4FZNA

Crystal structure of syringacin m mutant d232a from pseudomonas syringae pv. tomato dc3000
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
276
structure length
276
Chain Sequence
PIELPPTYITPYPEISAGGNGTYRGQDLSSGQSFPRGMQNPVATVLLLQGDLYCSPNCLATFQDQARRDSFGIQSKVALKTFAAADQREAEGRDLRTAYNEIATDIGRSQQINENIIKYPPGNHVLSGGLMTPFHALAHGMFGLGAPLTFPIQNVGLNVDIRGIPDVMNVIQSARPVGTSSLDVNFAYDVGKDSNASWLTLGNITLRLVGTIDKNASGAWTFSGEIRAFNAVYDANPSNHRGWLGENLTSLLSAVPFTSYSIEIPGSLPVTVSGNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacteriocin
publication title The Crystal Structure of the Lipid II-degrading Bacteriocin Syringacin M Suggests Unexpected Evolutionary Relationships between Colicin M-like Bacteriocins.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Antimicrobial protein
total genus 74
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.880 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4fznA01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4fznA02
4FZMA 4N59A 4N58A 2XTRA 4FZLA 4G75A 2XMXA 2XTQA 4G76A 4FZNA 3DA4A 3DA3A
chains in the Genus database with same CATH superfamily
4N59A 4N58A 4GF4A 1JX4A 1GFQA 4TUQA 3OJUA 5J2GA 2KHVA 1X6IA 1X9SA 1MM5A 4Y2XA 1ZQAA 1UA1A 2BCSA 2I9GA 3BZKA 1RPLA 1SZPA 4I2IA 3HPOA 5KTQA 1V97A 3QX7A 9ICIA 4O4UA 3PW4A 1HEKA 5AM2A 3J81j 4TUPA 2DPJA 4UB4A 2KXPA 3TZGA 3UXNA 3SZDA 1BVSA 5AK4A 4NL9A 1P7DA 3NVYA 5KAIO 3RFAA 4MF2A 3SY9A 4MEYA 4FOZA 4JB3A 1D8LA 3PSTA 1N5XA 2YMQA 4I2DA 3QNMA 4F92B 4RNMA 4KLMA 4ED3A 3LYSA 2ZTCA 4C00A 3M8RA 4UARA 2MUTA 4QIWC 3MR2A 1IZNB 3LK9A 4RT3A 3O0EA 4A8EA 3DA3A 3GV5B 1MC8A 3NASA 9ICCA 3TI0A 4O5KA 3PRNA 3UPGA 4JCHA 2ZLDA 3QRCA 2O4VA 3MC1A 3IM1A 4AUIA 2IA6A 4ACOA 5KFMA 5AM3A 5KG0A 3JPTA 5GTIO 2AXTO 2FLPA 3IG8A 3Q8QB 2XE2A 1NK0A 2VJ4A 4LSFA 3WU2U 1TKDA 4YD2A 3M6KA 3CYMA 4C4SA 5G5GA 4XA5A 2UVRA 3K4GA 4BDPA 8ICKA 1U4BA 2HBKA 1K1SA 1HJPA 3MDAA 3WK5A 3RJEA 1KW4A 1DRGA 1FEZA 4QZGA 3F2CA 4B6JA 3UMBA 3AUOA 4O3MA 4UBBA 3N7RC 5TZVA 3IG5A 1IV8A 5J0WA 5J0UA 2IWWA 2EH9A 3QEAZ 2GE4A 3AAEB 4DF8A 4K3BA 3GU3A 5J2IA 4HAIA 4J9QA 2ZJAA 5GV0A 1NKCA 4LJXA 1KDHA 5D49A 4Y2JA 1BXWA 3ZI4A 3BQ0A 3CNHA 1PZNA 2DGZA 1UHUA 2XVTA 4MF8A 4UB1A 2BCQA 1NK7A 1XS9D 5IIMA 1DK2A 4M9GA 2BGWA 8ICJA 2F1IA 4QQ1A 4RPYA 5JUMA 1BPZA 5ALQA 1PVRA 3QXGA 2WF6A 4DL4A 2GLEA 2HI0A 1TVAA 4Z6DA 5IILA 2JHDA 3PGSA 2HHVA 2G07A 5EWEA 2ZFGA 3SZ2A 5AKIA 1S76D 2KE7A 4C4VB 2OM6A 4I2GA 3PGUA 1PK1A 5J2KA 4C8OA 2F1CX 2K4EA 1GFMA 2E3TA 5KFJA 3B0YA 5ALEA 1A0PA 3T5JA 1Z00B 5TISO 1X66A 4EEKA 3RJGA 2AQ0A 5AI9A 4KX3A 3GIIA 3THVA 3AQEA 2A1JA 1AROP 4CNQA 1SKWA 3M7DA 1L7PA 3RJFA 4KLQA 1RQNA 7ICTA 3AA7A 1JUDA 2C2DA 4NLBA 2IOFK 4DOBA 5KT5A 2G08A 3A2SX 2KSOA 4I2JA 1X2IA 4JWNA 1Z19A 3HKZC 2YTUA 1ZD4A 2CN1A 1MM4A 3AA0A 2R89A 4IQTA 1TAQA 2M0NA 2FGRA 3BQ2A 1GFNA 1ED1A 2YMLA 4YR3A 1SIJA 1TK0A 2HBLA 3T3FA 2F44A 2FE9A 5DG9A 3ICXA 2KZ7A 3LK2A 2EZZA 7ICQA 2W54A 2QKQA 1ZQRA 2E8PA 2F8KA 5L1KA 4FZNA 2YMMA 5CHGA 4P0QB 1XSNA 3OSPA 3WKBA 3OJSA 5D46A 3VY9X 5DG7A 5KFNA 3BS5B 4UAUA 4DQPA 5KT7A 1IG6A 5DGBA 3UXOA 1ZRNA 4TUSA 1L3SA 1JRPA 3SMVA 2F1TA 2HOQA 3ZDAA 1GFOA 2CPRA 3NTUA 5ALYA 3AA1B 4OJLA 2F1VA 5KT3A 5J0PA 2ZIWA 5HMMA 3EWAA 1TV9A 3V7JA 2P6RA 4O3SA 3PSPA 1X9WA 1CEZA 5ALTA 4O5CA 4YD1A 1AQ6A 2ESEA 4I2HA 3IDWA 8ICLA 8ICWA 4DS5A 2M07A 5KT6A 1DXSA 2J6TA 1ZQOA 3DWNA 5J0OA 4YXJA 4KLUA 4P4OA 1LKYB 1H6S1 3PQSA 4CF5A 1DGJA 3D6JA 4PZNA 2KK0A 4KMUA 2A3VA 2W9CA 1ZD3A 1Z4NA 5CR0A 4AYNA 4JV2A 2ZXIA 4Q8EA 3OTQA 4CDGA 2V9WA 5KFUA 1TK8A 3SV3A 5JRTA 2BCRA 1XSLA 2ZIXA 1RG6A 5K4LA 5AM4A 3BRYA 2G09A 8PRNA 3QU5A 8ICOA 1ZQZA 3KVDD 3SAGA 3RH5A 4PHDA 1SXDA 2VKQA 2FMPA 1HXUA 7ICEA 1NK8A 1SWVA 4KRAA 5L9XA 5J0QA 1WWVA 3TACB 4DF4A 2BHNA 2ATLA 1QTMA 3SEIA 1RXVA 4B9UA 1ZQKA 2RQ5A 5KFGA 4Y2SA 2PMZF 4ICAA 4ECZA 4PL1A 3T24A 4DLGA 1NK5A 1SL2A 1CRXA 5HNKA 1QQ6A 3RJHA 4F4YA 5AKHA 1UT5A 4C7YA 4EZ6A 1T1LA 1ZQNA 3AEVA 2ODGA 4C4RA 5AI4A 4RQ4A 1NKBA 1PK3A 7ICFA 4Z6EA 4J9SA 2MSNA 2XCPA 3DEEA 1N48A 3PX0A 2KV2A 7ICUA 5AIBA 1DK3A 5ALWA 3JTYA 5ALIA 1FIQA 3V6JA 2ZIUB 4F50A 1IIPA 3VZWX 3NGDA 4LVSA 1KEJA 2ZIVA 3PSFA 5L1LA 2LHTA 9ICQA 3BZCA 2HVIA 2JEGA 3C5OA 3GFKB 5KL1B 1JALA 3MGHA 1SZHA 1MSWD 2FJ6A 4F2SA 3A0HU 4ECXA 2HHTA 5ALRA 3JPPA 2B0CA 3CW2C 2ZG6A 4YXMA 4ELUA 3Q8MA 2R4PA 4F4BA 4P4MA 1HUZA 1L6NA 5DLFA 2XY5A 1Q3VA 2HVHA 2ZJ5A 3FYHA 1ZQSA 2XI9A 2HHWA 4KN7A 1EXNA 1Q9GA 2F3NA 5J8YA 2ZTDA 4FSPA 5ALJA 4I2EA 1ZETA 3SYZA 1TK5A 9ICNA 4OO1J 3ZD8A 3ZDBA 2W43A 2F1JA 4FUVA 2FPKA 2KC0A 1BNOA 4FO6A 3RJKA 3D2QA 4JWMA 2LMRA 5KFQA 4D5UA 3H8WA 4QZ8A 4K4GA 5ALOA 2NRXA 5DDMA 3PGRA 4C69X 3K1ZA 3AAAB 3MGVA 5KFRA 3PY8A 2DL0A 4P4PA 1UT8A 4F4ZA 3DDHA 3RH4A 3QUQA 8ICVA 2ZUCA 2XGQA 3PMNA 2OCEA 2WB1F 4RUCA 4MFCA 1TFRA 1K1QA 4AKRB 4RU9A 2F77X 2O6KA 3I1YA 5F9LA 8ICPA 4O3QA 4USAA 3BDPA 2QARA 2RDIA 1IXRA 4DL2A 5ALUA 2WF7A 3FAHA 5KG6A 3K1RB 4AYBF 4Y2YA 4X5VA 3SAHA 1XO1A 3PORA 4RT2A 2ALZA 3M1YA 3RB4A 4GLXA 4C8LA 5DQGA 2W81C 4EZ9A 2Y0SC 1SKSA 4JV0A 3UXPA 5IIKA 3JPRA 2KIVA 5KFYA 3V6KA 3TANA 1F44A 2C22A 5G5HA 5IIOA 3MR6A 1RYUA 3BQTA 2KNJA 4UB8U 2LBOA 2ZXHA 2EZYA 9ICGA 3RJIA 5AKXA 2J1NA 4IC9A 1T16A 4PHAA 4AKMA 2JZBB 4G9BA 2W9AA 4RQ1A 4C8KA 3UQ2A 4EBEA 1BH3A 1X9XA 5AIAA 4Y2PA 3C1ZA 1JROA 2ISPA 2K60A 3O0FA 4RQ3A 4IS7A 3WK8A 5DGAA 4F4WA 7ICLA 4YMNA 4OJOA 3QZ7A 5GTHU 3C2KA 3RRGA 1THQA 4QWCA 2ZTEA 1D9FA 4LZGA 