4FZNA

Crystal structure of syringacin m mutant d232a from pseudomonas syringae pv. tomato dc3000
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
276
structure length
276
Chain Sequence
PIELPPTYITPYPEISAGGNGTYRGQDLSSGQSFPRGMQNPVATVLLLQGDLYCSPNCLATFQDQARRDSFGIQSKVALKTFAAADQREAEGRDLRTAYNEIATDIGRSQQINENIIKYPPGNHVLSGGLMTPFHALAHGMFGLGAPLTFPIQNVGLNVDIRGIPDVMNVIQSARPVGTSSLDVNFAYDVGKDSNASWLTLGNITLRLVGTIDKNASGAWTFSGEIRAFNAVYDANPSNHRGWLGENLTSLLSAVPFTSYSIEIPGSLPVTVSGNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein
molecule keywords Bacteriocin
publication title The Crystal Structure of the Lipid II-degrading Bacteriocin Syringacin M Suggests Unexpected Evolutionary Relationships between Colicin M-like Bacteriocins.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
total genus 74
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.880 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4fznA01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4fznA02
4N59A 4G75A 2XTQA 4FZLA 2XTRA 3DA3A 4FZNA 3DA4A 4FZMA 4G76A 2XMXA 4N58A
chains in the Genus database with same CATH superfamily
1NK4A 1COOA 2MUTA 2OMFA 1RM6C 2AXTO 4ED6A 1H38A 2ZXHA 5KL8B 5BPCA 1X9SA 3HT3A 4PH5A 5J0PA 2Y7SA 3VZWX 1COKA 4B9NA 3RBEA 4F92B 3JPSA 2KZMA 4M04A 4EELA 2A1JA 2XIDA 4AKRB 4I2GA 2HMXA 2KFZA 1QSYA 2W03A 2WTFA 2AU0A 3DZMA 2YX8A 5EWGA 4PHEA 1J2MA 2LKYA 2YMPA 3V72A 3L3FX 1T7PA 4CCHA 1ZQPA 2JXJA 3UPQA 2ODJA 1N5XA 1SV0C 4DEZA 1NK5A 2ASJA 3RH6A 4FE3A 3PW2A 3GV8B 2XY5A 4EYHB 3V7LA 5J8YA 3H0LB 2KZZA 3TFSA 1KW4A 2DKZA 1TK0A 2R8HA 4EX7A 3EUB2 3PW5A 2WJRA 4UB6U 3V8UA 3L4PA 4KLJA 5EE3A 3KZIO 2XICA 2OXOA 1Q9FA 3HOLA 5AHXA 3E0FA 7ICVA 4ED1A 3NTUA 2KIVA 2F77X 4AKMA 2JGAA 2E3TA 1RZTA 3TANA 2LMRA 2AGOA 5G3AA 4FBUA 4YMOA 4C8KA 2KIWA 3ISBA 2Y1IA 4F50A 3BS5A 1N2XA 4DSFA 3PQSA 3RJEA 2M0NA 3WKEA 3A0HU 3TADC 4M9GA 2LYAA 4KLQA 1QQ6A 2H3QA 1Q3UA 4QWDA 2ZG6A 3N97B 4YFKA 2GOLA 1V97A 4ED3A 1T1LA 2JH1A 3IN5A 1KFTA 4GLXA 4TUSA 5KFIA 4DQSA 4D64A 3C23A 3PSPA 2IA6A 3AQEA 2AQ4A 3KOOA 2ZJ8A 5DKWA 5AKHA 5TZVA 1ZQTA 3PR4A 2NRZA 7ICUA 4DFJA 2QB0A 8ICOA 2KOBA 1KTQA 4QW9A 2VANA 2UVVA 4EX6A 1MN8A 4BJQA 3H4BA 3BQ7A 1KQQA 4O3XB 2F8KA 7ICGA 4GXKA 7ICLA 5KFGA 3H7IA 1BPZA 4DFKA 2A1AA 2XC9A 1SWVA 3PW7A 4CF5A 1F0MA 4XUSA 4J9RA 1TK8A 4USAA 1JALA 3PSFA 4J9NA 2YPVA 4QZAA 3AAAA 4OJLA 4RQ0A 3U26A 3N28A 3QUQA 2C28A 4BUMX 4AYBC 4AFKA 5DDYA 4YR3A 4GC6A 4O4XA 7ICEA 4C4VB 4F2SA 5ALLA 1TKDA 1IZNB 4D5UA 4KR4A 3B9JA 1XSLA 2YQEA 5TISO 3PX6A 3SY7A 1T16A 5ALZA 4K4IA 4O3SA 1B0XA 2KICA 2XGQA 4X5VA 2HVIA 1N56A 1A77A 2KE7A 4B9MA 4KMUA 4DQQA 1RG6A 2AQ0A 4RT3A 1Z4OA 2M06A 3C28A 3POXA 2KHQA 5L1MA 4FO6A 3T20A 5GTHU 4RU9A 4AUIA 3NVZA 2KSOB 1ZQNA 2M07A 5ALNA 5J2DA 1ZD5A 4F91B 5J8YC 4QZFA 2KJ8A 2LPEA 5KFNA 1U49A 2RHFA 1NK7A 1NKCA 2FLLA 3OSPA 1F44A 1A6SA 5KFZA 4IR1A 1HXTA 5KFMA 4ECVA 4JWNA 2QARB 3NUQA 3M9OB 2WF7A 3KHRA 5KFXA 5D49A 3CYMA 4P0QB 2XE5A 3ALRA 2KKVA 3K1RB 4MF8A 3LYSA 1T3NA 5AKGA 4ECRA 1LB2B 4C80A 4QIWC 4MEYA 4C4TA 1X2IA 4NM1A 5G38A 3E2EA 3ICXA 1WG8A 3G6VA 4J9SA 1ZHYA 4F4ZA 1H6S1 3PX4A 3LK3B 1ZQCA 3SQIA 1VDVA 2KFNA 5KAFO 4RPXA 5IYUA 9ICUA 4A8EA 5J0WA 3LVVA 4BXOA 1B22A 3B0XA 5B66U 4F5NA 4QQ1A 4M9HA 3ORYA 3ED5A 4KN7A 2HI0A 4KLIA 3NVYA 4PZNA 3MGIA 2K8BB 3F5EA 4G9BA 4AP9A 2LI6A 4NY8A 1ZQVA 4FFDA 1HUZA 2PI4A 4KTQA 1X9WA 1NJXA 5HMMA 3TKAA 2LM1A 2N2MA 1ED1A 4Z6DA 2J1NA 3SZVA 2AH5A 2LFUA 1GFPA 3G6YA 4DOBA 1KL9A 3PO4A 2E8NA 4J9QA 1BNPA 1BPEA 3SI8A 1NNLA 3MGVA 1TAQA 2UVRA 2H3VA 4QNLA 2F76X 3Q8SB 4N59A 3F2CA 4RT2A 5KFTA 4ED8A 3OSNA 4IL6U 3AA1B 4IQWA 3POQA 5J0TA 1HXXA 1XWLA 5CJ7A 5JRTA 4TURA 2HCFA 2B6GA 4MF2A 5KFOA 4CTDA 1RYSA 2ZTEA 3DDHA 1DXSA 4NLGA 4JV2A 3A0BO 3QE9Y 2H3IA 4FRXA 4F3OA 2PMZF 3MDCA 5DLFA 5AFUK 4ED7A 4I2IA 1L3SA 4ZH4A 3K1ZA 5KFHA 1O03A 3PQUA 4UB8U 1ZQWA 4O49A 4RQ7A 5DLGA 1X9MA 8ICKA 7ICFA 7ICQA 2O4VA 4KR8A 2DGZA 3QEAZ 5KFDA 5KG2A 2G07A 2XTQA 1X9XA 1XU4A 4KLEA 5DDMA 2ZIUA 5CP2A 3QRCA 1XO1A 1U47A 4DL4A 4N74A 5AM4A 2BCVA 1V38A 3SV3A 4E1TA 4YD2A 2Y0HA 2KXPB 3VY8X 3MR5A 2W9AA 3IV6A 4Y2YA 2XY6A 4C8OA 1WCNA 3PVXA 4F4YA 4LZDA 2OH2A 9ICJA 5HR7A 1OXJA 5ALOA 4IQUA 3MBYA 4DL2A 5DG9A 5ALRA 1NK9A 3SYSA 2K4IA 2KVCA 5J2HA 2MRLA 2K4EA 3NGDA 2XGPA 5J2CA 1CEZA 1TFRA 1S10A 8ICBA 4EEYA 3UAQA 3GV7B 5CRXA 4KITB 4ELTA 2Y9UA 4QWAA 4J9KA 2RP5A 4ELVA 5KL1B 5CWRA 2W9CB 1DGJA 2WAQF 1N48A 2MAXA 3V6HA 5KT3A 4B9UA 5ALWA 4B6JA 2R89A 5DBCA 5J2BA 1YT3A 5KG6A 5ALJA 3JCUO 3PW0A 9ICXA 5L1LA 4FSPA 1L6NA 4C4SA 4B61A 4GCSA 2WJQA 3L5KA 4KLFA 3UQ0A 2FGQX 5H2FO 1QQ7A 4O3PA 2BPGA 5E79O 4JUZA 8ICVA 4LSHA 5C0YA 4UB1A 3OJSA 2AXTU 4F2RA 3HPOA 4YXMA 5HHIA 3AA7A 3FC4A 4UW9A 9ICVA 4M47A 4Q44A 5KG1A 3JPOA 1NKBA 4FUVA 1S0OA 1ZQQA 5A0LA 2BPCA 2OEHA 2A3VA 1WYGA 9ICSA 3WI4A 1YZ7A 4I27A 3PMNA 2KK0A 2W8KA 3PSIA 2W7PA 9ICPA 5ALHA 4GHBA 3ZDBA 2MA1A 4O3ZA 3H4DA 7ICTA 1QSLA 1S0NA 3FM9A 1L3TA 1URJA 5D4BA 1L5UA 2WB1C 2E1FA 1SXDA 2ZUDA 2OHFA 5DQGA 2R8AA 4PL2A 4FBTA 2K4HA 3H40A 2RDIA 5AKJA 4O3NA 5F9NA 4PGQA 1VLBA 1ZQOA 1D8LA 2ZXIA 2W9BA 2Y0LA 3EW9A 2I1QA 4KX5A 4IC9A 1HUOA 4QJFB 3VZUX 8ICLA 9ICKA 5EE1A 3DWOX 1ZQSA 2FLPA 5FVNA 4PJ0O 9ICAA 3O0FA 1Z00A 2IOHA 9ICRA 5KFQA 1S0MA 4ELUA 3J81j 4O3QA 4F5PA 5EWFA 3SAGA 4R64A 2E8MA 1JIHA 4J9PA 1IV8A 3IM1A 5ADXK 1K1SA 1NJWA 1MC8A 2K4PA 4NJ8A 1PZNA 3MABA 4DL3A 4R8UA 1Z1VA 4DF4A 1MSWD 4KX3A 3C2MA 8ICSA 