4FZNA

Crystal structure of syringacin m mutant d232a from pseudomonas syringae pv. tomato dc3000
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
276
structure length
276
Chain Sequence
PIELPPTYITPYPEISAGGNGTYRGQDLSSGQSFPRGMQNPVATVLLLQGDLYCSPNCLATFQDQARRDSFGIQSKVALKTFAAADQREAEGRDLRTAYNEIATDIGRSQQINENIIKYPPGNHVLSGGLMTPFHALAHGMFGLGAPLTFPIQNVGLNVDIRGIPDVMNVIQSARPVGTSSLDVNFAYDVGKDSNASWLTLGNITLRLVGTIDKNASGAWTFSGEIRAFNAVYDANPSNHRGWLGENLTSLLSAVPFTSYSIEIPGSLPVTVSGNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Lipid II-degrading Bacteriocin Syringacin M Suggests Unexpected Evolutionary Relationships between Colicin M-like Bacteriocins.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Antimicrobial protein
molecule keywords Bacteriocin
total genus 74
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.880 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4fznA01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4fznA02
4FZMA 4G75A 2XTQA 2XMXA 4G76A 4FZNA 2XTRA 3DA3A 4N59A 4N58A 4FZLA 3DA4A
chains in the Genus database with same CATH superfamily
5DLFA 1WWVA 2IA6A 1KL9A 3I1YA 4Q8EA 3AA6A 4RUAA 4KLQA 4KMOB 2QLTA 5ALDA 3Q8MA 2BDUA 2BQ3A 2FMQA 3ORYA 2BCSA 4YP3A 3OSNA 1WWUA 3PSTA 2ZUDA 3WKDA 2BCUA 3L5KA 3NVYA 4QIWC 2E1FA 1SKWA 1ZQ1C 3GDXA 3LK41 1J97A 5J2JA 3RBEA 2JZBA 3D2QA 1BPXA 4ED6A 1TK0A 3QUBA 1M6YA 8PRNA 1MPFA 2Y0HA 5DG7A 1TKDA 4J9RA 1Z19A 1NK9A 2AXTU 1BNPA 2IBKA 5EWGA 3RFAA 4QZDA 3H8JA 4FS1A 3TFSA 4O3RA 1Q46A 3KVDD 4N58A 1Z4NA 2HHSA 3QUQA 4JCHA 1ZJMA 5EE9A 2MHLA 1N61A 3QRAA 4FMSA 2J6SA 4JFBA 5H2FO 1IIPA 4BXOA 1MA7A 2PFPA 3MABA 2HCFA 4M9JA 4DQIA 4ELVA 4BWJA 3R9KA 1XSNA 2LFUA 3SV3A 4PUXA 5KFJA 3Q8PB 4G75A 8ICSA 2FPLA 2K8AA 5HHHA 1PUZA 4EELA 4BX9C 3KKAC 4JV0A 3A2SX 5BOMA 4Y2QA 1KFSA 2KVSA 3RR8A 4IRCA 4TQRA 4NLKA 9ICXA 4DQSA 1JXEA 1DK3A 5AI0A 5KG6A 1S5LO 3J81j 2ZJ8A 1RYRA 1KKXA 5KNIA 3QXGA 1ZETA 2XTRA 1QQ5A 3PV8A 7ICMA 4M2YA 4UQGA 4IRKA 2JHDA 2XIDA 4GC7A 3GIIA 2KC0A 2EZXA 2R88A 2C2EA 4ECXA 4RUCA 3AA7B 1A6SA 4WJ3B 4UB3A 2BPFA 4AKMA 2E8NA 3UPQA 4AZLA 2AQ4A 5DDMA 9ICNA 5BOLA 3BRYA 1ECWA 2W8KA 4FRXA 3G6XA 1O03A 5IIIA 5AM4A 1C7YA 2WTFA 2FMPA 2ATLA 4AKRA 3GIMA 5J2HA 4UW9A 1FIQA 1X42A 4KLIA 5EE3A 2M06A 1WCNA 3UAQA 3AA1B 5KFIA 3PORA 3UQ0A 3WI4A 5C5JA 3BQ7A 3DWOX 1D8LA 2NRWA 2VA8A 1UT5A 2RRDA 4NJ8A 1XS9D 1S0OA 5J0XA 1PRNA 5F9LA 4P4PA 3A0HO 4CNQA 2K60A 1JN3A 4F91B 1ZQSA 2R8AA 1KN5A 1SKRA 4OJOA 3WU2O 3LWLA 1T8EA 4I28A 1SV4A 4Q44A 3EMNX 4O3OA 5C0YA 2RQ5A 1SXDA 4C8OA 1ZQHA 2FGQX 2XCAA 2XVTA 3PNCA 2AGOA 5IIJA 9ICGA 4RQ1A 1T3NA 4DQQA 4KLGA 1S76D 2YMPA 4OJ6A 1OW5A 1QSLA 3NRWA 3NVWA 4F4KA 2QARA 9ICRA 2Y0KA 4AP9A 3F5EA 1MN8A 5HR7A 3MDAA 2JH1A 4NM1A 3HRDD 5ALGA 1Z3EB 2HBJA 4UAZA 1DOQA 5KT3A 2RHFA 1RPLA 3H8WA 3FDSA 3BQ0A 4Z6FA 2DPJA 2ZFGA 3ZI4A 2Y0SF 5DG8A 4UB6U 3GIKA 4N59A 1X9WA 4Q43A 2A3VA 4IS7A 1H6S1 2JGAA 2K0LA 5AK5A 5DB9A 1XU4A 4Y2SA 2EZZA 2WF6A 3WK8A 3K19A 1PK1A 1L8LA 3OHBA 3DDHA 1XC9A 4YQWA 2J4UP 5DBBA 1L3VA 2PI4A 3HPOA 2VKQA 2OM6A 5KFWA 1ORMA 4DL7A 2J6UA 4GXJA 4AKRB 2H3FA 1T1LA 1SGGA 1KW4A 4RQ0A 5AM0A 4P4OA 4Y2TA 2PFOA 1Z1BA 5L1LA 1DGJA 1BPZA 4M9NA 5ALMA 5KFOA 4E1SA 2A1AA 3A0BU 2JR5A 4NLCA 4DLGA 4AYEC 4XUSA 2E5SA 2KZ7A 1Z00A 5AKGA 4O5EA 3C29A 1S97A 2KV2A 4QZGA 1NZBA 9ICSA 4I2IA 1DK2A 5KT5A 3M1YA 3MR5A 2UVWA 1TK8A 5ALOA 2E3TA 3GQCA 3AU6A 4O0IA 5J2EA 3IHQB 2I5HA 3LWMA 1SB3C 1QQ7A 4Q45A 4F71A 3RAQA 1BVSA 1SV0C 5HMMA 2ES6A 2XY5A 2HOIA 1UPHA 1S9FA 1YT3A 4PHDA 5GTIO 2HBLA 2V4RA 2ODGA 2E8PA 5J0RA 4C4TA 1N63A 3BS0A 2D8CA 4M47A 3QE9Y 2P66A 4CRXA 7ICIA 2ASDA 4YFKA 3NJTA 3EW9A 5J2IA 3T0SA 2IOFK 4A8EA 4RQ2A 1TAMA 5ALSA 5CA7A 3ZD9A 5CP2A 1SZHA 2DWQA 4CGZA 3C2KA 4M04A 3N28A 4DSLA 3TFRA 3NS1A 3MGIA 3JPOA 1L3UA 4QZAA 2PI5A 2F1HA 3H40A 2XY6A 3WK4A 2BCRA 4J9OA 2KHQA 2IWWA 4UB2A 3HT3A 1Z00B 3C28A 2EAOA 3QU2A 5AKLA 3AU2A 3PGSA 4C8LA 3UXPA 5B5EO 4B9NA 4HAIA 2XGPA 3QU4A 4ED7A 3RTVA 4G3IA 3SY7A 4UAVA 2ASJA 2MRLA 4M9GA 1NOMA 5PRNA 1NK5A 2D3DA 2FLLA 1JXLA 5J0OA 4ACOA 3NTUA 2JH7A 2DGZA 9ICFA 1A76A 4Y2JA 2X27X 3TAPA 3N7RC 3BJYA 9ICTA 3H8SA 2YMLA 4DL2A 1T3QA 2M0NA 3RF9A 3HWBA 3UMBA 1RYUA 4KLMA 2AQ0A 2KK0A 3CNHA 5B66U 1PVRA 4RT3A 4JMUA 2H3ZA 3Q8LA 5ALZA 2BZFA 2HW3A 2OMFA 2R4OA 1MM4A 3TI0A 1NJZA 1AQ6A 3VE1A 2AU0A 3PO5A 2LM1A 5IINA 5L1MA 3C23A 1COOA 3RJGA 4QNLA 2QTKA 4E0DA 4NXZA 3KHLA 4QZFA 2F44A 7ICJA 5BPCA 1NJWA 5JDPA 4PJ0O 4OD0A 1QJPA 5DL5A 3PW7A 4US8A 1P7DA 1T4GA 3HW8A 4EZ6A 2YNKA 2AGQA 4KLEA 3VE2A 4PZOA 3ZDBA 4DSFA 5IIOA 2BCQA 2JEIA 5EE2A 2W7PA 9ICVA 2Y7SA 2W9MA 3HILA 4PJ0U 2KE7A 1ZQFA 2BQUA 3MR3A 5EE1A 1NK4A 2MUTA 4DF8A 1ZQCA 4PH5A 1L3SA 5G26A 4BXOB 5JU5A 1L5UA 2O4VA 3UM9A 2YB4A 3KOOA 3AA6B 1FFVA 2W04A 1URJA 4M9LA 2OXOA 2ZIWA 3RJHA 3KHHA 3IG5A 2OHFA 4J9MA 4I2CA 3AA0A 5ALKA 3WKBA 4LSHA 4ED2A 1VLBA 3WK9A 3FC4A 4FFDA 1BT9A 4RQ8A 5B66O 7ICOA 4KLSA 3AN1A 3AA1A 4NLNA 4I2JA 2KJ5A 3KHGA 3PW2A 4QZHA 2AHOB 2G5HB 4GCSA 2XO7A 3ISBA 2VJ5A 4J9LA 4ECZA 3O0FA 9ICIA 2K4TA 2ZLDA 3GFKB 2R8HA 1XO0A 4ECTA 2OYYA 3IDWA 5KT4A 3WKCA 2P6UA 2NRVA 4UB6O 3GV8B 3JTYA 5KFNA 8ICQA 2LYBA 1ZOLA 4KR4A 4FOZA 3QX7A 3IP4B 2HHTA 3LVVA 3RB3A 8ICEA 2XE2A 4QZBA 4U6PA 2V9WA 5CR0A 8ICIA 1MQ3A 4YMNA 2G08A 1ED1A 2KD1A 2R4NA 4DL5A 1OPFA 3HWTA 1PK3A 4ED1A 1AROP 1RZTA 3U26A 5L1JA 1UA1A 7ICNA 2W9CA 6PRNA 2XC9A 2ZXHA 4PL2A 7ICEA 4IQTA 2KEYA 1HJPA 2J1NA 3ZDCA 