2WF5A 3KHGA 2OWOA 5DL5A 1MQ3A 4R8UA 2HHXA 4O3NA 4ECSA 2YB1A 3GIKA 4KTQA 2JH1A 1S9FA 2KD1A 4F93B 3ZD9A 2QB0A 4GXIA 2FPLA 4I2FA 2W9BA 4R66A 4E0DA 3T0SA 4GIBA 8ICGA 3H4DA 4O0IA 4GHBA 3G6VA 1ZQUA 4ED1A 2WAQF 2ES6A 3K75D 4LSIA 4O3WA 2LHFA 4P0PB 4Y2RA 1SKRA 1KFSA 3PO4A 4PGYA 5KFHA 1ZQYA 5E79U 1WWUA 4EELA 5KFXA 1X9MA 2KZZA 2XE1A 2JEIA 3WKAA 2OHFA 3SR6A 2DBYA 2MRLA 4G3IA 2MAXA 3VZUX 3AMZA 3N7PD 1NZBA 4QW8A 1L3UA 3TFRA 1KFTA 4PGXA 2A19A 3POUA 2XIDA 3H8MA 3NUQA 4DCCA 3KTQA 4F72A 4EEYA 2NRZA 3NVVA 2YX8A 1FFUA 2R18A 3TADC 4CGZA 2VJ5A 3VE1A 4RQ8A 4RQ6A 1J2MA 2MU2A 4RNNA 2XO7A 5DB8A 1U47A 2F2AB 4ED6A 1FFVA 2GO7A 1J97A 4IQUA 4GFJA 4FZLA 4I27A 1ZOLA 3C28A 2ERVA 2JEFA 4FQEA 3PO5A 7ICVA 3TKAA 1UPHA 3PX6A 3VE2A 5DQIA 2Z7JA 1QLNA 4QZEA 1NK4A 2A1JB 2UVVA 1T4GA 4RL9A 1L7OA 2KSOB 5J2BA 2R88A 5G39A 2EZXA 4BWJA 2F76X 1S0NA 2FDRA 4F5NA 5F3XB 1O03A 2LKYA 4ECUA 3TQ1A 5DL7A 3NVWA 4QZFA 1MA7A 3HRDD 2XE3A 2XC9A 3AA0B 5KG4A 2DQNB 1B22A 3QE9Y 2HBMA 4U7CA 4NL9C 4FS1A 4DWIA 2K4HA 4Y2VA 5B66U 2WHEA 3M9OB 1JXLA 9ICUA 4YQWA 1KQQA 3WK9A 5CJ7A 4NY8A 3D2SA 2AHOB 2ASLA 1LV5A 2V4RA 5CWRA 1JN3A 4DSLA 3FC4A 4PL2A 3UQ0A 2AJQA 3A0BU 3GZFA 3T5KA 2Y9UA 3PSIA 2K0LA 2RRDA 4PJ0O 1RDFA 8ICSA 2I5HA 4RLBA 4RLCA 2BPCA 4C7ZA 4KLSA 3QU9A 2ASJA 3HOLA 2WJRA 4ECRA 4UB5A 3A0HO 5HR6A 1L8LA 2YNKA 4US9A 5ALPA 3LK3B 3RR7A 3QUCA 2D3DA 4C0ZA 2K4TA 1C7YA 3EW9A 4BXOB 4UAVA 3GP6A 4XQ8A 1QJ9A 2BCVA 1NKEA 1G90A 5PRNA 2MA1A 3HP6A 4KLJA 5H2FO 2K89A 5L1MA 1T3NA 4ECVA 3V72A 1ZQQA 5DDYA 4B9TA 2KFNA 1KTQA 4QZAA 5AKJA 4U6PA 4PH5A 4B9LA 2YN4A 4FFDA 1IZNA 2KKPA 4YMOA 4FE3A 2AGOA 4KLFA 5CB1A 2EAOA 1L8OA 3LK42 1JXEA 5BOMA 2ZIXB 5CA7A 1QH9A 4FBTA 2E5SA 1S5LU 2XICA 1PHOA 4Z6FA 5AM5A 1U9LA 4QW9A 2R8KA 1ZJNA 4XRHA 1ZQHA 1KSPA 3KFUF 5AI6A 2RDJA 1LVHA 4F3OA 2C28A 3LDAA 2R8JA 2HOIA 3PV8A 5KFCA 3AL0B 3KHRA 3Q8PB 4IL6U 4OJPA 1L3VA 3SENA 3CP8A 3FM9A 2FPMA 3K19A 4K3CA 4R63A 4F5PA 1P4TA 2K8AA 4KLTA 3RBHA 1RQLA 4RQNA 4YMMA 3NSGA 2R8AA 3IV6A 9ICHA 4JUZA 5AKGA 1RXWA 2HW3A 2UVUA 9ICKA 1C20A 2KICA 3LWMA 2BQRA 4F91B 5KFWA 2LYHA 4TQSA 4UB8O 3GQCA 5JU5A 3AAEA 5DB6A 4OJ6A 3PR5B 2JXJA 4D65A 2PI4A 4G75A 4QZIA 3R9KA 4DS4A 3EMNX 9ICWA 1ZQXA 2Y0HA 1ZYQA 1OXJA 5FVNA 2GWSA 2QTKA 1Q3UA 3JPQA 4M2YA 1N56A 1K5OA 1QSSA 1NOMA 1O08A 3ZDEA 1HUOA 2VANA 2BCUA 3WKCA 2RHFA 5KFKA 3H8SA 8ICRA 4ZOHC 2KJ8A 1S97A 2J6SA 2LI6A 4ECQA 3AQFA 4O3ZA 4DSFA 4KMOB 2CRXA 2YY6A 2ZJ8A 1Z00A 5ALVA 4RJWA 3ETLA 1A76A 1Q9FA 3KBBA 4DQRA 2MHLA 2E1FA 3D2NA 1ZQGA 1SGGA 3H4BA 1KLNA 2HHSA 4DFKA 1Y88A 4DFJA 1ZQIA 5DB7A 3SV4A 5ALSA 5D4BA 5CP2A 2W11A 9ICMA 2KVCA 3AU6A 5AICA 4J9PA 2FI1A 5E79O 3MABA 5ALNA 4JK1A 4LSEA 4NLNA 4DOAA 5AK6A 2XY6A 2XGPA 3JPNA 1XWLA 4M04A 1SV4A 2KP7A 3C2MA 2M06A 1ZHZA 1NZPA 1ZHXA 1NNLA 3QU4A 5DBBA 3KZIU 2N2LA 2HSZA 8ICQA 3LWLA 8ICXA 3KKAA 3E0FA 4FT6A 7ICKA 2QARB 4KX5A 3ORYA 2G0AA 4C80A 3MFHA 3ED5A 4F5RA 8ICAA 5KFEA 2E8OA 4EENA 4KLOA 2WF9A 3POXA 3TAPA 3H40A 2EANA 1MPFA 4E1TA 1SXEA 1N5WA 2OMFA 5KG7A 1ZQLA 5KFOA 5ALXA 2H3FA 3RAXA 3DZMA 1Z3EB 1SV0C 1BPYA 9ICEA 4KITB 1UCVA 2K8BB 2R4NA 4DQQA 3PW2A 4AP9A 5AKKA 3BS5A 4NV0A 3WKEA 4DSKA 2Q4TA 3ISCA 1Q46A 4P2HA 3WU2O 4DL3A 3Q8LA 3QU7A 5KT4A 3KD3A 2WFAA 4QZHA 2D6FC 1NJZA 3AA1A 4AYDC 3RB0A 4O3OA 2E1EA 1ZRMA 2EDUA 2NO4A 3MBYA 4J9MA 1WG8A 2RP5A 4CF4A 3L5KA 5KFSA 4YVZA 4AYID 2JGAA 2PRNA 3BQ1A 3RRHA 4BJQA 2RLTA 1QSYA 4GC7A 2IMWP 4M47A 4F2RA 4R8UB 2BPGA 1LKYA 3RH6A 4DSIA 2QB1A 4UW9A 1S0OA 1CUKA 5L1JA 1KN5A 2JV3A 5B5EU 2XMXA 2JR5A 3M9MB 4BGDA 1S0MA 4N74A 1WCNA 3A0BO 4I28A 2L5YA 3JPOA 2LPEA 1PVPA 1NJXA 1MN8A 4Z6CA 3IRUA 1BPDA 2KDYA 4BUMX 2ODJA 3Q8SB 4M0AA 4F8RA 2YQEA 5KAFU 9ICSA 5DBCA 5AFUL 3CRXA 2AGQA 2G5IB 3C2LA 7ICOA 1XSPA 8ICIA 3AM9A 5J0SA 1ECWA 4U9CA 4EBCA 3N7SC 4R64A 4J9KA 3VCBA 5DKWA 2KXPB 3OGUA 4KLLA 1QJ8A 3ZDCA 1L5UA 2R4OA 1MQ2A 4PPXA 3LK41 2PI5A 2B6GA 4ED0A 1ZHYA 5KL8B 3DWOX 5EE2A 5T14A 4US8A 5AKLA 9ICFA 4KLHA 3AA6A 1WYGA 1LB2B 2JQYA 3G6XA 2K4IA 2W8KA 4DLEA 2MUTB 9ICXA 1RYRA 1KBUA 4M9NA 4QWBA 4UQGA 2A1AA 5HMLA 2KEYA 3QU2A 2BR0A 4KLGA 3UPQA 3OHAA 5KFTA 2X9KA 8ICHA 2LM1A 3UMGA 2AH5A 4O3RA 3N97B 2C2EA 4NLCA 3IP4B 1BT9A 2HMXA 2J4UP 5EWFA 8ICEA 1DOQA 2VA2A 1S5LO 2KVSA 4J9LA 4NWIA 1T3QA 4YG2A 4DL5A 4UAZA 3V7KA 1ZQFA 1VLBA 3QRAA 4UB6U 1TAUA 2UVWA 2ZUBA 3V8UA 2P66A 3MFIA 3KHLA 4Y2TA 3C29A 1F0MA 4M9LA 2BQUA 4RQ5A 2Y9TA 2DWQA 3HW8A 2XTRA 1URJA 3H7IA 1NI3A 4C8MA 2FMSA 3UAQA 3IHQB 1COKA 3HJEA 4RUAA 3HT3A 3SY7A 3TADA 5KFBA 4DL6A 2NRVA 1HXTA 5HR7A 4G76A 2KG5A 2YMPA 1JIHA 4JV1A 4OD0A 4DFDA 3AAAA 5FP0A 3SYBA 3VY8X 3V7LA 4B9SA 4PGQA 2XCAA 3U26A 1RM6C 4CE6A 8ICUA 5HHIA 4MFAA 1PVQA 3SYSA 3N28A 2WJQA 5EE1A 4J9RA 3T5HA 1OPFA 1YS5A 3Q8RB 5AI5A 3LVWA 8ICTA 1KL9A 4M6WA 1D9DA 2IHNA 5ALKA 1X40A 5G26A 4AKRA 1ZQTA 5KFZA 1V9PA 4FS2A 4PHPA 4NM1A 4J03A 1ZQPA 3ETRA 3FDSA 4XNKA 3EZ5A 1Q8KA 4F5QA 4OJ5A 4B9VA 3DV9A 4Q45A 1N63A 3OHBA 2PFOA 4EX6A 2BDUA 3F5AA 4B9NA 5DB9A 3C5FA 1PK1B 4IQVA 4ELTA 3KHHA 1GO3F 4ECYA 3TAQA 9ICJA 2XG6A 3PZPA 4DFPA 3PW0A 3KOOA 1D8BA 4C8NA 5AKEA 2HHUA 1N2XA 1S77D 4O5EA 1PRNA 3JPSA 2Y1JA 4JMUA 1SL1A 3AA7B 2HBJA 5KFPA 1B4FA 1ZQBA 2B21A 2IOFA 4UBCA 3FYXA 1ZHWA 2JZBA 2AQ4A 1ZJMA 4Y2QA 3EPIA 4DL7A 5ALHA 2W7OA 4QWEA 1IM4A 5DLGA 1NK6A 8ICZA 1VDVA 3GIMA 3NVZA 4K4IA 1YZ6A 2KOBA 4UB2A 3C1YA 4YR2A 2H5XA 5KG2A 5EWGA 4RZRA 4GCQA 5AI8A 7ICHA 1JI7A 3UM9A 4MEXA 2GOLA 4I2BA 4IR9A 1ZQ1C 2M9NA 3KZIO 4GCPA 