2GE4A 4C7YA 3SV4A 1HEKA 3CNHA 5KG5A 5J2FA 3ZI4A 4PL1A 3RF9A 5DBBA 4F5QA 2BQUA 4Q43A 1VJ5A 3M9NB 1SZPA 3LK2A 4R65A 1B43A 5CEHA 3SY9A 1X40A 2DF4B 5BOLA 1SV4A 2VIXA 1JX4A 4KLGA 5C5JA 1N60A 1PVRA 4KLLA 4G3IA 3JPTA 3D6JA 1UT5A 1GFNA 3GP6A 1ZQJA 1NKEA 2ZIVB 3RJJA 2DWQA 2F1JA 2KDYA 9ICMA 5B5EU 5ALDA 4Z6EA 5J2IA 2PFPA 1S76D 2I9GA 4ECTA 2XMXA 4FSOA 9ICTA 3AU6A 4OCZA 2ZIXB 4KLUA 5EE2A 4O3MA 5HR6A 7ICHA 2Q0ZX 1B4FA 2F1HA 1UA0A 1AROP 5AI0A 4I28A 4YMMA 5KFEA 2FLNA 4JV1A 3EWAA 5AM2A 5JUMA 3HWTA 2JH7A 4IQVA 4JFBA 5TISU 1FEZA 4MFAA 2QTKA 4I2EA 4R63A 5AFUL 4Y2JA 1ZQGA 4Q8EA 4U6PA 1KRPA 3AA0B 4QZEA 2KJ9A 1ZRMA 4C00A 5EE9A 2A19A 1NK8A 4XA5A 2HBMA 4KLOA 5KFKA 4TQRA 1SB3C 2F1CX 5J0YA 4AZLA 4FRTA 5KFLA 2XG6A 1ZQRA 3QUTA 4OJPA 2N2LA 5G5GA 2W8LA 5JTIA 4FZLA 4RUCA 5L1JA 3GU3A 3MR3A 7PRNA 2RDJA 1T8EA 3BZKA 4YQWA 3RB6A 1KBUA 1XS9D 3PMLA 5DB6A 1T4GA 4UAVA 4LZGA 4UATA 5AKEA 2DUYA 5IILA 3NJTA 1PK1A 5KAFU 2YN4A 3V6JA 3QUBA 1PHOA 1RYRA 1XO0A 3I28A 4RQ2A 4GCPA 3SMVA 3RH5A 2M9NA 4QWEA 1LKYB 2XI9A 2O6KA 3C1ZA 1TE2A 4YD1A 5GTIU 7ICPA 4RLBA 5KT7A 1FO4A 5ALIA 4C8LA 3I1YA 4Y2PA 4DLGA 2K89A 3Q8LA 4DLEA 2FDRA 3VZTX 3WU2U 1ZQYA 3SR6A 1ZD4A 3EMNX 1ZQMA 4QZIA 1UCVA 1Q8KA 5PRNA 3LWMA 3T5JA 4ECZA 3N7PD 1U45A 4EENA 4F93B 1BT9A 3THVA 3PNCA 1KFSA 5DL7A 3B0YA 1U48A 1QQ5A 2R4NA 4R66A 1D8BA 1NOMA 1GFQA 2EZYA 2KZ7B 4AKRA 5DQHA 4NL9A 4M9LA 2HHXA 4RQ3A 5IIIA 1KKXA 5ALYA 1E54A 1MM5A 3MGHA 4F4XA 3HILA 2JEGA 3HKZC 3KBBA 9ICGA 4ECYA 2JMMA 4KRAA 4YN4A 1YZ6A 2C2DA 5AK3A 1TK5A 3BQ2A 4RQ4A 1TAUA 2PKEA 4Y2VA 4O3YA 4QZ8A 1LVHA 4YXJA 2RLTA 3NASA 3M8RA 4EYIB 5AK4A 4LSEA 3WKCA 3TAQA 1S5LU 3PW4A 5J2GA 3KHLA 5HNKA 4DCCA 4CDGA 2EANA 4FZNA 1V9PA 4Z3TA 9ICBA 5D5DA 1ZQEA 9ICIA 3BRYA 3SZDA 4AYMC 4GIBA 3AA6B 4C8MA 3C21A 4FMSA 3PR5B 1WWVA 3FDSA 2GO7A 2IWVA 4DOAA 4P2HA 3AEVA 4NLNA 4DL7A 1Q3VA 4UB6O 4UAWA 2GWSA 2JV3A 3IG5A 4RQ8A 3JPPA 3Q8MA 1XSPA 4QZDA 3I76A 4ECUA 5G39A 2ODGA 1Q9GA 4O3RA 2D3DA 2NO4A 2C2EA 3UM9A 4NM2A 3QU4A 5DGAA 2ZUBA 4F4KA 2CXYA 4QZCA 4GFJA 2AGQA 3T79A 1KFDA 4PHDA 4RQMA 2ZLDA 5KT4A 4RQ1A 5IIMA 4I2DA 3UU2A 1ZQLA 1SKWA 1RDFA 4QWCA 1X42A 2PFQA 1X66A 3MDAA 3MR2A 3RRGA 3CP8A 1CI4A 4YP3A 1TVAA 3E58A 2WF8A 1ZQFA 3V6KA 3AM9A 5AM0A 2XY7A 5E79U 3Q8PB 1XNSA 2W54A 1ZQXA 2E5SA 5J0RA 3TI0A 3BRZA 5AI8A 4AYNA 1NJZA 2PFNA 2YY6A 1IIPA 4J9OA 2JMGA 4RQNA 2N1RA 4P0PB 2PRNA 5CHGA 1ZD2P 3RBDA 1IXRA 2W3SA 4C4VA 4M0AA 4LVSA 1IZNA 1MPFA 4YCXA 1ZHWA 1U9LA 2R8GA 1CUKA 2HVHA 4MFCA 5KAIU 4KLSA 4J03A 1BPXA 3NRWA 1SWWA 1QJPA 4RZRA 1X6JA 2FMPA 8ICUA 4NL9C 2ZUCA 5HP4A 3G7GA 4C4RA 3D2NA 1MA7A 4QW8A 1GFOA 1SZHA 3K75D 2JR5A 4I2BA 3F5AA 2DBYA 7ICMA 1KDHA 5AI6A 3BQ0A 1ZJNA 4UBCA 3SZ2A 2P6UA 4O4UA 1QJ8A 3ETLA 2KSOA 6PRNA 4F4WA 5J2EA 1XC9A 2IBKA 3JTYA 4Q45A 1L7MA 4YMNA 1L8OA 3WK7A 5KFRA 5AM1A 3Q8QB 3TZGA 9ICLA 3T24A 2QARA 3WK5A 2NRVA 4PPXA 4B9VA 5KG7A 3TFRA 4P0QA 1SKRA 3GV5B 3F2BA 3C5GA 3NVWA 3DA3A 5KFSA 4Z6CA 5G26A 5DL6A 1PUZA 2IHNA 2VKQA 3M7DA 4M9JA 4ED2A 1L8LA 4PHAA 4JCHA 3TACB 3PV8A 2JEIA 1D8YA 1DOQA 8ICHA 4N58A 2ZIWB 2BZFA 1GFMA 5L1KA 4GXIA 4NLCA 3RJHA 5ALQA 4M6WB 4UASA 4KLHA 3WKBA 4UARA 1C7YA 3LK3A 5KT2A 3V7JA 5DB9A 5KFAA 3ZDCA 4B9LA 2KVSA 2HW3A 4AYEC 1KN5A 1RXWA 3SD7A 1BVSA 2DKXA 2BDUA 4RQ5A 2JZBB 4JK1A 4LJXA 7ICNA 2FPLA 1OPFA 2F1IA 3LVWA 3PX0A 4B9TA 2J4UP 1PVQA 3AAEB 3KHGA 3HW8A 3LWLA 1BNOA 1UA1A 4DS5A 2H3FA 4JWMA 2G5IB 1ZRNA 2XE2A 3KKAA 1G90A 1UT8A 9ICHA 7ICSA 5AKLA 4NLKA 3JPQA 2NRWA 2EAMA 2F1VA 4FQEA 2YMQA 1FIQA 5B66O 9ICEA 4JMUA 3AA1A 2KHVA 2HBJA 3H0RB 1L7PA 5F3XB 4OJ6A 2G06A 5KFUA 4EBEA 2NV3A 3M6ZA 2PMZC 3D2QA 1NJYA 2F2AB 2QLTA 4NV0A 3HX0A 3VY9X 9ICQA 2EZZA 5KTQA 1NI3A 2BCSA 4DFMA 3WK9A 4PHPA 3M8SA 2EDUA 4O3OA 4KN4A 4K3CA 4TQSA 1KEJA 2MUTB 3RJKA 2LM4A 4KLTA 3IP4B 1S0VA 4RL9A 2WF6A 3PRNA 2P66A 1Z19A 1TAMA 2KD1A 4F5OA 5J29A 5HHHA 9ICNA 2ESEA 2A1JB 2KXPA 1FFVA 2H3ZA 4IR9A 5T5FA 1X6IA 4F5RA 4OJOA 4UAYA 1N5WA 4UB8O 2WHEA 4GC7A 2CN1A 3KZIU 3PZPA 3FAHA 2VA3A 3VCBA 1C20A 5EWEA 2D8CA 3MR6A 2G08A 4AYID 1GO3F 4CE6A 2ISPA 4IRKA 3BDPA 2KEYA 3PGRA 2BQRA 3RJFA 3WK8A 4RLCA 2Y0SC 1A0PA 1UPHA 3KHHA 3RBHA 2G0AA 4KLMA 1QSSA 2F44A 3RR7A 2G09A 1PVPA 2MSNA 1RQNA 4RPZA 5AKKA 2R8KA 3AQFA 3BS7A 4I2CA 5DG8A 2PXIA 2HHVA 5GV0A 5AI5A 2PFOA 2HBLA 2IWWA 5AK5A 2FGRA 4DQIA 1IG6A 2QKQA 4UB3A 3HOEA 2HSZA 4Y2QA 2W9CA 1BPYA 3HP6A 2W81C 1ZOLA 4Y2UA 4YVZA 1WCLA 3HRDD 2ISOA 8ICWA 3RR8A 2GLEA 1ZD3A 5KG4A 5IIKA 5DBAA 4Z6FA 2D6FC 3BS5B 5D46A 5KFVA 4DSJA 5KFYA 3QYPA 2Y1JA 2I6XA 4NLZA 2OCEA 3GQCA 3KFUF 4F72A 3GZFA 1JN3A 2E8PA 3DA4A 3JPNA 4ECSA 4O5EA 2H5XA 4P4MA 5KFBA 3K4GA 3QZ8A 3KKAC 3JPRA 3KTQA 3WK4A 1ZQKA 4YG2A 2C2RA 2FPKA 1OW5A 1QJ9A 8PRNA 3IHQB 4FZMA 2HHQA 1NK6A 3O0EA 1SXEA 2QB0B 5DB8A 2NO5A 2W11A 3OHBA 2WF5A 5ALXA 3RB3A 4EZ6A 3K19A 1ORMA 2YB1A 3C2LA 4QZBA 1L3VA 5F9LA 4NLBA 5DGBA 4ZOHC 3DEEA 1BXWA 3QXGA 1DK3A 3Q8KA 2IMWP 4N75A 3OPXA 1JXLA 3LK41 2R8JA 1THQA 3AAAB 3RAQA 2L5YA 3H8WA 4DSIA 1J97A 5G5HA 4LSIA 3RFAA 2RRDA 3T5LA 1RXVA 4MEXA 4AYBF 3HKZF 1ECWA 2LHTA 3FYHA 4EBDA 4P4PA 3MFIA 1ZQBA 1S9FA 4DS4A 8ICMA 4F71A 1LV5A 3M9MB 1UQVA 2ATLA 5AKIA 2W43A 2DQNB 1ZETA 1JXEA 4G75A 3V7KA 2ALZA 4TUQA 3UMCA 2KN7A 2LYBA 1S8OA 2ZJ5A 1T3QA 1SL1A 4E0DA 2ZTDA 3BJYA 2OYYA 5DL8A 2HHWA 9ICCA 2R8IA 3WK6A 1XSNA 4J9MA 1BPBA 4O9MA 7ICOA 4RPYA 3BQTA 7ICKA 3SENA 1HJPA 3MFHA 9ICFA 5DG7A 3WKDA 3UXPA 2RQ5A 5JU5A 3PGSA 3ZD9A 3BQ1A 4GF4A 3QU5A 3QRAA 