4FZNA

Crystal structure of syringacin m mutant d232a from pseudomonas syringae pv. tomato dc3000
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
276
structure length
276
Chain Sequence
PIELPPTYITPYPEISAGGNGTYRGQDLSSGQSFPRGMQNPVATVLLLQGDLYCSPNCLATFQDQARRDSFGIQSKVALKTFAAADQREAEGRDLRTAYNEIATDIGRSQQINENIIKYPPGNHVLSGGLMTPFHALAHGMFGLGAPLTFPIQNVGLNVDIRGIPDVMNVIQSARPVGTSSLDVNFAYDVGKDSNASWLTLGNITLRLVGTIDKNASGAWTFSGEIRAFNAVYDANPSNHRGWLGENLTSLLSAVPFTSYSIEIPGSLPVTVSGNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Lipid II-degrading Bacteriocin Syringacin M Suggests Unexpected Evolutionary Relationships between Colicin M-like Bacteriocins.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Antimicrobial protein
molecule keywords Bacteriocin
total genus 74
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.880 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4fznA01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4fznA02
2XMXA 3DA4A 4N58A 4G75A 2XTQA 4FZNA 3DA3A 4FZLA 4FZMA 4G76A 4N59A 2XTRA
chains in the Genus database with same CATH superfamily
3RJFA 4FSPA 2Y9UA 1BPXA 4QJFB 1UHUA 1Q9GA 1LB2B 2B21A 1HJPA 5DB7A 4M47A 2JV3A 2G09A 5A0LA 4ED6A 3H8SA 3ZD9A 4Q8FA 5AIAA 3AUOA 5AK5A 5AICA 8ICUA 1ZRMA 3SAGA 7ICNA 4QZCA 2E8NA 2DFLA 3WKDA 5CJ7A 3D2QA 4UAZA 4FSOA 3V7JA 2MSNA 3AAAA 4F5RA 3LK3B 2XE1A 2A3VA 4I2GA 1QSYA 1QH9A 4QZBA 4TQRA 2JMMA 4QZ9A 4PL2A 2GWSA 2KZ3A 5AKLA 4DO9A 4M9GA 1RXVA 2ZUBA 4LZGA 1S10A 4I2HA 7PRNA 5AI8A 4FZNA 4PZOA 3HP6A 2F1VA 2C2EA 1Z00A 4JB3A 2JMGA 3AA7A 5ALLA 2W9BA 4F4WA 1O03A 2BDUA 3GIKA 2F76X 5L1IA 4J9LA 3LK42 5EWFA 5GV0A 4O3PA 3QRCA 1SKRA 2DL0A 8ICHA 2QB1A 2MUTA 5AM2A 2HHUA 3KHLA 1HXXA 5HP4A 3AAEB 2VKQA 2NV3A 4F2RA 5DQHA 3MR2A 1BPBA 3IV6A 5KFMA 4QWCA 4IR1A 1RYUA 3T5KA 2NO5A 3T5HA 4Z6EA 1LKYA 1TK0A 1ZQGA 1SKSA 3KBBA 2HOIA 1L7NA 1SV4A 9ICAA 5DQGA 1S0NA 2ODGA 4DFPA 1P4TA 4FE3A 3RB6A 1ECWA 3I28A 1ZQ1C 2W3SA 3QEAZ 5FVNA 3KHHA 2IOFA 4KLJA 2ZTCA 2IOFK 1GFNA 4KLUA 3C29A 1S0OA 1ZQRA 3CNHA 4QZHA 3F53A 5KG3A 2FPKA 4LSFA 2K8AA 1ZHWA 1L8OA 9ICQA 1M6YA 4BUGA 3KD3A 4ELUA 2LBOA 4ACOA 2HSZA 5DB6A 4XNLA 3ORYA 4GCQA 5B66U 3IN5A 1JI7A 5AKEA 2C22A 1T16A 5GTIO 1QQ5A 2KTQA 1S5LU 1T3NA 3AA0B 1V9PA 4UBCA 1NI3A 1IXRA 4ECXA 4DFJA 4MFAA 1EXNA 4C8OA 9ICPA 2F1CX 3C2LA 3PW2A 4Y2SA 5EE9A 3C5GA 2G0AA 2W55A 2CRXA 5DG8A 2R8HA 1TK5A 2KSOA 2AH5A 3RR7A 8ICCA 3KHGA 2HOQA 2Z7JA 8ICVA 5ALFA 1ZQCA 2E8OA 4MEXA 3D2NA 2XTRA 5BOMA 3RFAA 5KFNA 4DSJA 2W03A 1PK1B 5AKJA 4IR9A 3OHBA 4O3RA 2PORA 4KLEA 1D8LA 3AN1A 3H4BA 2R4PA 4RUCA 3MGIA 1F5SA 3CP8A 3WK5A 2XE2A 3WKCA 5KT5A 1UT8A 3C28A 4AYID 4ED3A 1BPZA 2V9WA 3JPRA 9ICTA 3PQSA 5G26A 5KT3A 5J0PA 5GTHO 3VE2A 4RPYA 4YR0A 3PW5A 3RH6A 4P0QA 4GXKA 3B0YA 3GV5B 5GTHU 1MPFA 4OO1J 4US9A 1JXLA 2W81C 1PK3A 3AQFA 4QZFA 1U4BA 5J2EA 3BDPA 2KJ9A 9ICBA 2ZG6A 5ALIA 4DFDA 4JMUA 2GO7A 4JFBA 4B9TA 4G75A 3F2BA 3BQ1A 1H6S1 7ICJA 4EYHB 4IQTA 3H0LB 4MHVA 2ESEA 1XC9A 4E1TA 2I1QA 4QZIA 4YN4A 4UB5A 4KN4A 1V38A 2FI1A 2XGQA 2HHSA 5HMLA 1ORMA 2WHEA 4RT2A 2R8JA 4KLHA 2KJ5A 3SZVA 2PFQA 2BCVA 3UXNA 3KKAA 3C2KA 4CGZA 4C8MA 4NL9C 3E2EA 4F4XA 2EAOA 5KAFU 3T24A 4J9SA 4YVZA 4GC7A 4Y2QA 9ICSA 2DUYA 3SZDA 9ICIA 4PGQA 4O0IA 2JEFA 4QWAA 4NLGA 3POXA 3MGVA 5DGAA 2JR5A 9ICGA 1KL9A 2IWWA 4FBUA 3FC4A 5G5HA 2VA8A 2BKEA 2DKZA 4C80A 1LVHA 2KZ7A 5DQIA 1KRPA 3TACB 3SQIA 2DPJA 4FQEA 2EAPA 2WB1C 4C69X 4DL5A 9ICJA 1JUDA 5AI5A 4Y2JA 2KNJA 4ED8A 1HEKA 4ED2A 2V4QA 1QLNA 4Y2TA 5KFQA 4Q45A 5J29A 2OH2A 1D8YA 2LM1A 5IYUA 5F3XB 3QNMA 2AHOB 2UVRA 4JV1A 1YS5A 5KFTA 4WJ3B 2FMQA 5DL5A 2G08A 4B9UA 2E5SA 3G6XA 3AA1B 4YD2A 3BRYA 2B0CA 3LK9A 1ZQHA 4YG2A 5J2CA 3HT3A 3QUQA 2AGPA 4IQUA 1ZOLA 3F2CA 3AM9A 3SENA 1SZHA 3QX7A 4RQ7A 5KL1B 1DXSA 2FPLA 3AEVA 1X66A 3V72A 1OPFA 1RYRA 3C21A 3BZKA 4FOZA 2HOFA 3PVXA 4AYBF 4A8EA 2HBJA 4FT6A 2VANA 3UMCA 4R8UB 4KLGA 5JU5A 2UVWA 4C8NA 2XTQA 3DA3A 2MHLA 3UXPA 3LK2A 3JTYA 5KFHA 3B9JA 3WK8A 1MN8A 4ZH4A 5ALQA 1PRNA 2Q4TA 3TADC 4YR3A 3RJEA 4UBBA 3V7KA 4NLCA 1NNLA 1KQQA 4AYEC 2I6XA 1T94A 4DOCA 9ICRA 5J0XA 1KFDA 2W9CB 3PRNA 1Z1BA 1N2XA 4UB1A 3OTQA 1T1LA 8ICJA 2ZIVA 3BS5A 4M6WB 1WCNA 4Y2YA 5KFJA 3KZXA 4YCXA 4PZNA 1X9WA 4LZDA 2QKQA 5ALZA 1COKA 1NK7A 4LJXA 4C4TA 5D5DA 3JPTA 3HX0A 3G6VA 3MDCA 3TANA 3SZ2A 3ZDCA 4LSIA 3CW2C 4ICAA 2KK0A 4DL7A 5KTQA 3ZDDA 4EENA 4DLGA 8ICFA 3T0SA 4NLZA 2R4LA 3PR5B 4UB6U 4B61A 3BQTA 3K1ZA 1AROP 1ZQWA 4KLLA 3A2SX 5BPCA 1ZD2P 2EZXA 2IA6A 3Q8QB 4NLNA 2PMZF 5KT2A 3RAQA 4F91B 3DDHA 5CHGA 3GIJA 3WU2U 4I2BA 1BPYA 8ICZA 1N48A 4IL6O 3PR4A 3BS5B 4M6WA 9ICEA 1ZQYA 5CA7A 4D5UA 2A1JB 4MF8A 3K1RB 3S6JA 3TQ1A 2J6SA 2WVPA 4BXOB 5ALMA 3WKBA 3JPPA 3M6KA 1LV5A 3PGUA 4FFDA 2AXTU 4I2DA 3SV3A 1SWWA 3NJTA 4DSKA 3PMNA 4OJLA 2W8KA 5EWEA 1ZQIA 4DQQA 4J9KA 4DS4A 5DLGA 5KG6A 1ZQTA 1IZNB 2QTKA 4NLKA 2KN7A 3RJJA 4YMOA 4N58A 3F5EA 5KFOA 2FGRA 2M9NA 4F4ZA 2BGWA 3THVA 2VIXA 1ZJNA 2WF9A 4QZDA 2HHWA 4AKMA 1UA1A 3QU4A 4O5CA 2ZIXB 5ALWA 1KW4A 3ETLA 3RJKA 5AKXA 3M7DA 4Z6FA 2NYVA 3E0FA 4ED7A 5ALTA 5KAIO 2K60A 2E8PA 2LHFA 4CE6A 4YD1A 4EBCA 1TAMA 3G6YA 4J9OA 5IIIA 3T5LA 1MA7A 3PORA 2LKYA 5HR6A 4JK1A 5AKKA 5HMMA 3AA0A 3PX0A 3AA6A 2WB1F 1TK8A 3WK7A 3ZDEA 4HAIA 3Q8PB 2F8KA 1TAUA 3UM9A 2KXPA 1SL1A 3EPGA 3RB3A 1WCLA 2F44A 2D8CA 2BQUA 4P4PA 2PXIA 1UQVA 2DBYA 1L7OA 2ZIUA 2KG5A 1U9LA 4RU9A 1U45A 2K4TA 3PW0A 9ICHA 4ED0A 5KL8B 3D6JA 