;  1L6N A;  3Q8S B;  1KBU A;  1HEK A;  4BDP A;  2EQY A;  2LYH A;  5KFK A;  3T5J A;  3AEV A;  4DCC A;  1ARO P;  1T3Q A;  2EAM A;  3WI5 A;  8ICR A;  7ICN A;  4FS2 A;  3TAR A;  4QZA A;  2XO7 A;  3BS0 A;  4I2B A;  2QAR A;  6PRN A;  2OH2 A;  1WYG A;  8ICM A;  2HVH A;  4MHV A;  3RFA A;  1NK0 A;  3C1Y A;  3QRC A;  2WF8 A;  3RF9 A;  4QIW C;  3J81 j;  1RG6 A;  4CF4 A;  5KG6 A;  4GXK A;  2PFQ A;  4GCQ A;  3QU7 A;  4ED1 A;  9ICW A;  3TAD A;  2ZG6 A;  5DL5 A;  2JZB A;  4WJ3 B;  1KRP A;  4UAR A;  4OD0 A;  1ZHT A;  2HMX A;  1N61 A;  5KFN A;  2E8P A;  3KZI O;  4B61 A;  4O3Q A;  4KLG A;  4I28 A;  3T5H A;  5HHH A;  4KLU A;  4F4X A;  4PL2 A;  5G3A A;  3C23 A;  3QZ7 A;  5L1I A;  4TUQ A;  2KE7 A;  2YB4 A;  1Z4N A;  3NAS A;  3H4D A;  2OYY A;  1DK3 A;  3Q8K A;  9ICC A;  4RQ5 A;  4JV2 A;  4U7C A;  3QE9 Y;  3RBH A;  1NZP A;  1NNL A;  3PQS A;  4JWM A;  3SD7 A;  5CRX A;  4I2H A;  2G07 A;  4J9O A;  1UA1 A;  5DL8 A;  1DXS A;  2JGA A;  1N5W A;  1S97 A;  2JEF A;  3CW2 C;  9ICM A;  3DA4 A;  5HML A;  2F8L A;  2LM1 A;  4Y2J A;  1ZQI A;  3TFS A;  2KXP B;  2ZUC A;  5BOL A;  1Z3E B;  3IHQ B;  4DQI A;  4K4H A;  5TIS O;  4GXJ A;  5CB1 A;  5KFR A;  1GFQ A;  2WAQ C;  1S9F A;  4P0P A;  4JCH A;  3MGH A;  2ZXH A;  3BQ2 A;  4ED0 A;  5PRN A;  2KC0 A;  1PVQ A;  1TE2 A;  1JXL A;  2R8K A;  2OM6 A;  3H0M B;  8ICX A;  5KFG A;  9ICS A;  4N75 A;  5IIL A;  3H4B A;  3VCB A;  1TK8 A;  1ZQC A;  5KAI U;  4EBE A;  5ALN A;  2ZLD A;  1X40 A;  5ALI A;  3FDS A;  1X2I A;  2QB0 B;  2NRZ A;  2BCS A;  2KSO B;  2LM4 A;  1MM4 A;  2E1E A;  3RJJ A;  2W9B B;  5J0P A;  4C4R A;  3GDX A;  3V72 A;  4QZF A;  3LK9 A;  2KXP A;  4Y2U A;  4UB8 O;  2AXT O;  3N7S C;  1U49 A;  2CXY A;  2JH1 A;  1PUZ A;  5KG5 A;  2R18 A;  1F44 A;  1Y88 A;  4P0Q A;  3DWN A;  3LK4 1;  1DGS A;  2YML A;  5ALU A;  4ELV A;  3F53 A;  2K8B B;  5AK3 A;  2IHM A;  2XE1 A;  4Y2S A;  4ZOH C;  2FLL A;  1XSP A;  5D46 A;  4M0A A;  9ICL A;  1Z19 A;  2PFP A;  3FAH A;  4EBC A;  4UAS A;  3B9J A;  2ZXI A;  1QSS A;  2MHL A;  2JQY A;  2IOH A;  4QW8 A;  2GLE A;  3LWL A;  5J29 A;  4PR7 A;  5GTI U;  1QJ9 A;  2VA8 A;  5DQI A;  5H2F U;  3Q8P B;  4I2C A;  3PGU A;  2EZY A;  1ZQV A;  2W9B A;  4FSO A;  1JI7 A;  3EW9 A;  4IQU A;  1ZQK A;  3GFK B;  3I1Y A;  3M6Z A;  5KFT A;  4I2D A;  4IQT A;  5EOZ A;  9ICP A;  3DV9 A;  4PHE A;  4D5U A;  4UAV A;  1XS9 D;  1S5L U;  3TI0 A;  1XC9 A;  5CR0 A;  3NRZ A;  3EUB 2;  1A76 A;  2W04 A; 