4CNQA 4QIWF 4QZ9A 5EE0A 3GDXA 4DOCA 4DFPA 8ICZA 3N7SC 2UVWA 2ZIVA 2HDOA 1S97A 3UMBA 3GILA 2V9WA 1ZQIA 2YTUA 2R18A 4O0IA 4HYKA 3OHAA 4EEKA 1K5OA 3M6KA 4BXOB 3SEIA 2J6TA 2KJ5A 3H8SA 2ZIXA 2QB1A 3RB4A 2WFAA 4CF3A 3T0SA 5KT6A 5KT5A 3A2SX 4DFDA 8ICAA 4KLDA 1HIWA 4TUPA 1TV9A 4M2YA 5ALTA 3OGUA 4K4GA 5IINA 1UHUA 3A0BU 4NWIA 2BQ3A 5KG0A 4J9LA 2DPIA 3UXNA 5B5EO 5AM3A 4M9NA 3AA0A 4KMOB 2JEJA 5IIOA 1K1QA 2B21A 1SL0A 3VE2A 1N62A 1M6YA 1N63A 2E1EA 1Z4NA 8ICEA 2W9MA 5AIAA 1NZPA 4DL6A 2ES6A 3AL0B 1BGXT 2P6RA 3H8JA 1Z1BA 3AUOA 1KLNA 5AIBA 2BGWA 3KZXA 2Y2XA 1NZBA 3M1YA 1N61A 4ED0A 1ZHTA 2XO7A 5L9XA 4CGZA 4ECWA 1J2NA 2AHOB 2IOFA 2KTQA 8ICJA 2V4QA 4CRXA 3C5FA 2Y9TA 2VA2A 4QZGA 5KG3A 3TARA 2XCAA 1Q46A 2OWOA 5KFCA 5HMLA 5T14A 3AU2A 1FFUA 8ICCA 1D9DA 3AMZA 3RB0A 4C8NA 3TAPA 4IRDA 2ZIUB 2PI5A 2ASLA 4I2JA 2K8AA 1SGGA 2X9KA 4US9A 4HAIA 3RJGA 4QZHA 5KFFA 4UBBA 3PF1A 2HBKA 4BDPA 2R88A 3GIKA 5AM5A 3QNMA 3T3FA 2FPMA 4AYDC 2KMDA 1LKYA 3LDAA 4IS7A 4RNNA 5ADXL 5IIJA 5AKXA 2K0LA 8ICYA 8ICNA 9ICWA 2EAPA 2K60A 4RNOA 4DF8A 2BPFA 4DWIA 4GCQA 2C22A 3A0HO 4G76A 5AKZA 4PZOA 4FOZA 4C69X 4EZ9A 2JHDA 1WUDA 1QLNA 1PK3A 1RPLA 3RH4A 1EXNA 4JV0A 5H2FU 5J0SA 5J2AA 4C7ZA 4Y2RA 4EBCA 3T5KA 3C5OA 4IRCA 3GIMA 2LBOA 1CRXA 2OM6A 4UQGA 3CW2C 1DRGA 1QCKA 2KZ7A 5GTIO 3QU9A 3C2KA 2KKPA 3ZDDA 3UQ2A 2KV2A 4DQRA 2Z7JA 5ALVA 1U4BA 4DSLA 2CRXA 3PO5A 3ISCA 3G6XA 3WU2O 3UMGA 4YR0A 2BCRA 1AQ6A 3ZDEA 4E1SA 4I29A 5KFJA 4Y2XA 5ALGA 2FMQA 3EZ5A 2DFLA 1SIJA 4XNLA 2DPJA 3NRZA 2XE3A 1ZQHA 1QH9A 5KFWA 2BR0A 5AKYA 4QWBA 5KFPA 2BCUA 2KNJA 8ICGA 5DL5A 3SYZA 3HW9A 4DQPA 2YMMA 1MQ3A 2G5HB 2W80C 3UPGA 1P7DA 2F3NA 4UB2A 2W04A 4BWMA 4DSEA 3AA7B 4MHVA 3EPIA 4I2AA 4RNMA 1SKSA 2W55A 2WF9A 1JUDA 3PORA 2Y0KA 8ICRA 2Q4TA 8ICPA 1OUQA 5AK6A 1ZQDA 2W3RA 4D65A 1RQLA 3QX7A 4IQTA 1ZQUA 3HJEA 4PGYA 3AA6A 1YS5A 2W7OA 2FE9A 5ALKA 4B9SA 3PY8A 1ZHZA 2VJ5A 4BWJA 3EPGA 4U9CA 3LK9A 2KC0A 1SL2A 3WKAA 2DL0A 2V4RA 3UXOA 3QZ7A 2XCPA 2NRTA 1S5LO 1ZQ1C 4DL5A 2K4TA 3ZDAA 4PJ0U 3R9KA 3F53A 2WB1F 2AJQA 1OSMA 2X27X 3QU2A 4CF4A 1S77D 5J0UA 5GTHO 1ZQAA 2YMLA 2GH1A 4GXJA 2NYVA 2FI1A 4O5CA 2W9BB 4UAUA 1ZJMA 3GFKB 2JEFA 3N7RC 3SAHA 3QEBZ 2XVTA 5DQIA 4DO9A 2UVUA 2BKEA 5KNIA 1MQ2A 2HOQA 4XRHA 8ICXA 1Y88A 2Y0SF 4FT6A 2EH9A 2ZTCA 5J0QA 4FESA 5CB1A 3DWNA 1DK2A 5ALEA 2LYHA 3C29A 2BHNA 2AGPA 1L7OA 3Q8RB 2ERVA 2WVPA 3SAFA 1Z00B 8ICIA 3T5HA 1RYUA 4U7CA 2I5HA 2ASDA 3RJIA 1MM4A 3RAXA 1HXUA 1O08A 2VA8A 4DSKA 4MFFA 7ICJA 2HHTA 3QU7A 2XTRA 4C0ZA 4K4HA 3NVVA 1PRNA 3WI5A 2KG5A 4R8UB 4FS1A 3KD3A 2IOFK 4JB3A 2JQYA 5ALSA 4P0PA 1BH3A 2KP7A 3GIJA 1P4TA 4XQ8A 2ZFGA 3LK42 2K8CB 2ZJAA 2BCQA 4Y2TA 2R4LA 5J0XA 4ACOA 1ZYQA 2JRZA 4UAZA 1WWUA 3IDWA 3LK2B 8ICQA 3QUCA 2IHMA 1L7NA 3H0MB 4RJWA 2NRXA 3OTQA 2J6SA 3ISDA 7ICRA 4PGXA 4IL6O 5L1IA 3NS1A 3NSGA 1V85A 4OD0A 5ALMA 4RQ6A 3VE1A 1SV0A 2F8LA 5KAIO 4ECXA 4I2HA 3GIIA 3SYBA 2CPRA 2R4PA 1DGSA 1BPDA 1D9FA 4O5KA 4LSFA 3OJUA 2F1TA 2KZ3A 4NXZA 2EQYA 3POUA 1L3UA 1JMSA 1QTMA 2MHLA 4PUXA 4WJ3B 2XE1A 3FYXA 3PGUA 5DB7A 9ICOA 4UB4A 5AI9A 5J2KA 4BGDA 2ZIWA 4M6WA 4OO1J 2EZXA 1JRPA 3TQ1A 1ZXIA 1JROA 4XNKA 4BUGA 2LHFA 5ALUA 8ICFA 8ICTA 4Q8FA 5AI4A 3PSTA 3F2DA 1IM4A 2YB4A 5ALPA 3EYZA 3CRXA 3ZD8A 2R4OA 5J0OA 1NK0A 2JZBA 1ZQZA 2J6UA 2PORA 5BOMA 3TADA 5K4LA 2WAQC 3N4MB 3C1YA 3BS0A 3AAEA 2MU2A 3H8MA 5ALFA 4F8RA 1Z3EB 2P35A 3RRHA 2FMSA 2VJ4A 1F5SA 4PR7A 3HWBA 2FJ6A 2E8OA 2YNKA 4UB5A 2BDPA 4RJXA 3VC8A 3MC1A 1T94A 4Y2SA 2MNHA 2HHUA 2HOFA 4RUAA 3BZCA 4ECQA 3ETRA 1JI7A 1ZHXA 2B0CA 7ICIA 5J2JA 5CR0A 5AICA 4K3BA 1PK1B 4I2FA 5JDPA 4ICAA 1KSPA 3AN1A 3IRUA 3D2SA 4F4BA 3IG8A 5CA7A 3ONNA 4OJ5A 3RTVA 3DV9A 4O3WA 2EAOA 4BX9C 4YR2A 3KVDD 3S6JA 4P4OA 2HOIA 2HHSA 5FP0A 4US8A 5EOZA 1A76A 4FS2A
chains in the Genus database with same CATH topology
4P0PB 2PRNA 2OMFA 1HIWA 2ZXHA 5KL8B 4FUVA 4NWIA 1IZNA 1MPFA 1ZHWA 5A0LA 2A3VA 2Y7SA 3VZWX 3WI4A 3NRWA 1QJPA 3AA0A 4KMOB 3VE2A 3G7GA 2XIDA 4AKRB 3D2NA 3PSIA 2W7PA 2HMXA 1MA7A 2E1EA 1GFOA 1SZHA 4GHBA 2W03A 3F5AA 2YX8A 2MA1A 2LKYA 3AL0B 4O3ZA 3L3FX 1URJA 1Z1BA 4O4UA 2WB1C 1QJ8A 2E1FA 2ODJA 6PRNA 3KZXA 2Y2XA 1NZBA 1ZHTA 4FE3A 3JTYA 4PL2A 4CGZA 2K4HA 3H0LB 3TZGA 4CRXA 3T24A 2ZXIA 2Y0LA 4KX5A 4IC9A 4P0QA 3F2BA 4QJFB 5T14A 3DA3A 3V8UA 3VZUX 5G26A 2XICA 5DL6A 2OXOA 2VKQA 1Q9FA 3M7DA 3HOLA 3E0FA 4JCHA 2ZIUB 4N58A 2F77X 2K8AA 5FVNA 2ZIWB 1GFMA 4AKMA 4NLCA 2JGAA 2HBKA 3O0FA 4AYDC 3LK3A 2KIWA 3PQSA 3SAGA 4AYEC 5ADXL 2M0NA 2K0LA 2BDUA 5ADXK 2LYAA 2H3QA 1OPFA 1Q3UA 2ZG6A 3LVWA 2GOLA 4GCQA 4KX3A 2J4UP 1PVQA 2JH1A 3IN5A 4G76A 3AAEB 2GE4A 4FOZA 4C69X 2JHDA 1HEKA 1WUDA 3PSPA 4D64A 4PL1A 3RF9A 3AQEA 2H3FA 3C5OA 2G5IB 2XE2A 1G90A 2LBOA 1CRXA 2OM6A 1DRGA 3LK2A 2KZ7A 2KOBA 2F1VA 3SY9A 2KKPA 2DF4B 2KV2A 2VIXA 2Z7JA 4JMUA 3AA1A 1PVRA 2CRXA 2KHVA 2HBJA 4BJQA 1GFNA 4O3XB 3GP6A 3H0RB 2ZIVB 2KDYA 4OJ6A 4E1SA 2G06A 2NV3A 4XNLA 3M6ZA 2PMZC 2XMXA 2XE3A 4FSOA 3D2QA 3PSFA 2YPVA 3AAAA 2F2AB 2KNJA 5DL5A 2ZIXB 3HW9A 4OJLA 4NV0A 3VY9X 5EE2A 4O3MA 5HR6A 2G5HB 2W80C 3UPGA 1P7DA 4BUMX 2W04A 3AA7B 4AYBC 4AFKA 4O4XA 2JH7A 4JFBA 3PORA 2Y0KA 3IP4B 2QTKA 1IZNB 5AFUL 4RL9A 2Q4TA 4D5UA 4KR4A 3PRNA 1Z19A 1OUQA 4U6PA 1TAMA 4D65A 2KD1A 3SY7A 3AA0B 2KICA 2KJ9A 2KXPA 2H3ZA 3AA6A 5T5FA 1YS5A 2W7OA 4OJOA 1ZHZA 2VJ5A 2HBMA 4U9CA 2CN1A 2KC0A 3PZPA 3VCBA 2M06A 3C28A 3POXA 4AYID 2G08A 1GO3F 4AZLA 2KHQA 1ZQ1C 3T20A 2KEYA 2K4TA 4FRTA 4AUIA 