7ICQA 4Z3TA 2AGQA 3N4MB 1N62A 5J2HA 3Q8KA 2OWOA 1L8LA 3HW9A 4M9HA 4O9MA 2BPGA 5KFEA 4M0AA 3AU2A 2GOLA 4IS7A 4R65A 3WK9A 4DEZA 2AQ0A 1ZQDA 4D65A 2LMRA 1PHOA 4LSHA 2ASLA 3NS1A 4RQ6A 2I5HA 4QW9A 5C5JA 4UAYA 5ALYA 1OSMA 4YXJA 4GIBA 5D49A 2IHMA 3DZMA 2EAMA 2R8GA 4IRDA 2YTUA 8ICLA 5E79O 3V6JA 5KAFO 1PUZA 4B9LA 4G3IA 1H38A 8ICYA 4BUMX 1IV8A 4PH5A 3DEEA 4RT3A 3VZUX 4ELTA 9ICWA 3SD7A 3RJIA 3LK41 1Y88A 5ALJA 4PUXA 4FS2A 3NVWA 3PZPA 3UQ0A 2KIVA 5AHXA 1CEZA 9ICMA 3NUQA 1F44A 1DK3A 4QNLA 3PX6A 4GXJA 8ICPA 3AA7B 2HI0A 4GHBA 2FMSA 4NV0A 2AJQA 5GTIU 3DWOX 2F2AB 4XQ8A 1L3UA 1ZQZA 4C7YA 2JEGA 1SV0A 2LYBA 3RH5A 2HVIA 2Y0HA 2ZJ8A 8ICTA 1JRPA 2YMQA 2M06A 2VA3A 5T5FA 5J2GA 3BRZA 3H40A 2AXTO 2J6TA 2M0NA 3C1ZA 3PSPA 2KKPA 5FP0A 2BDPA 3TAPA 4FMSA 5J0RA 2K89A 5KFVA 2XG6A 3BZCA 1ZYQA 1BXWA 2PI4A 4C0ZA 1HXUA 5CEHA 5J0SA 3R9KA 2AU0A 1JXEA 1RG6A 1XU4A 4KX3A 4Q44A 1NKCA 3ISBA 2V4RA 2W9MA 4DF8A 3O0FA 1ZQOA 1NK5A 4MFFA 3QU2A 3IG8A 4DQRA 1Z4NA 5KG4A 4EEKA 2WAQF 4J9RA 2EDUA 4UAWA 1PVPA 2G5HB 5J0UA 2PFPA 4F8RA 3RBEA 1BNPA 2DF4B 1RPLA 1Z1VA 3MGHA 4QIWC 2FMPA 2VA2A 3POUA 9ICXA 1N63A 2YQEA 3AQEA 1IZNA 4N74A 4O3MA 1JN3A 4F5PA 1NOMA 1ZQPA 2WJRA 2MU2A 3OSNA 3KHRA 2IHNA 7ICSA 3EZ5A 4KLOA 3HILA 4O3SA 5CR0A 2ISOA 1S5LO 4RNMA 4ELVA 4PHPA 5PRNA 1NJWA 3PX4A 4Z6CA 3GU3A 5ALDA 3PW4A 3QYPA 4I27A 2WF5A 4K4GA 1J2NA 4DQIA 1V85A 3HWBA 2ZIVB 1XSPA 4CF4A 3GILA 4ECQA 3DV9A 1SXDA 3MR3A 4I2AA 5J2AA 4QQ1A 1Q8KA 4NL9A 3NVYA 1ZHXA 1QQ6A 3LWLA 5CB1A 1L6NA 2W04A 3RR8A 1NK9A 2EZZA 2Y1JA 5ALUA 2KKVA 4DS5A 2JHDA 4RJWA 4FRTA 2RQ5A 1B22A 1J2MA 4CCHA 1SL0A 5DBAA 3C2MA 4RNOA 7ICVA 3PQUA 2Y2XA 1B0XA 5B66O 4KR8A 3I1YA 8ICBA 5JDPA 5KFWA 5KFCA 3ISDA 1X9XA 5J0OA 2F8LA 8ICIA 1QJ9A 2XI9A 3Q8LA 4IQWA 4I2JA 5J0YA 1HUOA 3N7PD 3N97B 3J81j 3H4DA 2N2MA 1BNOA 2BCSA 2EQYA 4EYIB 5KFLA 4LSEA 3HOLA 5DLFA 2K4IA 1GFMA 4FESA 2CPRA 3O0EA 4FRXA 5AK4A 8ICMA 3AA1A 1URJA 5AI4A 4AYNA 2F1IA 4NJ8A 4BWJA 2QLTA 4E0DA 2KD1A 2F1HA 3RRGA 2ZFGA 4R8UA 5J2KA 3DA4A 5AFUL 5KFRA 4FO6A 3AAAB 4O3NA 4O3WA 1VLBA 1T8EA 1HIWA 2MA1A 3HKZC 4O3OA 2YN4A 5DDMA 2DPIA 3H7IA 5ALRA 1ZQEA 7ICOA 2JH1A 4I2IA 2KIWA 2KMDA 2J4UP 4Y2XA 2FLLA 2QB0A 4LVSA 3GQCA 3V6HA 4DL6A 2KE7A 5HHHA 1ZQBA 4DSFA 3TI0A 2OCEA 4K4HA 1RYSA 1BGXT 4NM1A 2DKXA 2FLNA 1J97A 1FEZA 4OJ6A 1KBUA 3OPXA 3GP6A 2FLPA 5L9XA 1U48A 1BPEA 3QUCA 1L3VA 2KZMA 1X6JA 4M9LA 8ICKA 3HPOA 4O4XA 1MM4A 3NRZA 2PFOA 2YX8A 1YZ7A 3I76A 3MDAA 4DCCA 1NKEA 3SI8A 9ICLA 2YNKA 2ZJ5A 4DL4A 4P2HA 4U6PA 4RQMA 3WKEA 1N56A 2HHXA 4OJ5A 2O6KA 3PF1A 1IIPA 3LWMA 1MM5A 3RBHA 4OCZA 4YP3A 4C4SA 4FUVA 4PL1A 8ICGA 2WF6A 4YQWA 5KFGA 5KG2A 7ICRA 4R64A 2YMMA 4F2SA 1UPHA 4XNKA 2VJ5A 1HUZA 3PW7A 2K4HA 3T5JA 3RBDA 2GLEA 2ZIWB 3JPSA 1SV0C 3VC8A 4GLXA 4KITB 1Z19A 2WAQC 2JQYA 4JV2A 3ISCA 1ZHYA 7ICIA 3K19A 2F1JA 3HWTA 1WYGA 5TZVA 5ALNA 4DOBA 1SGGA 2ATLA 3MFHA 4QZ8A 2OXOA 1S76D 1Z4OA 4US8A 8ICSA 4OJPA 1OUQA 4I2CA 5ALOA 1BH3A 2JZBB 1F0MA 2HHQA 2J1NA 3TKAA 1NK4A 3K75D 1QCKA 4DFMA 5EE3A 2KHVA 5KFKA 3CRXA 4O3YA 4RLBA 1X2IA 5AI0A 5AKHA 5B5EU 4PPXA 3ED5A 3SY9A 1Z00B 2HHTA 5J0TA 3EUB2 3T79A 1KN5A 3ONNA 2IMWP 5KFYA 3PY8A 3KOOA 5AM4A 4AFKA 2WF7A 5KNIA 4G76A 1O08A 1D9FA 1ZQFA 2NRVA 1THQA 1A0PA 2Y0SC 4GF4A 3IP4B 2Q0ZX 3SV4A 1DOQA 1PVQA 1E54A 1XO1A 9ICNA 2E8MA 4UAUA 1CRXA 4P0PB 1TFRA 4AKRA 2E3TA 4J9PA 2XIDA 1BT9A 1L3SA 4KLTA 4XUSA 4F72A 4K3BA 4NM2A 2W43A 2BPFA 1JALA 5JTIA 1DGJA 2A1AA 3SYZA 2J6UA 5HHIA 4RZRA 4J9QA 1X9SA 4P0PA 4AKRB 3EW9A 4YMMA 1IG6A 3FM9A 4F71A 2KSOB 4EELA 3IHQB 3C5FA 1ZQKA 4UAVA 7ICEA 5KFAA 8ICQA 4UARA 3PGSA 3HRDD 2BCQA 4GFJA 4OJOA 4KMOB 4RUAA 1T4GA 1ZD4A 2FJ6A 3OJSA 1Q9FA 3L5KA 2P6UA 3NSGA 1VDVA 2QARA 2KZZA 5AM1A 3A0BO 5DKWA 1KLNA 5ALVA 5IINA 3OSPA 5DBCA 4GCSA 2D3DA 4MFCA 2LPEA 5J2FA 3B0XA 3RAXA 3IDWA 2WTFA 4QWDA 1N5XA 3HKZF 3GV8B 3EYZA 3SAHA 1HXTA 2LM4A 4PJ0O 1ZQVA 3MFIA 4B9SA 3SR6A 4FS1A 1ZQUA 2NRWA 3UPQA 5TISO 3HOEA 4CF5A 3KTQA 2IOHA 3N7SC 4NWIA 1FFVA 4RL9A 1MSWD 1NKBA 2G5IB 5L1LA 5TISU 1XWLA 4Q8EA 3BS7A 5IIKA 5KT4A 5L1JA 1RZTA 3FAHA 3RB0A 4EBDA 4JWMA 3UPGA 3OGUA 5BOLA 3U26A 1WG8A 2KVSA 4EX7A 1ZHTA 3HW8A 4AYDC 3V6KA 5KG5A 5ALXA 1TVAA 4F4KA 5IIJA 3IG5A 5AKIA 5E79U 2XO7A 2YPVA 4PGXA 1YT3A 4K4IA 2JH7A 2ZJAA 1SZPA 5HR7A 3E58A 2Y1IA 4IRCA 1G90A 2FE9A 5KT6A 4J9MA 4DQSA 7ICTA 2KXPB 1TE2A 1JX4A 1AQ6A 4CNQA 1FFUA 3MBYA 4ECWA 3TFRA 4PHDA 5AKGA 3AA6B 1Q3UA 2X27X 2Y7SA 1FIQA 7ICMA 2ZLDA 1GFOA 3KVDD 1KSPA 4N59A 4F92B 2P66A 3PO5A 3N28A 1S0MA 2IWVA 4O3XB 5AK3A 2RDJA 2CXYA 2F3NA 3RTVA 1FO4A 4RQ0A 3NGDA 3EMNX 3QRAA 2NRXA 3MC1A 2LHTA 1U47A 1K1SA 8PRNA 2F1TA 1JIHA 2R88A 7ICUA 5DL8A 3QUBA 4Z6DA 2R4OA 1S0VA 4RNNA 2H3ZA 4F93B 4N75A 5G5GA 4QWEA 2XICA 3MR6A 2BZFA 4O3ZA 5G39A 2R4NA 4I29A 2Y0LA 3K4GA 1V97A 5IIMA 2W54A 3RRHA 5G3AA 5KAIU 2GH1A 2KFZA 1BPDA 4KLSA 2R8AA 2DGZA 1NZPA 2LFUA 4BWMA 3KKAC 1ZQJA 2K4PA 2JEIA 1GFPA 3A0BU 2A1JA 2ZIWA 1D8BA 5D46A 3VZTX 3RJHA 4JUZA 4NY8A 9ICFA 2BPCA 2W3RA 1OXJA 2A19A 4D64A 1ZXIA 4G9BA 2BR0A 4RJXA 1Q3VA 1LKYB 2YY6A 3C1YA 4IQVA 5AKZA 1KFSA 4ECUA 2C28A 1XS9D 4YFKA 4RQNA 4B6JA 5EWGA 3M8SA 5KFPA 8ICOA 3KFUF 3ALRA 1C20A 5EOZA 4AUIA 4DSLA 5AM3A 5AI6A 1S77D 2R8KA 1ZD3A 4Q43A 3HJEA 2K8CB 2AQ4A 5B5EO 2W9BB 4Y2PA 1DGSA 3WI5A 4EX6A 4IL6U 2D6FC 4DOAA 7ICHA 2KICA 3AMZA 9ICVA 2MNHA 5AM5A 4P0QB 4M04A 2YMLA 5IILA 3PO4A 3GDXA 4AZLA 1NK8A 4ED1A 4RPXA 3VCBA 5DGBA 3Q8RB 2C2DA 1QJPA 7ICGA 4F3OA 5H2FO 4I28A 