4OCZA 4NXZA 2IBKA 1VJ5A 4NM2A 2DKZA 4Q44A 2Y2XA 1FO4A 3T5LA 1PUZA 4Q43A 2KZ7B 2H3ZA 5KFLA 8ICMA 3LK2B 5D5DA 2OEHA 5AKYA 4FRXA 3ALRA 2DF4B 7PRNA 2W3SA 3UMCA 4EBDA 1ZQMA 1ZD5A 3H0RB 4KLIA 2OYYA 2GH1A 4RPZA 4RPXA 4RJXA 3ZDDA 1QQ7A 4GCSA 3RJJA 4EYHB 9ICPA 1E54A 2PXIA 4P0PA 4QZ9A 1X6JA 4QIWF 1ZQCA 3V6HA 2JRZA 4YCXA 4I2CA 3SZVA 3C5GA 2JMGA 5ALDA 3HILA 2ZIWB 3MR5A 1ZQDA 2W8LA 3EYZA 3IN5A 3OSNA 3BQ7A 4WJ3B 2F1HA 3L4PA 4LZDA 3SI8A 1WUDA 5J0XA 8ICFA 1F5SA 2P35A 2KZMA 1SL0A 2I1QA 3SQIA 3LVVA 1RZTA 4PR7A 2R8IA 4IRDA 4O9MA 1Z1VA 3I28A 2DUYA 1NJYA 4GXJA 8ICBA 4XNLA 4MHVA 2W9CB 5ADXL 5B5EO 2OH2A 2PFNA 4F71A 3F5EA 2KJ5A 5J2HA 3PR4A 2FGQX 1B43A 5L1IA 4BWMA 4QZBA 4ELVA 5AI0A 1DGSA 3HOEA 5KFIA 3MR3A 4GC6A 2KFZA 5KAFO 8ICCA 3BRZA 9ICTA 1CI4A 4NJ8A 5AKZA 3VC8A 2KN7A 2KZ3A 4O3PA 1S10A 1YZ7A 2XY7A 1ZHTA 4EYIB 3BS0A 3RAQA 3RR8A 4ED2A 2BKEA 4CRXA 4PUXA 3NS1A 1OUQA 2NYVA 1BPBA 5HP4A 3Q8KA 2D8CA 1J2NA 2HHQA 1WCLA 5KFVA 2IOHA 1SB3C 2VIXA 1HIWA 5ADXK 2E8MA 2HDOA 3RF9A 2X27X 5DQHA 3RBEA 3MGIA 1UQVA 5AK5A 3HWBA 1Z1BA 5AHXA 5ALGA 2V4QA 1KRPA 4UAWA 5T5FA 4KN4A 1V38A 1QJPA 2NV3A 4M9HA 5KFFA 3GDXA 1BNPA 1QSLA 2EQYA 2I6XA 2Q0ZX 9ICAA 2C2RA 2E8NA 3BS7A 5J2CA 3HWTA 5J0RA 1L3TA 2YPVA 2PFPA 2ZIVB 4DEZA 4YN4A 3M8SA 3QUTA 3GILA 2PMZC 3RB3A 3UU2A 1U48A 1TAMA 4RQ0A 1N62A 5DBAA 2VA3A 2FLLA 4FSOA 4PHEA 5GTHO 5BPCA 4RNOA 4UATA 2W9MA 2AU0A 4M9JA 3HKZF 3F2BA 3LK3A 5DL8A 4UB6O 1BPXA 5IIJA 3KZXA 4EX7A 2Y7SA 3H0MB 7ICPA 3L3FX 1T8EA 4C4VA 4BXOA 2HOFA 2NRWA 4E1SA 3PQUA 4O4XA 4F4XA 5J2AA 5KAIU 4J9NA 2K8CB 1A6SA 1COOA 3GV7B 4KR4A 3DA4A 4FRTA 3WK6A 4CCHA 5JDPA 4N75A 4NLZA 2WVPA 1N61A 3WI4A 3S6JA 4D64A 3AN1A 2Y1IA 1BPEA 5F9NA 3PMLA 1ZD2P 4YFKA 2W3RA 5C5JA 3QZ8A 2JEJA 4UASA 3GV8B 2FMQA 5ALZA 3ISBA 3M9NB 1SV0A 5GTIU 2Y0KA 4TQRA 2AXTU 4ECTA 7ICIA 1M6YA 2JH7A 4O49A 1XC9A 5G38A 3B0XA 3PX4A 2KKVA 5J2FA 4YR0A 2AGPA 2OXOA 5ALFA 7ICJA 3POQA 1T94A 1ZXIA 4DFMA 3QEBZ 3QUBA 2JMMA 3HW9A 3PW7A 2XE5A 4BX9C 4R65A 2FLNA 2DKXA 1L7NA 4F4KA 2KMDA 4ECWA 4TURA 1TE2A 2EAPA 2N1RA 2R8HA 2W7PA 4AYEC 2R8GA 4YP3A 1ZQVA 4FESA 4P0QA 4RQ7A 1D8YA 7ICNA 3AU2A 3F2DA 1XO0A 2BZFA 2H3VA 4ZH4A 2PFQA 2YB4A 3RB6A 3AA6B 4DSJA 1UA0A 5C0YA 2WB1C 4KR8A 3GIJA 4I2AA 1KFDA 4RQMA 3OPXA 5EOZA 4B9MA 2W03A 3M6ZA 9ICOA 5J2JA 4BUGA 4PJ0U 2XTQA 3BJYA 7ICSA 1OW5A 4FBUA 3JCUO 4AYBC 4CTDA 2IHMA 2W80C 3SAFA 8ICNA 1NJWA 1XNSA 5DG8A 3H8JA 4Y2UA 3T79A 1U45A 5J2EA 3KKAC 4PZOA 4DSEA 1HXXA 1BGXT 4AFKA 2NO5A 5IYUA 4DQIA 7ICGA 2F8LA 2BPFA 1A77A 1B0XA 3H0LB 4IR1A 5B66O 1ORMA 2ISOA 3PF1A 2CXYA 5DL6A 5KG5A 4ED7A 4J9OA 4FMSA 2KIWA 2H3IA 4QZDA 5IINA 2G06A 2VA8A 1U49A 4IQWA 2QB0B 3E2EA 5H2FU 3ONNA 5TISU 1SWWA 5J0TA 2W9BB 2P6UA 5IIIA 3QYPA 3WKDA 2BQ3A 2LYAA 4O3XB 4LSHA 3SD7A 1S8OA 5J29A 4DQSA 4QNLA 1OSMA 4MFFA 7ICRA 3I76A 2KTQA 4IRKA 2N2MA 4NLGA 2K4PA 1N60A 5KFAA 4FZMA 4IRCA 9ICLA 2NRTA 3TFSA 1KKXA 3E58A 5KT2A 4RQ2A 5J2DA 2R4LA 3G7GA 9ICVA 4NLKA 3WK7A 4Q8FA 3EUB2 6PRNA 4QJFB 2MNHA 4AYMC 2DFLA 4C4TA 4B61A 5CRXA 5J8YC 4M6WB 4AZLA 2PORA 1YT3A 2LFUA 1Z4OA 3F53A 5BOLA 2KHQA 4HYKA 4KLDA 5EE9A 1JMSA 2WAQC 1S0VA 2G5HB 5KFDA 4DOCA 5ALLA 4CF3A 1L7MA 3MDCA 3C23A 9ICBA 1RYSA 5AK3A 5HHHA 1H38A 3RTVA 4XUSA 1V85A 2ZIUA 4QWAA 3C21A 5KNIA 2ZUDA 5J0YA 5AFUK 4GXKA 5AM0A 1T7PA 2Y0LA 5AM1A 2W55A 2LM4A 3VZTX 5EE3A 2EAMA 2ASDA 4UAYA 3PW5A 3PVXA 5CEHA 3RBDA 4F5OA 3TARA 1XU4A 3NJTA 2PKEA 2IWVA 9ICRA 3WK4A 5KG1A 3HX0A 4JFBA 2KJ9A 8ICYA 3ISDA 1NK9A 7ICMA 5KG3A 3N4MB 4K4HA 2W04A 4I29A 5JTIA 1X42A 4IL6O 2DPIA 2J6UA 2H3QA 3B9JA 1GFPA 4ED8A 1ZQWA 3G6YA 2HCFA 2QLTA 5A0LA 1ZQJA 4QWDA 2WF8A 2LYBA 3PNCA 1ZQEA 4UB3A 4QZCA 3T20A 4O3YA 1QCKA 4KLEA 4DO9A 3NRWA 3EPGA 2BDPA 3NRZA 5EE0A 1QQ5A 3WI5A 4Z3TA 5ALMA 2WTFA 2Y0SF 5G3AA
chains in the Genus database with same CATH topology
3IN5A 4N59A 4N58A 4GF4A 3D2QA 4WJ3B 2KJ8A 1GFQA 2KHVA 4D5UA 1WUDA 3AQFA 4O3ZA 1MM5A 4KMOB 4C69X 2CRXA 3K1ZA 3AAAB 3MGVA 3SQIA 3LVVA 4RJWA 4O4UA 1Q9FA 2MHLA 2E1FA 3D2NA 1HEKA 4XNLA 2KXPA 5ADXL 3TZGA 3SZDA 2OH2A 2WB1F 3F5EA 2KJ5A 4AKRB 2KVCA 2F77X 1P7DA 2FGQX 3RFAA 3SY9A 4FOZA 3PSTA 4LSEA 4AYBF 3SAHA 3LYSA 2M06A 3PORA 1ZHZA 3HOEA 1ZHXA 1IZNB 4QIWC 3O0EA 4A8EA 2W81C 3DA3A 2N2LA 3VC8A 2Y0SC 3E0FA 4FT6A 3PRNA 4KX5A 3UPGA 2G0AA 4JCHA 2ZLDA 1F44A 1ZHTA 2O4VA 3QRCA 4AUIA 4ACOA 2KNJA 4CRXA 3POXA 4PUXA 2LBOA 1OUQA 2ZXHA 3IG8A 1MPFA 2XE2A 2VJ4A 4E1TA 2OMFA 4LSFA 2J1NA 4IC9A 4AKMA 2H3FA 3M6KA 2VIXA 1HIWA 5ADXK 3CYMA 3RF9A 2X27X 1BH3A 3HWBA 1Z1BA 2K8BB 3O0FA 5T5FA 2HBKA 1QJPA 4NV0A 4OJOA 1THQA 2NV3A 2Q4TA 1DRGA 5DL5A 2D6FC 3F2CA 2YPVA 3AA1A 4AYDC 4O3MA 2ZIVB 2E1EA 3N7RC 2YB1A 2PMZC 3IG5A 2JH1A 2KD1A 3UU2A 2RP5A 1TAMA 2GE4A 3AAEB 4FSOA 4AYID 2JGAA 3GU3A 2PRNA 4BJQA 3HKZF 3F2BA 5GV0A 3LK3A 3T0SA 5DL8A 1BXWA 2DGZA 4GHBA 2WAQF 2XVTA 3KZXA 4LSIA 2XMXA 4O3WA 2Y7SA 3H0MB 3L3FX 2LHFA 4P0PB 4QQ1A 2HOFA 1PVRA 4E1SA 3PQUA 4O4XA 2XE1A 1PVPA 2K8CB 1A6SA 2MRLA 4KR4A 3DA4A 2JHDA 3VZUX 3N7PD 4FRTA 1NZBA 5JDPA 2G07A 2KDYA 4BUMX 2ODJA 2ZFGA 3WI4A 4D64A 2OM6A 5AFUL 3CRXA 2G5IB 2K4EA 1GFMA 3POUA 2XIDA 1A0PA 3NUQA 1ECWA 4U9CA 4KX3A 2YX8A 2R18A 3N7SC 4CGZA 3AQEA 2VJ5A 3VE1A 2Y0KA 3VCBA 3M7DA 3AA7A 2KXPB 2JH7A 4NLBA 2F2AB 2G08A 1QJ8A 3A2SX 4O49A 4GFJA 4FZLA 2KKVA 1Z19A 3HKZC 3C28A 2ERVA 3LK41 2OXOA 3POQA 2CN1A 1UPHA 1ZHYA 1T94A 5KL8B 5EE2A 3VE2A 2Z7JA 2JMMA 3HW9A 1MM4A 5T14A 2XE5A 3AA0A 4BX9C 3AA6A 2K4IA 2M0NA 4RL9A 