2XG6A 3F53A 2WB1F 2M07A 1OSMA 2X27X 4RLCA 2Y0SC 1A0PA 1UPHA 3RBHA 2KJ8A 2G0AA 2RHFA 4OJPA 2N2LA 1A6SA 1F44A 2GH1A 2G09A 1HXTA 1PVPA 4FZLA 3NUQA 3AQFA 3GU3A 7PRNA 3CYMA 4P0QB 2XE5A 3ALRA 2KKVA 1KBUA 3N7RC 3SAHA 5GV0A 2XVTA 2HBLA 2HOQA 3LYSA 2FGRA 4QIWC 3HOEA 2Y0SF 4FT6A 4FESA 2W81C 3ICXA 3C29A 2ERVA 1PHOA 1ZHYA 3SAFA 1H6S1 1XO0A 3A2SX 3LK3B 3SQIA 4U7CA 4GCPA 3SMVA 2D6FC 5IYUA 2XI9A 4A8EA 3LVVA 1MM4A 1HXUA 4RLBA 4QQ1A 2XTRA 4C0ZA 2K89A 3KFUF 3GZFA 1PRNA 3VZTX 3WI5A 2K8BB 3F5EA 3EMNX 3DA4A 1BH3A 4P0PA 1P4TA 5PRNA 2ZFGA 3LK42 2N2MA 1ED1A 2J1NA 3N7PD 2K8CB 3SZVA 2LFUA 1BT9A 1GFPA 5DL7A 4ACOA 3MGVA 1D8BA 1QJ9A 8PRNA 2H3VA 4FZMA 4QNLA 3LK2B 1GFQA 3O0EA 2F76X 2KZ7B 4N59A 3F2CA 4AKRA 3K19A 1ORMA 3AA1B 2YB1A 1E54A 1MM5A 3POQA 1HXXA 3H0MB 4RJWA 4NLBA 3HKZC 3DEEA 1BXWA 2JMMA 4KRAA 3NSGA 3OPXA 3LK41 2H3IA 3VE1A 4FRXA 1THQA 2PMZF 5AFUK 2F8LA 4O3YA 3AAAB 3K1ZA 3PQUA 3SYBA 4LSIA 4O49A 2CPRA 3RFAA 4LSFA 2O4VA 4LSEA 4KR8A 2RRDA 2F1TA 2DGZA 4AYBF 3POUA 3HKZF 2G07A 2XTQA 2MHLA 1ECWA 2LHTA 4PUXA 4WJ3B 2XE1A 3FYXA 4CDGA 2ZIUA 4FZNA 3QRCA 4Z3TA 5D5DA 2ZIWA 2DQNB 4OO1J 4E1TA 3SZDA 4AYMC 2Y0HA 2KXPB 3VY8X 3AA6B 4XNKA 4BUGA 2LHFA 4G75A 4FMSA 2LYBA 3PSTA 3F2DA 2YB4A 3CRXA 2OH2A 5HR7A 2OYYA 5DL8A 1Q3VA 2PORA 3IG5A 2WAQC 3SYSA 3AAEA 1Q9GA 2K4IA 2KVCA 2MRLA 2K4EA 4GFJA 2VJ4A 3T79A 3HWBA 2ZLDA 2YNKA 3UU2A 3UAQA 4RJXA 3VC8A 5CRXA 1T94A 2MNHA 4GF4A 2HOFA 3QRAA 2RP5A 5KL1B 4QIWF 2WAQF 3CP8A 1ZHXA 3N7SC 2ZIVA 1YT3A 5JDPA 4ICAA 4FSPA 1L6NA 4B61A 2R18A 4GCSA 3D2SA 3M6KA 3IG8A 1XNSA 4F4BA 3ONNA 4OJ5A 2KJ5A 4O3WA 2FGQX 4BX9C 2E5SA 2ZIXA 3KVDD 4AYNA 2HOIA 4LSHA 3T0SA 5C0YA 1IIPA 2JMGA 2N1RA 3AA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N59 A;  4G75 A;  2XTQ A;  4FZL A;  2XTR A;  3DA3 A;  4FZN A;  3DA4 A;  4FZM A;  4G76 A;  2XMX A;  4N58 A; 
#chains in the Genus database with same CATH topology
 1NK4 A;  1COO A;  2MUT A;  2OMF A;  1RM6 C;  2AXT O;  4ED6 A;  1H38 A;  2ZXH A;  5KL8 B;  5BPC A;  1X9S A;  3HT3 A;  4PH5 A;  5J0P A;  2Y7S A;  3VZW X;  1COK A;  4B9N A;  3RBE A;  4F92 B;  3JPS A;  2KZM A;  4M04 A;  4EEL A;  2A1J A;  2XID A;  4AKR B;  4I2G A;  2HMX A;  2KFZ A;  1QSY A;  2W03 A;  2WTF A;  2AU0 A;  3DZM A;  2YX8 A;  5EWG A;  4PHE A;  1J2M A;  2LKY A;  2YMP A;  3V72 A;  3L3F X;  1T7P A;  4CCH A;  1ZQP A;  2JXJ A;  3UPQ A;  2ODJ A;  1N5X A;  1SV0 C;  4DEZ A;  1NK5 A;  2ASJ A;  3RH6 A;  4FE3 A;  3PW2 A;  3GV8 B;  2XY5 A;  4EYH B;  3V7L A;  5J8Y A;  3H0L B;  2KZZ A;  3TFS A;  1KW4 A;  2DKZ A;  1TK0 A;  2R8H A;  4EX7 A;  3EUB 2;  3PW5 A;  2WJR A;  4UB6 U;  3V8U A;  3L4P A;  4KLJ A;  5EE3 A;  3KZI O;  2XIC A;  2OXO A;  1Q9F A;  3HOL A;  5AHX A;  3E0F A;  7ICV A;  4ED1 A;  3NTU A;  2KIV A;  2F77 X;  4AKM A;  2JGA A;  2E3T A;  1RZT A;  3TAN A;  2LMR A;  2AGO A;  5G3A A;  4FBU A;  4YMO A;  4C8K A;  2KIW A;  3ISB A;  2Y1I A;  4F50 A;  3BS5 A;  1N2X A;  4DSF A;  3PQS A;  3RJE A;  2M0N A;  3WKE A;  3A0H U;  3TAD C;  4M9G A;  2LYA A;  4KLQ A;  1QQ6 A;  2H3Q A;  1Q3U A;  4QWD A;  2ZG6 A;  3N97 B;  4YFK A;  2GOL A;  1V97 A;  4ED3 A;  1T1L A;  2JH1 A;  3IN5 A;  1KFT A;  4GLX A;  4TUS A;  5KFI A;  4DQS A;  4D64 A;  3C23 A;  3PSP A;  2IA6 A;  3AQE A;  2AQ4 A;  3KOO A;  2ZJ8 A;  5DKW A;  5AKH A;  5TZV A;  1ZQT A;  3PR4 A;  2NRZ A;  7ICU A;  4DFJ A;  2QB0 A;  8ICO A;  2KOB A;  1KTQ A;  4QW9 A;  2VAN A;  2UVV A;  4EX6 A;  1MN8 A;  4BJQ A;  3H4B A;  3BQ7 A;  1KQQ A;  4O3X B;  2F8K A;  7ICG A;  4GXK A;  7ICL A;  5KFG A;  3H7I A;  1BPZ A;  4DFK A;  2A1A A;  2XC9 A;  1SWV A;  3PW7 A;  4CF5 A;  1F0M A;  4XUS A;  4J9R A;  1TK8 A;  4USA A;  1JAL A;  3PSF A;  4J9N A;  2YPV A;  4QZA A;  3AAA A;  4OJL A;  4RQ0 A;  3U26 A;  3N28 A;  3QUQ A;  2C28 A;  4BUM X;  4AYB C;  4AFK A;  5DDY A;  4YR3 A;  4GC6 A;  4O4X A;  7ICE A;  4C4V B;  4F2S A;  5ALL A;  1TKD A;  1IZN B;  4D5U A;  4KR4 A;  3B9J A;  1XSL A;  2YQE A;  5TIS O;  3PX6 A;  3SY7 A;  1T16 A;  5ALZ A;  4K4I A;  4O3S A;  1B0X A;  2KIC A;  2XGQ A;  4X5V A;  2HVI A;  1N56 A;  1A77 A;  2KE7 A;  4B9M A;  4KMU A;  4DQQ A;  1RG6 A;  2AQ0 A;  4RT3 A;  1Z4O A;  2M06 A;  3C28 A;  3POX A;  2KHQ A;  5L1M A;  4FO6 A;  3T20 A;  5GTH U;  4RU9 A;  4AUI A;  3NVZ A;  2KSO B;  1ZQN A;  2M07 A;  5ALN A;  5J2D A;  1ZD5 A;  4F91 B;  5J8Y C;  4QZF A;  2KJ8 A;  2LPE A;  5KFN A;  1U49 A;  2RHF A;  1NK7 A;  1NKC A;  2FLL A;  3OSP A;  1F44 A;  1A6S A;  5KFZ A;  4IR1 A;  1HXT A;  5KFM A;  4ECV A;  4JWN A;  2QAR B;  3NUQ A;  3M9O B;  2WF7 A;  3KHR A;  5KFX A;  5D49 A;  3CYM A;  4P0Q B;  2XE5 A;  3ALR A;  2KKV A;  3K1R B;  4MF8 A;  3LYS A;  1T3N A;  5AKG A;  4ECR A;  1LB2 B;  4C80 A;  4QIW C;  4MEY A;  4C4T A;  1X2I A;  4NM1 A;  5G38 A;  3E2E A;  3ICX A;  1WG8 A;  3G6V A;  4J9S A;  1ZHY A;  4F4Z A;  1H6S 1;  3PX4 A;  3LK3 B;  1ZQC A;  3SQI A;  1VDV A;  2KFN A;  5KAF O;  4RPX A;  5IYU A;  9ICU A;  4A8E A;  5J0W A;  3LVV A;  4BXO A;  1B22 A;  3B0X A;  5B66 U;  4F5N A;  4QQ1 A;  4M9H A;  3ORY A;  3ED5 A;  4KN7 A;  2HI0 A;  4KLI A;  3NVY A;  4PZN A;  3MGI A;  2K8B B;  3F5E A;  4G9B A;  4AP9 A;  2LI6 A;  4NY8 A;  1ZQV A;  4FFD A;  1HUZ A;  2PI4 A;  4KTQ A;  1X9W A;  1NJX A;  5HMM A;  3TKA A;  2LM1 A;  2N2M A;  1ED1 A;  4Z6D A;  2J1N A;  3SZV A;  2AH5 A;  2LFU A;  1GFP A;  3G6Y A;  4DOB A;  1KL9 A;  3PO4 A;  2E8N A;  4J9Q A;  