4DQPA 2FPMA 5KFIA 3QEBZ 3LK3A 5IIOA 1UCVA 4PGYA 2UVVA 3M9OB 1KEJA 3SYSA 4ECZA 2OM6A 2FDRA 9ICUA 2EH9A 1IM4A 3WK4A 3BQ2A 4I2FA 3M8RA 3AU6A 3UXOA 2XY7A 4OD0A 2W8LA 5AI9A 4RQ3A 3H8JA 5J2IA 3LVVA 2LYAA 4C4VA 1Q46A 5ALKA 4R66A 4UQGA 4DLEA 3L4PA 4NLBA 2H5XA 4P4MA 7ICKA 1A6SA 3IM1A 2BQ3A 5ALSA 4KMUA 4RLCA 4Y2RA 3SEIA 3VY9X 1L5UA 2N1RA 8ICEA 2XE3A 1DK2A 5ALEA 2JGAA 1DRGA 2KFNA 3PNCA 3NASA 2KV2A 1MC8A 4M9NA 4BGDA 5AK6A 1KKXA 4KN7A 4BX9C 4UASA 3NRWA 3JPNA 2JEJA 1A77A 2E1EA 1P7DA 2HHVA 2ZIXA 2ERVA 4QZGA 2G07A 2YMPA 3LYSA 8ICRA 3MABA 1YZ6A 4AYBC 4NXZA 4KX5A 3F2DA 4ECTA 4Y2UA 7ICFA 1ZHZA 1X40A 2KZ7B 4FZLA 3EWAA 1RQLA 4XRHA 5KG1A 2RHFA 1ZQQA 2ZXHA 1GO3F 4KR4A 3LVWA 5J8YC 2HBKA 2NRZA 5ALPA 2PFNA 2PKEA 1Z3EB 1TV9A 1L7PA 1K5OA 4CRXA 8ICNA 1T7PA 1VJ5A 4QZAA 4UB2A 2WF8A 4MF2A 5EE1A 3H8WA 3G7GA 4KLMA 1MQ2A 2VJ4A 5C0YA 1NJZA 2M07A 4ECSA 1L3TA 3GFKB 2F77X 1X6IA 2ZXIA 2LI6A 2W11A 3T3FA 1ZQMA 4B9MA 3M6ZA 2XC9A 2Y9TA 3ETRA 2KEYA 2BCUA 1GFQA 3D2SA 4F4BA 5HNKA 5J2JA 2DWQA 2PRNA 3NTUA 3RF9A 3RJGA 4O3QA 1N60A 1S8OA 5J2DA 2FGQX 5K4LA 3QZ7A 2ALZA 2OMFA 3BS0A 3SY7A 1JMSA 4RPZA 9ICOA 2MUTB 5KFDA 4DF4A 2K4EA 4UATA 3GV7B 2JRZA 2KOBA 2P35A 4QW8A 5F9NA 4JWNA 2KC0A 1ZD5A 3QU9A 4B9VA 3L3FX 4F4YA 1UT5A 1SXEA 3WU2O 4B9NA 1ED1A 6PRNA 4DL2A 4O5KA 2NRTA 4BJQA 4GCPA 1NJYA 3ZD8A 5DL6A 4KLQA 4C8LA 5ALHA 5AFUK 1B4FA 4PR7A 2Y0SF 3GZFA 2EANA 3PSTA 1QTMA 2YB1A 2XGPA 4DFKA 2R18A 3IRUA 2CN1A 2EZYA 2NO4A 2QB0B 2MAXA 4E1SA 2RRDA 4DSIA 5DL7A 1JROA 4TQSA 1L7MA 1X9MA 3Q8SB 2HMXA 2G06A 3QZ8A 4DSEA 5JRTA 4XA5A 1PK1A 2KVCA 1T3QA 2L5YA 4BDPA 1QQ7A 4J9NA 2HBLA 3TAQA 1SWVA 1OW5A 2ASJA 4JV0A 1ZETA 3TFSA 3QUTA 4YMNA 3TZGA 3T20A 2XMXA 5AM0A 5KT7A 3VZWX 4IC9A 2H3QA 2XY5A 2H3IA 3OHAA 2Y0KA 3WKAA 4QWBA 4KLDA 5DB8A 2AGOA 3H8MA 1B43A 3RB4A 2BHNA 3H0MB 4BXOA 7ICLA 3AL0B 4HYKA 1TKDA 2H3FA 5DG7A 5ADXL 4FZMA 4GXIA 4X5VA 1NK0A 9ICCA 3PSIA 4EEYA 4C4VB 5DB9A 4UB4A 2XCAA 4CF3A 4ECRA 2WFAA 5F9LA 4QIWF 2YB4A 2OYYA 3V7LA 5KFXA 4TUSA 4EZ6A 4R63A 2JZBA 2I9GA 3WI4A 4RQ2A 2X9KA 1RXWA 2E1FA 1XO0A 5KG0A 2R89A 2RP5A 3CYMA 4KLFA 1N61A 2RDIA 5CRXA 2KDYA 4P4OA 1WWUA 2OEHA 3QU5A 3JPQA 3GIIA 1RM6C 2WJQA 5J0QA 4PHAA 4Y2VA 2H3VA 4AP9A 3DWNA 2W9AA 3OJUA 3ZDBA 2B6GA 1C7YA 2W9CA 4C00A 2ZUCA 1UA0A 4J03A 3PGRA 4F5NA 4TUPA 1XSLA 2C2RA 3NVVA 4C4RA 2R8IA 4JCHA 2P6RA 1ZJMA 4UW9A 4TURA 2HDOA 5KFFA 3POQA 4PHEA 3FYHA 1SIJA 1BVSA 1PZNA 2OHFA 5DG9A 3LDAA 4UB6O 5H2FU 3QXGA 3UAQA 2W7PA 1XSNA 4K3CA 4UB8U 2XCPA 1RDFA 4EZ9A 1NK6A 4PJ0U 1SL2A 5T14A 4M9JA 2QARB 3SAFA 3ZI4A 4KTQA 2XVTA 1KFTA 4EBEA 2BCRA 4YXMA 5L1MA 4GC6A 5KFSA 4YR2A 2ZTEA 1QSLA 2ODJA 5J8YA 2KHQA 1NZBA 2ZIUB 2MRLA 2KP7A 2BQRA 1CUKA 4DL3A 2KJ8A 3M9MB 1PVRA 3BQ7A 3UMGA 2XY6A 3UQ2A 1A76A 1QJ8A 3JCUO 3SYBA 5EE0A 2HCFA 5D4BA 2HBMA 5CWRA 4UB3A 3TARA 3VE1A 5DBBA 4RQ8A 5J2BA 1U49A 4ECYA 4RQ4A 2W80C 1N5WA 3QE9Y 1ZRNA 4O5EA 3GIMA 1WUDA 3N7RC 5L1KA 3C5OA 4RQ1A 2ISPA 2UVUA 4I2EA 2HVHA 2K8BB 2PMZC 2ZUDA 1S9FA 1ZQAA 1SB3C 8ICWA 4CTDA 1MQ3A 2GE4A 3EPIA 4U9CA 9ICKA 3M9NB 1CI4A 3M1YA 5ALGA 1ZQXA 3A0HU 1X42A 5KFUA 3UMBA 4O49A 5DDYA 5KFBA 7ICPA 2K0LA 4QZEA 5AKYA 5KG7A 3ZDAA 5KFZA 5ADXK 1ZQLA 4F5QA 2W7OA 4AYMC 4MEYA 3BJYA 4FBTA 3KZIU 2XE5A 4F5OA 4F50A 2LYHA 4ZOHC 2O4VA 2JXJA 4C8KA 5J0WA 1COOA 2ES6A 2DQNB 8ICAA 3H0RB 3SMVA 1QSSA 3NVZA 1XNSA 1ZQNA 4CDGA 3FYXA 3Q8MA 3PSFA 1KDHA 4U7CA 3TADA 3V8UA 3PV8A 4KRAA 5EE2A 5G38A 3RH4A 1SKWA 4DWIA 4C7ZA 4M2YA 3C23A 4TUQA 3PMLA 2IBKA 3KZIO 2PI5A 4KLIA 5AIBA 3FDSA 3ICXA 3JPOA 2ZTDA 3LK2B 2RLTA 3F5AA 3BQ0A 3AAEA 1D9DA 1TAQA 1K1QA 4O4UA 1WWVA 3MR5A 3VY8X 5CP2A 4ECVA 1RQNA 1NJXA 3WK6A 8ICXA 4UB8O 4IRKA 5JUMA 3A0HO 4RQ5A 3UU2A 1ZQSA 2N2LA 4USAA 2HW3A 2ASDA 1KTQA 1S97A 3QU7A
chains in the Genus database with same CATH topology
4FSPA 2E1EA 1P7DA 4QJFB 1Q9GA 2YNKA 2PMZF 2ZIXA 2ERVA 2G07A 4U6PA 3LYSA 4OJ5A 4AYBC 1IIPA 4KX5A 3F2DA 1MM5A 3RBHA 1ZHZA 2KZ7B 4FUVA 4D5UA 4FZLA 4PL1A 2G09A 5A0LA 2RHFA 2ZXHA 3M6KA 1UPHA 1GO3F 4KR4A 2VJ5A 3LVWA 4XNKA 2K4HA 2HBKA 3SAGA 2ZIWB 4OJLA 3VC8A 4CRXA 3D2QA 1Z19A 2WAQC 4FSOA 1ZHYA 3K19A 3AAAA 3LK3B 1IZNB 2QTKA 3G7GA 2XE1A 2A3VA 5C0YA 2VJ4A 2OXOA 2M07A 4OJPA 1OUQA 2JMMA 4N58A 3F5EA 2F77X 2ZXIA 4PL2A 2FGRA 1BH3A 2VIXA 2J1NA 4AKMA 3M6ZA 2ZIXB 2KEYA 1GFQA 3D2SA 7PRNA 4F4BA 4FZNA 2F1VA 2KHVA 2PRNA 3RF9A 3M7DA 3E0FA 2JMGA 3AA7A 3CRXA 4O3YA 4RLBA 2FGQX 2BDUA 2F76X 2OMFA 3LK42 2LHFA 5GV0A 3SY7A 1TAMA 3QRCA 3SY9A 1MA7A 3PORA 2LKYA 2K4EA 5HR6A 3T79A 3ONNA 1HXXA 2KOBA 3AA0A 3AA6A 2KC0A 3AAEB 2VKQA 2WB1F 4AFKA 2NV3A 3L3FX 4G76A 1THQA 1ED1A 1A0PA 2Y0SC 6PRNA 4GF4A 3IP4B 1PVQA 2KXPA 4BJQA 1E54A 4GCPA 2HOIA 5DL6A 1CRXA 5AFUK 4P0PB 4AKRA 2XIDA 1BT9A 1P4TA 4FE3A 3GZFA 2Y0SF 1ECWA 3PSTA 2YB1A 1ZQ1C 2ZIUA 2R18A 2K4TA 5FVNA 2CN1A 5KL8B 4E1SA 2RRDA 1GFNA 4Z3TA 5DL7A 3C29A 3HW9A 4P0PA 4AKRB 3F53A 2GOLA 4LSFA 2HMXA 2K8AA 1ZHWA 2G06A 4D65A 2KVCA 1PHOA 4LSHA 4BUGA 2LBOA 2HBLA 4ACOA 4XNLA 4GCQA 4GFJA 3IN5A 4OJOA 4KMOB 1OSMA 3TZGA 3T20A 2XMXA 1Q9FA 3VZWX 4IC9A 2H3QA 3NSGA 2H3IA 2Y0KA 3AA0B 4BUMX 4GCSA 3DEEA 3H0MB 3VZUX 3AL0B 2G0AA 2H3FA 5ADXL 4FZMA 2CRXA 3HKZF 3LK41 4PUXA 3SAHA 3PSIA 1HXTA 3PZPA 2HOQA 2Z7JA 3NUQA 1F44A 4QIWF 2YB4A 3D2NA 4QNLA 3HOEA 2OYYA 2XTRA 3AA7B 4GHBA 3N7SC 3RFAA 4NV0A 2W03A 4NWIA 4RL9A 3WI4A 2PORA 2G5IB 2F2AB 2E1FA 1XO0A 2RP5A 3CYMA 3CP8A 2LYBA 5CRXA 2KDYA 2XE2A 3C28A 4AYID 2Y0HA 3UPGA 2M06A 1ZHTA 