4FZNA

Crystal structure of syringacin m mutant d232a from pseudomonas syringae pv. tomato dc3000
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
276
structure length
276
Chain Sequence
b'PIELPPTYITPYPEISAGGNGTYRGQDLSSGQSFPRGMQNPVATVLLLQGDLYCSPNCLATFQDQARRDSFGIQSKVALKTFAAADQREAEGRDLRTAYNEIATDIGRSQQINENIIKYPPGNHVLSGGLMTPFHALAHGMFGLGAPLTFPIQNVGLNVDIRGIPDVMNVIQSARPVGTSSLDVNFAYDVGKDSNASWLTLGNITLRLVGTIDKNASGAWTFSGEIRAFNAVYDANPSNHRGWLGENLTSLLSAVPFTSYSIEIPGSLPVTVSGNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacteriocin
publication title The Crystal Structure of the Lipid II-degrading Bacteriocin Syringacin M Suggests Unexpected Evolutionary Relationships between Colicin M-like Bacteriocins.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Antimicrobial protein
total genus 74
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.880 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4fznA01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4fznA02
2XTRA 3DA3A 4N59A 4FZMA 2XTQA 4FZNA 4FZLA 4G76A 3DA4A 4N58A 4G75A 2XMXA
chains in the Genus database with same CATH superfamily
3UU2A 4KITB 2YB4A 4JK1A 2ESEA 1X2IA 2HMXA 3T0SA 4NJ8A 5J0OA 1NK8A 2ZG6A 4OCZA 3C2KA 1JIHA 2G5IB 1CUKA 3IM1A 4AUIA 1Q3VA 4CNQA 1SZHA 4KLQA 3WK9A 1ZQUA 3WKBA 3QE9Y 1COOA 2RP5A 5F9LA 2XICA 3RRHA 2R4NA 2KNJA 3N28A 4OJ6A 1DK3A 8ICFA 5KG7A 3RJJA 5AM1A 4NXZA 1TV9A 4R65A 2KSOB 2ZFGA 4IRDA 4F5QA 5J8YC 1A6SA 3E0FA 2DBYA 2KKVA 4C8OA 2W7PA 4KLMA 2K89A 1D8BA 2VA8A 2FPLA 3TACB 4BJQA 2E5SA 4BUMX 2R88A 4KX5A 5KT4A 2KIWA 2XE2A 2ZTCA 5DBCA 3UXOA 2XTRA 3CP8A 5KFGA 1N5WA 2LHFA 4JWNA 4NLKA 5J29A 4DFPA 2QLTA 5J0UA 1LKYB 1SGGA 2EH9A 3UPGA 2G09A 3HRDD 5J2KA 2GOLA 7ICOA 5AHXA 4EBDA 2ZIXA 3C21A 3AAEA 3OGUA 2LM1A 3PF1A 4DQRA 3RB6A 1FFVA 2EZXA 3DZMA 2JEGA 3SYSA 1ECWA 3AA7A 2PFOA 2BCUA 1KFDA 4LSFA 2KG5A 4MFCA 5IIKA 4KR8A 3OHBA 3HOLA 5AM5A 3QZ7A 7PRNA 2KP7A 1ZJMA 1KLNA 8ICOA 5A0LA 1ZQRA 4LVSA 5AIBA 2HBLA 3V6KA 3C5OA 5BPCA 2WAQC 2RDIA 4I28A 1OPFA 1X9MA 4AYEC 5KFJA 3T5HA 2KD1A 2HOFA 3DA4A 4NWIA 2KZZA 5CJ7A 5CR0A 4RQ3A 5DLFA 1THQA 3HWBA 1B0XA 1B22A 2N2LA 2WF8A 4DQIA 3UPQA 8ICSA 3I1YA 4O3NA 3A0BU 3AA6B 3GV8B 1ZHYA 1S0NA 4RQ7A 5L1LA 1MA7A 5KFWA 4UAZA 5AFUL 3RR7A 2FGQX 4GXKA 4U7CA 3RJHA 4UBBA 4YXJA 1RDFA 3WKAA 1NK4A 