1KBUA 2FGRA 2N1RA 1GFNA 2W7PA 1ED1A 2KEYA 4AYEC 2F76X 2LKYA 4P0QA 4FESA 5DL7A 2HBLA 3F2DA 1XO0A 1MA7A 2H3VA 2XE3A 3ICXA 2YB4A 2KZ7A 3AA0B 2DQNB 3AA6B 4NLCA 3IP4B 1BT9A 5C0YA 3LK2A 2HBMA 2HMXA 4U7CA 2WB1C 2J4UP 4KR8A 3OPXA 2K4HA 2W03A 3M6ZA 4NWIA 4BUGA 2XTQA 4FZNA 4P0QB 3QRAA 4AYBC 3D2SA 3V8UA 2W80C 3SAFA 1XNSA 3VY9X 4PL2A 3T79A 3C29A 3GZFA 1HXXA 3PSIA 2K0LA 4AFKA 5IYUA 2F8LA 3SMVA 3H0LB 2RRDA 2HOQA 2F1TA 1GFOA 2XTRA 2CPRA 1ORMA 1URJA 3AA1B 4OJLA 2F1VA 5DL6A 2ZIWA 4RLBA 4FMSA 4RLCA 3PSPA 3UAQA 2KIWA 2H3IA 3SY7A 2G06A 1HXTA 5HR7A 4G76A 3HOLA 2M07A 3ONNA 5HR6A 3AAAA 3SYBA 2YNKA 3VY8X 2LYAA 3LK3B 4O3XB 4LSHA 1H6S1 3PQSA 1PVQA 3SYSA 4C0ZA 1OSMA 4QNLA 2A3VA 2K4TA 1OPFA 1YS5A 2N2MA 3LVWA 4FZMA 4AYNA 3GP6A 2ZXIA 5G26A 1QJ9A 4AKRA 1G90A 4CDGA 5PRNA 2MA1A 3G7GA 2K89A 2ZIXA 4XNKA 4OJ5A 6PRNA 4U6PA 4QJFB 2MNHA 2G09A 4AYMC 8PRNA 3KVDD 3SAGA 3F5AA 2BDUA 1IZNA 4B61A 5CRXA 2KKPA 4FE3A 4AZLA 2PORA 2VKQA 1GO3F 1YT3A 1HXUA 2LFUA 3F53A 2XG6A 3PZPA 3LK42 4KRAA 2KHQA 2ZIXB 1D8BA 2WAQC 2G5HB 1PRNA 2E5SA 4JMUA 3AA7B 2HBJA 2XICA 2PMZF 4ICAA 4PL1A 1PHOA 3T24A 1CRXA 3FYXA 1ZHWA 3KFUF 2ZIUA 2W7OA 5AFUK 2HOIA 3AL0B 2Y0LA 2KOBA 3VZTX 3DEEA 4OJPA 2KV2A 3CP8A 3K19A 4GCQA 3JTYA 2GOLA 1ZQ1C 1P4TA 4GCPA 2K8AA 2ZIUB 3RBHA 1IIPA 3NSGA 3VZWX 4JFBA 2Y2XA 2KJ9A 2ZIVA 3PSFA 2KZ7B 2H3ZA 2KICA 2LHTA 3LK2B 5D5DA 3C5OA 5KL1B 2W04A 4FRXA 1SZHA 3ALRA 2DF4B 7PRNA 3AAEA 2H3QA 1GFPA 4OJ6A 3H0RB 4D65A 4G75A 5A0LA 2OYYA 2GH1A 2ZG6A 2LYBA 3EMNX 4RJXA 2Y0HA 4GCSA 5FVNA 4F4BA 3T20A 1L6NA 4O3YA 1Q3VA 1E54A 2QTKA 1Q3UA 4P0PA 2XI9A 4QIWF 3NRWA 1Q9GA 3SZVA 4FSPA 2JMGA 3WI5A 4Z3TA 4OO1J 2Y0SF 2RHFA 2ZIWB 4FUVA 2KC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FZM A;  4N59 A;  4N58 A;  2XTR A;  4FZL A;  4G75 A;  2XMX A;  2XTQ A;  4G76 A;  4FZN A;  3DA4 A;  3DA3 A; 
#chains in the Genus database with same CATH topology
 4N59 A;  4N58 A;  4GF4 A;  1JX4 A;  1GFQ A;  4TUQ A;  3OJU A;  5J2G A;  2KHV A;  1X6I A;  1X9S A;  1MM5 A;  4Y2X A;  1ZQA A;  1UA1 A;  2BCS A;  2I9G A;  3BZK A;  1RPL A;  1SZP A;  4I2I A;  3HPO A;  5KTQ A;  1V97 A;  3QX7 A;  9ICI A;  4O4U A;  3PW4 A;  1HEK A;  5AM2 A;  3J81 j;  4TUP A;  2DPJ A;  4UB4 A;  2KXP A;  3TZG A;  3UXN A;  3SZD A;  1BVS A;  5AK4 A;  4NL9 A;  1P7D A;  3NVY A;  5KAI O;  3RFA A;  4MF2 A;  3SY9 A;  4MEY A;  4FOZ A;  4JB3 A;  1D8L A;  3PST A;  1N5X A;  2YMQ A;  4I2D A;  3QNM A;  4F92 B;  4RNM A;  4KLM A;  4ED3 A;  3LYS A;  2ZTC A;  4C00 A;  3M8R A;  4UAR A;  2MUT A;  4QIW C;  3MR2 A;  1IZN B;  3LK9 A;  4RT3 A;  3O0E A;  4A8E A;  3DA3 A;  3GV5 B;  1MC8 A;  3NAS A;  9ICC A;  3TI0 A;  4O5K A;  3PRN A;  3UPG A;  4JCH A;  2ZLD A;  3QRC A;  2O4V A;  3MC1 A;  3IM1 A;  4AUI A;  2IA6 A;  4ACO A;  5KFM A;  5AM3 A;  5KG0 A;  3JPT A;  5GTI O;  2AXT O;  2FLP A;  3IG8 A;  3Q8Q B;  2XE2 A;  1NK0 A;  2VJ4 A;  4LSF A;  3WU2 U;  1TKD A;  4YD2 A;  3M6K A;  3CYM A;  4C4S A;  5G5G A;  4XA5 A;  2UVR A;  3K4G A;  4BDP A;  8ICK A;  1U4B A;  2HBK A;  1K1S A;  1HJP A;  3MDA A;  3WK5 A;  3RJE A;  1KW4 A;  1DRG A;  1FEZ A;  4QZG A;  3F2C A;  4B6J A;  3UMB A;  3AUO A;  4O3M A;  4UBB A;  3N7R C;  5TZV A;  3IG5 A;  1IV8 A;  5J0W A;  5J0U A;  2IWW A;  2EH9 A;  3QEA Z;  2GE4 A;  3AAE B;  4DF8 A;  4K3B A;  3GU3 A;  5J2I A;  4HAI A;  4J9Q A;  2ZJA A;  5GV0 A;  1NKC A;  4LJX A;  1KDH A;  5D49 A;  4Y2J A;  1BXW A;  3ZI4 A;  3BQ0 A;  3CNH A;  1PZN A;  2DGZ A;  1UHU A;  2XVT A;  4MF8 A;  4UB1 A;  2BCQ A;  1NK7 A;  1XS9 D;  5IIM A;  1DK2 A;  4M9G A;  2BGW A;  8ICJ A;  2F1I A;  4QQ1 A;  4RPY A;  5JUM A;  1BPZ A;  5ALQ A;  1PVR A;  3QXG A;  2WF6 A;  4DL4 A;  2GLE A;  2HI0 A;  1TVA A;  4Z6D A;  5IIL A;  2JHD A;  3PGS A;  2HHV A;  2G07 A;  5EWE A;  2ZFG A;  3SZ2 A;  5AKI A;  1S76 D;  2KE7 A;  4C4V B;  2OM6 A;  4I2G A;  3PGU A;  1PK1 A;  5J2K A;  4C8O A;  2F1C X;  2K4E A;  1GFM A;  2E3T A;  5KFJ A;  3B0Y A;  5ALE A;  1A0P A;  3T5J A;  1Z00 B;  5TIS O;  1X66 A;  4EEK A;  3RJG A;  2AQ0 A;  5AI9 A;  4KX3 A;  3GII A;  3THV A;  3AQE A;  2A1J A;  1ARO P;  4CNQ A;  1SKW A;  3M7D A;  1L7P A;  3RJF A;  4KLQ A;  1RQN A;  7ICT A;  3AA7 A;  1JUD A;  2C2D A;  4NLB A;  2IOF K;  4DOB A;  5KT5 A;  2G08 A;  3A2S X;  2KSO A;  4I2J A;  1X2I A;  4JWN A;  1Z19 A;  3HKZ C;  2YTU A;  1ZD4 A;  2CN1 A;  1MM4 A;  3AA0 A;  2R89 A;  4IQT A;  1TAQ A;  2M0N A;  2FGR A;  3BQ2 A;  1GFN A;  1ED1 A;  2YML A;  4YR3 A;  1SIJ A;  1TK0 A;  2HBL A;  3T3F A;  2F44 A;  2FE9 A;  5DG9 A;  3ICX A;  2KZ7 A;  3LK2 A;  2EZZ A;  7ICQ A;  2W54 A;  2QKQ A;  1ZQR A;  2E8P A;  2F8K A;  5L1K A;  4FZN A;  2YMM A;  5CHG A;  4P0Q B;  1XSN A;  3OSP A;  3WKB A;  3OJS A;  5D46 A;  3VY9 X;  5DG7 A;  5KFN A;  3BS5 B;  4UAU A;  4DQP A;  5KT7 A;  1IG6 A;  5DGB A;  3UXO A;  1ZRN A;  4TUS A;  1L3S A;  1JRP A;  3SMV A;  2F1T A;  2HOQ A;  3ZDA A;  1GFO A;  2CPR A;  3NTU A;  5ALY A;  3AA1 B;  4OJL A;  2F1V A;  5KT3 A;  5J0P A;  2ZIW A;  5HMM A;  3EWA A;  1TV9 A;  3V7J A;  2P6R A;  4O3S A;  3PSP A;  1X9W A;  1CEZ A;  5ALT A;  4O5C A;  4YD1 A;  1AQ6 A;  2ESE A;  4I2H A;  3IDW A;  8ICL A;  8ICW A;  4DS5 A;  2M07 A;  5KT6 A;  1DXS A;  2J6T A;  1ZQO A;  3DWN A;  5J0O A;  4YXJ A;  4KLU A;  4P4O A;  1LKY B;  1H6S 1;  3PQS A;  4CF5 A;  1DGJ A;  3D6J A;  4PZN A;  2KK0 A;  4KMU A;  2A3V A;  2W9C A;  1ZD3 A;  1Z4N A;  5CR0 A;  