5T5FA 5G26A 3PQSA 4AYDC 2M0NA 3VE2A 3PSPA 2KKPA 2H3VA 3IG5A 4FMSA 4P0QA 2K89A 2YPVA 2XG6A 1MPFA 1YT3A 4OO1J 2W81C 2JH7A 3AQFA 5HR7A 1BXWA 4C0ZA 1HXUA 4JCHA 2KJ9A 1G90A 2ZG6A 3POQA 4KX3A 4JMUA 4JFBA 3O0FA 2KXPB 4G75A 3IG8A 3F2BA 1H6S1 2WAQF 3H0LB 4E1TA 3AA6B 1PVPA 1Q3UA 2X27X 2G5HB 3UAQA 2Y7SA 2W7PA 2ZLDA 1GFOA 3KVDD 4N59A 2DF4B 5T14A 1ORMA 4O3XB 3SAFA 4QIWC 3POUA 2XVTA 2KJ5A 3SZVA 3AQEA 1IZNA 4O3MA 4CGZA 3EMNX 3QRAA 2ODJA 2LHTA 2KHQA 3T24A 1NZBA 8PRNA 2ZIUB 2F1TA 2MRLA 3SZDA 5DL8A 5PRNA 3POXA 2KJ8A 2H3ZA 3GU3A 3MGVA 1PVRA 2XICA 4O3ZA 1QJ8A 3HWBA 3SYBA 2ZIVB 2Y0LA 2HBMA 4QQ1A 3VE1A 2KZ7A 2GH1A 1ZHXA 3SQIA 1L6NA 2DGZA 2W04A 2W80C 2LFUA 2WB1C 1GFPA 2KKVA 4C69X 2ZIWA 2JHDA 4RJWA 1D8BA 1WUDA 3N7RC 4FRTA 3C5OA 2KNJA 3VZTX 1HEKA 2OH2A 2K8BB 5IYUA 3PQUA 2PMZC 2Y2XA 4D64A 1YS5A 4KR8A 4RJXA 5JDPA 1Q3VA 4WJ3B 5DL5A 2G08A 2GE4A 2E5SA 2F8LA 3AA1B 4U9CA 1QJ9A 2XI9A 3N7PD 3F2CA 2N2MA 1SZHA 3KFUF 4LSEA 3ALRA 4O49A 4AUIA 3HOLA 2K0LA 5KL1B 2K4IA 1GFMA 4FESA 2CPRA 3O0EA 4FRXA 2K8CB 1OPFA 5ADXK 2W7OA 4FOZA 2HOFA 3AA1A 1URJA 4AYBF 3WI5A 4AYNA 4AYMC 4A8EA 2HBJA 2D6FC 4FT6A 2KD1A 2KICA 2ZFGA 2XE5A 2MNHA 3DA4A 4P0QB 5AFUL 2XTQA 2O4VA 3DA3A 2MHLA 3AAAB 4AZLA 4O3WA 3LK2A 3JTYA 2DQNB 1HIWA 2MA1A 3H0RB 3HKZC 3VCBA 3SMVA 1QJPA 1XNSA 1PRNA 2Q4TA 4CDGA 2JH1A 3FYXA 2KIWA 3PSFA 4NLCA 4U7CA 3V8UA 3LK3A 4KRAA 2J4UP 4AYEC 3SYSA 2OM6A 5EE2A 1T94A 3PRNA 1Z1BA 3LVVA 2LYAA 2ZIVA 3ICXA 4NLBA 3KZXA 3LK2B 3F5AA 1A6SA 3AAEA 4O4UA 4RLCA 5D5DA 3VY8X 4OJ6A 1KBUA 3OPXA 3VY9X 2N1RA 2XE3A 3GP6A 4LSIA 2JGAA 1DRGA 4ICAA 3T0SA 2KV2A 3UU2A 2N2LA 4B61A 4O4XA 1MM4A 3K1ZA 2YX8A 4BX9C 3NRWA 3A2SX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XMX A;  3DA4 A;  4N58 A;  4G75 A;  2XTQ A;  4FZN A;  3DA3 A;  4FZL A;  4FZM A;  4G76 A;  4N59 A;  2XTR A; 
#chains in the Genus database with same CATH topology
 3RJF A;  4FSP A;  2Y9U A;  1BPX A;  4QJF B;  1UHU A;  1Q9G A;  1LB2 B;  2B21 A;  1HJP A;  5DB7 A;  4M47 A;  2JV3 A;  2G09 A;  5A0L A;  4ED6 A;  3H8S A;  3ZD9 A;  4Q8F A;  5AIA A;  3AUO A;  5AK5 A;  5AIC A;  8ICU A;  1ZRM A;  3SAG A;  7ICN A;  4QZC A;  2E8N A;  2DFL A;  3WKD A;  5CJ7 A;  3D2Q A;  4UAZ A;  4FSO A;  3V7J A;  2MSN A;  3AAA A;  4F5R A;  3LK3 B;  2XE1 A;  2A3V A;  4I2G A;  1QSY A;  1QH9 A;  4QZB A;  4TQR A;  2JMM A;  4QZ9 A;  4PL2 A;  2GWS A;  2KZ3 A;  5AKL A;  4DO9 A;  4M9G A;  1RXV A;  2ZUB A;  4LZG A;  1S10 A;  4I2H A;  7PRN A;  5AI8 A;  4FZN A;  4PZO A;  3HP6 A;  2F1V A;  2C2E A;  1Z00 A;  4JB3 A;  2JMG A;  3AA7 A;  5ALL A;  2W9B A;  4F4W A;  1O03 A;  2BDU A;  3GIK A;  2F76 X;  5L1I A;  4J9L A;  3LK4 2;  5EWF A;  5GV0 A;  4O3P A;  3QRC A;  1SKR A;  2DL0 A;  8ICH A;  2QB1 A;  2MUT A;  5AM2 A;  2HHU A;  3KHL A;  1HXX A;  5HP4 A;  3AAE B;  2VKQ A;  2NV3 A;  4F2R A;  5DQH A;  3MR2 A;  1BPB A;  3IV6 A;  5KFM A;  4QWC A;  4IR1 A;  1RYU A;  3T5K A;  2NO5 A;  3T5H A;  4Z6E A;  1LKY A;  1TK0 A;  1ZQG A;  1SKS A;  3KBB A;  2HOI A;  1L7N A;  1SV4 A;  9ICA A;  5DQG A;  1S0N A;  2ODG A;  4DFP A;  1P4T A;  4FE3 A;  3RB6 A;  1ECW A;  3I28 A;  1ZQ1 C;  2W3S A;  3QEA Z;  5FVN A;  3KHH A;  2IOF A;  4KLJ A;  2ZTC A;  2IOF K;  1GFN A;  4KLU A;  3C29 A;  1S0O A;  1ZQR A;  3CNH A;  4QZH A;  3F53 A;  5KG3 A;  2FPK A;  4LSF A;  2K8A A;  1ZHW A;  1L8O A;  9ICQ A;  1M6Y A;  4BUG A;  3KD3 A;  4ELU A;  2LBO A;  4ACO A;  2HSZ A;  5DB6 A;  4XNL A;  3ORY A;  4GCQ A;  5B66 U;  3IN5 A;  1JI7 A;  5AKE A;  2C22 A;  1T16 A;  5GTI O;  1QQ5 A;  2KTQ A;  1S5L U;  1T3N A;  3AA0 B;  1V9P A;  4UBC A;  1NI3 A;  1IXR A;  4ECX A;  4DFJ A;  4MFA A;  1EXN A;  4C8O A;  9ICP A;  2F1C X;  3C2L A;  3PW2 A;  4Y2S A;  5EE9 A;  3C5G A;  2G0A A;  2W55 A;  2CRX A;  5DG8 A;  2R8H A;  1TK5 A;  2KSO A;  2AH5 A;  3RR7 A;  8ICC A;  3KHG A;  2HOQ A;  2Z7J A;  8ICV A;  5ALF A;  1ZQC A;  2E8O A;  4MEX A;  3D2N A;  2XTR A;  5BOM A;  3RFA A;  5KFN A;  4DSJ A;  2W03 A;  1PK1 B;  5AKJ A;  4IR9 A;  3OHB A;  4O3R A;  2POR A;  4KLE A;  1D8L A;  3AN1 A;  3H4B A;  2R4P A;  4RUC A;  3MGI A;  1F5S A;  3CP8 A;  3WK5 A;  2XE2 A;  3WKC A;  5KT5 A;  1UT8 A;  3C28 A;  4AYI D;  4ED3 A;  1BPZ A;  2V9W A;  3JPR A;  9ICT A;  3PQS A;  5G26 A;  5KT3 A;  5J0P A;  5GTH O;  3VE2 A;  4RPY A;  4YR0 A;  3PW5 A;  3RH6 A;  4P0Q A;  4GXK A;  3B0Y A;  3GV5 B;  5GTH U;  1MPF A;  4OO1 J;  4US9 A;  1JXL A;  2W81 C;  1PK3 A;  3AQF A;  4QZF A;  1U4B A;  5J2E A;  3BDP A;  2KJ9 A;  9ICB A;  2ZG6 A;  5ALI A;  4DFD A;  4JMU A;  2GO7 A;  4JFB A;  4B9T A;  4G75 A;  3F2B A;  3BQ1 A;  1H6S 1;  7ICJ A;  4EYH B;  4IQT A;  3H0L B;  4MHV A;  2ESE A;  1XC9 A;  4E1T A;  2I1Q A;  4QZI A;  4YN4 A;  4UB5 A;  4KN4 A;  1V38 A;  2FI1 A;  2XGQ A;  2HHS A;  5HML A;  1ORM A;  2WHE A;  4RT2 A;  2R8J A;  4KLH A;  2KJ5 A;  3SZV A;  2PFQ A;  2BCV A;  3UXN A;  3KKA A;  3C2K A;  4CGZ A;  4C8M A;  4NL9 C;  3E2E A;  4F4X A;  2EAO A;  5KAF U;  3T24 A;  4J9S A;  4YVZ A;  4GC7 A;  4Y2Q A;  9ICS A;  2DUY A;  3SZD A;  9ICI A;  4PGQ A;  4O0I A;  2JEF A;  4QWA A;  4NLG A;  3POX A;  3MGV A;  5DGA A;  2JR5 A;  9ICG A;  1KL9 A;  2IWW A;  4FBU A;  3FC4 A;  5G5H A;  2VA8 A;  2BKE A;  2DKZ A;  4C80 A;  1LVH A;  2KZ7 A;  5DQI A;  1KRP A;  3TAC B;  3SQI A;  2DPJ A;  4FQE A;  2EAP A;  2WB1 C;  4C69 X;  4DL5 A;  9ICJ A;  1JUD A;  5AI5 A;  4Y2J A;  2KNJ A;  4ED8 A;  1HEK A;  