4C4RA 1QTMA 1XO1A 4FSOA 1ZD2P 3ZD8A 2E1EA 3PMLA 5L1IA 4DS5A 4QIWF 4FSPA 1ZD4A 1T94A 2EQYA 1YS5A 3KFUF 3JPRA 8ICWA 3SMVA 5KL8B 4MEYA 2KSOA 3PX0A 2A1JA 5FP0A 1SKSA 2GO7A 5F9NA 5CJ7A 1SXEA 3MBYA 4KLLA 5KFMA 5KFQA 4R8UA 4JV2A 4UBBA 3PGRA 4D65A 5JUMA 9ICCA 3OJUA 4ECRA 7ICTA 3V72A 3RBDA 4B9VA 4RLBA 3GILA 2KMDA 1CEZA 3WI5A 2F1IA 4TUPA 3NVZA 2FI1A 3ISCA 1ZXIA 2BCVA 4D64A 3MGHA 2LM4A 4GIBA 1IZNA 2XG6A 1WCLA 1U47A 2ZTDA 1GFMA 3Q8QB 4QWDA 2PFQA 2IOFA 4R63A 3SYZA 1JIHA 2RDJA 4C7YA 5CEHA 5AK3A 5T14A 2XTQA 4M6WB 3BQ2A 2P6RA 4EZ9A 7ICSA 5AI6A 4YN4A 1T7PA 4RNMA 3ETLA 2M9NA 3AAAA 4F93B 4AYDC 2QB1A 1LVHA 1WUDA 2ERVA 2HSZA 3WK5A 1KRPA 5D4BA 3K4GA 1COKA 9ICMA 3M6KA 2N1RA 4DS4A 1S5LU 2KXPA 5J8YC 3KTQA 5AKEA 3RRHA 1OSMA 2HBKA 1YZ7A 3C1ZA 4R64A 3JPPA 4EBCA 2R4PA 2XMXA 1K1SA 2UVRA 1PVPA 4I2DA 4C80A 3ISDA 4DL6A 1J2MA 3GU3A 1L3TA 3AMZA 3LK42 3PVXA 2W11A 7ICHA 1TAUA 3TANA 4KMUA 2KFNA 5KT7A 2W55A 4YXMA 4DEZA 3ALRA 1HXTA 4QWCA 5IYUA 4F4YA 1MM5A 4BUMX 2BDPA 2HHWA 2FLPA 4CE6A 4DO9A 1NK7A 4DSJA 3UMCA 4DQPA 4ECVA 3RRGA 5KFXA 2F1TA 1NI3A 5B5EU 5J0YA 2LI6A 3H0RB 5KFLA 1UA0A 4Y2UA 5AKJA 4RQMA 4LSFA 3C2MA 4QJFB 4RPYA 3MR6A 7ICRA 2JV3A 3TAQA 4FE3A 2XE5A 4KITB 9ICUA 1NZPA 4PHPA 2YB1A 2V4QA 1ZHXA 5ALYA 2BQRA 2PMZF 1ZQXA 4OCZA 4DFMA 1LV5A 2FE9A 4YD2A 8ICUA 3E0FA 5DBAA 5AHXA 4ECQA 2XE3A 2DKXA 1Z4OA 5F3XB 5KL1B 2PMZC 8ICNA 1UHUA 3NGDA 2W54A 3F2CA 2CPRA 5KFEA 4QZIA 1X6IA 2OEHA 1X9MA 4KX5A 2B21A 2Q0ZX 2ZG6A 4DSKA 2Y2XA 4F8RA 3T5KA 3CYMA 4LVSA 2IWVA 3SYSA 4AUIA 3C5GA 3D2NA 1D9DA 5J8YA 4P0PA 3WK7A 5ALEA 5KFBA 3EWAA 3SAHA 2ZIXB 5AKKA 1SL1A 2YMQA 2XI9A 4C8NA 5L1KA 4CF3A 4RPXA 1NNLA 7ICUA 5KFZA 4BWMA 2EDUA 1QLNA 4KLFA 5DQGA 2KIWA 4F50A 5DB6A 3LK3B 3V7JA 5DDYA 2G06A 5KG3A 1F44A 3SENA 1PZNA 1D8YA 5J2AA 7ICFA 5J29A 3FM9A 1P4TA 4GXKA 3QU7A 4F2RA 2F77X 4O9MA 3C21A 3RH5A 2D6FC 4C4VA 3PR4A 2F8KA 1UQVA 5KG0A 3NVVA 5DLGA 3OPXA 1NKCA 4BUGA 2NYVA 4OJ5A 1XWLA 1ZQJA 1SV0A 4G76A 2IMWP 1N5XA 5ALRA 1J2NA 3IRUA 4EX6A 3SQIA 4DWIA 3OHAA 5KAFO 8ICCA 8ICHA 2ZJ5A 3MFHA 4M6WA 4FQEA 1JI7A 2ZTEA 1B22A 5EOZA 1JRPA 2W81C 4LSIA 5AIAA 1LKYA 3T5JA 2XY7A 5AM1A 2WVPA 1KTQA 2KTQA 3WKEA 1ZQDA 2M07A 4FESA 2BGWA 2RLTA 3VY8X 5DBCA 1OXJA 3NRZA 4RL9A 3WKAA 3SZ2A 3PW5A 3POQA 2YN4A 4GCPA 1KDHA 2I6XA 5HNKA 4K4IA 4FRTA 2LYHA 7ICVA 1BPBA 2HMXA 1ZYQA 2ZIVB 1ZQGA 3EYZA 5DGAA 2JEJA 3BZKA 1B43A 4GF4A 4AFKA 4F4ZA 5EE0A 2YX8A 3ICXA 4UAYA 4EBDA 3FYHA 1TVAA 9ICAA 2W3RA 5AI9A 4Q8FA 2I9GA 1QH9A 2KSOB 4DFDA 2JQYA 1X40A 1X6JA 1CUKA 4IC9A 3VCBA 4GXIA 2NO4A 2XE1A 4JB3A 4LSEA 2VIXA 5ALQA 4R65A 3PY8A 5KFAA 2HVHA 3QNMA 5KFGA 1U4BA 4D5UA 3ED5A 5J0WA 4LZDA 5AI4A 2W8LA 9ICOA 2LHFA 2FLNA 8ICFA 4C4VB 4DFKA 2WF5A 4P0QA 4NLGA 2N2MA 4QZEA 4DL3A 4NL9C 3M8RA 3TZGA 2VANA 2C22A 2ASLA 4DOCA 2DPIA 3D6JA 4ECUA 2QKQA 1RG6A 3UU2A 4FBUA 2PORA 3DWNA 4PGQA 9ICWA 4F92B 4X5VA 2LHTA 1Q9GA 2Y1JA 2ZIUA 3LK9A 3A0HU 3M8SA 3N7SC 3IN5A 5J0PA 1XSPA 1NK0A 3Q8SB 4DQRA 4CF4A 3CRXA 5KG1A 4US9A 3SY9A 2H3IA 1X2IA 5ADXK 3LYSA 2LKYA 1SIJA 2CN1A 1L8OA 4CTDA 2WFAA 4MHVA 3E2EA 1ZHYA 4NY8A 1ZHTA 5ADXL 1K1QA 2KFZA 5JTIA 5ALJA 1L7NA 1JROA 4UAWA 2K4EA 1ZQIA 1ZQWA 3NUQA 1BPDA 5AKZA 4EBEA 5J2FA 1EXNA 4ECWA 4Y2RA 1UT8A 1RQLA 5FVNA 3GIJA 1ZRNA 3BZCA 5AIBA 4I27A 3T79A 5J0TA 1FO4A 4KX3A 3D2SA 4Y2VA 4ELUA 2HHQA 4JWNA 8ICTA 4FZNA 4RQ3A 4C7ZA 3AAEA 4O3XB 3ETRA 4J03A 2A1JB 8ICGA 1QSSA 5G3AA 1CRXA 2KJ8A 4U7CA 5KFPA 1KEJA 3PGUA 3TACB 4LJXA 3ZDAA 8ICBA 4YR3A 2JMMA 4O5CA 1V85A 4XA5A 2K8CB 1BPEA 1RM6C 4YG2A 3NSGA 3SEIA 3QU9A 1A0PA 4RNNA 2R8JA 5AI5A 2UVUA 3KHRA 3M9MB 2NV3A 5J0SA 4C4SA 1RXVA 2IHNA 4N75A 1B4FA 4PHAA 3L3FX 5DQHA 2HOFA 3A0BO 4FT6A 3PSPA 3HX0A 1IXRA 4DSEA 3K1ZA 2LMRA 2F2AB 5ALUA 2RP5A 3AM9A 2EH9A 4CF5A 3PW4A 4RQNA 4IR1A 4I2HA 4M9HA 3MR2A 5J2GA 4DCCA 1L7PA 3DV9A 3OSPA 1FFUA 5DB8A 4UB5A 3M7DA 1ZQKA 1RXWA 5GTHU 1KFDA 2CXYA 9ICBA 3T3FA 3SD7A 3F2DA 2N2LA 4ED3A 1Y88A 1RDFA 4TUQA 2KNJA 3L4PA 4NV0A 4MF8A 5ALPA 4KRAA 4UB8U 4NLBA 4RPZA 1ZQEA 2WAQC 3QUTA 4Z6EA 5CRXA 4I29A 1BH3A 3WK6A 1SL2A 2YMMA 2PFNA 2XICA 4LZGA 3AA0B 4N74A 3G6VA 4QZCA 4O3QA 4OO1J 5AK4A 1NKEA 4GHBA 2HHXA 3ZDEA 3IM1A 1IZNB 3Q8RB 4I2GA 1G90A 2ZIUB 5H2FU 4B61A 4C8MA 2OH2A 3KD3A 4RLCA 5KFTA 3BS5A 2ODJA 3JPSA 4QWAA 3I76A 5J2BA 1KBUA 2ZTCA 5AM5A 3QRCA 3RAXA 2R18A 4NLZA 1E54A 2JEGA 3MGVA 4UARA 2K8BB 1PHOA 2W43A 3UQ2A 4M0AA 1ZQNA 2PRNA 3MFIA 4O3MA 1JMSA 4KN4A 1HXXA 2GH1A 5KFKA 3VC8A 2E8MA 3F5AA 2AXTO 9ICQA 5AKYA 1IG6A 5KG4A 1QJ8A 5EWFA 3EPGA 3TQ1A 3PMNA 1VJ5A 4F2SA 2B6GA 7ICPA 4KR8A 3EUB2 3H4BA 4Z6CA 1THQA 4NM2A 4FS2A 3S6JA 1XNSA 5CHGA 1KSPA 1LB2B 5E79U 4YD1A 3BRZA 3AQEA 3I28A 3SR6A 2W9CB 2W7OA 2WF7A 1MC8A 4F5PA 3BQTA 3M6ZA 2W9BB 4BDPA 2JXJA 2C2RA 3IV6A 1ZHWA 5J2CA 4YR0A 5GV0A 2GOLA 4ECSA 2XCPA 2WAQF 3E58A 3BQ1A 4EYIB 3H0LB 5CWRA 4EX7A 4JK1A 7PRNA 2R89A 3V6HA 1ZJNA 5AI8A 2DKZA 1BGXT 2CRXA 2L5YA 2HVIA 3RR7A 3HW9A 4QWBA 5AFUK 5KT6A 1NKBA 5AM2A 2PXIA 4U9CA 2EAPA 5DL6A 4MFAA 4IL6O 2I1QA 3B0XA 1GFQA 4RJWA 2Y1IA 5ALXA 5DL7A 3DZMA 4DOBA 2YQEA 1ZQOA 2H3VA 3QZ8A 1BXWA 4Y2PA 4F5OA 3AQFA 3JPNA 2GLEA 1ZQYA 4O3ZA 2FGRA 2ZUBA 2WF8A 4EYHB 3SYBA 4BGDA 2UVVA 3QUCA 2G07A 2DUYA 3T5LA 1WG8A 3V6JA 4UAUA 5JRTA 7ICGA 5CB1A 2MUTB 1GFPA 4OJPA 2KKVA 4KLDA 3RJIA 1DRGA 2KZ7B 3HOLA 4ZH4A 5E79O 5KFVA 4R8UB 5J2KA 1DGSA 4J9QA 5DB7A 2F1VA 4QW8A 2DQNB 4UASA 5KAIO 2WJRA 5KFYA 4GFJA 5AICA 1N2XA 2E8OA 2Y9TA 2ZUCA 5KFFA 2DFLA 4I2EA 