#chains in the Genus database with same CATH homology
 5DL6 A;  4RL9 A;  4ACO A;  3SZD A;  1QJP A;  4LSH A;  3GU3 A;  1T94 A;  3AA0 B;  3PST A;  3L3F X;  2KHQ A;  2Y2X A;  1WUD A;  2HBJ A;  5HR6 A;  4RJW A;  4D64 A;  2H3F A;  8PRN A;  3VZT X;  4NLC A;  1Z1B A;  1Q3V A;  2H3Z A;  4C69 X;  5AFU K;  4XNL A;  1THQ A;  2K8C B;  4N58 A;  3LK2 B;  4AYM C;  2XI9 A;  3SAG A;  3DA3 A;  4IC9 A;  3VZW X;  2G5H B;  3O0F A;  1MM5 A;  2ZIU B;  2VJ4 A;  4FZL A;  2XTQ A;  4BUM X;  2YB1 A;  1ED1 A;  4LSF A;  4AUI A;  3CP8 A;  1IIP A;  1P4T A;  3VE1 A;  2W7O A;  4AFK A;  3T0S A;  1Q9G A;  2ZIW B;  2K8A A;  3ONN A;  2ERV A;  2KIW A;  2N1R A;  3AA1 A;  4U9C A;  4AYB F;  5G26 A;  5T14 A;  4O49 A;  1MA7 A;  2K4T A;  3D2N A;  3CRX A;  3LVV A;  4AYN A;  4AYI D;  5HR7 A;  2JMM A;  4AYD C;  3O0E A;  3KZX A;  4GCS A;  4RLB A;  4D65 A;  2GH1 A;  2JH7 A;  2QTK A;  3HOE A;  3AQF A;  2KD1 A;  2WB1 F;  3F5E A;  3LK4 2;  3HKZ C;  3N7P D;  4BJQ A;  2DGZ A;  3K19 A;  2K4I A;  2RRD A;  2Y0S F;  4F4B A;  1ZHW A;  2KNJ A;  3D2S A;  2VKQ A;  2N2M A;  3SYS A;  4OJP A;  3VY9 X;  2H3Q A;  2LBO A;  3FYX A;  4FRX A;  1ZHX A;  4A8E A;  1XNS A;  3H0L B;  1ZHZ A;  4LSI A;  4QNL A;  2RHF A;  5DL7 A;  2ZIW A;  3AAE B;  3SAF A;  1QJ8 A;  2VJ5 A;  2XE5 A;  3AA6 B;  2ZIX B;  3ALR A;  4FES A;  2G08 A;  1P7D A;  1GO3 F;  2GOL A;  3KFU F;  3F2C A;  2LKY A;  1GFO A;  1ORM A;  5IYU A;  2G06 A;  3NUQ A;  1XO0 A;  3D2Q A;  5EE2 A;  2KJ9 A;  3QRA A;  2XE3 A;  2GE4 A;  3F2D A;  2LHF A;  2H3V A;  1CRX A;  1OSM A;  1SZH A;  4PUX A;  2F1T A;  1Q3U A;  3ICX A;  2KHV A;  2Y0L A;  4AYB C;  1HIW A;  4CRX A;  1IZN B;  3SYB A;  4U6P A;  2ZFG A;  1ECW A;  4OJL A;  3LYS A;  2D6F C;  1PRN A;  2K4E A;  4KX3 A;  4P0P B;  3LK3 B;  3POX A;  2HOQ A;  2HOF A;  3AAE A;  2Q4T A;  2Y0H A;  4E1S A;  5ADX K;  3GZF A;  3EMN X;  2KZ7 B;  3AA6 A;  4N59 A;  2WB1 C;  2ZIX A;  2NV3 A;  1PVP A;  5GV0 A;  3IG5 A;  4FZM A;  1HXX A;  2Y0S C;  4LSE A;  3AAA B;  2RP5 A;  2XIC A;  4AKR B;  4O3Y A;  4BUG A;  2KKP A;  4O3W A;  3SMV A;  2KJ5 A;  3IG8 A;  2E5S A;  2A3V A;  3IP4 B;  2K4H A;  3T20 A;  4XNK A;  1OUQ A;  2G09 A;  1YS5 A;  2XE2 A;  3VE2 A;  3VY8 X;  3AQE A;  1DRG A;  4QJF B;  5C0Y A;  4QIW F;  1Q9F A;  2VIX A;  3LVW A;  3HOL A;  4FUV A;  3MGV A;  3PSF A;  4BX9 C;  1MPF A;  4KMO B;  2K89 A;  2G0A A;  2XVT A;  2M07 A;  3T24 A;  4P0Q B;  3LK3 A;  4O3Z A;  4CGZ A;  4NWI A;  3NRW A;  3AA0 A;  1A6S A;  1OPF A;  2KZ7 A;  2M06 A;  2LFU