4ED2 A;  2V4Q A;  1QLN A;  4Y2T A;  5KFQ A;  4Q45 A;  5J29 A;  2OH2 A;  1D8Y A;  2LM1 A;  5IYU A;  5F3X B;  3QNM A;  2AHO B;  2UVR A;  4JV1 A;  1YS5 A;  5KFT A;  4WJ3 B;  2FMQ A;  5DL5 A;  2G08 A;  4B9U A;  2E5S A;  3G6X A;  3AA1 B;  4YD2 A;  3BRY A;  2B0C A;  3LK9 A;  1ZQH A;  4YG2 A;  5J2C A;  3HT3 A;  3QUQ A;  2AGP A;  4IQU A;  1ZOL A;  3F2C A;  3AM9 A;  3SEN A;  1SZH A;  3QX7 A;  4RQ7 A;  5KL1 B;  1DXS A;  2FPL A;  3AEV A;  1X66 A;  3V72 A;  1OPF A;  1RYR A;  3C21 A;  3BZK A;  4FOZ A;  2HOF A;  3PVX A;  4AYB F;  4A8E A;  2HBJ A;  4FT6 A;  2VAN A;  3UMC A;  4R8U B;  4KLG A;  5JU5 A;  2UVW A;  4C8N A;  2XTQ A;  3DA3 A;  2MHL A;  3UXP A;  3LK2 A;  3JTY A;  5KFH A;  3B9J A;  3WK8 A;  1MN8 A;  4ZH4 A;  5ALQ A;  1PRN A;  2Q4T A;  3TAD C;  4YR3 A;  3RJE A;  4UBB A;  3V7K A;  4NLC A;  1NNL A;  1KQQ A;  4AYE C;  2I6X A;  1T94 A;  4DOC A;  9ICR A;  5J0X A;  1KFD A;  2W9C B;  3PRN A;  1Z1B A;  1N2X A;  4UB1 A;  3OTQ A;  1T1L A;  8ICJ A;  2ZIV A;  3BS5 A;  4M6W B;  1WCN A;  4Y2Y A;  5KFJ A;  3KZX A;  4YCX A;  4PZN A;  1X9W A;  4LZD A;  2QKQ A;  5ALZ A;  1COK A;  1NK7 A;  4LJX A;  4C4T A;  5D5D A;  3JPT A;  3HX0 A;  3G6V A;  3MDC A;  3TAN A;  3SZ2 A;  3ZDC A;  4LSI A;  3CW2 C;  4ICA A;  2KK0 A;  4DL7 A;  5KTQ A;  3ZDD A;  4EEN A;  4DLG A;  8ICF A;  3T0S A;  4NLZ A;  2R4L A;  3PR5 B;  4UB6 U;  4B61 A;  3BQT A;  3K1Z A;  1ARO P;  1ZQW A;  4KLL A;  3A2S X;  5BPC A;  1ZD2 P;  2EZX A;  2IA6 A;  3Q8Q B;  4NLN A;  2PMZ F;  5KT2 A;  3RAQ A;  4F91 B;  3DDH A;  5CHG A;  3GIJ A;  3WU2 U;  4I2B A;  1BPY A;  8ICZ A;  1N48 A;  4IL6 O;  3PR4 A;  3BS5 B;  4M6W A;  9ICE A;  1ZQY A;  5CA7 A;  4D5U A;  2A1J B;  4MF8 A;  3K1R B;  3S6J A;  3TQ1 A;  2J6S A;  2WVP A;  4BXO B;  5ALM A;  3WKB A;  3JPP A;  3M6K A;  1LV5 A;  3PGU A;  4FFD A;  2AXT U;  4I2D A;  3SV3 A;  1SWW A;  3NJT A;  4DSK A;  3PMN A;  4OJL A;  2W8K A;  5EWE A;  1ZQI A;  4DQQ A;  4J9K A;  4DS4 A;  5DLG A;  5KG6 A;  1ZQT A;  1IZN B;  2QTK A;  4NLK A;  2KN7 A;  3RJJ A;  4YMO A;  4N58 A;  3F5E A;  5KFO A;  2FGR A;  2M9N A;  4F4Z A;  2BGW A;  3THV A;  2VIX A;  1ZJN A;  2WF9 A;  4QZD A;  2HHW A;  4AKM A;  1UA1 A;  3QU4 A;  4O5C A;  2ZIX B;  5ALW A;  1KW4 A;  3ETL A;  3RJK A;  5AKX A;  3M7D A;  4Z6F A;  2NYV A;  3E0F A;  4ED7 A;  5ALT A;  5KAI O;  2K60 A;  2E8P A;  2LHF A;  4CE6 A;  4YD1 A;  4EBC A;  1TAM A;  3G6Y A;  4J9O A;  5III A;  3T5L A;  1MA7 A;  3POR A;  2LKY A;  5HR6 A;  4JK1 A;  5AKK A;  5HMM A;  3AA0 A;  3PX0 A;  3AA6 A;  2WB1 F;  1TK8 A;  3WK7 A;  3ZDE A;  4HAI A;  3Q8P B;  2F8K A;  1TAU A;  3UM9 A;  2KXP A;  1SL1 A;  3EPG A;  3RB3 A;  1WCL A;  2F44 A;  2D8C A;  2BQU A;  4P4P A;  2PXI A;  1UQV A;  2DBY A;  1L7O A;  2ZIU A;  2KG5 A;  1U9L A;  4RU9 A;  1U45 A;  2K4T A;  3PW0 A;  9ICH A;  4ED0 A;  5KL8 B;  3D6J A;  7ICQ A;  4Z3T A;  2AGQ A;  3N4M B;  1N62 A;  5J2H A;  3Q8K A;  2OWO A;  1L8L A;  3HW9 A;  4M9H A;  4O9M A;  2BPG A;  5KFE A;  4M0A A;  3AU2 A;  2GOL A;  4IS7 A;  4R65 A;  3WK9 A;  4DEZ A;  2AQ0 A;  1ZQD A;  4D65 A;  2LMR A;  1PHO A;  4LSH A;  2ASL A;  3NS1 A;  4RQ6 A;  2I5H A;  4QW9 A;  5C5J A;  4UAY A;  5ALY A;  1OSM A;  4YXJ A;  4GIB A;  5D49 A;  2IHM A;  3DZM A;  2EAM A;  2R8G A;  4IRD A;  2YTU A;  8ICL A;  5E79 O;  3V6J A;  5KAF O;  1PUZ A;  4B9L A;  4G3I A;  1H38 A;  8ICY A;  4BUM X;  1IV8 A;  4PH5 A;  3DEE A;  4RT3 A;  3VZU X;  4ELT A;  9ICW A;  3SD7 A;  3RJI A;  3LK4 1;  1Y88 A;  5ALJ A;  4PUX A;  4FS2 A;  3NVW A;  3PZP A;  3UQ0 A;  2KIV A;  5AHX A;  1CEZ A;  9ICM A;  3NUQ A;  1F44 A;  1DK3 A;  4QNL A;  3PX6 A;  4GXJ A;  8ICP A;  3AA7 B;  2HI0 A;  4GHB A;  2FMS A;  4NV0 A;  2AJQ A;  5GTI U;  3DWO X;  2F2A B;  4XQ8 A;  1L3U A;  1ZQZ A;  4C7Y A;  2JEG A;  1SV0 A;  2LYB A;  3RH5 A;  2HVI A;  2Y0H A;  2ZJ8 A;  8ICT A;  1JRP A;  2YMQ A;  2M06 A;  2VA3 A;  5T5F A;  5J2G A;  3BRZ A;  3H40 A;  2AXT O;  2J6T A;  2M0N A;  3C1Z A;  3PSP A;  2KKP A;  5FP0 A;  2BDP A;  3TAP A;  4FMS A;  5J0R A;  2K89 A;  5KFV A;  2XG6 A;  3BZC A;  1ZYQ A;  1BXW A;  2PI4 A;  4C0Z A;  1HXU A;  5CEH A;  5J0S A;  3R9K A;  2AU0 A;  1JXE A;  1RG6 A;  1XU4 A;  4KX3 A;  4Q44 A;  1NKC A;  3ISB A;  2V4R A;  2W9M A;  4DF8 A;  3O0F A;  1ZQO A;  1NK5 A;  4MFF A;  3QU2 A;  3IG8 A;  4DQR A;  1Z4N A;  5KG4 A;  4EEK A;  2WAQ F;  4J9R A;  2EDU A;  4UAW A;  1PVP A;  2G5H B;  5J0U A;  2PFP A;  4F8R A;  3RBE A;  1BNP A;  2DF4 B;  1RPL A;  1Z1V A;  3MGH A;  4QIW C;  2FMP A;  2VA2 A;  3POU A;  9ICX A;  1N63 A;  2YQE A;  3AQE A;  1IZN A;  4N74 A;  4O3M A;  1JN3 A;  4F5P A;  1NOM A;  1ZQP A;  2WJR A;  2MU2 A;  3OSN A;  3KHR A;  2IHN A;  7ICS A;  3EZ5 A;  4KLO A;  3HIL A;  4O3S A;  5CR0 A;  2ISO A;  1S5L O;  4RNM A;  4ELV A;  4PHP A;  5PRN A;  1NJW A;  3PX4 A;  4Z6C A;  3GU3 A;  5ALD A;  3PW4 A;  3QYP A;  4I27 A;  2WF5 A;  4K4G A;  1J2N A;  4DQI A;  1V85 A;  3HWB A;  2ZIV B;  1XSP A;  4CF4 A;  3GIL A;  4ECQ A;  3DV9 A;  1SXD A;  3MR3 A;  4I2A A;  5J2A A;  4QQ1 A;  1Q8K A;  4NL9 A;  3NVY A;  1ZHX A;  1QQ6 A;  3LWL A;  5CB1 A;  1L6N A;  2W04 A;  3RR8 A;  1NK9 A;  2EZZ A;  2Y1J A;  5ALU A;  2KKV A;  4DS5 A;  2JHD A;  4RJW A;  4FRT A;  2RQ5 A;  1B22 A;  1J2M A;  4CCH A;  1SL0 A;  5DBA A;  3C2M A;  4RNO A;  7ICV A;  3PQU A;  2Y2X A;  1B0X A;  5B66 O;  4KR8 A;  3I1Y A;  8ICB A;  5JDP A;  