4AYMC 4DFJA 1TE2A 5ALWA 2MNHA 3CW2C 4O3PA 5J0UA 1HIWA 2KZ3A 2H5XA 2WHEA 3PZPA 3NASA 4YVZA 4FUVA 4RT2A 3K1RB 1L7OA 3V7KA 3LK2B 4K4HA 2EAMA 4KLHA 1QSYA 2FDRA 3FAHA 4J9KA 5HHIA 4O3NA 1N48A 3VZWX 4KN7A 4F3OA 2JZBB 3V7LA 2AJQA 3HJEA 2KKPA 4UB1A 4O3SA 2X9KA 1GFOA 3MC1A 3RBHA 2KVCA 4IRDA 4NL9A 4B6JA 3LDAA 4ICAA 1F5SA 2W80C 2DF4B 4F4XA 4IR9A 9ICPA 5KT2A 3RH6A 1U45A 4UB4A 1ZHZA 1FEZA 5ALNA 3K75D 3UXOA 2NO5A 4DOAA 4XQ8A 3WU2U 1LKYB 2FMSA 4FO6A 2EZYA 4XNLA 4YMMA 3EZ5A 1N5WA 5T5FA 2YTUA 2KJ9A 2QARB 1SL0A 3GV7B 3HP6A 3T24A 2ESEA 3N97B 5GTIU 3PSIA 4MFCA 1ZD5A 5GTHO 2WB1F 1U49A 3F53A 1QQ6A 5K4LA 2VA2A 2LBOA 1N56A 3SZDA 4QZ8A 3V6KA 1IV8A 1HUOA 3HKZC 8ICPA 5KFRA 1YZ6A 3SAFA 2KIVA 3G7GA 4P0QB 3RJJA 3GZFA 3IG8A 4Y2YA 3BDPA 5G5HA 3HKZF 3O0EA 2NRZA 2Y0SC 4JWMA 3PQUA 3QZ7A 1Z1VA 3LVWA 2KN7A 4PZNA 4F5RA 4EENA 4B9TA 5J2DA 2EANA 2GWSA 4PGYA 5KTQA 4K4GA 4AYID 3UXNA 1TFRA 2HI0A 1CI4A 2MAXA 3SV4A 5ALVA 1NK6A 2F8LA 1BPYA 2XGQA 4B9SA 5HP4A 4PHEA 9ICHA 2AGPA 8ICAA 3V8UA 2ZIVA 4F4WA 3Q8KA 1KLNA 2ALZA 3QEAZ 5AK6A 2Z7JA 3KZXA 2P35A 4E1TA 2JRZA 4F5QA 5G38A 4IQWA 2FPKA 4RQ5A 3PW0A 1JALA 3GP6A 4RQ6A 3OJSA 2HOQA 4QZ9A 1JUDA 1C20A 5ALTA 1L7MA 4O3WA 2R4LA 3POUA 3C5OA 1PK1B 1TK5A 4ZOHC 4MFFA 4Y2XA 1TV9A 4TURA 4G9BA 2H3QA 4I2AA 2ZJAA 2NRXA 5KFCA 3ZDDA 4PR7A 4QW9A 3QU5A 3BS5B 4PL1A 3OTQA 5HR6A 1ZQRA 7ICQA 1RQNA 5KFHA 4C8KA 4ECYA 4C00A 9ICKA 5D46A 2R8KA 1HXUA 2VA3A 4O49A 3PRNA 4B9UA 4AYBF 8ICJA 1V97A 2C28A 4RU9A 4J9PA 1L6NA 1DXSA 1H38A 4B9MA 3KZIO 3RJKA 5D5DA 1ZQQA 3CP8A 5TISU 2KICA 1GFNA 2PKEA 1SWVA 3SI8A 1HEKA 2QB0A 4FBTA 5IIKA 3RJFA 3BS7A 3FYXA 3G6YA 4EEKA 4XNKA 4KTQA 2BPCA 3TADC 5L9XA 1XSLA 4NWIA 1ZQPA 5ALHA 2BKEA 1HUZA 4FZMA 1S0NA 2IHMA 4ED0A 2G5IB 4P0PB 1TAQA 1ZQMA 2ZXIA 2KP7A 3B0YA 4ED8A 5DQIA 1QJ9A 4XRHA 5TISO 3VZUX 1ZD3A 2A19A 1A77A 1MQ2A 2DBYA 1Q3VA 2KZZA 3PX6A 1S10A 3TARA 4RQ4A 4B9LA 3PX4A 1V38A 5ALFA 1D9FA 4IQVA 7ICLA 4Z3TA 5HMLA 2JEFA 4KLOA 5D49A 2HBMA 5KFUA 2F76X 8ICZA 1N60A 4F72A 2C2DA 1WYGA 4MF2A 4J9NA 1ZRMA 5ALLA 2MU2A 4KLUA 1QCKA 4RJXA 4HYKA 4JUZA 3AUOA 2AH5A 3PO4A 2ZIXA 4IL6U 3UPGA 2WF9A 4OJLA 5IIMA 3AEVA 5EWEA 4DSIA 3RJEA 4F4BA 3DEEA 4F5NA 4RQ7A 3EPIA 4UBCA 2B0CA 3DA4A 5G5GA 1BNOA 5DGBA 9ICLA 2W9BA 5ALIA 5KAFU 5KG7A 4JV1A 5KFSA 3RB0A 1K5OA 1SZPA 2FJ6A 2MSNA 3M9OB 8ICLA 2RDIA 4AYNA 4RZRA 3TADA 1KFTA 1ZQBA 1ZQVA 1U9LA 8ICOA 4O3YA 5G39A 8ICXA 2HHUA 4DLEA 3C1YA 4ELTA 1N62A 2G09A 2VJ4A 1D8BA 1Q3UA 1B0XA 1MSWD 3C5FA 2HHVA 2J6TA 4I2FA 5KG2A 1RYSA 3RH4A 1SWWA 5A0LA 2W9AA 5IILA 2F1JA 4GC6A 4PPXA 1S8OA 3VZTX 5AKIA 3C2LA 1ZQZA 2HDOA 2KG5A 2OWOA 5KFDA 1NK8A 5TZVA 9ICEA 3T20A 2YY6A 4QQ1A 4C69X 4CDGA 3M9NB 3AA7A 2KDYA 1S0VA 3KBBA 2Y0LA 1UCVA 2QB0B 9ICJA 2K89A 3RB6A 4MEXA 1Q9FA 2KXPB 2YPVA 4CCHA 5DL8A 2WB1C 2KHVA 3GV5B 3THVA 3DA3A 4RNOA 1S77D 2FPMA 2W03A 4YMOA 2F1CX 1ZQUA 2K4IA 3SZVA 3AL0B 1X66A 2ISPA 3PF1A 4YCXA 5KAIU 2O6KA 1KQQA 1PVQA 4I2BA 4Z6DA 2MA1A 2BR0A 3OGUA 2KZMA 3JPQA 2LYAA 5KG5A 1U48A 1NJXA 4AYBC 3MDCA 4UB8O 5J0QA 2ZIWB 1GO3F 3VY9X 3QEBZ 3LK3A 4DL4A 3KZIU 1X9SA 1NJYA 2R8IA 4GCQA 7ICKA 2KOBA 1T16A 3PQSA 2W3SA 5DG9A 4K3CA 2K4PA 4KLTA 3POXA 2Y9UA 2ISOA 4O4XA 8ICVA 1OUQA 2DL0A 3SAGA 8ICYA 3PR5B 5DKWA 1Q8KA 3ONNA 2F3NA 4PGXA 2LPEA 1ZQAA 3H7IA 4K3BA 5AFUL 3F2BA 2JMGA 2K4HA 3KKAA 4DF4A 2R8GA 4O4UA 3RB4A 4EEYA 1X9XA 5AM3A 4USAA 3LK2A 4O5KA 3JPTA 2WJQA 5AKXA 3B9JA 8ICMA 4UATA 3H8MA 3T5HA 1JX4A 1V9PA 3H4DA 2G0AA 4QWEA 1F0MA 2Q4TA 1ZQTA 4KLJA 1VDVA 8ICKA 3AAEB 4YR2A 4BJQA 4R66A 4TQSA 3H0MB 1ZQLA 8ICRA 3JCUO 4TUSA 2BHNA 2NRTA 1S0MA 3UMGA 4DFPA 2GE4A 1IM4A 3PSFA 3N4MB 2OCEA 5AKHA 2IOHA 4J9SA 3AAAB 3HOEA 4P4MA 4IQUA 3QYPA 1O08A 4P2HA 3TKAA 4GLXA 2BPGA 4YXJA 3N7PD 4C0ZA 4FZLA
chains in the Genus database with same CATH topology
3RF9A 3HWBA 3AA6A 3POQA 4GCPA 4KMOB 4XNLA 1PVRA 5T5FA 2BDUA 4FRTA 2KJ9A 4JMUA 3T24A 2HMXA 2H3ZA 2ZIVB 3PSTA 2OMFA 1MM4A 3PSIA 4GF4A 2WB1F 4AFKA 3VE1A 3F53A 4QIWC 2E1FA 2YX8A 3ICXA 2LBOA 1ZQ1C 3LK41 3SZDA 3HKZC 3D2QA 4QNLA 2QTKA 4IC9A 3VCBA 2XE1A 3SAFA 4LSEA 3G7GA 4P0QB 2VIXA 8PRNA 3GZFA 3IG8A 1MPFA 2Y0HA 3HKZF 3O0EA 5JDPA 2Y0SC 1QJPA 3PQUA 5DL5A 4D5UA 1P7DA 3LVWA 1Z19A 2LHFA 2YNKA 4P0QA 2N2MA 4AYID 3RFAA 3VE2A 3TZGA 3KVDD 4N58A 5EE2A 2W7PA 2Y7SA 2F8LA 4JCHA 3UU2A 2PORA 5G26A 3V8UA 2ZIVA 2MHLA 2LHTA 1Q9GA 2ZIUA 2O4VA 3N7SC 3QRAA 4FMSA 2YB4A 2Z7JA 3IN5A 3KZXA 4E1TA 3GP6A 4JFBA 2HOQA 1IIPA 3CRXA 3AA6B 2W04A 1URJA 3SY9A 2H3IA 2OXOA 2ZIWA 3LYSA 1MA7A 5ADXK 2LKYA 3IG5A 3AA0A 4O3WA 4LSHA 3POUA 3C5OA 2CN1A 1ZHYA 1ZHTA 1BT9A 5ADXL 2H3QA 3AA1A 2LFUA 2K4EA 4PUXA 2KJ5A 3NUQA 4G75A 2K8AA 4BX9C 4PL1A 2G5HB 3A2SX 4GCSA 5HR6A 5FVNA 2VJ5A 3O0FA 3T79A 2K4TA 2ZLDA 1XO0A 4KX3A 3D2SA 2OYYA 1HXUA 4FZNA 3AAEA 4O3XB 3JTYA 4O49A 3PRNA 2LYBA 4KR4A 4FOZA 4AYBF 3IP4B 1L6NA 5D5DA 2XTRA 1CRXA 2KJ8A 3LVVA 3CP8A 4U7CA 2JHDA 2KICA 2XIDA 1GFNA 2XE2A 2KC0A 4U6PA 1HEKA 2JMMA 2K8CB 3AA7B 1A6SA 2G08A 4WJ3B 1ED1A 3FYXA 2KD1A 1OPFA 4AKMA 4XNKA 3NSGA 1A0PA 4AZLA 4NWIA 1ECWA 6PRNA 2ZXHA 2NV3A 4PL2A 4FRXA 2KEYA 2J1NA 4FZMA 4FSOA 4AKRA 2G5IB 3L3FX 2E1EA 4P0PB 4QIWF 2HOFA 2ZXIA 4FSPA 4FT6A 3PSPA 1T94A 1YS5A 3KFUF 2M06A 1QJ9A 3SMVA 5KL8B 3K1ZA 3UAQA 3VZUX 3AA1B 2F2AB 2RP5A 3PORA 3WI4A 1Q3VA 2RRDA 1PRNA 3M7DA 4D65A 3F2DA 4Z3TA 2N2LA 2HBMA 4RLBA 2F76X 2KNJA 4NV0A 4OJOA 3WI5A 4KRAA 4NLBA 3EMNX 5C0YA 4D64A 2WAQC 5CRXA 2FGQX 4RJXA 1BH3A 2XVTA 1IZNA 