4AYN A;  4JV2 A;  2ZXI A;  4Q8E A;  3OTQ A;  4CDG A;  2V9W A;  5KFU A;  1TK8 A;  3SV3 A;  5JRT A;  2BCR A;  1XSL A;  2ZIX A;  1RG6 A;  5K4L A;  5AM4 A;  3BRY A;  2G09 A;  8PRN A;  3QU5 A;  8ICO A;  1ZQZ A;  3KVD D;  3SAG A;  3RH5 A;  4PHD A;  1SXD A;  2VKQ A;  2FMP A;  1HXU A;  7ICE A;  1NK8 A;  1SWV A;  4KRA A;  5L9X A;  5J0Q A;  1WWV A;  3TAC B;  4DF4 A;  2BHN A;  2ATL A;  1QTM A;  3SEI A;  1RXV A;  4B9U A;  1ZQK A;  2RQ5 A;  5KFG A;  4Y2S A;  2PMZ F;  4ICA A;  4ECZ A;  4PL1 A;  3T24 A;  4DLG A;  1NK5 A;  1SL2 A;  1CRX A;  5HNK A;  1QQ6 A;  3RJH A;  4F4Y A;  5AKH A;  1UT5 A;  4C7Y A;  4EZ6 A;  1T1L A;  1ZQN A;  3AEV A;  2ODG A;  4C4R A;  5AI4 A;  4RQ4 A;  1NKB A;  1PK3 A;  7ICF A;  4Z6E A;  4J9S A;  2MSN A;  2XCP A;  3DEE A;  1N48 A;  3PX0 A;  2KV2 A;  7ICU A;  5AIB A;  1DK3 A;  5ALW A;  3JTY A;  5ALI A;  1FIQ A;  3V6J A;  2ZIU B;  4F50 A;  1IIP A;  3VZW X;  3NGD A;  4LVS A;  1KEJ A;  2ZIV A;  3PSF A;  5L1L A;  2LHT A;  9ICQ A;  3BZC A;  2HVI A;  2JEG A;  3C5O A;  3GFK B;  5KL1 B;  1JAL A;  3MGH A;  1SZH A;  1MSW D;  2FJ6 A;  4F2S A;  3A0H U;  4ECX A;  2HHT A;  5ALR A;  3JPP A;  2B0C A;  3CW2 C;  2ZG6 A;  4YXM A;  4ELU A;  3Q8M A;  2R4P A;  4F4B A;  4P4M A;  1HUZ A;  1L6N A;  5DLF A;  2XY5 A;  1Q3V A;  2HVH A;  2ZJ5 A;  3FYH A;  1ZQS A;  2XI9 A;  2HHW A;  4KN7 A;  1EXN A;  1Q9G A;  2F3N A;  5J8Y A;  2ZTD A;  4FSP A;  5ALJ A;  4I2E A;  1ZET A;  3SYZ A;  1TK5 A;  9ICN A;  4OO1 J;  3ZD8 A;  3ZDB A;  2W43 A;  2F1J A;  4FUV A;  2FPK A;  2KC0 A;  1BNO A;  4FO6 A;  3RJK A;  3D2Q A;  4JWM A;  2LMR A;  5KFQ A;  4D5U A;  3H8W A;  4QZ8 A;  4K4G A;  5ALO A;  2NRX A;  5DDM A;  3PGR A;  4C69 X;  3K1Z A;  3AAA B;  3MGV A;  5KFR A;  3PY8 A;  2DL0 A;  4P4P A;  1UT8 A;  4F4Z A;  3DDH A;  3RH4 A;  3QUQ A;  8ICV A;  2ZUC A;  2XGQ A;  3PMN A;  2OCE A;  2WB1 F;  4RUC A;  4MFC A;  1TFR A;  1K1Q A;  4AKR B;  4RU9 A;  2F77 X;  2O6K A;  3I1Y A;  5F9L A;  8ICP A;  4O3Q A;  4USA A;  3BDP A;  2QAR A;  2RDI A;  1IXR A;  4DL2 A;  5ALU A;  2WF7 A;  3FAH A;  5KG6 A;  3K1R B;  4AYB F;  4Y2Y A;  4X5V A;  3SAH A;  1XO1 A;  3POR A;  4RT2 A;  2ALZ A;  3M1Y A;  3RB4 A;  4GLX A;  4C8L A;  5DQG A;  2W81 C;  4EZ9 A;  2Y0S C;  1SKS A;  4JV0 A;  3UXP A;  5IIK A;  3JPR A;  2KIV A;  5KFY A;  3V6K A;  3TAN A;  1F44 A;  2C22 A;  5G5H A;  5IIO A;  3MR6 A;  1RYU A;  3BQT A;  2KNJ A;  4UB8 U;  2LBO A;  2ZXH A;  2EZY A;  9ICG A;  3RJI A;  5AKX A;  2J1N A;  4IC9 A;  1T16 A;  4PHA A;  4AKM A;  2JZB B;  4G9B A;  2W9A A;  4RQ1 A;  4C8K A;  3UQ2 A;  4EBE A;  1BH3 A;  1X9X A;  5AIA A;  4Y2P A;  3C1Z A;  1JRO A;  2ISP A;  2K60 A;  3O0F A;  4RQ3 A;  4IS7 A;  3WK8 A;  5DGA A;  4F4W A;  7ICL A;  4YMN A;  4OJO A;  3QZ7 A;  5GTH U;  3C2K A;  3RRG A;  1THQ A;  4QWC A;  2ZTE A;  1D9F A;  4LZG A;  2WF5 A;  3KHG A;  2OWO A;  5DL5 A;  1MQ3 A;  4R8U A;  2HHX A;  4O3N A;  4ECS A;  2YB1 A;  3GIK A;  4KTQ A;  2JH1 A;  1S9F A;  2KD1 A;  4F93 B;  3ZD9 A;  2QB0 A;  4GXI A;  2FPL A;  4I2F A;  2W9B A;  4R66 A;  4E0D A;  3T0S A;  4GIB A;  8ICG A;  3H4D A;  4O0I A;  4GHB A;  3G6V A;  1ZQU A;  4ED1 A;  2WAQ F;  2ES6 A;  3K75 D;  4LSI A;  4O3W A;  2LHF A;  4P0P B;  4Y2R A;  1SKR A;  1KFS A;  3PO4 A;  4PGY A;  5KFH A;  1ZQY A;  5E79 U;  1WWU A;  4EEL A;  5KFX A;  1X9M A;  2KZZ A;  2XE1 A;  2JEI A;  3WKA A;  2OHF A;  3SR6 A;  2DBY A;  2MRL A;  4G3I A;  2MAX A;  3VZU X;  3AMZ A;  3N7P D;  1NZB A;  4QW8 A;  1L3U A;  3TFR A;  1KFT A;  4PGX A;  2A19 A;  3POU A;  2XID A;  3H8M A;  3NUQ A;  4DCC A;  3KTQ A;  4F72 A;  4EEY A;  2NRZ A;  3NVV A;  2YX8 A;  1FFU A;  2R18 A;  3TAD C;  4CGZ A;  2VJ5 A;  3VE1 A;  4RQ8 A;  4RQ6 A;  1J2M A;  2MU2 A;  4RNN A;  2XO7 A;  5DB8 A;  1U47 A;  2F2A B;  4ED6 A;  1FFV A;  2GO7 A;  1J97 A;  4IQU A;  4GFJ A;  4FZL A;  4I27 A;  1ZOL A;  3C28 A;  2ERV A;  2JEF A;  4FQE A;  3PO5 A;  7ICV A;  3TKA A;  1UPH A;  3PX6 A;  3VE2 A;  5DQI A;  2Z7J A;  1QLN A;  4QZE A;  1NK4 A;  2A1J B;  2UVV A;  1T4G A;  4RL9 A;  1L7O A;  2KSO B;  5J2B A;  2R88 A;  5G39 A;  2EZX A;  4BWJ A;  2F76 X;  1S0N A;  2FDR A;  4F5N A;  5F3X B;  1O03 A;  2LKY A;  4ECU A;  3TQ1 A;  5DL7 A;  3NVW A;  4QZF A;  1MA7 A;  3HRD D;  2XE3 A;  2XC9 A;  3AA0 B;  5KG4 A;  2DQN B;  1B22 A;  3QE9 Y;  2HBM A;  4U7C A;  4NL9 C;  4FS1 A;  4DWI A;  2K4H A;  4Y2V A;  5B66 U;  2WHE A;  3M9O B;  1JXL A;  9ICU A;  4YQW A;  1KQQ A;  3WK9 A;  5CJ7 A;  4NY8 A;  3D2S A;  2AHO B;  2ASL A;  1LV5 A;  2V4R A;  5CWR A;  1JN3 A;  4DSL A;  3FC4 A;  4PL2 A;  3UQ0 A;  2AJQ A;  3A0B U;  3GZF A;  3T5K A;  2Y9U A;  3PSI A;  2K0L A;  2RRD A;  4PJ0 O;  1RDF A;  8ICS A;  2I5H A;  4RLB A;  4RLC A;  2BPC A;  4C7Z A;  4KLS A;  3QU9 A;  2ASJ A;  3HOL A;  2WJR A;  4ECR A;  4UB5 A;  3A0H O;  5HR6 A;  1L8L A;  2YNK A;  4US9 A;  5ALP A;  3LK3 B;  3RR7 A;  3QUC A;  2D3D A;  4C0Z A;  2K4T A;  1C7Y A;  3EW9 A;  4BXO B;  4UAV A;  3GP6 A;  4XQ8 A;  1QJ9 A;  2BCV A;  1NKE A;  1G90 A;  5PRN A;  2MA1 A;  3HP6 A;  4KLJ A;  5H2F O;  2K89 A;  5L1M A;  1T3N A;  4ECV A;  3V72 A;  1ZQQ A;  5DDY A;  4B9T A;  2KFN A;  1KTQ A;  4QZA A;  5AKJ A;  4U6P A;  4PH5 A;  4B9L A;  2YN4 A;  4FFD A;  1IZN A;  2KKP A;  4YMO A;  4FE3 A;  2AGO A;  4KLF A;  5CB1 A;  2EAO A;  1L8O A;  3LK4 2;  1JXE A;  5BOM A;  2ZIX B;  5CA7 A;  1QH9 A;  4FBT A;  2E5S A;  1S5L U;  