1BNP A;  1BPE A;  3SI8 A;  1NNL A;  3MGV A;  1TAQ A;  2UVR A;  2H3V A;  4QNL A;  2F76 X;  3Q8S B;  4N59 A;  3F2C A;  4RT2 A;  5KFT A;  4ED8 A;  3OSN A;  4IL6 U;  3AA1 B;  4IQW A;  3POQ A;  5J0T A;  1HXX A;  1XWL A;  5CJ7 A;  5JRT A;  4TUR A;  2HCF A;  2B6G A;  4MF2 A;  5KFO A;  4CTD A;  1RYS A;  2ZTE A;  3DDH A;  1DXS A;  4NLG A;  4JV2 A;  3A0B O;  3QE9 Y;  2H3I A;  4FRX A;  4F3O A;  2PMZ F;  3MDC A;  5DLF A;  5AFU K;  4ED7 A;  4I2I A;  1L3S A;  4ZH4 A;  3K1Z A;  5KFH A;  1O03 A;  3PQU A;  4UB8 U;  1ZQW A;  4O49 A;  4RQ7 A;  5DLG A;  1X9M A;  8ICK A;  7ICF A;  7ICQ A;  2O4V A;  4KR8 A;  2DGZ A;  3QEA Z;  5KFD A;  5KG2 A;  2G07 A;  2XTQ A;  1X9X A;  1XU4 A;  4KLE A;  5DDM A;  2ZIU A;  5CP2 A;  3QRC A;  1XO1 A;  1U47 A;  4DL4 A;  4N74 A;  5AM4 A;  2BCV A;  1V38 A;  3SV3 A;  4E1T A;  4YD2 A;  2Y0H A;  2KXP B;  3VY8 X;  3MR5 A;  2W9A A;  3IV6 A;  4Y2Y A;  2XY6 A;  4C8O A;  1WCN A;  3PVX A;  4F4Y A;  4LZD A;  2OH2 A;  9ICJ A;  5HR7 A;  1OXJ A;  5ALO A;  4IQU A;  3MBY A;  4DL2 A;  5DG9 A;  5ALR A;  1NK9 A;  3SYS A;  2K4I A;  2KVC A;  5J2H A;  2MRL A;  2K4E A;  3NGD A;  2XGP A;  5J2C A;  1CEZ A;  1TFR A;  1S10 A;  8ICB A;  4EEY A;  3UAQ A;  3GV7 B;  5CRX A;  4KIT B;  4ELT A;  2Y9U A;  4QWA A;  4J9K A;  2RP5 A;  4ELV A;  5KL1 B;  5CWR A;  2W9C B;  1DGJ A;  2WAQ F;  1N48 A;  2MAX A;  3V6H A;  5KT3 A;  4B9U A;  5ALW A;  4B6J A;  2R89 A;  5DBC A;  5J2B A;  1YT3 A;  5KG6 A;  5ALJ A;  3JCU O;  3PW0 A;  9ICX A;  5L1L A;  4FSP A;  1L6N A;  4C4S A;  4B61 A;  4GCS A;  2WJQ A;  3L5K A;  4KLF A;  3UQ0 A;  2FGQ X;  5H2F O;  1QQ7 A;  4O3P A;  2BPG A;  5E79 O;  4JUZ A;  8ICV A;  4LSH A;  5C0Y A;  4UB1 A;  3OJS A;  2AXT U;  4F2R A;  3HPO A;  4YXM A;  5HHI A;  3AA7 A;  3FC4 A;  4UW9 A;  9ICV A;  4M47 A;  4Q44 A;  5KG1 A;  3JPO A;  1NKB A;  4FUV A;  1S0O A;  1ZQQ A;  5A0L A;  2BPC A;  2OEH A;  2A3V A;  1WYG A;  9ICS A;  3WI4 A;  1YZ7 A;  4I27 A;  3PMN A;  2KK0 A;  2W8K A;  3PSI A;  2W7P A;  9ICP A;  5ALH A;  4GHB A;  3ZDB A;  2MA1 A;  4O3Z A;  3H4D A;  7ICT A;  1QSL A;  1S0N A;  3FM9 A;  1L3T A;  1URJ A;  5D4B A;  1L5U A;  2WB1 C;  2E1F A;  1SXD A;  2ZUD A;  2OHF A;  5DQG A;  2R8A A;  4PL2 A;  4FBT A;  2K4H A;  3H40 A;  2RDI A;  5AKJ A;  4O3N A;  5F9N A;  4PGQ A;  1VLB A;  1ZQO A;  1D8L A;  2ZXI A;  2W9B A;  2Y0L A;  3EW9 A;  2I1Q A;  4KX5 A;  4IC9 A;  1HUO A;  4QJF B;  3VZU X;  8ICL A;  9ICK A;  5EE1 A;  3DWO X;  1ZQS A;  2FLP A;  5FVN A;  4PJ0 O;  9ICA A;  3O0F A;  1Z00 A;  2IOH A;  9ICR A;  5KFQ A;  1S0M A;  4ELU A;  3J81 j;  4O3Q A;  4F5P A;  5EWF A;  3SAG A;  4R64 A;  2E8M A;  1JIH A;  4J9P A;  1IV8 A;  3IM1 A;  5ADX K;  1K1S A;  1NJW A;  1MC8 A;  2K4P A;  4NJ8 A;  1PZN A;  3MAB A;  4DL3 A;  4R8U A;  1Z1V A;  4DF4 A;  1MSW D;  4KX3 A;  3C2M A;  8ICS A;  2GE4 A;  4C7Y A;  3SV4 A;  1HEK A;  3CNH A;  5KG5 A;  5J2F A;  3ZI4 A;  4PL1 A;  3RF9 A;  5DBB A;  4F5Q A;  2BQU A;  4Q43 A;  1VJ5 A;  3M9N B;  1SZP A;  3LK2 A;  4R65 A;  1B43 A;  5CEH A;  3SY9 A;  1X40 A;  2DF4 B;  5BOL A;  1SV4 A;  2VIX A;  1JX4 A;  4KLG A;  5C5J A;  1N60 A;  1PVR A;  4KLL A;  4G3I A;  3JPT A;  3D6J A;  1UT5 A;  1GFN A;  3GP6 A;  1ZQJ A;  1NKE A;  2ZIV B;  3RJJ A;  2DWQ A;  2F1J A;  2KDY A;  9ICM A;  5B5E U;  5ALD A;  4Z6E A;  5J2I A;  2PFP A;  1S76 D;  2I9G A;  4ECT A;  2XMX A;  4FSO A;  9ICT A;  3AU6 A;  4OCZ A;  2ZIX B;  4KLU A;  5EE2 A;  4O3M A;  5HR6 A;  7ICH A;  2Q0Z X;  1B4F A;  2F1H A;  1UA0 A;  1ARO P;  5AI0 A;  4I28 A;  4YMM A;  5KFE A;  2FLN A;  4JV1 A;  3EWA A;  5AM2 A;  5JUM A;  3HWT A;  2JH7 A;  4IQV A;  4JFB A;  5TIS U;  1FEZ A;  4MFA A;  2QTK A;  4I2E A;  4R63 A;  5AFU L;  4Y2J A;  1ZQG A;  4Q8E A;  4U6P A;  1KRP A;  3AA0 B;  4QZE A;  2KJ9 A;  1ZRM A;  4C00 A;  5EE9 A;  2A19 A;  1NK8 A;  4XA5 A;  2HBM A;  4KLO A;  5KFK A;  4TQR A;  1SB3 C;  2F1C X;  5J0Y A;  4AZL A;  4FRT A;  5KFL A;  2XG6 A;  1ZQR A;  3QUT A;  4OJP A;  2N2L A;  5G5G A;  2W8L A;  5JTI A;  4FZL A;  4RUC A;  5L1J A;  3GU3 A;  3MR3 A;  7PRN A;  2RDJ A;  1T8E A;  3BZK A;  4YQW A;  3RB6 A;  1KBU A;  1XS9 D;  3PML A;  5DB6 A;  1T4G A;  4UAV A;  4LZG A;  4UAT A;  5AKE A;  2DUY A;  5IIL A;  3NJT A;  1PK1 A;  5KAF U;  2YN4 A;  3V6J A;  3QUB A;  1PHO A;  1RYR A;  1XO0 A;  3I28 A;  4RQ2 A;  4GCP A;  3SMV A;  3RH5 A;  2M9N A;  4QWE A;  1LKY B;  2XI9 A;  2O6K A;  3C1Z A;  1TE2 A;  4YD1 A;  5GTI U;  7ICP A;  4RLB A;  5KT7 A;  1FO4 A;  5ALI A;  4C8L A;  3I1Y A;  4Y2P A;  4DLG A;  2K89 A;  3Q8L A;  4DLE A;  2FDR A;  3VZT X;  3WU2 U;  1ZQY A;  3SR6 A;  1ZD4 A;  3EMN X;  1ZQM A;  4QZI A;  1UCV A;  1Q8K A;  5PRN A;  3LWM A;  3T5J A;  4ECZ A;  3N7P D;  1U45 A;  4EEN A;  4F93 B;  1BT9 A;  3THV A;  3PNC A;  1KFS A;  5DL7 A;  3B0Y A;  1U48 A;  1QQ5 A;  2R4N A;  4R66 A;  1D8B A;  1NOM A;  1GFQ A;  2EZY A;  2KZ7 B;  4AKR A;  5DQH A;  4NL9 A;  4M9L A;  2HHX A;  4RQ3 A;  5III A;  1KKX A;  5ALY A;  1E54 A;  1MM5 A;  3MGH A;  4F4X A;  3HIL A;  2JEG A;  3HKZ C;  3KBB A;  9ICG A;  4ECY A;  2JMM A;  4KRA A;  4YN4 A;  1YZ6 A;  2C2D A;  5AK3 A;  1TK5 A;  3BQ2 A;  4RQ4 A;  1TAU A;  2PKE A;  4Y2V A;  4O3Y A;  4QZ8 A;  1LVH A;  4YXJ A;  2RLT A;  3NAS A;  3M8R A;  4EYI B;  5AK4 A;  4LSE A;  3WKC A;  3TAQ A;  1S5L U;  3PW4 A;  5J2G A;  3KHL A;  5HNK A;  4DCC A;  4CDG A;  2EAN A;  4FZN A;  1V9P