2XG6A 1GFMA 2ZIXA 2XICA 3AA0B 3UPGA 4OJLA 4OJ6A 3NRWA 4F4BA 3DEEA 4OO1J 5T14A 2XTQA 2Y0KA 4GHBA 1IZNB 1G90A 2ZIUB 3F5EA 3DA4A 2OH2A 4B61A 5HR7A 2JH1A 4RLCA 3AAAA 2ODJA 4AYDC 2HBJA 1KBUA 2RHFA 1WUDA 2ERVA 3QRCA 2R18A 2ZFGA 1E54A 3M6KA 3MGVA 2Y0SF 2N1RA 4AYNA 2KXPA 2K8BB 1OSMA 2HBKA 4N59A 2A3VA 1PHOA 1H6S1 2JGAA 2PRNA 2K0LA 4O3YA 4O3MA 1HXXA 2GH1A 3VC8A 3F5AA 2G09A 2VJ4A 1D8BA 3K19A 2XMXA 1Q3UA 1PVPA 1QJ8A 4KR8A 3GU3A 2J4UP 1THQA 5A0LA 1XNSA 3LK42 2VKQA 3VZTX 2OM6A 3AQEA 3ALRA 1HXTA 2W7OA 5IYUA 1MM5A 1ORMA 3M6ZA 4BUMX 4AKRB 2H3FA 3T20A 1ZHWA 4QQ1A 4C69X 4CDGA 3AA7A 2KDYA 2Y0LA 2F1TA 5GV0A 1Z1BA 4E1SA 2GOLA 3H0RB 2K89A 2WAQF 3H0LB 1Q9FA 4NLCA 2KXPB 4AYEC 4LSFA 2YPVA 7PRNA 2E5SA 4QJFB 2KZ7A 5DL8A 2WB1C 3C29A 2CRXA 2KHVA 2KV2A 4FE3A 1NZBA 2XE5A 3DA3A 3HW9A 5AFUK 2YB1A 1ZHXA 4U9CA 5DL6A 2W03A 2PMZF 2K4IA 3SZVA 1GFQA 3AL0B 4RJWA 5DL7A 1PVQA 3E0FA 2MA1A 2H3VA 2XE3A 2LYAA 4AYBC 5KL1B 2PMZC 2ZIWB 1GO3F 3VY9X 1BXWA 3F2CA 2CPRA 3AQFA 3LK3A 4O3ZA 2HOIA 1UPHA 4KX5A 2FGRA 1YT3A 2ZG6A 4GCQA 2Y2XA 2HBLA 3SYBA 2KOBA 3PQSA 3CYMA 3SYSA 4AUIA 2G07A 3D2NA 4P0PA 3POXA 4CRXA 2ZIXB 3SAHA 1GFPA 4O4XA 1OUQA 3SAGA 2XI9A 4OJPA 2KKVA 1DRGA 2KZ7B 3HOLA 3ONNA 3T0SA 4A8EA 2KIWA 3LK3B 5AFUL 3F2BA 2JMGA 1TAMA 2K4HA 2G06A 1F44A 4O4UA 2F1VA 2DQNB 1SZHA 4GFJA 1P4TA 3LK2A 4CGZA 4AYMC 2F77X 2MNHA 1HIWA 2D6FC 3PZPA 2G0AA 4FUVA 2Q4TA 2KHQA 3OPXA 3LK2B 4BUGA 4OJ5A 3C28A 3AAEB 4BJQA 4G76A 3H0MB 3SY7A 2MRLA 3VZWX 3SQIA 5PRNA 2KKPA 1GFOA 3RBHA 2KVCA 2GE4A 4ACOA 4ICAA 4LSIA 2W81C 3PSFA 2W80C 2JH7A 2DF4B 2DGZA 3AAAB 3HOEA 2X27X 3N7RC 2M07A 4FESA 3VY8X 1ZHZA 2M0NA 4RL9A 3N7PD 4C0ZA 4FZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FZM A;  4G75 A;  2XTQ A;  2XMX A;  4G76 A;  4FZN A;  2XTR A;  3DA3 A;  4N59 A;  4N58 A;  4FZL A;  3DA4 A; 
#chains in the Genus database with same CATH topology
 5DLF A;  1WWV A;  2IA6 A;  1KL9 A;  3I1Y A;  4Q8E A;  3AA6 A;  4RUA A;  4KLQ A;  4KMO B;  2QLT A;  5ALD A;  3Q8M A;  2BDU A;  2BQ3 A;  2FMQ A;  3ORY A;  2BCS A;  4YP3 A;  3OSN A;  1WWU A;  3PST A;  2ZUD A;  3WKD A;  2BCU A;  3L5K A;  3NVY A;  4QIW C;  2E1F A;  1SKW A;  1ZQ1 C;  3GDX A;  3LK4 1;  1J97 A;  5J2J A;  3RBE A;  2JZB A;  3D2Q A;  1BPX A;  4ED6 A;  1TK0 A;  3QUB A;  1M6Y A;  8PRN A;  1MPF A;  2Y0H A;  5DG7 A;  1TKD A;  4J9R A;  1Z19 A;  1NK9 A;  2AXT U;  1BNP A;  2IBK A;  5EWG A;  3RFA A;  4QZD A;  3H8J A;  4FS1 A;  3TFS A;  4O3R A;  1Q46 A;  3KVD D;  4N58 A;  1Z4N A;  2HHS A;  3QUQ A;  4JCH A;  1ZJM A;  5EE9 A;  2MHL A;  1N61 A;  3QRA A;  4FMS A;  2J6S A;  4JFB A;  5H2F O;  1IIP A;  4BXO A;  1MA7 A;  2PFP A;  3MAB A;  2HCF A;  4M9J A;  4DQI A;  4ELV A;  4BWJ A;  3R9K A;  1XSN A;  2LFU A;  3SV3 A;  4PUX A;  5KFJ A;  3Q8P B;  4G75 A;  8ICS A;  2FPL A;  2K8A A;  5HHH A;  1PUZ A;  4EEL A;  4BX9 C;  3KKA C;  4JV0 A;  3A2S X;  5BOM A;  4Y2Q A;  1KFS A;  2KVS A;  3RR8 A;  4IRC A;  4TQR A;  4NLK A;  9ICX A;  4DQS A;  1JXE A;  1DK3 A;  5AI0 A;  5KG6 A;  1S5L O;  3J81 j;  2ZJ8 A;  1RYR A;  1KKX A;  5KNI A;  3QXG A;  1ZET A;  2XTR A;  1QQ5 A;  3PV8 A;  7ICM A;  4M2Y A;  4UQG A;  4IRK A;  2JHD A;  2XID A;  4GC7 A;  3GII A;  2KC0 A;  2EZX A;  2R88 A;  2C2E A;  4ECX A;  4RUC A;  3AA7 B;  1A6S A;  4WJ3 B;  4UB3 A;  2BPF A;  4AKM A;  2E8N A;  3UPQ A;  4AZL A;  2AQ4 A;  5DDM A;  9ICN A;  5BOL A;  3BRY A;  1ECW A;  2W8K A;  4FRX A;  3G6X A;  1O03 A;  5III A;  5AM4 A;  1C7Y A;  2WTF A;  2FMP A;  2ATL A;  4AKR A;  3GIM A;  5J2H A;  4UW9 A;  1FIQ A;  1X42 A;  4KLI A;  5EE3 A;  2M06 A;  1WCN A;  3UAQ A;  3AA1 B;  5KFI A;  3POR A;  3UQ0 A;  3WI4 A;  5C5J A;  3BQ7 A;  3DWO X;  1D8L A;  2NRW A;  2VA8 A;  1UT5 A;  2RRD A;  4NJ8 A;  1XS9 D;  1S0O A;  5J0X A;  1PRN A;  5F9L A;  4P4P A;  3A0H O;  4CNQ A;  2K60 A;  1JN3 A;  4F91 B;  1ZQS A;  2R8A A;  1KN5 A;  1SKR A;  4OJO A;  3WU2 O;  3LWL A;  1T8E A;  4I28 A;  1SV4 A;  4Q44 A;  3EMN X;  4O3O A;  5C0Y A;  2RQ5 A;  1SXD A;  4C8O A;  1ZQH A;  2FGQ X;  2XCA A;  2XVT A;  3PNC A;  2AGO A;  5IIJ A;  9ICG A;  4RQ1 A;  1T3N A;  4DQQ A;  4KLG A;  1S76 D;  2YMP A;  4OJ6 A;  1OW5 A;  1QSL A;  3NRW A;  3NVW A;  4F4K A;  2QAR A;  9ICR A;  2Y0K A;  4AP9 A;  3F5E A;  1MN8 A;  5HR7 A;  3MDA A;  2JH1 A;  4NM1 A;  3HRD D;  5ALG A;  1Z3E B;  2HBJ A;  4UAZ A;  1DOQ A;  5KT3 A;  2RHF A;  1RPL A;  3H8W A;  3FDS A;  3BQ0 A;  4Z6F A;  2DPJ A;  2ZFG A;  3ZI4 A;  2Y0S F;  5DG8 A;  4UB6 U;  3GIK A;  4N59 A;  1X9W A;  4Q43 A;  2A3V A;  4IS7 A;  1H6S 1;  2JGA A;  2K0L A;  5AK5 A;  5DB9 A;  1XU4 A;  4Y2S A;  2EZZ A;  2WF6 A;  3WK8 A;  3K19 A;  1PK1 A;  1L8L A;  3OHB A;  3DDH A;  1XC9 A;  4YQW A;  2J4U P;  5DBB A;  1L3V A;  2PI4 A;  3HPO A;  2VKQ A;  2OM6 A;  5KFW A;  1ORM A;  4DL7 A;  2J6U A;  4GXJ A;  4AKR B;  2H3F A;  1T1L A;  1SGG A;  1KW4 A;  4RQ0 A;  5AM0 A;  4P4O A;  4Y2T A;  2PFO A;  1Z1B A;  5L1L A;  1DGJ A;  1BPZ A;  4M9N A;  5ALM A;  5KFO A;  4E1S A;  2A1A A;  3A0B U;  2JR5 A;  4NLC A;  4DLG A;  4AYE C;  4XUS A;  2E5S A;  2KZ7 A;  1Z00 A;  5AKG A;  4O5E A;  3C29 A;  1S97 A;  2KV2 A;  4QZG A;  1NZB A;  9ICS A;  4I2I A;  1DK2 A;  5KT5 A;  3M1Y A;  3MR5 A;  2UVW A;  1TK8 A;  5ALO A;  2E3T A;  3GQC A;  3AU6 A;  4O0I A;  5J2E A;  3IHQ B;  2I5H A;  3LWM A;  1SB3 C;  1QQ7 A;  4Q45 A;  4F71 A;  3RAQ A;  1BVS A;  1SV0 C;  5HMM A;  2ES6 