2XIC A;  1PHO A;  4Z6F A;  5AM5 A;  1U9L A;  4QW9 A;  2R8K A;  1ZJN A;  4XRH A;  1ZQH A;  1KSP A;  3KFU F;  5AI6 A;  2RDJ A;  1LVH A;  4F3O A;  2C28 A;  3LDA A;  2R8J A;  2HOI A;  3PV8 A;  5KFC A;  3AL0 B;  3KHR A;  3Q8P B;  4IL6 U;  4OJP A;  1L3V A;  3SEN A;  3CP8 A;  3FM9 A;  2FPM A;  3K19 A;  4K3C A;  4R63 A;  4F5P A;  1P4T A;  2K8A A;  4KLT A;  3RBH A;  1RQL A;  4RQN A;  4YMM A;  3NSG A;  2R8A A;  3IV6 A;  9ICH A;  4JUZ A;  5AKG A;  1RXW A;  2HW3 A;  2UVU A;  9ICK A;  1C20 A;  2KIC A;  3LWM A;  2BQR A;  4F91 B;  5KFW A;  2LYH A;  4TQS A;  4UB8 O;  3GQC A;  5JU5 A;  3AAE A;  5DB6 A;  4OJ6 A;  3PR5 B;  2JXJ A;  4D65 A;  2PI4 A;  4G75 A;  4QZI A;  3R9K A;  4DS4 A;  3EMN X;  9ICW A;  1ZQX A;  2Y0H A;  1ZYQ A;  1OXJ A;  5FVN A;  2GWS A;  2QTK A;  1Q3U A;  3JPQ A;  4M2Y A;  1N56 A;  1K5O A;  1QSS A;  1NOM A;  1O08 A;  3ZDE A;  1HUO A;  2VAN A;  2BCU A;  3WKC A;  2RHF A;  5KFK A;  3H8S A;  8ICR A;  4ZOH C;  2KJ8 A;  1S97 A;  2J6S A;  2LI6 A;  4ECQ A;  3AQF A;  4O3Z A;  4DSF A;  4KMO B;  2CRX A;  2YY6 A;  2ZJ8 A;  1Z00 A;  5ALV A;  4RJW A;  3ETL A;  1A76 A;  1Q9F A;  3KBB A;  4DQR A;  2MHL A;  2E1F A;  3D2N A;  1ZQG A;  1SGG A;  3H4B A;  1KLN A;  2HHS A;  4DFK A;  1Y88 A;  4DFJ A;  1ZQI A;  5DB7 A;  3SV4 A;  5ALS A;  5D4B A;  5CP2 A;  2W11 A;  9ICM A;  2KVC A;  3AU6 A;  5AIC A;  4J9P A;  2FI1 A;  5E79 O;  3MAB A;  5ALN A;  4JK1 A;  4LSE A;  4NLN A;  4DOA A;  5AK6 A;  2XY6 A;  2XGP A;  3JPN A;  1XWL A;  4M04 A;  1SV4 A;  2KP7 A;  3C2M A;  2M06 A;  1ZHZ A;  1NZP A;  1ZHX A;  1NNL A;  3QU4 A;  5DBB A;  3KZI U;  2N2L A;  2HSZ A;  8ICQ A;  3LWL A;  8ICX A;  3KKA A;  3E0F A;  4FT6 A;  7ICK A;  2QAR B;  4KX5 A;  3ORY A;  2G0A A;  4C80 A;  3MFH A;  3ED5 A;  4F5R A;  8ICA A;  5KFE A;  2E8O A;  4EEN A;  4KLO A;  2WF9 A;  3POX A;  3TAP A;  3H40 A;  2EAN A;  1MPF A;  4E1T A;  1SXE A;  1N5W A;  2OMF A;  5KG7 A;  1ZQL A;  5KFO A;  5ALX A;  2H3F A;  3RAX A;  3DZM A;  1Z3E B;  1SV0 C;  1BPY A;  9ICE A;  4KIT B;  1UCV A;  2K8B B;  2R4N A;  4DQQ A;  3PW2 A;  4AP9 A;  5AKK A;  3BS5 A;  4NV0 A;  3WKE A;  4DSK A;  2Q4T A;  3ISC A;  1Q46 A;  4P2H A;  3WU2 O;  4DL3 A;  3Q8L A;  3QU7 A;  5KT4 A;  3KD3 A;  2WFA A;  4QZH A;  2D6F C;  1NJZ A;  3AA1 A;  4AYD C;  3RB0 A;  4O3O A;  2E1E A;  1ZRM A;  2EDU A;  2NO4 A;  3MBY A;  4J9M A;  1WG8 A;  2RP5 A;  4CF4 A;  3L5K A;  5KFS A;  4YVZ A;  4AYI D;  2JGA A;  2PRN A;  3BQ1 A;  3RRH A;  4BJQ A;  2RLT A;  1QSY A;  4GC7 A;  2IMW P;  4M47 A;  4F2R A;  4R8U B;  2BPG A;  1LKY A;  3RH6 A;  4DSI A;  2QB1 A;  4UW9 A;  1S0O A;  1CUK A;  5L1J A;  1KN5 A;  2JV3 A;  5B5E U;  2XMX A;  2JR5 A;  3M9M B;  4BGD A;  1S0M A;  4N74 A;  1WCN A;  3A0B O;  4I28 A;  2L5Y A;  3JPO A;  2LPE A;  1PVP A;  1NJX A;  1MN8 A;  4Z6C A;  3IRU A;  1BPD A;  2KDY A;  4BUM X;  2ODJ A;  3Q8S B;  4M0A A;  4F8R A;  2YQE A;  5KAF U;  9ICS A;  5DBC A;  5AFU L;  3CRX A;  2AGQ A;  2G5I B;  3C2L A;  7ICO A;  1XSP A;  8ICI A;  3AM9 A;  5J0S A;  1ECW A;  4U9C A;  4EBC A;  3N7S C;  4R64 A;  4J9K A;  3VCB A;  5DKW A;  2KXP B;  3OGU A;  4KLL A;  1QJ8 A;  3ZDC A;  1L5U A;  2R4O A;  1MQ2 A;  4PPX A;  3LK4 1;  2PI5 A;  2B6G A;  4ED0 A;  1ZHY A;  5KL8 B;  3DWO X;  5EE2 A;  5T14 A;  4US8 A;  5AKL A;  9ICF A;  4KLH A;  3AA6 A;  1WYG A;  1LB2 B;  2JQY A;  3G6X A;  2K4I A;  2W8K A;  4DLE A;  2MUT B;  9ICX A;  1RYR A;  1KBU A;  4M9N A;  4QWB A;  4UQG A;  2A1A A;  5HML A;  2KEY A;  3QU2 A;  2BR0 A;  4KLG A;  3UPQ A;  3OHA A;  5KFT A;  2X9K A;  8ICH A;  2LM1 A;  3UMG A;  2AH5 A;  4O3R A;  3N97 B;  2C2E A;  4NLC A;  3IP4 B;  1BT9 A;  2HMX A;  2J4U P;  5EWF A;  8ICE A;  1DOQ A;  2VA2 A;  1S5L O;  2KVS A;  4J9L A;  4NWI A;  1T3Q A;  4YG2 A;  4DL5 A;  4UAZ A;  3V7K A;  1ZQF A;  1VLB A;  3QRA A;  4UB6 U;  1TAU A;  2UVW A;  2ZUB A;  3V8U A;  2P66 A;  3MFI A;  3KHL A;  4Y2T A;  3C29 A;  1F0M A;  4M9L A;  2BQU A;  4RQ5 A;  2Y9T A;  2DWQ A;  3HW8 A;  2XTR A;  1URJ A;  3H7I A;  1NI3 A;  4C8M A;  2FMS A;  3UAQ A;  3IHQ B;  1COK A;  3HJE A;  4RUA A;  3HT3 A;  3SY7 A;  3TAD A;  5KFB A;  4DL6 A;  2NRV A;  1HXT A;  5HR7 A;  4G76 A;  2KG5 A;  2YMP A;  1JIH A;  4JV1 A;  4OD0 A;  4DFD A;  3AAA A;  5FP0 A;  3SYB A;  3VY8 X;  3V7L A;  4B9S A;  4PGQ A;  2XCA A;  3U26 A;  1RM6 C;  4CE6 A;  8ICU A;  5HHI A;  4MFA A;  1PVQ A;  3SYS A;  3N28 A;  2WJQ A;  5EE1 A;  4J9R A;  3T5H A;  1OPF A;  1YS5 A;  3Q8R B;  5AI5 A;  3LVW A;  8ICT A;  1KL9 A;  4M6W A;  1D9D A;  2IHN A;  5ALK A;  1X40 A;  5G26 A;  4AKR A;  1ZQT A;  5KFZ A;  1V9P A;  4FS2 A;  4PHP A;  4NM1 A;  4J03 A;  1ZQP A;  3ETR A;  3FDS A;  4XNK A;  3EZ5 A;  1Q8K A;  4F5Q A;  4OJ5 A;  4B9V A;  3DV9 A;  4Q45 A;  1N63 A;  3OHB A;  2PFO A;  4EX6 A;  2BDU A;  3F5A A;  4B9N A;  5DB9 A;  3C5F A;  1PK1 B;  4IQV A;  4ELT A;  3KHH A;  1GO3 F;  4ECY A;  3TAQ A;  9ICJ A;  2XG6 A;  3PZP A;  4DFP A;  3PW0 A;  3KOO A;  1D8B A;  4C8N A;  5AKE A;  2HHU A;  1N2X A;  1S77 D;  4O5E A;  1PRN A;  3JPS A;  2Y1J A;  4JMU A;  1SL1 A;  3AA7 B;  2HBJ A;  5KFP A;  1B4F A;  1ZQB A;  2B21 A;  2IOF A;  4UBC A;  3FYX A;  1ZHW A;  2JZB A;  2AQ4 A;  1ZJM A;  4Y2Q A;  3EPI A;  4DL7 A;  5ALH A;  2W7O A;  4QWE A;  1IM4 A;  5DLG A;  1NK6 A;  8ICZ A;  1VDV A;  3GIM A;  3NVZ A;  4K4I A;  1YZ6 A;  2KOB A;  4UB2 A;  3C1Y A;  4YR2 A;  2H5X A;  5KG2 