A;  4Z3T A;  9ICB A;  5D5D A;  1ZQE A;  9ICI A;  3BRY A;  3SZD A;  4AYM C;  4GIB A;  3AA6 B;  4C8M A;  3C21 A;  4FMS A;  3PR5 B;  1WWV A;  3FDS A;  2GO7 A;  2IWV A;  4DOA A;  4P2H A;  3AEV A;  4NLN A;  4DL7 A;  1Q3V A;  4UB6 O;  4UAW A;  2GWS A;  2JV3 A;  3IG5 A;  4RQ8 A;  3JPP A;  3Q8M A;  1XSP A;  4QZD A;  3I76 A;  4ECU A;  5G39 A;  2ODG A;  1Q9G A;  4O3R A;  2D3D A;  2NO4 A;  2C2E A;  3UM9 A;  4NM2 A;  3QU4 A;  5DGA A;  2ZUB A;  4F4K A;  2CXY A;  4QZC A;  4GFJ A;  2AGQ A;  3T79 A;  1KFD A;  4PHD A;  4RQM A;  2ZLD A;  5KT4 A;  4RQ1 A;  5IIM A;  4I2D A;  3UU2 A;  1ZQL A;  1SKW A;  1RDF A;  4QWC A;  1X42 A;  2PFQ A;  1X66 A;  3MDA A;  3MR2 A;  3RRG A;  3CP8 A;  1CI4 A;  4YP3 A;  1TVA A;  3E58 A;  2WF8 A;  1ZQF A;  3V6K A;  3AM9 A;  5AM0 A;  2XY7 A;  5E79 U;  3Q8P B;  1XNS A;  2W54 A;  1ZQX A;  2E5S A;  5J0R A;  3TI0 A;  3BRZ A;  5AI8 A;  4AYN A;  1NJZ A;  2PFN A;  2YY6 A;  1IIP A;  4J9O A;  2JMG A;  4RQN A;  2N1R A;  4P0P B;  2PRN A;  5CHG A;  1ZD2 P;  3RBD A;  1IXR A;  2W3S A;  4C4V A;  4M0A A;  4LVS A;  1IZN A;  1MPF A;  4YCX A;  1ZHW A;  1U9L A;  2R8G A;  1CUK A;  2HVH A;  4MFC A;  5KAI U;  4KLS A;  4J03 A;  1BPX A;  3NRW A;  1SWW A;  1QJP A;  4RZR A;  1X6J A;  2FMP A;  8ICU A;  4NL9 C;  2ZUC A;  5HP4 A;  3G7G A;  4C4R A;  3D2N A;  1MA7 A;  4QW8 A;  1GFO A;  1SZH A;  3K75 D;  2JR5 A;  4I2B A;  3F5A A;  2DBY A;  7ICM A;  1KDH A;  5AI6 A;  3BQ0 A;  1ZJN A;  4UBC A;  3SZ2 A;  2P6U A;  4O4U A;  1QJ8 A;  3ETL A;  2KSO A;  6PRN A;  4F4W A;  5J2E A;  1XC9 A;  2IBK A;  3JTY A;  4Q45 A;  1L7M A;  4YMN A;  1L8O A;  3WK7 A;  5KFR A;  5AM1 A;  3Q8Q B;  3TZG A;  9ICL A;  3T24 A;  2QAR A;  3WK5 A;  2NRV A;  4PPX A;  4B9V A;  5KG7 A;  3TFR A;  4P0Q A;  1SKR A;  3GV5 B;  3F2B A;  3C5G A;  3NVW A;  3DA3 A;  5KFS A;  4Z6C A;  5G26 A;  5DL6 A;  1PUZ A;  2IHN A;  2VKQ A;  3M7D A;  4M9J A;  4ED2 A;  1L8L A;  4PHA A;  4JCH A;  3TAC B;  3PV8 A;  2JEI A;  1D8Y A;  1DOQ A;  8ICH A;  4N58 A;  2ZIW B;  2BZF A;  1GFM A;  5L1K A;  4GXI A;  4NLC A;  3RJH A;  5ALQ A;  4M6W B;  4UAS A;  4KLH A;  3WKB A;  4UAR A;  1C7Y A;  3LK3 A;  5KT2 A;  3V7J A;  5DB9 A;  5KFA A;  3ZDC A;  4B9L A;  2KVS A;  2HW3 A;  4AYE C;  1KN5 A;  1RXW A;  3SD7 A;  1BVS A;  2DKX A;  2BDU A;  4RQ5 A;  2JZB B;  4JK1 A;  4LJX A;  7ICN A;  2FPL A;  1OPF A;  2F1I A;  3LVW A;  3PX0 A;  4B9T A;  2J4U P;  1PVQ A;  3AAE B;  3KHG A;  3HW8 A;  3LWL A;  1BNO A;  1UA1 A;  4DS5 A;  2H3F A;  4JWM A;  2G5I B;  1ZRN A;  2XE2 A;  3KKA A;  1G90 A;  1UT8 A;  9ICH A;  7ICS A;  5AKL A;  4NLK A;  3JPQ A;  2NRW A;  2EAM A;  2F1V A;  4FQE A;  2YMQ A;  1FIQ A;  5B66 O;  9ICE A;  4JMU A;  3AA1 A;  2KHV A;  2HBJ A;  3H0R B;  1L7P A;  5F3X B;  4OJ6 A;  2G06 A;  5KFU A;  4EBE A;  2NV3 A;  3M6Z A;  2PMZ C;  3D2Q A;  1NJY A;  2F2A B;  2QLT A;  4NV0 A;  3HX0 A;  3VY9 X;  9ICQ A;  2EZZ A;  5KTQ A;  1NI3 A;  2BCS A;  4DFM A;  3WK9 A;  4PHP A;  3M8S A;  2EDU A;  4O3O A;  4KN4 A;  4K3C A;  4TQS A;  1KEJ A;  2MUT B;  3RJK A;  2LM4 A;  4KLT A;  3IP4 B;  1S0V A;  4RL9 A;  2WF6 A;  3PRN A;  2P66 A;  1Z19 A;  1TAM A;  2KD1 A;  4F5O A;  5J29 A;  5HHH A;  9ICN A;  2ESE A;  2A1J B;  2KXP A;  1FFV A;  2H3Z A;  4IR9 A;  5T5F A;  1X6I A;  4F5R A;  4OJO A;  4UAY A;  1N5W A;  4UB8 O;  2WHE A;  4GC7 A;  2CN1 A;  3KZI U;  3PZP A;  3FAH A;  2VA3 A;  3VCB A;  1C20 A;  5EWE A;  2D8C A;  3MR6 A;  2G08 A;  4AYI D;  1GO3 F;  4CE6 A;  2ISP A;  4IRK A;  3BDP A;  2KEY A;  3PGR A;  2BQR A;  3RJF A;  3WK8 A;  4RLC A;  2Y0S C;  1A0P A;  1UPH A;  3KHH A;  3RBH A;  2G0A A;  4KLM A;  1QSS A;  2F44 A;  3RR7 A;  2G09 A;  1PVP A;  2MSN A;  1RQN A;  4RPZ A;  5AKK A;  2R8K A;  3AQF A;  3BS7 A;  4I2C A;  5DG8 A;  2PXI A;  2HHV A;  5GV0 A;  5AI5 A;  2PFO A;  2HBL A;  2IWW A;  5AK5 A;  2FGR A;  4DQI A;  1IG6 A;  2QKQ A;  4UB3 A;  3HOE A;  2HSZ A;  4Y2Q A;  2W9C A;  1BPY A;  3HP6 A;  2W81 C;  1ZOL A;  4Y2U A;  4YVZ A;  1WCL A;  3HRD D;  2ISO A;  8ICW A;  3RR8 A;  2GLE A;  1ZD3 A;  5KG4 A;  5IIK A;  5DBA A;  4Z6F A;  2D6F C;  3BS5 B;  5D46 A;  5KFV A;  4DSJ A;  5KFY A;  3QYP A;  2Y1J A;  2I6X A;  4NLZ A;  2OCE A;  3GQC A;  3KFU F;  4F72 A;  3GZF A;  1JN3 A;  2E8P A;  3DA4 A;  3JPN A;  4ECS A;  4O5E A;  2H5X A;  4P4M A;  5KFB A;  3K4G A;  3QZ8 A;  3KKA C;  3JPR A;  3KTQ A;  3WK4 A;  1ZQK A;  4YG2 A;  2C2R A;  2FPK A;  1OW5 A;  1QJ9 A;  8PRN A;  3IHQ B;  4FZM A;  2HHQ A;  1NK6 A;  3O0E A;  1SXE A;  2QB0 B;  5DB8 A;  2NO5 A;  2W11 A;  3OHB A;  2WF5 A;  5ALX A;  3RB3 A;  4EZ6 A;  3K19 A;  1ORM A;  2YB1 A;  3C2L A;  4QZB A;  1L3V A;  5F9L A;  4NLB A;  5DGB A;  4ZOH C;  3DEE A;  1BXW A;  3QXG A;  1DK3 A;  3Q8K A;  2IMW P;  4N75 A;  3OPX A;  1JXL A;  3LK4 1;  2R8J A;  1THQ A;  3AAA B;  3RAQ A;  2L5Y A;  3H8W A;  4DSI A;  1J97 A;  5G5H A;  4LSI A;  3RFA A;  2RRD A;  3T5L A;  1RXV A;  4MEX A;  4AYB F;  3HKZ F;  1ECW A;  2LHT A;  3FYH A;  4EBD A;  4P4P A;  3MFI A;  1ZQB A;  1S9F A;  4DS4 A;  8ICM A;  4F71 A;  1LV5 A;  3M9M B;  1UQV A;  2ATL A;  5AKI A;  2W43 A;  2DQN B;  1ZET A;  1JXE A;  4G75 A;  3V7K A;  2ALZ A;  4TUQ A;  3UMC A;  2KN7 A;  2LYB A;  1S8O A;  2ZJ5 A;  1T3Q A;  1SL1 A;  4E0D A;  2ZTD A;  3BJY A;  2OYY A;  5DL8 A;  2HHW A;  9ICC A;  2R8I A;  3WK6 A;  1XSN A;  4J9M A;  1BPB A;  4O9M A;  7ICO A;  4RPY A;  3BQT A;  7ICK