A;  2XY5 A;  2HOI A;  1UPH A;  1S9F A;  1YT3 A;  4PHD A;  5GTI O;  2HBL A;  2V4R A;  2ODG A;  2E8P A;  5J0R A;  4C4T A;  1N63 A;  3BS0 A;  2D8C A;  4M47 A;  3QE9 Y;  2P66 A;  4CRX A;  7ICI A;  2ASD A;  4YFK A;  3NJT A;  3EW9 A;  5J2I A;  3T0S A;  2IOF K;  4A8E A;  4RQ2 A;  1TAM A;  5ALS A;  5CA7 A;  3ZD9 A;  5CP2 A;  1SZH A;  2DWQ A;  4CGZ A;  3C2K A;  4M04 A;  3N28 A;  4DSL A;  3TFR A;  3NS1 A;  3MGI A;  3JPO A;  1L3U A;  4QZA A;  2PI5 A;  2F1H A;  3H40 A;  2XY6 A;  3WK4 A;  2BCR A;  4J9O A;  2KHQ A;  2IWW A;  4UB2 A;  3HT3 A;  1Z00 B;  3C28 A;  2EAO A;  3QU2 A;  5AKL A;  3AU2 A;  3PGS A;  4C8L A;  3UXP A;  5B5E O;  4B9N A;  4HAI A;  2XGP A;  3QU4 A;  4ED7 A;  3RTV A;  4G3I A;  3SY7 A;  4UAV A;  2ASJ A;  2MRL A;  4M9G A;  1NOM A;  5PRN A;  1NK5 A;  2D3D A;  2FLL A;  1JXL A;  5J0O A;  4ACO A;  3NTU A;  2JH7 A;  2DGZ A;  9ICF A;  1A76 A;  4Y2J A;  2X27 X;  3TAP A;  3N7R C;  3BJY A;  9ICT A;  3H8S A;  2YML A;  4DL2 A;  1T3Q A;  2M0N A;  3RF9 A;  3HWB A;  3UMB A;  1RYU A;  4KLM A;  2AQ0 A;  2KK0 A;  3CNH A;  5B66 U;  1PVR A;  4RT3 A;  4JMU A;  2H3Z A;  3Q8L A;  5ALZ A;  2BZF A;  2HW3 A;  2OMF A;  2R4O A;  1MM4 A;  3TI0 A;  1NJZ A;  1AQ6 A;  3VE1 A;  2AU0 A;  3PO5 A;  2LM1 A;  5IIN A;  5L1M A;  3C23 A;  1COO A;  3RJG A;  4QNL A;  2QTK A;  4E0D A;  4NXZ A;  3KHL A;  4QZF A;  2F44 A;  7ICJ A;  5BPC A;  1NJW A;  5JDP A;  4PJ0 O;  4OD0 A;  1QJP A;  5DL5 A;  3PW7 A;  4US8 A;  1P7D A;  1T4G A;  3HW8 A;  4EZ6 A;  2YNK A;  2AGQ A;  4KLE A;  3VE2 A;  4PZO A;  3ZDB A;  4DSF A;  5IIO A;  2BCQ A;  2JEI A;  5EE2 A;  2W7P A;  9ICV A;  2Y7S A;  2W9M A;  3HIL A;  4PJ0 U;  2KE7 A;  1ZQF A;  2BQU A;  3MR3 A;  5EE1 A;  1NK4 A;  2MUT A;  4DF8 A;  1ZQC A;  4PH5 A;  1L3S A;  5G26 A;  4BXO B;  5JU5 A;  1L5U A;  2O4V A;  3UM9 A;  2YB4 A;  3KOO A;  3AA6 B;  1FFV A;  2W04 A;  1URJ A;  4M9L A;  2OXO A;  2ZIW A;  3RJH A;  3KHH A;  3IG5 A;  2OHF A;  4J9M A;  4I2C A;  3AA0 A;  5ALK A;  3WKB A;  4LSH A;  4ED2 A;  1VLB A;  3WK9 A;  3FC4 A;  4FFD A;  1BT9 A;  4RQ8 A;  5B66 O;  7ICO A;  4KLS A;  3AN1 A;  3AA1 A;  4NLN A;  4I2J A;  2KJ5 A;  3KHG A;  3PW2 A;  4QZH A;  2AHO B;  2G5H B;  4GCS A;  2XO7 A;  3ISB A;  2VJ5 A;  4J9L A;  4ECZ A;  3O0F A;  9ICI A;  2K4T A;  2ZLD A;  3GFK B;  2R8H A;  1XO0 A;  4ECT A;  2OYY A;  3IDW A;  5KT4 A;  3WKC A;  2P6U A;  2NRV A;  4UB6 O;  3GV8 B;  3JTY A;  5KFN A;  8ICQ A;  2LYB A;  1ZOL A;  4KR4 A;  4FOZ A;  3QX7 A;  3IP4 B;  2HHT A;  3LVV A;  3RB3 A;  8ICE A;  2XE2 A;  4QZB A;  4U6P A;  2V9W A;  5CR0 A;  8ICI A;  1MQ3 A;  4YMN A;  2G08 A;  1ED1 A;  2KD1 A;  2R4N A;  4DL5 A;  1OPF A;  3HWT A;  1PK3 A;  4ED1 A;  1ARO P;  1RZT A;  3U26 A;  5L1J A;  1UA1 A;  7ICN A;  2W9C A;  6PRN A;  2XC9 A;  2ZXH A;  4PL2 A;  7ICE A;  4IQT A;  2KEY A;  1HJP A;  2J1N A;  3ZDC A;  4C4R A;  1QTM A;  1XO1 A;  4FSO A;  1ZD2 P;  3ZD8 A;  2E1E A;  3PML A;  5L1I A;  4DS5 A;  4QIW F;  4FSP A;  1ZD4 A;  1T94 A;  2EQY A;  1YS5 A;  3KFU F;  3JPR A;  8ICW A;  3SMV A;  5KL8 B;  4MEY A;  2KSO A;  3PX0 A;  2A1J A;  5FP0 A;  1SKS A;  2GO7 A;  5F9N A;  5CJ7 A;  1SXE A;  3MBY A;  4KLL A;  5KFM A;  5KFQ A;  4R8U A;  4JV2 A;  4UBB A;  3PGR A;  4D65 A;  5JUM A;  9ICC A;  3OJU A;  4ECR A;  7ICT A;  3V72 A;  3RBD A;  4B9V A;  4RLB A;  3GIL A;  2KMD A;  1CEZ A;  3WI5 A;  2F1I A;  4TUP A;  3NVZ A;  2FI1 A;  3ISC A;  1ZXI A;  2BCV A;  4D64 A;  3MGH A;  2LM4 A;  4GIB A;  1IZN A;  2XG6 A;  1WCL A;  1U47 A;  2ZTD A;  1GFM A;  3Q8Q B;  4QWD A;  2PFQ A;  2IOF A;  4R63 A;  3SYZ A;  1JIH A;  2RDJ A;  4C7Y A;  5CEH A;  5AK3 A;  5T14 A;  2XTQ A;  4M6W B;  3BQ2 A;  2P6R A;  4EZ9 A;  7ICS A;  5AI6 A;  4YN4 A;  1T7P A;  4RNM A;  3ETL A;  2M9N A;  3AAA A;  4F93 B;  4AYD C;  2QB1 A;  1LVH A;  1WUD A;  2ERV A;  2HSZ A;  3WK5 A;  1KRP A;  5D4B A;  3K4G A;  1COK A;  9ICM A;  3M6K A;  2N1R A;  4DS4 A;  1S5L U;  2KXP A;  5J8Y C;  3KTQ A;  5AKE A;  3RRH A;  1OSM A;  2HBK A;  1YZ7 A;  3C1Z A;  4R64 A;  3JPP A;  4EBC A;  2R4P A;  2XMX A;  1K1S A;  2UVR A;  1PVP A;  4I2D A;  4C80 A;  3ISD A;  4DL6 A;  1J2M A;  3GU3 A;  1L3T A;  3AMZ A;  3LK4 2;  3PVX A;  2W11 A;  7ICH A;  1TAU A;  3TAN A;  4KMU A;  2KFN A;  5KT7 A;  2W55 A;  4YXM A;  4DEZ A;  3ALR A;  1HXT A;  4QWC A;  5IYU A;  4F4Y A;  1MM5 A;  4BUM X;  2BDP A;  2HHW A;  2FLP A;  4CE6 A;  4DO9 A;  1NK7 A;  4DSJ A;  3UMC A;  4DQP A;  4ECV A;  3RRG A;  5KFX A;  2F1T A;  1NI3 A;  5B5E U;  5J0Y A;  2LI6 A;  3H0R B;  5KFL A;  1UA0 A;  4Y2U A;  5AKJ A;  4RQM A;  4LSF A;  3C2M A;  4QJF B;  4RPY A;  3MR6 A;  7ICR A;  2JV3 A;  3TAQ A;  4FE3 A;  2XE5 A;  4KIT B;  9ICU A;  1NZP A;  4PHP A;  2YB1 A;  2V4Q A;  1ZHX A;  5ALY A;  2BQR A;  2PMZ F;  1ZQX A;  4OCZ A;  4DFM A;  1LV5 A;  2FE9 A;  4YD2 A;  8ICU A;  3E0F A;  5DBA A;  5AHX A;  4ECQ A;  2XE3 A;  2DKX A;  1Z4O A;  5F3X B;  5KL1 B;  2PMZ C;  8ICN A;  1UHU A;  3NGD A;  2W54 A;  3F2C A;  2CPR A;  5KFE A;  4QZI A;  1X6I A;  2OEH A;  1X9M A;  4KX5 A;  2B21 A;  2Q0Z X;  2ZG6 A;  4DSK A;  2Y2X A;  4F8R A;  3T5K A;  3CYM A;  4LVS A;  2IWV A;  3SYS A;  4AUI A;  3C5G A;  3D2N A;  1D9D A;  5J8Y A;  4P0P A;  3WK7 A;  5ALE A;  5KFB A;  3EWA A;  3SAH A;  2ZIX B;  5AKK A;  1SL1 A;  2YMQ A;  2XI9 A;  4C8N A;  5L1K A;  4CF3 A;  4RPX A;  1NNL A;  7ICU A;  5KFZ A;  4BWM A;  2EDU A;  