5KFW A;  5KFC A;  3ISD A;  1X9X A;  5J0O A;  2F8L A;  8ICI A;  1QJ9 A;  2XI9 A;  3Q8L A;  4IQW A;  4I2J A;  5J0Y A;  1HUO A;  3N7P D;  3N97 B;  3J81 j;  3H4D A;  2N2M A;  1BNO A;  2BCS A;  2EQY A;  4EYI B;  5KFL A;  4LSE A;  3HOL A;  5DLF A;  2K4I A;  1GFM A;  4FES A;  2CPR A;  3O0E A;  4FRX A;  5AK4 A;  8ICM A;  3AA1 A;  1URJ A;  5AI4 A;  4AYN A;  2F1I A;  4NJ8 A;  4BWJ A;  2QLT A;  4E0D A;  2KD1 A;  2F1H A;  3RRG A;  2ZFG A;  4R8U A;  5J2K A;  3DA4 A;  5AFU L;  5KFR A;  4FO6 A;  3AAA B;  4O3N A;  4O3W A;  1VLB A;  1T8E A;  1HIW A;  2MA1 A;  3HKZ C;  4O3O A;  2YN4 A;  5DDM A;  2DPI A;  3H7I A;  5ALR A;  1ZQE A;  7ICO A;  2JH1 A;  4I2I A;  2KIW A;  2KMD A;  2J4U P;  4Y2X A;  2FLL A;  2QB0 A;  4LVS A;  3GQC A;  3V6H A;  4DL6 A;  2KE7 A;  5HHH A;  1ZQB A;  4DSF A;  3TI0 A;  2OCE A;  4K4H A;  1RYS A;  1BGX T;  4NM1 A;  2DKX A;  2FLN A;  1J97 A;  1FEZ A;  4OJ6 A;  1KBU A;  3OPX A;  3GP6 A;  2FLP A;  5L9X A;  1U48 A;  1BPE A;  3QUC A;  1L3V A;  2KZM A;  1X6J A;  4M9L A;  8ICK A;  3HPO A;  4O4X A;  1MM4 A;  3NRZ A;  2PFO A;  2YX8 A;  1YZ7 A;  3I76 A;  3MDA A;  4DCC A;  1NKE A;  3SI8 A;  9ICL A;  2YNK A;  2ZJ5 A;  4DL4 A;  4P2H A;  4U6P A;  4RQM A;  3WKE A;  1N56 A;  2HHX A;  4OJ5 A;  2O6K A;  3PF1 A;  1IIP A;  3LWM A;  1MM5 A;  3RBH A;  4OCZ A;  4YP3 A;  4C4S A;  4FUV A;  4PL1 A;  8ICG A;  2WF6 A;  4YQW A;  5KFG A;  5KG2 A;  7ICR A;  4R64 A;  2YMM A;  4F2S A;  1UPH A;  4XNK A;  2VJ5 A;  1HUZ A;  3PW7 A;  2K4H A;  3T5J A;  3RBD A;  2GLE A;  2ZIW B;  3JPS A;  1SV0 C;  3VC8 A;  4GLX A;  4KIT B;  1Z19 A;  2WAQ C;  2JQY A;  4JV2 A;  3ISC A;  1ZHY A;  7ICI A;  3K19 A;  2F1J A;  3HWT A;  1WYG A;  5TZV A;  5ALN A;  4DOB A;  1SGG A;  2ATL A;  3MFH A;  4QZ8 A;  2OXO A;  1S76 D;  1Z4O A;  4US8 A;  8ICS A;  4OJP A;  1OUQ A;  4I2C A;  5ALO A;  1BH3 A;  2JZB B;  1F0M A;  2HHQ A;  2J1N A;  3TKA A;  1NK4 A;  3K75 D;  1QCK A;  4DFM A;  5EE3 A;  2KHV A;  5KFK A;  3CRX A;  4O3Y A;  4RLB A;  1X2I A;  5AI0 A;  5AKH A;  5B5E U;  4PPX A;  3ED5 A;  3SY9 A;  1Z00 B;  2HHT A;  5J0T A;  3EUB 2;  3T79 A;  1KN5 A;  3ONN A;  2IMW P;  5KFY A;  3PY8 A;  3KOO A;  5AM4 A;  4AFK A;  2WF7 A;  5KNI A;  4G76 A;  1O08 A;  1D9F A;  1ZQF A;  2NRV A;  1THQ A;  1A0P A;  2Y0S C;  4GF4 A;  3IP4 B;  2Q0Z X;  3SV4 A;  1DOQ A;  1PVQ A;  1E54 A;  1XO1 A;  9ICN A;  2E8M A;  4UAU A;  1CRX A;  4P0P B;  1TFR A;  4AKR A;  2E3T A;  4J9P A;  2XID A;  1BT9 A;  1L3S A;  4KLT A;  4XUS A;  4F72 A;  4K3B A;  4NM2 A;  2W43 A;  2BPF A;  1JAL A;  5JTI A;  1DGJ A;  2A1A A;  3SYZ A;  2J6U A;  5HHI A;  4RZR A;  4J9Q A;  1X9S A;  4P0P A;  4AKR B;  3EW9 A;  4YMM A;  1IG6 A;  3FM9 A;  4F71 A;  2KSO B;  4EEL A;  3IHQ B;  3C5F A;  1ZQK A;  4UAV A;  7ICE A;  5KFA A;  8ICQ A;  4UAR A;  3PGS A;  3HRD D;  2BCQ A;  4GFJ A;  4OJO A;  4KMO B;  4RUA A;  1T4G A;  1ZD4 A;  2FJ6 A;  3OJS A;  1Q9F A;  3L5K A;  2P6U A;  3NSG A;  1VDV A;  2QAR A;  2KZZ A;  5AM1 A;  3A0B O;  5DKW A;  1KLN A;  5ALV A;  5IIN A;  3OSP A;  5DBC A;  4GCS A;  2D3D A;  4MFC A;  2LPE A;  5J2F A;  3B0X A;  3RAX A;  3IDW A;  2WTF A;  4QWD A;  1N5X A;  3HKZ F;  3GV8 B;  3EYZ A;  3SAH A;  1HXT A;  2LM4 A;  4PJ0 O;  1ZQV A;  3MFI A;  4B9S A;  3SR6 A;  4FS1 A;  1ZQU A;  2NRW A;  3UPQ A;  5TIS O;  3HOE A;  4CF5 A;  3KTQ A;  2IOH A;  3N7S C;  4NWI A;  1FFV A;  4RL9 A;  1MSW D;  1NKB A;  2G5I B;  5L1L A;  5TIS U;  1XWL A;  4Q8E A;  3BS7 A;  5IIK A;  5KT4 A;  5L1J A;  1RZT A;  3FAH A;  3RB0 A;  4EBD A;  4JWM A;  3UPG A;  3OGU A;  5BOL A;  3U26 A;  1WG8 A;  2KVS A;  4EX7 A;  1ZHT A;  3HW8 A;  4AYD C;  3V6K A;  5KG5 A;  5ALX A;  1TVA A;  4F4K A;  5IIJ A;  3IG5 A;  5AKI A;  5E79 U;  2XO7 A;  2YPV A;  4PGX A;  1YT3 A;  4K4I A;  2JH7 A;  2ZJA A;  1SZP A;  5HR7 A;  3E58 A;  2Y1I A;  4IRC A;  1G90 A;  2FE9 A;  5KT6 A;  4J9M A;  4DQS A;  7ICT A;  2KXP B;  1TE2 A;  1JX4 A;  1AQ6 A;  4CNQ A;  1FFU A;  3MBY A;  4ECW A;  3TFR A;  4PHD A;  5AKG A;  3AA6 B;  1Q3U A;  2X27 X;  2Y7S A;  1FIQ A;  7ICM A;  2ZLD A;  1GFO A;  3KVD D;  1KSP A;  4N59 A;  4F92 B;  2P66 A;  3PO5 A;  3N28 A;  1S0M A;  2IWV A;  4O3X B;  5AK3 A;  2RDJ A;  2CXY A;  2F3N A;  3RTV A;  1FO4 A;  4RQ0 A;  3NGD A;  3EMN X;  3QRA A;  2NRX A;  3MC1 A;  2LHT A;  1U47 A;  1K1S A;  8PRN A;  2F1T A;  1JIH A;  2R88 A;  7ICU A;  5DL8 A;  3QUB A;  4Z6D A;  2R4O A;  1S0V A;  4RNN A;  2H3Z A;  4F93 B;  4N75 A;  5G5G A;  4QWE A;  2XIC A;  3MR6 A;  2BZF A;  4O3Z A;  5G39 A;  2R4N A;  4I29 A;  2Y0L A;  3K4G A;  1V97 A;  5IIM A;  2W54 A;  3RRH A;  5G3A A;  5KAI U;  2GH1 A;  2KFZ A;  1BPD A;  4KLS A;  2R8A A;  2DGZ A;  1NZP A;  2LFU A;  4BWM A;  3KKA C;  1ZQJ A;  2K4P A;  2JEI A;  1GFP A;  3A0B U;  2A1J A;  2ZIW A;  1D8B A;  5D46 A;  3VZT X;  3RJH A;  4JUZ A;  4NY8 A;  9ICF A;  2BPC A;  2W3R A;  1OXJ A;  2A19 A;  4D64 A;  1ZXI A;  4G9B A;  2BR0 A;  4RJX A;  1Q3V A;  1LKY B;  2YY6 A;  3C1Y A;  4IQV A;  5AKZ A;  1KFS A;  4ECU A;  2C28 A;  1XS9 D;  4YFK A;  4RQN A;  4B6J A;  5EWG A;  3M8S A;  5KFP A;  8ICO A;  3KFU F;  3ALR A;  1C20 A;  5EOZ A;  4AUI A;  4DSL A;  5AM3 A;  5AI6 A;  1S77 D;  2R8K A;  1ZD3 A;  4Q43 A;  3HJE A;  2K8C B;  2AQ4 A;  5B5E O;  2W9B B;  4Y2P A;  1DGS A;  3WI5 A;  4EX6 A;  4IL6 U;  2D6F C;  4DOA A;  7ICH A;  2KIC A;  3AMZ A;  9ICV A;  2MNH A;  5AM5 A;  4P0Q