A;  4KRA A;  2DQN B;  3C5O A;  3JTY A;  3PZP A;  2BDU A;  2HBM A;  4C0Z A;  1NZB A;  1URJ A;  3M7D A;  2FGR A;  3AAA A;  3GP6 A;  4AKR A;  1GFM A;  4AZL A;  3SQI A;  3LK2 A;  3G7G A;  1BT9 A;  3AA7 B;  2MA1 A;  3NSG A;  1E54 A;  1ZHY A;  4NV0 A;  5FVN A;  4AYE C;  3CYM A;  3E0F A;  2ZIU A;  2YX8 A;  3TZG A;  2F77 X;  3DEE A;  3AL0 B;  5KL8 B;  2PRN A;  3POR A;  4GFJ A;  2HOI A;  3WI4 A;  2KOB A;  4JMU A;  4GHB A;  4FZN A;  2KJ8 A;  2G5I B;  3OPX A;  1TAM A;  3C28 A;  2KIC A;  1L6N A;  1KBU A;  1HEK A;  5KL1 B;  2WAQ F;  1H6S 1;  2KEY A;  1YT3 A;  5D5D A;  4G76 A;  3WI5 A;  7PRN A;  3SZV A;  2N2L A;  4NLB A;  6PRN A;  2OH2 A;  4OO1 J;  3V8U A;  3RFA A;  2JMG A;  3AA7 A;  3QRC A;  3RF9 A;  4QIW C;  4G75 A;  4GCQ A;  2J4U P;  4AKM A;  2ZG6 A;  5DL5 A;  2ODJ A;  3UPG A;  3C29 A;  4WJ3 B;  2W03 A;  2W7P A;  1ZHT A;  3VC8 A;  2HMX A;  2H3I A;  5JDP A;  1BH3 A;  1HXU A;  3UAQ A;  4FRT A;  4B61 A;  2F1V A;  1D8B A;  2Y7S A;  4PL2 A;  2MNH A;  3HW9 A;  3N7R C;  4FOZ A;  2YB4 A;  2OXO A;  2LYA A;  2OYY A;  2ZIV B;  2Y0K A;  2PMZ F;  4U7C A;  4CDG A;  3SAH A;  3RBH A;  3PQS A;  2LYB A;  5CRX A;  2G07 A;  2DF4 B;  1HXT A;  2POR A;  5DL8 A;  2JGA A;  4O4U A;  3DA4 A;  2F8L A;  2F2A B;  2KXP B;  1IZN A;  3PQU A;  3F5A A;  5ADX L;  3SY9 A;  4FE3 A;  1GFQ A;  2WAQ C;  3POQ A;  4P0P A;  4JCH A;  2KV2 A;  4O4X A;  2ZXH A;  2OMF A;  5PRN A;  2KC0 A;  2K0L A;  1PVQ A;  4GF4 A;  4RJX A;  5AFU L;  2J1N A;  4OJ5 A;  2Z7J A;  2OM6 A;  3H0M B;  4Z3T A;  2W80 C;  4GCP A;  3F2B A;  3VCB A;  2F76 X;  3HWB A;  2ZIV A;  2X27 X;  1ZQ1 C;  2ZLD A;  1GFP A;  4FSP A;  3KVD D;  1MM4 A;  3PRN A;  2E1E A;  2CN1 A;  3T79 A;  5T5F A;  4OJ6 A;  4PL1 A;  2KKV A;  1UPH A;  1BXW A;  4KR4 A;  2W81 C;  2KVC A;  2KXP A;  3N7S C;  2JH1 A;  1PVR A;  2M0N A;  2R18 A;  1F44 A;  4ICA A;  2LHT A;  1GFN A;  2YNK A;  4P0Q A;  3LK4 1;  3POU A;  2E1F A;  2K8B B;  3F53 A;  2MRL A;  2PMZ C;  4JFB A;  4QQ1 A;  2XE1 A;  5A0L A;  3K1Z A;  2YPV A;  3A2S X;  4O3M A;  4FMS A;  3PSI A;  1Z19 A;  2FGQ X;  2ZXI A;  2MHL A;  4KX5 A;  4E1T A;  3VZU X;  1G90 A;  4OJO A;  4RLC A;  2XMX A;  1QJ9 A;  1PHO A;  3H0R B;  4FT6 A;  1A0P A;  2CRX A;  4O3X B;  3SY7 A;  4KR8 A;  4FSO A;  3UU2 A;  3HKZ F;  3M6Z A;  2KDY A;  2XG6 A;  3M6K A;  2CPR A;  2HBK A;  3PSP A;  4D5U A;  2XID A;  2O4V A;  3AA1 B;  2XTR A;  3IN5 A;  2JHD A;  2HBL A;  2W04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...