1QLN A;  4KLF A;  5DQG A;  2KIW A;  4F50 A;  5DB6 A;  3LK3 B;  3V7J A;  5DDY A;  2G06 A;  5KG3 A;  1F44 A;  3SEN A;  1PZN A;  1D8Y A;  5J2A A;  7ICF A;  5J29 A;  3FM9 A;  1P4T A;  4GXK A;  3QU7 A;  4F2R A;  2F77 X;  4O9M A;  3C21 A;  3RH5 A;  2D6F C;  4C4V A;  3PR4 A;  2F8K A;  1UQV A;  5KG0 A;  3NVV A;  5DLG A;  3OPX A;  1NKC A;  4BUG A;  2NYV A;  4OJ5 A;  1XWL A;  1ZQJ A;  1SV0 A;  4G76 A;  2IMW P;  1N5X A;  5ALR A;  1J2N A;  3IRU A;  4EX6 A;  3SQI A;  4DWI A;  3OHA A;  5KAF O;  8ICC A;  8ICH A;  2ZJ5 A;  3MFH A;  4M6W A;  4FQE A;  1JI7 A;  2ZTE A;  1B22 A;  5EOZ A;  1JRP A;  2W81 C;  4LSI A;  5AIA A;  1LKY A;  3T5J A;  2XY7 A;  5AM1 A;  2WVP A;  1KTQ A;  2KTQ A;  3WKE A;  1ZQD A;  2M07 A;  4FES A;  2BGW A;  2RLT A;  3VY8 X;  5DBC A;  1OXJ A;  3NRZ A;  4RL9 A;  3WKA A;  3SZ2 A;  3PW5 A;  3POQ A;  2YN4 A;  4GCP A;  1KDH A;  2I6X A;  5HNK A;  4K4I A;  4FRT A;  2LYH A;  7ICV A;  1BPB A;  2HMX A;  1ZYQ A;  2ZIV B;  1ZQG A;  3EYZ A;  5DGA A;  2JEJ A;  3BZK A;  1B43 A;  4GF4 A;  4AFK A;  4F4Z A;  5EE0 A;  2YX8 A;  3ICX A;  4UAY A;  4EBD A;  3FYH A;  1TVA A;  9ICA A;  2W3R A;  5AI9 A;  4Q8F A;  2I9G A;  1QH9 A;  2KSO B;  4DFD A;  2JQY A;  1X40 A;  1X6J A;  1CUK A;  4IC9 A;  3VCB A;  4GXI A;  2NO4 A;  2XE1 A;  4JB3 A;  4LSE A;  2VIX A;  5ALQ A;  4R65 A;  3PY8 A;  5KFA A;  2HVH A;  3QNM A;  5KFG A;  1U4B A;  4D5U A;  3ED5 A;  5J0W A;  4LZD A;  5AI4 A;  2W8L A;  9ICO A;  2LHF A;  2FLN A;  8ICF A;  4C4V B;  4DFK A;  2WF5 A;  4P0Q A;  4NLG A;  2N2M A;  4QZE A;  4DL3 A;  4NL9 C;  3M8R A;  3TZG A;  2VAN A;  2C22 A;  2ASL A;  4DOC A;  2DPI A;  3D6J A;  4ECU A;  2QKQ A;  1RG6 A;  3UU2 A;  4FBU A;  2POR A;  3DWN A;  4PGQ A;  9ICW A;  4F92 B;  4X5V A;  2LHT A;  1Q9G A;  2Y1J A;  2ZIU A;  3LK9 A;  3A0H U;  3M8S A;  3N7S C;  3IN5 A;  5J0P A;  1XSP A;  1NK0 A;  3Q8S B;  4DQR A;  4CF4 A;  3CRX A;  5KG1 A;  4US9 A;  3SY9 A;  2H3I A;  1X2I A;  5ADX K;  3LYS A;  2LKY A;  1SIJ A;  2CN1 A;  1L8O A;  4CTD A;  2WFA A;  4MHV A;  3E2E A;  1ZHY A;  4NY8 A;  1ZHT A;  5ADX L;  1K1Q A;  2KFZ A;  5JTI A;  5ALJ A;  1L7N A;  1JRO A;  4UAW A;  2K4E A;  1ZQI A;  1ZQW A;  3NUQ A;  1BPD A;  5AKZ A;  4EBE A;  5J2F A;  1EXN A;  4ECW A;  4Y2R A;  1UT8 A;  1RQL A;  5FVN A;  3GIJ A;  1ZRN A;  3BZC A;  5AIB A;  4I27 A;  3T79 A;  5J0T A;  1FO4 A;  4KX3 A;  3D2S A;  4Y2V A;  4ELU A;  2HHQ A;  4JWN A;  8ICT A;  4FZN A;  4RQ3 A;  4C7Z A;  3AAE A;  4O3X B;  3ETR A;  4J03 A;  2A1J B;  8ICG A;  1QSS A;  5G3A A;  1CRX A;  2KJ8 A;  4U7C A;  5KFP A;  1KEJ A;  3PGU A;  3TAC B;  4LJX A;  3ZDA A;  8ICB A;  4YR3 A;  2JMM A;  4O5C A;  1V85 A;  4XA5 A;  2K8C B;  1BPE A;  1RM6 C;  4YG2 A;  3NSG A;  3SEI A;  3QU9 A;  1A0P A;  4RNN A;  2R8J A;  5AI5 A;  2UVU A;  3KHR A;  3M9M B;  2NV3 A;  5J0S A;  4C4S A;  1RXV A;  2IHN A;  4N75 A;  1B4F A;  4PHA A;  3L3F X;  5DQH A;  2HOF A;  3A0B O;  4FT6 A;  3PSP A;  3HX0 A;  1IXR A;  4DSE A;  3K1Z A;  2LMR A;  2F2A B;  5ALU A;  2RP5 A;  3AM9 A;  2EH9 A;  4CF5 A;  3PW4 A;  4RQN A;  4IR1 A;  4I2H A;  4M9H A;  3MR2 A;  5J2G A;  4DCC A;  1L7P A;  3DV9 A;  3OSP A;  1FFU A;  5DB8 A;  4UB5 A;  3M7D A;  1ZQK A;  1RXW A;  5GTH U;  1KFD A;  2CXY A;  9ICB A;  3T3F A;  3SD7 A;  3F2D A;  2N2L A;  4ED3 A;  1Y88 A;  1RDF A;  4TUQ A;  2KNJ A;  3L4P A;  4NV0 A;  4MF8 A;  5ALP A;  4KRA A;  4UB8 U;  4NLB A;  4RPZ A;  1ZQE A;  2WAQ C;  3QUT A;  4Z6E A;  5CRX A;  4I29 A;  1BH3 A;  3WK6 A;  1SL2 A;  2YMM A;  2PFN A;  2XIC A;  4LZG A;  3AA0 B;  4N74 A;  3G6V A;  4QZC A;  4O3Q A;  4OO1 J;  5AK4 A;  1NKE A;  4GHB A;  2HHX A;  3ZDE A;  3IM1 A;  1IZN B;  3Q8R B;  4I2G A;  1G90 A;  2ZIU B;  5H2F U;  4B61 A;  4C8M A;  2OH2 A;  3KD3 A;  4RLC A;  5KFT A;  3BS5 A;  2ODJ A;  3JPS A;  4QWA A;  3I76 A;  5J2B A;  1KBU A;  2ZTC A;  5AM5 A;  3QRC A;  3RAX A;  2R18 A;  4NLZ A;  1E54 A;  2JEG A;  3MGV A;  4UAR A;  2K8B B;  1PHO A;  2W43 A;  3UQ2 A;  4M0A A;  1ZQN A;  2PRN A;  3MFI A;  4O3M A;  1JMS A;  4KN4 A;  1HXX A;  2GH1 A;  5KFK A;  3VC8 A;  2E8M A;  3F5A A;  2AXT O;  9ICQ A;  5AKY A;  1IG6 A;  5KG4 A;  1QJ8 A;  5EWF A;  3EPG A;  3TQ1 A;  3PMN A;  1VJ5 A;  4F2S A;  2B6G A;  7ICP A;  4KR8 A;  3EUB 2;  3H4B A;  4Z6C A;  1THQ A;  4NM2 A;  4FS2 A;  3S6J A;  1XNS A;  5CHG A;  1KSP A;  1LB2 B;  5E79 U;  4YD1 A;  3BRZ A;  3AQE A;  3I28 A;  3SR6 A;  2W9C B;  2W7O A;  2WF7 A;  1MC8 A;  4F5P A;  3BQT A;  3M6Z A;  2W9B B;  4BDP A;  2JXJ A;  2C2R A;  3IV6 A;  1ZHW A;  5J2C A;  4YR0 A;  5GV0 A;  2GOL A;  4ECS A;  2XCP A;  2WAQ F;  3E58 A;  3BQ1 A;  4EYI B;  3H0L B;  5CWR A;  4EX7 A;  4JK1 A;  7PRN A;  2R89 A;  3V6H A;  1ZJN A;  5AI8 A;  2DKZ A;  1BGX T;  2CRX A;  2L5Y A;  2HVI A;  3RR7 A;  3HW9 A;  4QWB A;  5AFU K;  5KT6 A;  1NKB A;  5AM2 A;  2PXI A;  4U9C A;  2EAP A;  5DL6 A;  4MFA A;  4IL6 O;  2I1Q A;  3B0X A;  1GFQ A;  4RJW A;  2Y1I A;  5ALX A;  5DL7 A;  3DZM A;  4DOB A;  2YQE A;  1ZQO A;  2H3V A;  3QZ8 A;  1BXW A;  4Y2P A;  4F5O A;  3AQF A;  3JPN A;  2GLE A;  1ZQY A;  4O3Z A;  2FGR A;  2ZUB A;  2WF8 A;  4EYH B;  3SYB A;  4BGD A;  2UVV A;  3QUC A;  2G07 A;  2DUY A;  3T5L A;  1WG8 A;  3V6J A;  4UAU A;  5JRT A;  7ICG A;  5CB1 A;  2MUT B;  1GFP A;  4OJP A;  2KKV A;  4KLD A;  3RJI A;  1DRG A;  2KZ7 B;  3HOL A;  4ZH4 A;  5E79 O;  5KFV A;  4R8U B;  5J2K A;  