B;  4M04 A;  2YML A;  5IIL A;  3PO4 A;  3GDX A;  4AZL A;  1NK8 A;  4ED1 A;  4RPX A;  3VCB A;  5DGB A;  3Q8R B;  2C2D A;  1QJP A;  7ICG A;  4F3O A;  5H2F O;  4I28 A;  4DQP A;  2FPM A;  5KFI A;  3QEB Z;  3LK3 A;  5IIO A;  1UCV A;  4PGY A;  2UVV A;  3M9O B;  1KEJ A;  3SYS A;  4ECZ A;  2OM6 A;  2FDR A;  9ICU A;  2EH9 A;  1IM4 A;  3WK4 A;  3BQ2 A;  4I2F A;  3M8R A;  3AU6 A;  3UXO A;  2XY7 A;  4OD0 A;  2W8L A;  5AI9 A;  4RQ3 A;  3H8J A;  5J2I A;  3LVV A;  2LYA A;  4C4V A;  1Q46 A;  5ALK A;  4R66 A;  4UQG A;  4DLE A;  3L4P A;  4NLB A;  2H5X A;  4P4M A;  7ICK A;  1A6S A;  3IM1 A;  2BQ3 A;  5ALS A;  4KMU A;  4RLC A;  4Y2R A;  3SEI A;  3VY9 X;  1L5U A;  2N1R A;  8ICE A;  2XE3 A;  1DK2 A;  5ALE A;  2JGA A;  1DRG A;  2KFN A;  3PNC A;  3NAS A;  2KV2 A;  1MC8 A;  4M9N A;  4BGD A;  5AK6 A;  1KKX A;  4KN7 A;  4BX9 C;  4UAS A;  3NRW A;  3JPN A;  2JEJ A;  1A77 A;  2E1E A;  1P7D A;  2HHV A;  2ZIX A;  2ERV A;  4QZG A;  2G07 A;  2YMP A;  3LYS A;  8ICR A;  3MAB A;  1YZ6 A;  4AYB C;  4NXZ A;  4KX5 A;  3F2D A;  4ECT A;  4Y2U A;  7ICF A;  1ZHZ A;  1X40 A;  2KZ7 B;  4FZL A;  3EWA A;  1RQL A;  4XRH A;  5KG1 A;  2RHF A;  1ZQQ A;  2ZXH A;  1GO3 F;  4KR4 A;  3LVW A;  5J8Y C;  2HBK A;  2NRZ A;  5ALP A;  2PFN A;  2PKE A;  1Z3E B;  1TV9 A;  1L7P A;  1K5O A;  4CRX A;  8ICN A;  1T7P A;  1VJ5 A;  4QZA A;  4UB2 A;  2WF8 A;  4MF2 A;  5EE1 A;  3H8W A;  3G7G A;  4KLM A;  1MQ2 A;  2VJ4 A;  5C0Y A;  1NJZ A;  2M07 A;  4ECS A;  1L3T A;  3GFK B;  2F77 X;  1X6I A;  2ZXI A;  2LI6 A;  2W11 A;  3T3F A;  1ZQM A;  4B9M A;  3M6Z A;  2XC9 A;  2Y9T A;  3ETR A;  2KEY A;  2BCU A;  1GFQ A;  3D2S A;  4F4B A;  5HNK A;  5J2J A;  2DWQ A;  2PRN A;  3NTU A;  3RF9 A;  3RJG A;  4O3Q A;  1N60 A;  1S8O A;  5J2D A;  2FGQ X;  5K4L A;  3QZ7 A;  2ALZ A;  2OMF A;  3BS0 A;  3SY7 A;  1JMS A;  4RPZ A;  9ICO A;  2MUT B;  5KFD A;  4DF4 A;  2K4E A;  4UAT A;  3GV7 B;  2JRZ A;  2KOB A;  2P35 A;  4QW8 A;  5F9N A;  4JWN A;  2KC0 A;  1ZD5 A;  3QU9 A;  4B9V A;  3L3F X;  4F4Y A;  1UT5 A;  1SXE A;  3WU2 O;  4B9N A;  1ED1 A;  6PRN A;  4DL2 A;  4O5K A;  2NRT A;  4BJQ A;  4GCP A;  1NJY A;  3ZD8 A;  5DL6 A;  4KLQ A;  4C8L A;  5ALH A;  5AFU K;  1B4F A;  4PR7 A;  2Y0S F;  3GZF A;  2EAN A;  3PST A;  1QTM A;  2YB1 A;  2XGP A;  4DFK A;  2R18 A;  3IRU A;  2CN1 A;  2EZY A;  2NO4 A;  2QB0 B;  2MAX A;  4E1S A;  2RRD A;  4DSI A;  5DL7 A;  1JRO A;  4TQS A;  1L7M A;  1X9M A;  3Q8S B;  2HMX A;  2G06 A;  3QZ8 A;  4DSE A;  5JRT A;  4XA5 A;  1PK1 A;  2KVC A;  1T3Q A;  2L5Y A;  4BDP A;  1QQ7 A;  4J9N A;  2HBL A;  3TAQ A;  1SWV A;  1OW5 A;  2ASJ A;  4JV0 A;  1ZET A;  3TFS A;  3QUT A;  4YMN A;  3TZG A;  3T20 A;  2XMX A;  5AM0 A;  5KT7 A;  3VZW X;  4IC9 A;  2H3Q A;  2XY5 A;  2H3I A;  3OHA A;  2Y0K A;  3WKA A;  4QWB A;  4KLD A;  5DB8 A;  2AGO A;  3H8M A;  1B43 A;  3RB4 A;  2BHN A;  3H0M B;  4BXO A;  7ICL A;  3AL0 B;  4HYK A;  1TKD A;  2H3F A;  5DG7 A;  5ADX L;  4FZM A;  4GXI A;  4X5V A;  1NK0 A;  9ICC A;  3PSI A;  4EEY A;  4C4V B;  5DB9 A;  4UB4 A;  2XCA A;  4CF3 A;  4ECR A;  2WFA A;  5F9L A;  4QIW F;  2YB4 A;  2OYY A;  3V7L A;  5KFX A;  4TUS A;  4EZ6 A;  4R63 A;  2JZB A;  2I9G A;  3WI4 A;  4RQ2 A;  2X9K A;  1RXW A;  2E1F A;  1XO0 A;  5KG0 A;  2R89 A;  2RP5 A;  3CYM A;  4KLF A;  1N61 A;  2RDI A;  5CRX A;  2KDY A;  4P4O A;  1WWU A;  2OEH A;  3QU5 A;  3JPQ A;  3GII A;  1RM6 C;  2WJQ A;  5J0Q A;  4PHA A;  4Y2V A;  2H3V A;  4AP9 A;  3DWN A;  2W9A A;  3OJU A;  3ZDB A;  2B6G A;  1C7Y A;  2W9C A;  4C00 A;  2ZUC A;  1UA0 A;  4J03 A;  3PGR A;  4F5N A;  4TUP A;  1XSL A;  2C2R A;  3NVV A;  4C4R A;  2R8I A;  4JCH A;  2P6R A;  1ZJM A;  4UW9 A;  4TUR A;  2HDO A;  5KFF A;  3POQ A;  4PHE A;  3FYH A;  1SIJ A;  1BVS A;  1PZN A;  2OHF A;  5DG9 A;  3LDA A;  4UB6 O;  5H2F U;  3QXG A;  3UAQ A;  2W7P A;  1XSN A;  4K3C A;  4UB8 U;  2XCP A;  1RDF A;  4EZ9 A;  1NK6 A;  4PJ0 U;  1SL2 A;  5T14 A;  4M9J A;  2QAR B;  3SAF A;  3ZI4 A;  4KTQ A;  2XVT A;  1KFT A;  4EBE A;  2BCR A;  4YXM A;  5L1M A;  4GC6 A;  5KFS A;  4YR2 A;  2ZTE A;  1QSL A;  2ODJ A;  5J8Y A;  2KHQ A;  1NZB A;  2ZIU B;  2MRL A;  2KP7 A;  2BQR A;  1CUK A;  4DL3 A;  2KJ8 A;  3M9M B;  1PVR A;  3BQ7 A;  3UMG A;  2XY6 A;  3UQ2 A;  1A76 A;  1QJ8 A;  3JCU O;  3SYB A;  5EE0 A;  2HCF A;  5D4B A;  2HBM A;  5CWR A;  4UB3 A;  3TAR A;  3VE1 A;  5DBB A;  4RQ8 A;  5J2B A;  1U49 A;  4ECY A;  4RQ4 A;  2W80 C;  1N5W A;  3QE9 Y;  1ZRN A;  4O5E A;  3GIM A;  1WUD A;  3N7R C;  5L1K A;  3C5O A;  4RQ1 A;  2ISP A;  2UVU A;  4I2E A;  2HVH A;  2K8B B;  2PMZ C;  2ZUD A;  1S9F A;  1ZQA A;  1SB3 C;  8ICW A;  4CTD A;  1MQ3 A;  2GE4 A;  3EPI A;  4U9C A;  9ICK A;  3M9N B;  1CI4 A;  3M1Y A;  5ALG A;  1ZQX A;  3A0H U;  1X42 A;  5KFU A;  3UMB A;  4O49 A;  5DDY A;  5KFB A;  7ICP A;  2K0L A;  4QZE A;  5AKY A;  5KG7 A;  3ZDA A;  5KFZ A;  5ADX K;  1ZQL A;  4F5Q A;  2W7O A;  4AYM C;  4MEY A;  3BJY A;  4FBT A;  3KZI U;  2XE5 A;  4F5O A;  4F50 A;  2LYH A;  4ZOH C;  2O4V A;  2JXJ A;  4C8K A;  5J0W A;  1COO A;  2ES6 A;  2DQN B;  8ICA A;  3H0R B;  3SMV A;  1QSS A;  3NVZ A;  1XNS A;  1ZQN A;  4CDG A;  3FYX A;  3Q8M A;  3PSF A;  1KDH A;  4U7C A;  3TAD A;  3V8U A;  3PV8 A;  4KRA A;  5EE2 A;  5G38 A;  3RH4 A;  1SKW A;  4DWI A;  4C7Z A;  4M2Y A;  3C23 A;  4TUQ A;  3PML A;  2IBK A;  3KZI O;  2PI5 A;  4KLI A;  5AIB A;  3FDS A;  3ICX A;  3JPO A;  2ZTD A;  3LK2 B;  2RLT A;  3F5A A;  3BQ0 A;  3AAE A;  1D9D A;  1TAQ A;  1K1Q A;  4O4U A;  1WWV A;  3MR5 A;  3VY8 X;  5CP2 A;  4ECV A;  1RQN A;  1NJX A;  3WK6 A;  8ICX A;  4UB8 O;  4IRK A;  5JUM A;  3A0H O;  4RQ5 A;  3UU2 A;  1ZQS A;  2N2L A;  4USA A;  2HW3 A;  2ASD A;  1KTQ A;  1S97 A;  3QU7 A; 