A;  3SEN A;  1HJP A;  3MFH A;  9ICF A;  5DG7 A;  3WKD A;  3UXP A;  2RQ5 A;  5JU5 A;  3PGS A;  3ZD9 A;  3BQ1 A;  4GF4 A;  3QU5 A;  3QRA A;  4CNQ A;  4QIW F;  4QZ9 A;  5EE0 A;  3GDX A;  4DOC A;  4DFP A;  8ICZ A;  3N7S C;  2UVW A;  2ZIV A;  2HDO A;  1S97 A;  3UMB A;  3GIL A;  2V9W A;  1ZQI A;  2YTU A;  2R18 A;  4O0I A;  4HYK A;  3OHA A;  4EEK A;  1K5O A;  3M6K A;  4BXO B;  3SEI A;  2J6T A;  2KJ5 A;  3H8S A;  2ZIX A;  2QB1 A;  3RB4 A;  2WFA A;  4CF3 A;  3T0S A;  5KT6 A;  5KT5 A;  3A2S X;  4DFD A;  8ICA A;  4KLD A;  1HIW A;  4TUP A;  1TV9 A;  4M2Y A;  5ALT A;  3OGU A;  4K4G A;  5IIN A;  1UHU A;  3A0B U;  4NWI A;  2BQ3 A;  5KG0 A;  4J9L A;  2DPI A;  3UXN A;  5B5E O;  5AM3 A;  4M9N A;  3AA0 A;  4KMO B;  2JEJ A;  5IIO A;  1K1Q A;  2B21 A;  1SL0 A;  3VE2 A;  1N62 A;  1M6Y A;  1N63 A;  2E1E A;  1Z4N A;  8ICE A;  2W9M A;  5AIA A;  1NZP A;  4DL6 A;  2ES6 A;  3AL0 B;  1BGX T;  2P6R A;  3H8J A;  1Z1B A;  3AUO A;  1KLN A;  5AIB A;  2BGW A;  3KZX A;  2Y2X A;  1NZB A;  3M1Y A;  1N61 A;  4ED0 A;  1ZHT A;  2XO7 A;  5L9X A;  4CGZ A;  4ECW A;  1J2N A;  2AHO B;  2IOF A;  2KTQ A;  8ICJ A;  2V4Q A;  4CRX A;  3C5F A;  2Y9T A;  2VA2 A;  4QZG A;  5KG3 A;  3TAR A;  2XCA A;  1Q46 A;  2OWO A;  5KFC A;  5HML A;  5T14 A;  3AU2 A;  1FFU A;  8ICC A;  1D9D A;  3AMZ A;  3RB0 A;  4C8N A;  3TAP A;  4IRD A;  2ZIU B;  2PI5 A;  2ASL A;  4I2J A;  2K8A A;  1SGG A;  2X9K A;  4US9 A;  4HAI A;  3RJG A;  4QZH A;  5KFF A;  4UBB A;  3PF1 A;  2HBK A;  4BDP A;  2R88 A;  3GIK A;  5AM5 A;  3QNM A;  3T3F A;  2FPM A;  4AYD C;  2KMD A;  1LKY A;  3LDA A;  4IS7 A;  4RNN A;  5ADX L;  5IIJ A;  5AKX A;  2K0L A;  8ICY A;  8ICN A;  9ICW A;  2EAP A;  2K60 A;  4RNO A;  4DF8 A;  2BPF A;  4DWI A;  4GCQ A;  2C22 A;  3A0H O;  4G76 A;  5AKZ A;  4PZO A;  4FOZ A;  4C69 X;  4EZ9 A;  2JHD A;  1WUD A;  1QLN A;  1PK3 A;  1RPL A;  3RH4 A;  1EXN A;  4JV0 A;  5H2F U;  5J0S A;  5J2A A;  4C7Z A;  4Y2R A;  4EBC A;  3T5K A;  3C5O A;  4IRC A;  3GIM A;  2LBO A;  1CRX A;  2OM6 A;  4UQG A;  3CW2 C;  1DRG A;  1QCK A;  2KZ7 A;  5GTI O;  3QU9 A;  3C2K A;  2KKP A;  3ZDD A;  3UQ2 A;  2KV2 A;  4DQR A;  2Z7J A;  5ALV A;  1U4B A;  4DSL A;  2CRX A;  3PO5 A;  3ISC A;  3G6X A;  3WU2 O;  3UMG A;  4YR0 A;  2BCR A;  1AQ6 A;  3ZDE A;  4E1S A;  4I29 A;  5KFJ A;  4Y2X A;  5ALG A;  2FMQ A;  3EZ5 A;  2DFL A;  1SIJ A;  4XNL A;  2DPJ A;  3NRZ A;  2XE3 A;  1ZQH A;  1QH9 A;  5KFW A;  2BR0 A;  5AKY A;  4QWB A;  5KFP A;  2BCU A;  2KNJ A;  8ICG A;  5DL5 A;  3SYZ A;  3HW9 A;  4DQP A;  2YMM A;  1MQ3 A;  2G5H B;  2W80 C;  3UPG A;  1P7D A;  2F3N A;  4UB2 A;  2W04 A;  4BWM A;  4DSE A;  3AA7 B;  4MHV A;  3EPI A;  4I2A A;  4RNM A;  1SKS A;  2W55 A;  2WF9 A;  1JUD A;  3POR A;  2Y0K A;  8ICR A;  2Q4T A;  8ICP A;  1OUQ A;  5AK6 A;  1ZQD A;  2W3R A;  4D65 A;  1RQL A;  3QX7 A;  4IQT A;  1ZQU A;  3HJE A;  4PGY A;  3AA6 A;  1YS5 A;  2W7O A;  2FE9 A;  5ALK A;  4B9S A;  3PY8 A;  1ZHZ A;  2VJ5 A;  4BWJ A;  3EPG A;  4U9C A;  3LK9 A;  2KC0 A;  1SL2 A;  3WKA A;  2DL0 A;  2V4R A;  3UXO A;  3QZ7 A;  2XCP A;  2NRT A;  1S5L O;  1ZQ1 C;  4DL5 A;  2K4T A;  3ZDA A;  4PJ0 U;  3R9K A;  3F53 A;  2WB1 F;  2AJQ A;  1OSM A;  2X27 X;  3QU2 A;  4CF4 A;  1S77 D;  5J0U A;  5GTH O;  1ZQA A;  2YML A;  2GH1 A;  4GXJ A;  2NYV A;  2FI1 A;  4O5C A;  2W9B B;  4UAU A;  1ZJM A;  3GFK B;  2JEF A;  3N7R C;  3SAH A;  3QEB Z;  2XVT A;  5DQI A;  4DO9 A;  2UVU A;  2BKE A;  5KNI A;  1MQ2 A;  2HOQ A;  4XRH A;  8ICX A;  1Y88 A;  2Y0S F;  4FT6 A;  2EH9 A;  2ZTC A;  5J0Q A;  4FES A;  5CB1 A;  3DWN A;  1DK2 A;  5ALE A;  2LYH A;  3C29 A;  2BHN A;  2AGP A;  1L7O A;  3Q8R B;  2ERV A;  2WVP A;  3SAF A;  1Z00 B;  8ICI A;  3T5H A;  1RYU A;  4U7C A;  2I5H A;  2ASD A;  3RJI A;  1MM4 A;  3RAX A;  1HXU A;  1O08 A;  2VA8 A;  4DSK A;  4MFF A;  7ICJ A;  2HHT A;  3QU7 A;  2XTR A;  4C0Z A;  4K4H A;  3NVV A;  1PRN A;  3WI5 A;  2KG5 A;  4R8U B;  4FS1 A;  3KD3 A;  2IOF K;  4JB3 A;  2JQY A;  5ALS A;  4P0P A;  1BH3 A;  2KP7 A;  3GIJ A;  1P4T A;  4XQ8 A;  2ZFG A;  3LK4 2;  2K8C B;  2ZJA A;  2BCQ A;  4Y2T A;  2R4L A;  5J0X A;  4ACO A;  1ZYQ A;  2JRZ A;  4UAZ A;  1WWU A;  3IDW A;  3LK2 B;  8ICQ A;  3QUC A;  2IHM A;  1L7N A;  3H0M B;  4RJW A;  2NRX A;  3OTQ A;  2J6S A;  3ISD A;  7ICR A;  4PGX A;  4IL6 O;  5L1I A;  3NS1 A;  3NSG A;  1V85 A;  4OD0 A;  5ALM A;  4RQ6 A;  3VE1 A;  1SV0 A;  2F8L A;  5KAI O;  4ECX A;  4I2H A;  3GII A;  3SYB A;  2CPR A;  2R4P A;  1DGS A;  1BPD A;  1D9F A;  4O5K A;  4LSF A;  3OJU A;  2F1T A;  2KZ3 A;  4NXZ A;  2EQY A;  3POU A;  1L3U A;  1JMS A;  1QTM A;  2MHL A;  4PUX A;  4WJ3 B;  2XE1 A;  3FYX A;  3PGU A;  5DB7 A;  9ICO A;  4UB4 A;  5AI9 A;  5J2K A;  4BGD A;  2ZIW A;  4M6W A;  4OO1 J;  2EZX A;  1JRP A;  3TQ1 A;  1ZXI A;  1JRO A;  4XNK A;  4BUG A;  2LHF A;  5ALU A;  8ICF A;  8ICT A;  4Q8F A;  5AI4 A;  3PST A;  3F2D A;  1IM4 A;  2YB4 A;  5ALP A;  3EYZ A;  3CRX A;  3ZD8 A;  2R4O A;  5J0O A;  1NK0 A;  2JZB A;  1ZQZ A;  2J6U A;  2POR A;  5BOM A;  3TAD A;  5K4L A;  2WAQ C;  3N4M B;  3C1Y A;  3BS0 A;  3AAE A;  2MU2 A;  3H8M A;  5ALF A;  4F8R A;  1Z3E B;  2P35 A;  3RRH A;  2FMS A;  2VJ4 A;  1F5S A;  4PR7 A;  3HWB A;  2FJ6 A;  2E8O A;  2YNK A;  4UB5 A;  2BDP A;  4RJX A;  3VC8 A;  3MC1 A;  1T94 A;  4Y2S A;  2MNH A;  2HHU A;  2HOF A;  4RUA A;  3BZC A;  4ECQ A;  3ETR A;  1JI7 A;  1ZHX A;  2B0C A;  7ICI A;  5J2J A;  5CR0 A;  5AIC A;  4K3B A;  1PK1 B;  4I2F A;  5JDP A;  4ICA A;  1KSP A;  3AN1 A;  3IRU A;  3D2S A;  4F4B A;  3IG8 A;  5CA7 A;  3ONN A;  4OJ5 A;  3RTV A;  3DV9 A;  4O3W A;  2EAO A;  4BX9 C;  4YR2 A;  3KVD D;  3S6J A;  4P4O A;  2HOI A;  2HHS A;  5FP0 A;  4US8 A;  5EOZ A;  1A76 A;  4FS2 A; 