A;  5EWG A;  4RZR A;  4GCQ A;  5AI8 A;  7ICH A;  1JI7 A;  3UM9 A;  4MEX A;  2GOL A;  4I2B A;  4IR9 A;  1ZQ1 C;  2M9N A;  3KZI O;  4GCP A;  4OCZ A;  4NXZ A;  2IBK A;  1VJ5 A;  4NM2 A;  2DKZ A;  4Q44 A;  2Y2X A;  1FO4 A;  3T5L A;  1PUZ A;  4Q43 A;  2KZ7 B;  2H3Z A;  5KFL A;  8ICM A;  3LK2 B;  5D5D A;  2OEH A;  5AKY A;  4FRX A;  3ALR A;  2DF4 B;  7PRN A;  2W3S A;  3UMC A;  4EBD A;  1ZQM A;  1ZD5 A;  3H0R B;  4KLI A;  2OYY A;  2GH1 A;  4RPZ A;  4RPX A;  4RJX A;  3ZDD A;  1QQ7 A;  4GCS A;  3RJJ A;  4EYH B;  9ICP A;  1E54 A;  2PXI A;  4P0P A;  4QZ9 A;  1X6J A;  4QIW F;  1ZQC A;  3V6H A;  2JRZ A;  4YCX A;  4I2C A;  3SZV A;  3C5G A;  2JMG A;  5ALD A;  3HIL A;  2ZIW B;  3MR5 A;  1ZQD A;  2W8L A;  3EYZ A;  3IN5 A;  3OSN A;  3BQ7 A;  4WJ3 B;  2F1H A;  3L4P A;  4LZD A;  3SI8 A;  1WUD A;  5J0X A;  8ICF A;  1F5S A;  2P35 A;  2KZM A;  1SL0 A;  2I1Q A;  3SQI A;  3LVV A;  1RZT A;  4PR7 A;  2R8I A;  4IRD A;  4O9M A;  1Z1V A;  3I28 A;  2DUY A;  1NJY A;  4GXJ A;  8ICB A;  4XNL A;  4MHV A;  2W9C B;  5ADX L;  5B5E O;  2OH2 A;  2PFN A;  4F71 A;  3F5E A;  2KJ5 A;  5J2H A;  3PR4 A;  2FGQ X;  1B43 A;  5L1I A;  4BWM A;  4QZB A;  4ELV A;  5AI0 A;  1DGS A;  3HOE A;  5KFI A;  3MR3 A;  4GC6 A;  2KFZ A;  5KAF O;  8ICC A;  3BRZ A;  9ICT A;  1CI4 A;  4NJ8 A;  5AKZ A;  3VC8 A;  2KN7 A;  2KZ3 A;  4O3P A;  1S10 A;  1YZ7 A;  2XY7 A;  1ZHT A;  4EYI B;  3BS0 A;  3RAQ A;  3RR8 A;  4ED2 A;  2BKE A;  4CRX A;  4PUX A;  3NS1 A;  1OUQ A;  2NYV A;  1BPB A;  5HP4 A;  3Q8K A;  2D8C A;  1J2N A;  2HHQ A;  1WCL A;  5KFV A;  2IOH A;  1SB3 C;  2VIX A;  1HIW A;  5ADX K;  2E8M A;  2HDO A;  3RF9 A;  2X27 X;  5DQH A;  3RBE A;  3MGI A;  1UQV A;  5AK5 A;  3HWB A;  1Z1B A;  5AHX A;  5ALG A;  2V4Q A;  1KRP A;  4UAW A;  5T5F A;  4KN4 A;  1V38 A;  1QJP A;  2NV3 A;  4M9H A;  5KFF A;  3GDX A;  1BNP A;  1QSL A;  2EQY A;  2I6X A;  2Q0Z X;  9ICA A;  2C2R A;  2E8N A;  3BS7 A;  5J2C A;  3HWT A;  5J0R A;  1L3T A;  2YPV A;  2PFP A;  2ZIV B;  4DEZ A;  4YN4 A;  3M8S A;  3QUT A;  3GIL A;  2PMZ C;  3RB3 A;  3UU2 A;  1U48 A;  1TAM A;  4RQ0 A;  1N62 A;  5DBA A;  2VA3 A;  2FLL A;  4FSO A;  4PHE A;  5GTH O;  5BPC A;  4RNO A;  4UAT A;  2W9M A;  2AU0 A;  4M9J A;  3HKZ F;  3F2B A;  3LK3 A;  5DL8 A;  4UB6 O;  1BPX A;  5IIJ A;  3KZX A;  4EX7 A;  2Y7S A;  3H0M B;  7ICP A;  3L3F X;  1T8E A;  4C4V A;  4BXO A;  2HOF A;  2NRW A;  4E1S A;  3PQU A;  4O4X A;  4F4X A;  5J2A A;  5KAI U;  4J9N A;  2K8C B;  1A6S A;  1COO A;  3GV7 B;  4KR4 A;  3DA4 A;  4FRT A;  3WK6 A;  4CCH A;  5JDP A;  4N75 A;  4NLZ A;  2WVP A;  1N61 A;  3WI4 A;  3S6J A;  4D64 A;  3AN1 A;  2Y1I A;  1BPE A;  5F9N A;  3PML A;  1ZD2 P;  4YFK A;  2W3R A;  5C5J A;  3QZ8 A;  2JEJ A;  4UAS A;  3GV8 B;  2FMQ A;  5ALZ A;  3ISB A;  3M9N B;  1SV0 A;  5GTI U;  2Y0K A;  4TQR A;  2AXT U;  4ECT A;  7ICI A;  1M6Y A;  2JH7 A;  4O49 A;  1XC9 A;  5G38 A;  3B0X A;  3PX4 A;  2KKV A;  5J2F A;  4YR0 A;  2AGP A;  2OXO A;  5ALF A;  7ICJ A;  3POQ A;  1T94 A;  1ZXI A;  4DFM A;  3QEB Z;  3QUB A;  2JMM A;  3HW9 A;  3PW7 A;  2XE5 A;  4BX9 C;  4R65 A;  2FLN A;  2DKX A;  1L7N A;  4F4K A;  2KMD A;  4ECW A;  4TUR A;  1TE2 A;  2EAP A;  2N1R A;  2R8H A;  2W7P A;  4AYE C;  2R8G A;  4YP3 A;  1ZQV A;  4FES A;  4P0Q A;  4RQ7 A;  1D8Y A;  7ICN A;  3AU2 A;  3F2D A;  1XO0 A;  2BZF A;  2H3V A;  4ZH4 A;  2PFQ A;  2YB4 A;  3RB6 A;  3AA6 B;  4DSJ A;  1UA0 A;  5C0Y A;  2WB1 C;  4KR8 A;  3GIJ A;  4I2A A;  1KFD A;  4RQM A;  3OPX A;  5EOZ A;  4B9M A;  2W03 A;  3M6Z A;  9ICO A;  5J2J A;  4BUG A;  4PJ0 U;  2XTQ A;  3BJY A;  7ICS A;  1OW5 A;  4FBU A;  3JCU O;  4AYB C;  4CTD A;  2IHM A;  2W80 C;  3SAF A;  8ICN A;  1NJW A;  1XNS A;  5DG8 A;  3H8J A;  4Y2U A;  3T79 A;  1U45 A;  5J2E A;  3KKA C;  4PZO A;  4DSE A;  1HXX A;  1BGX T;  4AFK A;  2NO5 A;  5IYU A;  4DQI A;  7ICG A;  2F8L A;  2BPF A;  1A77 A;  1B0X A;  3H0L B;  4IR1 A;  5B66 O;  1ORM A;  2ISO A;  3PF1 A;  2CXY A;  5DL6 A;  5KG5 A;  4ED7 A;  4J9O A;  4FMS A;  2KIW A;  2H3I A;  4QZD A;  5IIN A;  2G06 A;  2VA8 A;  1U49 A;  4IQW A;  2QB0 B;  3E2E A;  5H2F U;  3ONN A;  5TIS U;  1SWW A;  5J0T A;  2W9B B;  2P6U A;  5III A;  3QYP A;  3WKD A;  2BQ3 A;  2LYA A;  4O3X B;  4LSH A;  3SD7 A;  1S8O A;  5J29 A;  4DQS A;  4QNL A;  1OSM A;  4MFF A;  7ICR A;  3I76 A;  2KTQ A;  4IRK A;  2N2M A;  4NLG A;  2K4P A;  1N60 A;  5KFA A;  4FZM A;  4IRC A;  9ICL A;  2NRT A;  3TFS A;  1KKX A;  3E58 A;  5KT2 A;  4RQ2 A;  5J2D A;  2R4L A;  3G7G A;  9ICV A;  4NLK A;  3WK7 A;  4Q8F A;  3EUB 2;  6PRN A;  4QJF B;  2MNH A;  4AYM C;  2DFL A;  4C4T A;  4B61 A;  5CRX A;  5J8Y C;  4M6W B;  4AZL A;  2POR A;  1YT3 A;  2LFU A;  1Z4O A;  3F53 A;  5BOL A;  2KHQ A;  4HYK A;  4KLD A;  5EE9 A;  1JMS A;  2WAQ C;  1S0V A;  2G5H B;  5KFD A;  4DOC A;  5ALL A;  4CF3 A;  1L7M A;  3MDC A;  3C23 A;  9ICB A;  1RYS A;  5AK3 A;  5HHH A;  1H38 A;  3RTV A;  4XUS A;  1V85 A;  2ZIU A;  4QWA A;  3C21 A;  5KNI A;  2ZUD A;  5J0Y A;  5AFU K;  4GXK A;  5AM0 A;  1T7P A;  2Y0L A;  5AM1 A;  2W55 A;  2LM4 A;  3VZT X;  5EE3 A;  2EAM A;  2ASD A;  4UAY A;  3PW5 A;  3PVX A;  5CEH A;  3RBD A;  4F5O A;  3TAR A;  1XU4 A;  3NJT A;  2PKE A;  2IWV A;  9ICR A;  3WK4 A;  5KG1 A;  3HX0 A;  4JFB A;  2KJ9 A;  8ICY A;  3ISD A;  1NK9 A;  7ICM A;  5KG3 A;  3N4M B;  4K4H A;  2W04 A;  4I29 A;  5JTI A;  1X42 A;  4IL6 O;  2DPI A;  2J6U A;  2H3Q A;  3B9J A;  1GFP A;  4ED8 A;  1ZQW A;  3G6Y A;  2HCF A;  2QLT A;  5A0L A;  1ZQJ A;  4QWD A;  2WF8 A;  2LYB A;  3PNC A;  1ZQE A;  4UB3 A;  4QZC A;  3T20 A;  4O3Y A;  1QCK A;  4KLE A;  4DO9 A;  3NRW A;  3EPG A;  2BDP A;  3NRZ A;  5EE0 A;  1QQ5 A;  3WI5 A;  4Z3T A;  5ALM A;  2WTF A;  2Y0S F;  5G3A A; 