1DGS A;  4J9Q A;  5DB7 A;  2F1V A;  4QW8 A;  2DQN B;  4UAS A;  5KAI O;  2WJR A;  5KFY A;  4GFJ A;  5AIC A;  1N2X A;  2E8O A;  2Y9T A;  2ZUC A;  5KFF A;  2DFL A;  4I2E A;  4AYM C;  4DFJ A;  1TE2 A;  5ALW A;  2MNH A;  3CW2 C;  4O3P A;  5J0U A;  1HIW A;  2KZ3 A;  2H5X A;  2WHE A;  3PZP A;  3NAS A;  4YVZ A;  4FUV A;  4RT2 A;  3K1R B;  1L7O A;  3V7K A;  3LK2 B;  4K4H A;  2EAM A;  4KLH A;  1QSY A;  2FDR A;  3FAH A;  4J9K A;  5HHI A;  4O3N A;  1N48 A;  3VZW X;  4KN7 A;  4F3O A;  2JZB B;  3V7L A;  2AJQ A;  3HJE A;  2KKP A;  4UB1 A;  4O3S A;  2X9K A;  1GFO A;  3MC1 A;  3RBH A;  2KVC A;  4IRD A;  4NL9 A;  4B6J A;  3LDA A;  4ICA A;  1F5S A;  2W80 C;  2DF4 B;  4F4X A;  4IR9 A;  9ICP A;  5KT2 A;  3RH6 A;  1U45 A;  4UB4 A;  1ZHZ A;  1FEZ A;  5ALN A;  3K75 D;  3UXO A;  2NO5 A;  4DOA A;  4XQ8 A;  3WU2 U;  1LKY B;  2FMS A;  4FO6 A;  2EZY A;  4XNL A;  4YMM A;  3EZ5 A;  1N5W A;  5T5F A;  2YTU A;  2KJ9 A;  2QAR B;  1SL0 A;  3GV7 B;  3HP6 A;  3T24 A;  2ESE A;  3N97 B;  5GTI U;  3PSI A;  4MFC A;  1ZD5 A;  5GTH O;  2WB1 F;  1U49 A;  3F53 A;  1QQ6 A;  5K4L A;  2VA2 A;  2LBO A;  1N56 A;  3SZD A;  4QZ8 A;  3V6K A;  1IV8 A;  1HUO A;  3HKZ C;  8ICP A;  5KFR A;  1YZ6 A;  3SAF A;  2KIV A;  3G7G A;  4P0Q B;  3RJJ A;  3GZF A;  3IG8 A;  4Y2Y A;  3BDP A;  5G5H A;  3HKZ F;  3O0E A;  2NRZ A;  2Y0S C;  4JWM A;  3PQU A;  3QZ7 A;  1Z1V A;  3LVW A;  2KN7 A;  4PZN A;  4F5R A;  4EEN A;  4B9T A;  5J2D A;  2EAN A;  2GWS A;  4PGY A;  5KTQ A;  4K4G A;  4AYI D;  3UXN A;  1TFR A;  2HI0 A;  1CI4 A;  2MAX A;  3SV4 A;  5ALV A;  1NK6 A;  2F8L A;  1BPY A;  2XGQ A;  4B9S A;  5HP4 A;  4PHE A;  9ICH A;  2AGP A;  8ICA A;  3V8U A;  2ZIV A;  4F4W A;  3Q8K A;  1KLN A;  2ALZ A;  3QEA Z;  5AK6 A;  2Z7J A;  3KZX A;  2P35 A;  4E1T A;  2JRZ A;  4F5Q A;  5G38 A;  4IQW A;  2FPK A;  4RQ5 A;  3PW0 A;  1JAL A;  3GP6 A;  4RQ6 A;  3OJS A;  2HOQ A;  4QZ9 A;  1JUD A;  1C20 A;  5ALT A;  1L7M A;  4O3W A;  2R4L A;  3POU A;  3C5O A;  1PK1 B;  1TK5 A;  4ZOH C;  4MFF A;  4Y2X A;  1TV9 A;  4TUR A;  4G9B A;  2H3Q A;  4I2A A;  2ZJA A;  2NRX A;  5KFC A;  3ZDD A;  4PR7 A;  4QW9 A;  3QU5 A;  3BS5 B;  4PL1 A;  3OTQ A;  5HR6 A;  1ZQR A;  7ICQ A;  1RQN A;  5KFH A;  4C8K A;  4ECY A;  4C00 A;  9ICK A;  5D46 A;  2R8K A;  1HXU A;  2VA3 A;  4O49 A;  3PRN A;  4B9U A;  4AYB F;  8ICJ A;  1V97 A;  2C28 A;  4RU9 A;  4J9P A;  1L6N A;  1DXS A;  1H38 A;  4B9M A;  3KZI O;  3RJK A;  5D5D A;  1ZQQ A;  3CP8 A;  5TIS U;  2KIC A;  1GFN A;  2PKE A;  1SWV A;  3SI8 A;  1HEK A;  2QB0 A;  4FBT A;  5IIK A;  3RJF A;  3BS7 A;  3FYX A;  3G6Y A;  4EEK A;  4XNK A;  4KTQ A;  2BPC A;  3TAD C;  5L9X A;  1XSL A;  4NWI A;  1ZQP A;  5ALH A;  2BKE A;  1HUZ A;  4FZM A;  1S0N A;  2IHM A;  4ED0 A;  2G5I B;  4P0P B;  1TAQ A;  1ZQM A;  2ZXI A;  2KP7 A;  3B0Y A;  4ED8 A;  5DQI A;  1QJ9 A;  4XRH A;  5TIS O;  3VZU X;  1ZD3 A;  2A19 A;  1A77 A;  1MQ2 A;  2DBY A;  1Q3V A;  2KZZ A;  3PX6 A;  1S10 A;  3TAR A;  4RQ4 A;  4B9L A;  3PX4 A;  1V38 A;  5ALF A;  1D9F A;  4IQV A;  7ICL A;  4Z3T A;  5HML A;  2JEF A;  4KLO A;  5D49 A;  2HBM A;  5KFU A;  2F76 X;  8ICZ A;  1N60 A;  4F72 A;  2C2D A;  1WYG A;  4MF2 A;  4J9N A;  1ZRM A;  5ALL A;  2MU2 A;  4KLU A;  1QCK A;  4RJX A;  4HYK A;  4JUZ A;  3AUO A;  2AH5 A;  3PO4 A;  2ZIX A;  4IL6 U;  3UPG A;  2WF9 A;  4OJL A;  5IIM A;  3AEV A;  5EWE A;  4DSI A;  3RJE A;  4F4B A;  3DEE A;  4F5N A;  4RQ7 A;  3EPI A;  4UBC A;  2B0C A;  3DA4 A;  5G5G A;  1BNO A;  5DGB A;  9ICL A;  2W9B A;  5ALI A;  5KAF U;  5KG7 A;  4JV1 A;  5KFS A;  3RB0 A;  1K5O A;  1SZP A;  2FJ6 A;  2MSN A;  3M9O B;  8ICL A;  2RDI A;  4AYN A;  4RZR A;  3TAD A;  1KFT A;  1ZQB A;  1ZQV A;  1U9L A;  8ICO A;  4O3Y A;  5G39 A;  8ICX A;  2HHU A;  4DLE A;  3C1Y A;  4ELT A;  1N62 A;  2G09 A;  2VJ4 A;  1D8B A;  1Q3U A;  1B0X A;  1MSW D;  3C5F A;  2HHV A;  2J6T A;  4I2F A;  5KG2 A;  1RYS A;  3RH4 A;  1SWW A;  5A0L A;  2W9A A;  5IIL A;  2F1J A;  4GC6 A;  4PPX A;  1S8O A;  3VZT X;  5AKI A;  3C2L A;  1ZQZ A;  2HDO A;  2KG5 A;  2OWO A;  5KFD A;  1NK8 A;  5TZV A;  9ICE A;  3T20 A;  2YY6 A;  4QQ1 A;  4C69 X;  4CDG A;  3M9N B;  3AA7 A;  2KDY A;  1S0V A;  3KBB A;  2Y0L A;  1UCV A;  2QB0 B;  9ICJ A;  2K89 A;  3RB6 A;  4MEX A;  1Q9F A;  2KXP B;  2YPV A;  4CCH A;  5DL8 A;  2WB1 C;  2KHV A;  3GV5 B;  3THV A;  3DA3 A;  4RNO A;  1S77 D;  2FPM A;  2W03 A;  4YMO A;  2F1C X;  1ZQU A;  2K4I A;  3SZV A;  3AL0 B;  1X66 A;  2ISP A;  3PF1 A;  4YCX A;  5KAI U;  2O6K A;  1KQQ A;  1PVQ A;  4I2B A;  4Z6D A;  2MA1 A;  2BR0 A;  3OGU A;  2KZM A;  3JPQ A;  2LYA A;  5KG5 A;  1U48 A;  1NJX A;  4AYB C;  3MDC A;  4UB8 O;  5J0Q A;  2ZIW B;  1GO3 F;  3VY9 X;  3QEB Z;  3LK3 A;  4DL4 A;  3KZI U;  1X9S A;  1NJY A;  2R8I A;  4GCQ A;  7ICK A;  2KOB A;  1T16 A;  3PQS A;  2W3S A;  5DG9 A;  4K3C A;  2K4P A;  4KLT A;  3POX A;  2Y9U A;  2ISO A;  4O4X A;  8ICV A;  1OUQ A;  2DL0 A;  3SAG A;  8ICY A;  3PR5 B;  5DKW A;  1Q8K A;  3ONN A;  2F3N A;  4PGX A;  2LPE A;  1ZQA A;  3H7I A;  4K3B A;  5AFU L;  3F2B A;  2JMG A;  2K4H A;  3KKA A;  4DF4 A;  2R8G A;  4O4U A;  3RB4 A;  4EEY A;  1X9X A;  5AM3 A;  4USA A;  3LK2 A;  4O5K A;  3JPT A;  2WJQ A;  5AKX A;  3B9J A;  8ICM A;  4UAT A;  3H8M A;  3T5H A;  1JX4 A;  1V9P A;  3H4D A;  2G0A A;  4QWE A;  1F0M A;  2Q4T A;  1ZQT A;  4KLJ A;  1VDV A;  8ICK A;  3AAE B;  4YR2 A;  4BJQ A;  4R66 A;  4TQS A;  3H0M B;  1ZQL A;  8ICR A;  3JCU O;  4TUS A;  2BHN A;  2NRT A;  1S0M A;  3UMG A;  4DFP A;  2GE4 A;  1IM4 A;  3PSF A;  3N4M B;  2OCE A;  5AKH A;  2IOH A;  4J9S A;  3AAA B;  3HOE A;  4P4M A;  4IQU A;  3QYP A;  1O08 A;  4P2H A;  3TKA A;  4GLX A;  2BPG A;  4YXJ A;  3N7P D;  4C0Z A;  4FZL A; 