#chains in the Genus database with same CATH homology
 4P0P B;  2PRN A;  2OMF A;  1HIW A;  2ZXH A;  5KL8 B;  4FUV A;  4NWI A;  1IZN A;  1MPF A;  1ZHW A;  5A0L A;  2A3V A;  2Y7S A;  3VZW X;  3WI4 A;  3NRW A;  1QJP A;  3AA0 A;  4KMO B;  3VE2 A;  3G7G A;  2XID A;  4AKR B;  3D2N A;  3PSI A;  2W7P A;  2HMX A;  1MA7 A;  2E1E A;  1GFO A;  1SZH A;  4GHB A;  2W03 A;  3F5A A;  2YX8 A;  2MA1 A;  2LKY A;  3AL0 B;  4O3Z A;  3L3F X;  1URJ A;  1Z1B A;  4O4U A;  2WB1 C;  1QJ8 A;  2E1F A;  2ODJ A;  6PRN A;  3KZX A;  2Y2X A;  1NZB A;  1ZHT A;  4FE3 A;  3JTY A;  4PL2 A;  4CGZ A;  2K4H A;  3H0L B;  3TZG A;  4CRX A;  3T24 A;  2ZXI A;  2Y0L A;  4KX5 A;  4IC9 A;  4P0Q A;  3F2B A;  4QJF B;  5T14 A;  3DA3 A;  3V8U A;  3VZU X;  5G26 A;  2XIC A;  5DL6 A;  2OXO A;  2VKQ A;  1Q9F A;  3M7D A;  3HOL A;  3E0F A;  4JCH A;  2ZIU B;  4N58 A;  2F77 X;  2K8A A;  5FVN A;  2ZIW B;  1GFM A;  4AKM A;  4NLC A;  2JGA A;  2HBK A;  3O0F A;  4AYD C;  3LK3 A;  2KIW A;  3PQS A;  3SAG A;  4AYE C;  5ADX L;  2M0N A;  2K0L A;  2BDU A;  5ADX K;  2LYA A;  2H3Q A;  1OPF A;  1Q3U A;  2ZG6 A;  3LVW A;  2GOL A;  4GCQ A;  4KX3 A;  2J4U P;  1PVQ A;  2JH1 A;  3IN5 A;  4G76 A;  3AAE B;  2GE4 A;  4FOZ A;  4C69 X;  2JHD A;  1HEK A;  1WUD A;  3PSP A;  4D64 A;  4PL1 A;  3RF9 A;  3AQE A;  2H3F A;  3C5O A;  2G5I B;  2XE2 A;  1G90 A;  2LBO A;  1CRX A;  2OM6 A;  1DRG A;  3LK2 A;  2KZ7 A;  2KOB A;  2F1V A;  3SY9 A;  2KKP A;  2DF4 B;  2KV2 A;  2VIX A;  2Z7J A;  4JMU A;  3AA1 A;  1PVR A;  2CRX A;  2KHV A;  2HBJ A;  4BJQ A;  1GFN A;  4O3X B;  3GP6 A;  3H0R B;  2ZIV B;  2KDY A;  4OJ6 A;  4E1S A;  2G06 A;  2NV3 A;  4XNL A;  3M6Z A;  2PMZ C;  2XMX A;  2XE3 A;  4FSO A;  3D2Q A;  3PSF A;  2YPV A;  3AAA A;  2F2A B;  2KNJ A;  5DL5 A;  2ZIX B;  3HW9 A;  4OJL A;  4NV0 A;  3VY9 X;  5EE2 A;  4O3M A;  5HR6 A;  2G5H B;  2W80 C;  3UPG A;  1P7D A;  4BUM X;  2W04 A;  3AA7 B;  4AYB C;  4AFK A;  4O4X A;  2JH7 A;  4JFB A;  3POR A;  2Y0K A;  3IP4 B;  2QTK A;  1IZN B;  5AFU L;  4RL9 A;  2Q4T A;  4D5U A;  4KR4 A;  3PRN A;  1Z19 A;  1OUQ A;  4U6P A;  1TAM A;  4D65 A;  2KD1 A;  3SY7 A;  3AA0 B;  2KIC A;  2KJ9 A;  2KXP A;  2H3Z A;  3AA6 A;  5T5F A;  1YS5 A;  2W7O A;  4OJO A;  1ZHZ A;  2VJ5 A;  2HBM A;  4U9C A;  2CN1 A;  2KC0 A;  3PZP A;  3VCB A;  2M06 A;  3C28 A;  3POX A;  4AYI D;  2G08 A;  1GO3 F;  4AZL A;  2KHQ A;  1ZQ1 C;  3T20 A;  2KEY A;  2K4T A;  4FRT A;  4AUI A;  2XG6 A;  3F53 A;  2WB1 F;  2M07 A;  1OSM A;  2X27 X;  4RLC A;  2Y0S C;  1A0P A;  1UPH A;  3RBH A;  2KJ8 A;  2G0A A;  2RHF A;  4OJP A;  2N2L A;  1A6S A;  1F44 A;  2GH1 A;  2G09 A;  1HXT A;  1PVP A;  4FZL A;  3NUQ A;  3AQF A;  3GU3 A;  7PRN A;  3CYM A;  4P0Q B;  2XE5 A;  3ALR A;  2KKV A;  1KBU A;  3N7R C;  3SAH A;  5GV0 A;  2XVT A;  2HBL A;  2HOQ A;  3LYS A;  2FGR A;  4QIW C;  3HOE A;  2Y0S F;  4FT6 A;  4FES A;  2W81 C;  3ICX A;  3C29 A;  2ERV A;  1PHO A;  1ZHY A;  3SAF A;  1H6S 1;  1XO0 A;  3A2S X;  3LK3 B;  3SQI A;  4U7C A;  4GCP A;  3SMV A;  2D6F C;  5IYU A;  2XI9 A;  4A8E A;  3LVV A;  1MM4 A;  1HXU A;  4RLB A;  4QQ1 A;  2XTR A;  4C0Z A;  2K89 A;  3KFU F;  3GZF A;  1PRN A;  3VZT X;  3WI5 A;  2K8B B;  3F5E A;  3EMN X;  3DA4 A;  1BH3 A;  4P0P A;  1P4T A;  5PRN A;  2ZFG A;  3LK4 2;  2N2M A;  1ED1 A;  2J1N A;  3N7P D;  2K8C B;  3SZV A;  2LFU A;  1BT9 A;  1GFP A;  5DL7 A;  4ACO A;  3MGV A;  1D8B A;  1QJ9 A;  8PRN A;  2H3V A;  4FZM A;  4QNL A;  3LK2 B;  1GFQ A;  3O0E A;  2F76 X;  2KZ7 B;  4N59 A;  3F2C A;  4AKR A;  3K19 A;  1ORM A;  3AA1 B;  2YB1 A;  1E54 A;  1MM5 A;  3POQ A;  1HXX A;  3H0M B;  4RJW A;  4NLB A;  3HKZ C;  3DEE A;  1BXW A;  2JMM A;  4KRA A;  3NSG A;  3OPX A;  3LK4 1;  2H3I A;  3VE1 A;  4FRX A;  1THQ A;  2PMZ F;  5AFU K;  2F8L A;  4O3Y A;  3AAA B;  3K1Z A;  3PQU A;  3SYB A;  4LSI A;  4O49 A;  2CPR A;  3RFA A;  4LSF A;  2O4V A;  4LSE A;  4KR8 A;  2RRD A;  2F1T A;  2DGZ A;  4AYB F;  3POU A;  3HKZ F;  2G07 A;  2XTQ A;  2MHL A;  1ECW A;  2LHT A;  4PUX A;  4WJ3 B;  2XE1 A;  3FYX A;  4CDG A;  2ZIU A;  4FZN A;  3QRC A;  4Z3T A;  5D5D A;  2ZIW A;  2DQN B;  4OO1 J;  4E1T A;  3SZD A;  4AYM C;  2Y0H A;  2KXP B;  3VY8 X;  3AA6 B;  4XNK A;  4BUG A;  2LHF A;  4G75 A;  4FMS A;  2LYB A;  3PST A;  3F2D A;  2YB4 A;  3CRX A;  2OH2 A;  5HR7 A;  2OYY A;  5DL8 A;  1Q3V A;  2POR A;  3IG5 A;  2WAQ C;  3SYS A;  3AAE A;  1Q9G A;  2K4I A;  2KVC A;  2MRL A;  2K4E A;  4GFJ A;  2VJ4 A;  3T79 A;  3HWB A;  2ZLD A;  2YNK A;  3UU2 A;  3UAQ A;  4RJX A;  3VC8 A;  5CRX A;  1T94 A;  2MNH A;  4GF4 A;  2HOF A;  3QRA A;  2RP5 A;  5KL1 B;  4QIW F;  2WAQ F;  3CP8 A;  1ZHX A;  3N7S C;  2ZIV A;  1YT3 A;  5JDP A;  4ICA A;  4FSP A;  1L6N A;  4B61 A;  2R18 A;  4GCS A;  3D2S A;  3M6K A;  3IG8 A;  1XNS A;  4F4B A;  3ONN A;  4OJ5 A;  2KJ5 A;  4O3W A;  2FGQ X;  4BX9 C;  2E5S A;  2ZIX A;  3KVD D;  4AYN A;  2HOI A;  4LSH A;  3T0S A;  5C0Y A;  1IIP A;  2JMG A;  2N1R A;  3AA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...