#chains in the Genus database with same CATH homology
 3IN5 A;  4N59 A;  4N58 A;  4GF4 A;  3D2Q A;  4WJ3 B;  2KJ8 A;  1GFQ A;  2KHV A;  4D5U A;  1WUD A;  3AQF A;  4O3Z A;  1MM5 A;  4KMO B;  4C69 X;  2CRX A;  3K1Z A;  3AAA B;  3MGV A;  3SQI A;  3LVV A;  4RJW A;  4O4U A;  1Q9F A;  2MHL A;  2E1F A;  3D2N A;  1HEK A;  4XNL A;  2KXP A;  5ADX L;  3TZG A;  3SZD A;  2OH2 A;  2WB1 F;  3F5E A;  2KJ5 A;  4AKR B;  2KVC A;  2F77 X;  1P7D A;  2FGQ X;  3RFA A;  3SY9 A;  4FOZ A;  3PST A;  4LSE A;  4AYB F;  3SAH A;  3LYS A;  2M06 A;  3POR A;  1ZHZ A;  3HOE A;  1ZHX A;  1IZN B;  4QIW C;  3O0E A;  4A8E A;  2W81 C;  3DA3 A;  2N2L A;  3VC8 A;  2Y0S C;  3E0F A;  4FT6 A;  3PRN A;  4KX5 A;  3UPG A;  2G0A A;  4JCH A;  2ZLD A;  1F44 A;  1ZHT A;  2O4V A;  3QRC A;  4AUI A;  4ACO A;  2KNJ A;  4CRX A;  3POX A;  4PUX A;  2LBO A;  1OUQ A;  2ZXH A;  3IG8 A;  1MPF A;  2XE2 A;  2VJ4 A;  4E1T A;  2OMF A;  4LSF A;  2J1N A;  4IC9 A;  4AKM A;  2H3F A;  3M6K A;  2VIX A;  1HIW A;  5ADX K;  3CYM A;  3RF9 A;  2X27 X;  1BH3 A;  3HWB A;  1Z1B A;  2K8B B;  3O0F A;  5T5F A;  2HBK A;  1QJP A;  4NV0 A;  4OJO A;  1THQ A;  2NV3 A;  2Q4T A;  1DRG A;  5DL5 A;  2D6F C;  3F2C A;  2YPV A;  3AA1 A;  4AYD C;  4O3M A;  2ZIV B;  2E1E A;  3N7R C;  2YB1 A;  2PMZ C;  3IG5 A;  2JH1 A;  2KD1 A;  3UU2 A;  2RP5 A;  1TAM A;  2GE4 A;  3AAE B;  4FSO A;  4AYI D;  2JGA A;  3GU3 A;  2PRN A;  4BJQ A;  3HKZ F;  3F2B A;  5GV0 A;  3LK3 A;  3T0S A;  5DL8 A;  1BXW A;  2DGZ A;  4GHB A;  2WAQ F;  2XVT A;  3KZX A;  4LSI A;  2XMX A;  4O3W A;  2Y7S A;  3H0M B;  3L3F X;  2LHF A;  4P0P B;  4QQ1 A;  2HOF A;  1PVR A;  4E1S A;  3PQU A;  4O4X A;  2XE1 A;  1PVP A;  2K8C B;  1A6S A;  2MRL A;  4KR4 A;  3DA4 A;  2JHD A;  3VZU X;  3N7P D;  4FRT A;  1NZB A;  5JDP A;  2G07 A;  2KDY A;  4BUM X;  2ODJ A;  2ZFG A;  3WI4 A;  4D64 A;  2OM6 A;  5AFU L;  3CRX A;  2G5I B;  2K4E A;  1GFM A;  3POU A;  2XID A;  1A0P A;  3NUQ A;  1ECW A;  4U9C A;  4KX3 A;  2YX8 A;  2R18 A;  3N7S C;  4CGZ A;  3AQE A;  2VJ5 A;  3VE1 A;  2Y0K A;  3VCB A;  3M7D A;  3AA7 A;  2KXP B;  2JH7 A;  4NLB A;  2F2A B;  2G08 A;  1QJ8 A;  3A2S X;  4O49 A;  4GFJ A;  4FZL A;  2KKV A;  1Z19 A;  3HKZ C;  3C28 A;  2ERV A;  3LK4 1;  2OXO A;  3POQ A;  2CN1 A;  1UPH A;  1ZHY A;  1T94 A;  5KL8 B;  5EE2 A;  3VE2 A;  2Z7J A;  2JMM A;  3HW9 A;  1MM4 A;  5T14 A;  2XE5 A;  3AA0 A;  4BX9 C;  3AA6 A;  2K4I A;  2M0N A;  4RL9 A;  1KBU A;  2FGR A;  2N1R A;  1GFN A;  2W7P A;  1ED1 A;  2KEY A;  4AYE C;  2F76 X;  2LKY A;  4P0Q A;  4FES A;  5DL7 A;  2HBL A;  3F2D A;  1XO0 A;  1MA7 A;  2H3V A;  2XE3 A;  3ICX A;  2YB4 A;  2KZ7 A;  3AA0 B;  2DQN B;  3AA6 B;  4NLC A;  3IP4 B;  1BT9 A;  5C0Y A;  3LK2 A;  2HBM A;  2HMX A;  4U7C A;  2WB1 C;  2J4U P;  4KR8 A;  3OPX A;  2K4H A;  2W03 A;  3M6Z A;  4NWI A;  4BUG A;  2XTQ A;  4FZN A;  4P0Q B;  3QRA A;  4AYB C;  3D2S A;  3V8U A;  2W80 C;  3SAF A;  1XNS A;  3VY9 X;  4PL2 A;  3T79 A;  3C29 A;  3GZF A;  1HXX A;  3PSI A;  2K0L A;  4AFK A;  5IYU A;  2F8L A;  3SMV A;  3H0L B;  2RRD A;  2HOQ A;  2F1T A;  1GFO A;  2XTR A;  2CPR A;  1ORM A;  1URJ A;  3AA1 B;  4OJL A;  2F1V A;  5DL6 A;  2ZIW A;  4RLB A;  4FMS A;  4RLC A;  3PSP A;  3UAQ A;  2KIW A;  2H3I A;  3SY7 A;  2G06 A;  1HXT A;  5HR7 A;  4G76 A;  3HOL A;  2M07 A;  3ONN A;  5HR6 A;  3AAA A;  3SYB A;  2YNK A;  3VY8 X;  2LYA A;  3LK3 B;  4O3X B;  4LSH A;  1H6S 1;  3PQS A;  1PVQ A;  3SYS A;  4C0Z A;  1OSM A;  4QNL A;  2A3V A;  2K4T A;  1OPF A;  1YS5 A;  2N2M A;  3LVW A;  4FZM A;  4AYN A;  3GP6 A;  2ZXI A;  5G26 A;  1QJ9 A;  4AKR A;  1G90 A;  4CDG A;  5PRN A;  2MA1 A;  3G7G A;  2K89 A;  2ZIX A;  4XNK A;  4OJ5 A;  6PRN A;  4U6P A;  4QJF B;  2MNH A;  2G09 A;  4AYM C;  8PRN A;  3KVD D;  3SAG A;  3F5A A;  2BDU A;  1IZN A;  4B61 A;  5CRX A;  2KKP A;  4FE3 A;  4AZL A;  2POR A;  2VKQ A;  1GO3 F;  1YT3 A;  1HXU A;  2LFU A;  3F53 A;  2XG6 A;  3PZP A;  3LK4 2;  4KRA A;  2KHQ A;  2ZIX B;  1D8B A;  2WAQ C;  2G5H B;  1PRN A;  2E5S A;  4JMU A;  3AA7 B;  2HBJ A;  2XIC A;  2PMZ F;  4ICA A;  4PL1 A;  1PHO A;  3T24 A;  1CRX A;  3FYX A;  1ZHW A;  3KFU F;  2ZIU A;  2W7O A;  5AFU K;  2HOI A;  3AL0 B;  2Y0L A;  2KOB A;  3VZT X;  3DEE A;  4OJP A;  2KV2 A;  3CP8 A;  3K19 A;  4GCQ A;  3JTY A;  2GOL A;  1ZQ1 C;  1P4T A;  4GCP A;  2K8A A;  2ZIU B;  3RBH A;  1IIP A;  3NSG A;  3VZW X;  4JFB A;  2Y2X A;  2KJ9 A;  2ZIV A;  3PSF A;  2KZ7 B;  2H3Z A;  2KIC A;  2LHT A;  3LK2 B;  5D5D A;  3C5O A;  5KL1 B;  2W04 A;  4FRX A;  1SZH A;  3ALR A;  2DF4 B;  7PRN A;  3AAE A;  2H3Q A;  1GFP A;  4OJ6 A;  3H0R B;  4D65 A;  4G75 A;  5A0L A;  2OYY A;  2GH1 A;  2ZG6 A;  2LYB A;  3EMN X;  4RJX A;  2Y0H A;  4GCS A;  5FVN A;  4F4B A;  3T20 A;  1L6N A;  4O3Y A;  1Q3V A;  1E54 A;  2QTK A;  1Q3U A;  4P0P A;  2XI9 A;  4QIW F;  3NRW A;  1Q9G A;  3SZV A;  4FSP A;  2JMG A;  3WI5 A;  4Z3T A;  4OO1 J;  2Y0S F;  2RHF A;  2ZIW B;  4FUV A;  2KC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...