#chains in the Genus database with same CATH homology
 4FSP A;  2E1E A;  1P7D A;  4QJF B;  1Q9G A;  2YNK A;  2PMZ F;  2ZIX A;  2ERV A;  2G07 A;  4U6P A;  3LYS A;  4OJ5 A;  4AYB C;  1IIP A;  4KX5 A;  3F2D A;  1MM5 A;  3RBH A;  1ZHZ A;  2KZ7 B;  4FUV A;  4D5U A;  4FZL A;  4PL1 A;  2G09 A;  5A0L A;  2RHF A;  2ZXH A;  3M6K A;  1UPH A;  1GO3 F;  4KR4 A;  2VJ5 A;  3LVW A;  4XNK A;  2K4H A;  2HBK A;  3SAG A;  2ZIW B;  4OJL A;  3VC8 A;  4CRX A;  3D2Q A;  1Z19 A;  2WAQ C;  4FSO A;  1ZHY A;  3K19 A;  3AAA A;  3LK3 B;  1IZN B;  2QTK A;  3G7G A;  2XE1 A;  2A3V A;  5C0Y A;  2VJ4 A;  2OXO A;  2M07 A;  4OJP A;  1OUQ A;  2JMM A;  4N58 A;  3F5E A;  2F77 X;  2ZXI A;  4PL2 A;  2FGR A;  1BH3 A;  2VIX A;  2J1N A;  4AKM A;  3M6Z A;  2ZIX B;  2KEY A;  1GFQ A;  3D2S A;  7PRN A;  4F4B A;  4FZN A;  2F1V A;  2KHV A;  2PRN A;  3RF9 A;  3M7D A;  3E0F A;  2JMG A;  3AA7 A;  3CRX A;  4O3Y A;  4RLB A;  2FGQ X;  2BDU A;  2F76 X;  2OMF A;  3LK4 2;  2LHF A;  5GV0 A;  3SY7 A;  1TAM A;  3QRC A;  3SY9 A;  1MA7 A;  3POR A;  2LKY A;  2K4E A;  5HR6 A;  3T79 A;  3ONN A;  1HXX A;  2KOB A;  3AA0 A;  3AA6 A;  2KC0 A;  3AAE B;  2VKQ A;  2WB1 F;  4AFK A;  2NV3 A;  3L3F X;  4G76 A;  1THQ A;  1ED1 A;  1A0P A;  2Y0S C;  6PRN A;  4GF4 A;  3IP4 B;  1PVQ A;  2KXP A;  4BJQ A;  1E54 A;  4GCP A;  2HOI A;  5DL6 A;  1CRX A;  5AFU K;  4P0P B;  4AKR A;  2XID A;  1BT9 A;  1P4T A;  4FE3 A;  3GZF A;  2Y0S F;  1ECW A;  3PST A;  2YB1 A;  1ZQ1 C;  2ZIU A;  2R18 A;  2K4T A;  5FVN A;  2CN1 A;  5KL8 B;  4E1S A;  2RRD A;  1GFN A;  4Z3T A;  5DL7 A;  3C29 A;  3HW9 A;  4P0P A;  4AKR B;  3F53 A;  2GOL A;  4LSF A;  2HMX A;  2K8A A;  1ZHW A;  2G06 A;  4D65 A;  2KVC A;  1PHO A;  4LSH A;  4BUG A;  2LBO A;  2HBL A;  4ACO A;  4XNL A;  4GCQ A;  4GFJ A;  3IN5 A;  4OJO A;  4KMO B;  1OSM A;  3TZG A;  3T20 A;  2XMX A;  1Q9F A;  3VZW X;  4IC9 A;  2H3Q A;  3NSG A;  2H3I A;  2Y0K A;  3AA0 B;  4BUM X;  4GCS A;  3DEE A;  3H0M B;  3VZU X;  3AL0 B;  2G0A A;  2H3F A;  5ADX L;  4FZM A;  2CRX A;  3HKZ F;  3LK4 1;  4PUX A;  3SAH A;  3PSI A;  1HXT A;  3PZP A;  2HOQ A;  2Z7J A;  3NUQ A;  1F44 A;  4QIW F;  2YB4 A;  3D2N A;  4QNL A;  3HOE A;  2OYY A;  2XTR A;  3AA7 B;  4GHB A;  3N7S C;  3RFA A;  4NV0 A;  2W03 A;  4NWI A;  4RL9 A;  3WI4 A;  2POR A;  2G5I B;  2F2A B;  2E1F A;  1XO0 A;  2RP5 A;  3CYM A;  3CP8 A;  2LYB A;  5CRX A;  2KDY A;  2XE2 A;  3C28 A;  4AYI D;  2Y0H A;  3UPG A;  2M06 A;  1ZHT A;  5T5F A;  5G26 A;  3PQS A;  4AYD C;  2M0N A;  3VE2 A;  3PSP A;  2KKP A;  2H3V A;  3IG5 A;  4FMS A;  4P0Q A;  2K89 A;  2YPV A;  2XG6 A;  1MPF A;  1YT3 A;  4OO1 J;  2W81 C;  2JH7 A;  3AQF A;  5HR7 A;  1BXW A;  4C0Z A;  1HXU A;  4JCH A;  2KJ9 A;  1G90 A;  2ZG6 A;  3POQ A;  4KX3 A;  4JMU A;  4JFB A;  3O0F A;  2KXP B;  4G75 A;  3IG8 A;  3F2B A;  1H6S 1;  2WAQ F;  3H0L B;  4E1T A;  3AA6 B;  1PVP A;  1Q3U A;  2X27 X;  2G5H B;  3UAQ A;  2Y7S A;  2W7P A;  2ZLD A;  1GFO A;  3KVD D;  4N59 A;  2DF4 B;  5T14 A;  1ORM A;  4O3X B;  3SAF A;  4QIW C;  3POU A;  2XVT A;  2KJ5 A;  3SZV A;  3AQE A;  1IZN A;  4O3M A;  4CGZ A;  3EMN X;  3QRA A;  2ODJ A;  2LHT A;  2KHQ A;  3T24 A;  1NZB A;  8PRN A;  2ZIU B;  2F1T A;  2MRL A;  3SZD A;  5DL8 A;  5PRN A;  3POX A;  2KJ8 A;  2H3Z A;  3GU3 A;  3MGV A;  1PVR A;  2XIC A;  4O3Z A;  1QJ8 A;  3HWB A;  3SYB A;  2ZIV B;  2Y0L A;  2HBM A;  4QQ1 A;  3VE1 A;  2KZ7 A;  2GH1 A;  1ZHX A;  3SQI A;  1L6N A;  2DGZ A;  2W04 A;  2W80 C;  2LFU A;  2WB1 C;  1GFP A;  2KKV A;  4C69 X;  2ZIW A;  2JHD A;  4RJW A;  1D8B A;  1WUD A;  3N7R C;  4FRT A;  3C5O A;  2KNJ A;  3VZT X;  1HEK A;  2OH2 A;  2K8B B;  5IYU A;  3PQU A;  2PMZ C;  2Y2X A;  4D64 A;  1YS5 A;  4KR8 A;  4RJX A;  5JDP A;  1Q3V A;  4WJ3 B;  5DL5 A;  2G08 A;  2GE4 A;  2E5S A;  2F8L A;  3AA1 B;  4U9C A;  1QJ9 A;  2XI9 A;  3N7P D;  3F2C A;  2N2M A;  1SZH A;  3KFU F;  4LSE A;  3ALR A;  4O49 A;  4AUI A;  3HOL A;  2K0L A;  5KL1 B;  2K4I A;  1GFM A;  4FES A;  2CPR A;  3O0E A;  4FRX A;  2K8C B;  1OPF A;  5ADX K;  2W7O A;  4FOZ A;  2HOF A;  3AA1 A;  1URJ A;  4AYB F;  3WI5 A;  4AYN A;  4AYM C;  4A8E A;  2HBJ A;  2D6F C;  4FT6 A;  2KD1 A;  2KIC A;  2ZFG A;  2XE5 A;  2MNH A;  3DA4 A;  4P0Q B;  5AFU L;  2XTQ A;  2O4V A;  3DA3 A;  2MHL A;  3AAA B;  4AZL A;  4O3W A;  3LK2 A;  3JTY A;  2DQN B;  1HIW A;  2MA1 A;  3H0R B;  3HKZ C;  3VCB A;  3SMV A;  1QJP A;  1XNS A;  1PRN A;  2Q4T A;  4CDG A;  2JH1 A;  3FYX A;  2KIW A;  3PSF A;  4NLC A;  4U7C A;  3V8U A;  3LK3 A;  4KRA A;  2J4U P;  4AYE C;  3SYS A;  2OM6 A;  5EE2 A;  1T94 A;  3PRN A;  1Z1B A;  3LVV A;  2LYA A;  2ZIV A;  3ICX A;  4NLB A;  3KZX A;  3LK2 B;  3F5A A;  1A6S A;  3AAE A;  4O4U A;  4RLC A;  5D5D A;  3VY8 X;  4OJ6 A;  1KBU A;  3OPX A;  3VY9 X;  2N1R A;  2XE3 A;  3GP6 A;  4LSI A;  2JGA A;  1DRG A;  4ICA A;  3T0S A;  2KV2 A;  3UU2 A;  2N2L A;  4B61 A;  4O4X A;  1MM4 A;  3K1Z A;  2YX8 A;  4BX9 C;  3NRW A;  3A2S X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...