#chains in the Genus database with same CATH homology
 3RF9 A;  3HWB A;  3AA6 A;  3POQ A;  4GCP A;  4KMO B;  4XNL A;  1PVR A;  5T5F A;  2BDU A;  4FRT A;  2KJ9 A;  4JMU A;  3T24 A;  2HMX A;  2H3Z A;  2ZIV B;  3PST A;  2OMF A;  1MM4 A;  3PSI A;  4GF4 A;  2WB1 F;  4AFK A;  3VE1 A;  3F53 A;  4QIW C;  2E1F A;  2YX8 A;  3ICX A;  2LBO A;  1ZQ1 C;  3LK4 1;  3SZD A;  3HKZ C;  3D2Q A;  4QNL A;  2QTK A;  4IC9 A;  3VCB A;  2XE1 A;  3SAF A;  4LSE A;  3G7G A;  4P0Q B;  2VIX A;  8PRN A;  3GZF A;  3IG8 A;  1MPF A;  2Y0H A;  3HKZ F;  3O0E A;  5JDP A;  2Y0S C;  1QJP A;  3PQU A;  5DL5 A;  4D5U A;  1P7D A;  3LVW A;  1Z19 A;  2LHF A;  2YNK A;  4P0Q A;  2N2M A;  4AYI D;  3RFA A;  3VE2 A;  3TZG A;  3KVD D;  4N58 A;  5EE2 A;  2W7P A;  2Y7S A;  2F8L A;  4JCH A;  3UU2 A;  2POR A;  5G26 A;  3V8U A;  2ZIV A;  2MHL A;  2LHT A;  1Q9G A;  2ZIU A;  2O4V A;  3N7S C;  3QRA A;  4FMS A;  2YB4 A;  2Z7J A;  3IN5 A;  3KZX A;  4E1T A;  3GP6 A;  4JFB A;  2HOQ A;  1IIP A;  3CRX A;  3AA6 B;  2W04 A;  1URJ A;  3SY9 A;  2H3I A;  2OXO A;  2ZIW A;  3LYS A;  1MA7 A;  5ADX K;  2LKY A;  3IG5 A;  3AA0 A;  4O3W A;  4LSH A;  3POU A;  3C5O A;  2CN1 A;  1ZHY A;  1ZHT A;  1BT9 A;  5ADX L;  2H3Q A;  3AA1 A;  2LFU A;  2K4E A;  4PUX A;  2KJ5 A;  3NUQ A;  4G75 A;  2K8A A;  4BX9 C;  4PL1 A;  2G5H B;  3A2S X;  4GCS A;  5HR6 A;  5FVN A;  2VJ5 A;  3O0F A;  3T79 A;  2K4T A;  2ZLD A;  1XO0 A;  4KX3 A;  3D2S A;  2OYY A;  1HXU A;  4FZN A;  3AAE A;  4O3X B;  3JTY A;  4O49 A;  3PRN A;  2LYB A;  4KR4 A;  4FOZ A;  4AYB F;  3IP4 B;  1L6N A;  5D5D A;  2XTR A;  1CRX A;  2KJ8 A;  3LVV A;  3CP8 A;  4U7C A;  2JHD A;  2KIC A;  2XID A;  1GFN A;  2XE2 A;  2KC0 A;  4U6P A;  1HEK A;  2JMM A;  2K8C B;  3AA7 B;  1A6S A;  2G08 A;  4WJ3 B;  1ED1 A;  3FYX A;  2KD1 A;  1OPF A;  4AKM A;  4XNK A;  3NSG A;  1A0P A;  4AZL A;  4NWI A;  1ECW A;  6PRN A;  2ZXH A;  2NV3 A;  4PL2 A;  4FRX A;  2KEY A;  2J1N A;  4FZM A;  4FSO A;  4AKR A;  2G5I B;  3L3F X;  2E1E A;  4P0P B;  4QIW F;  2HOF A;  2ZXI A;  4FSP A;  4FT6 A;  3PSP A;  1T94 A;  1YS5 A;  3KFU F;  2M06 A;  1QJ9 A;  3SMV A;  5KL8 B;  3K1Z A;  3UAQ A;  3VZU X;  3AA1 B;  2F2A B;  2RP5 A;  3POR A;  3WI4 A;  1Q3V A;  2RRD A;  1PRN A;  3M7D A;  4D65 A;  3F2D A;  4Z3T A;  2N2L A;  2HBM A;  4RLB A;  2F76 X;  2KNJ A;  4NV0 A;  4OJO A;  3WI5 A;  4KRA A;  4NLB A;  3EMN X;  5C0Y A;  4D64 A;  2WAQ C;  5CRX A;  2FGQ X;  4RJX A;  1BH3 A;  2XVT A;  1IZN A;  2XG6 A;  1GFM A;  2ZIX A;  2XIC A;  3AA0 B;  3UPG A;  4OJL A;  4OJ6 A;  3NRW A;  4F4B A;  3DEE A;  4OO1 J;  5T14 A;  2XTQ A;  2Y0K A;  4GHB A;  1IZN B;  1G90 A;  2ZIU B;  3F5E A;  3DA4 A;  2OH2 A;  4B61 A;  5HR7 A;  2JH1 A;  4RLC A;  3AAA A;  2ODJ A;  4AYD C;  2HBJ A;  1KBU A;  2RHF A;  1WUD A;  2ERV A;  3QRC A;  2R18 A;  2ZFG A;  1E54 A;  3M6K A;  3MGV A;  2Y0S F;  2N1R A;  4AYN A;  2KXP A;  2K8B B;  1OSM A;  2HBK A;  4N59 A;  2A3V A;  1PHO A;  1H6S 1;  2JGA A;  2PRN A;  2K0L A;  4O3Y A;  4O3M A;  1HXX A;  2GH1 A;  3VC8 A;  3F5A A;  2G09 A;  2VJ4 A;  1D8B A;  3K19 A;  2XMX A;  1Q3U A;  1PVP A;  1QJ8 A;  4KR8 A;  3GU3 A;  2J4U P;  1THQ A;  5A0L A;  1XNS A;  3LK4 2;  2VKQ A;  3VZT X;  2OM6 A;  3AQE A;  3ALR A;  1HXT A;  2W7O A;  5IYU A;  1MM5 A;  1ORM A;  3M6Z A;  4BUM X;  4AKR B;  2H3F A;  3T20 A;  1ZHW A;  4QQ1 A;  4C69 X;  4CDG A;  3AA7 A;  2KDY A;  2Y0L A;  2F1T A;  5GV0 A;  1Z1B A;  4E1S A;  2GOL A;  3H0R B;  2K89 A;  2WAQ F;  3H0L B;  1Q9F A;  4NLC A;  2KXP B;  4AYE C;  4LSF A;  2YPV A;  7PRN A;  2E5S A;  4QJF B;  2KZ7 A;  5DL8 A;  2WB1 C;  3C29 A;  2CRX A;  2KHV A;  2KV2 A;  4FE3 A;  1NZB A;  2XE5 A;  3DA3 A;  3HW9 A;  5AFU K;  2YB1 A;  1ZHX A;  4U9C A;  5DL6 A;  2W03 A;  2PMZ F;  2K4I A;  3SZV A;  1GFQ A;  3AL0 B;  4RJW A;  5DL7 A;  1PVQ A;  3E0F A;  2MA1 A;  2H3V A;  2XE3 A;  2LYA A;  4AYB C;  5KL1 B;  2PMZ C;  2ZIW B;  1GO3 F;  3VY9 X;  1BXW A;  3F2C A;  2CPR A;  3AQF A;  3LK3 A;  4O3Z A;  2HOI A;  1UPH A;  4KX5 A;  2FGR A;  1YT3 A;  2ZG6 A;  4GCQ A;  2Y2X A;  2HBL A;  3SYB A;  2KOB A;  3PQS A;  3CYM A;  3SYS A;  4AUI A;  2G07 A;  3D2N A;  4P0P A;  3POX A;  4CRX A;  2ZIX B;  3SAH A;  1GFP A;  4O4X A;  1OUQ A;  3SAG A;  2XI9 A;  4OJP A;  2KKV A;  1DRG A;  2KZ7 B;  3HOL A;  3ONN A;  3T0S A;  4A8E A;  2KIW A;  3LK3 B;  5AFU L;  3F2B A;  2JMG A;  1TAM A;  2K4H A;  2G06 A;  1F44 A;  4O4U A;  2F1V A;  2DQN B;  1SZH A;  4GFJ A;  1P4T A;  3LK2 A;  4CGZ A;  4AYM C;  2F77 X;  2MNH A;  1HIW A;  2D6F C;  3PZP A;  2G0A A;  4FUV A;  2Q4T A;  2KHQ A;  3OPX A;  3LK2 B;  4BUG A;  4OJ5 A;  3C28 A;  3AAE B;  4BJQ A;  4G76 A;  3H0M B;  3SY7 A;  2MRL A;  3VZW X;  3SQI A;  5PRN A;  2KKP A;  1GFO A;  3RBH A;  2KVC A;  2GE4 A;  4ACO A;  4ICA A;  4LSI A;  2W81 C;  3PSF A;  2W80 C;  2JH7 A;  2DF4 B;  2DGZ A;  3AAA B;  3HOE A;  2X27 X;  3N7R C;  2M07 A;  4FES A;  3VY8 X;  1ZHZ A;  2M0N A;  4RL9 A;  3N7P D;  4C0Z A;  4FZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...