4RQ1A 4PUXA 2MHLA 3ED5A 1LV5A 4AYBF 1N60A 4C4VA 1KL9A 2Y0SF 1Q8KA 1BPYA 4ZH4A 4IQTA 4FFDA 1K1SA 4I2DA 3JCUO 4P0QB 2ZJ8A 1CEZA 5D5DA 1XSNA 2BCQA 4BGDA 2ZUCA 2K8BB 5KFYA 4YVZA 5ALHA 1ZQPA 2LYAA 4CE6A 4DFDA 2WFAA 2G06A 4YR0A 1ZQFA 5AKXA 4M9HA 3Q8MA 8ICRA 3KD3A 3NGDA 3JPTA 1T7PA 2HOIA 3BZKA 2BGWA 1KN5A 4DL5A 2IMWP 3Q8QB 4O3ZA 2F1CX 1SV4A 1QSSA 9ICJA 2K60A 2BPFA 3MBYA 4E1SA 3SV3A 2M06A 4JMUA 2PXIA 1ZQSA 2YY6A 2HHTA 2WF6A 3RJEA 1O08A 4FS1A 2WTFA 2XY6A 3T5JA 2G5HB 4QJFB 1BPEA 1NI3A 3PMNA 2KN7A 3QU2A 2R8KA 4YMMA 2B21A 5KFXA 4DSJA 3BZCA 4GHBA 2PMZC 4ECXA 1S5LU 1SWWA 4QZBA 1BPDA 3V7KA 2VIXA 4I2JA 5AKLA 5ALXA 5J0SA 1S8OA 4PJ0U 4PR7A 4FUVA 2PFQA 2EAPA 2NRVA 1N62A 2AGPA 2KSOA 3G7GA 2W3RA 1T8EA 2UVUA 3QUTA 1ZQIA 4AYID 3FAHA 2I6XA 2OWOA 3UXNA 5HR7A 1J97A 4QWAA 3VZWX 3K4GA 2N2MA 3E2EA 2K4HA 2BR0A 4B9VA 2F1TA 2EDUA 3CRXA 4JCHA 1IXRA 4DL2A 2A19A 3CYMA 5E79O 4FSPA 1SXEA 4WJ3B 2W9MA 3CW2C 1RPLA 4JB3A 3T5KA 2YMLA 2J4UP 2QARA 4GC6A 2GH1A 4M9GA 4AYBC 3RH4A 1O03A 4QIWF 1LB2B 3RAQA 2R18A 1JMSA 2IWVA 2PI4A 5ALZA 3GIKA 5JUMA 3PX0A 3SY9A 3FYHA 3QRAA 1ZHZA 4PZOA 3M1YA 1IZNB 2QB0B 2R8IA 3HKZC 8ICQA 7ICFA 2X9KA 2R4OA 5J2JA 4ED2A 5HP4A 4DSFA 5KFMA 2O6KA 3H0LB 2F44A 4QZAA 1H38A 2KXPA 2OCEA 3SZVA 1OW5A 5KFAA 4B9SA 3V8UA 1KW4A 4J9SA 1L7PA 4QZCA 1BXWA 3N7SC 2LMRA 2XO7A 4O3MA 5AKIA 4GC7A 3C28A 3PW2A 1XU4A 3ZD9A 4DFKA 5KG1A 3ZDEA 1ZQLA 3G6YA 3AA6A 3L4PA 5KG4A 1TE2A 1ZQNA 4FZMA 2JH7A 5KG2A 1RZTA 5J0RA 2AHOB 4DSLA 1DK2A 4F92B 5DBBA 4OD0A 2MU2A 2OMFA 1MQ2A 4Z6EA 3M9MB 4DWIA 4PHEA 1MM5A 1ZQVA 5KT6A 5J2BA 4TUPA 1ZQHA 3NSGA 4IL6O 2A1JB 4AKMA 3PGRA 2J6UA 2KOBA 3QNMA 4RPXA 3IN5A 4PL1A 2DFLA 3N4MB 2LYBA 3SAHA 1UPHA 4DOCA 4P0QA 5KFDA 2I5HA 4BWJA 3M9NB 3T24A 4LSHA 5CEHA 2PI5A 4YD1A 5KFZA 5ALYA 4O5KA 2WHEA 4O0IA 4F5OA 4K4GA 4FRTA 5KFQA 3HJEA 5JRTA 4EX6A 2PORA 1H6S1 4M6WA 1NZPA 7ICTA 4DLEA 2GO7A 2W9AA 3AA0B 5DKWA 3QUQA 3QU7A 4KN7A 4ECYA 4GXIA 1ZQMA 4QIWC 3VY9X 1QJPA 2YB1A 1DGJA 2ZTEA 4J9PA 1SV0C 3I76A 4I2AA 4KN4A 4DOBA 1PVPA 2HDOA 2PRNA 4AP9A 4DSEA 2KFNA 4ZOHC 3C5FA 3H0RB 2PFNA 2BZFA 3RJGA 3OPXA 4B9TA 1L7OA 3BQTA 3V72A 3GIMA 2MA1A 5H2FO 5DL7A 4DS5A 4EBCA 2KFZA 3SAFA 3JTYA 5J2IA 2HBJA 2KE7A 1HXUA 3RB0A 1CRXA 2ERVA 3H8WA 2E8NA 3GQCA 3KHLA 3GZFA 3PSIA 3NVVA 5ALFA 5DL5A 1GFQA 1L7MA 4E1TA 3SI8A 5KFOA 5J8YA 2LPEA 1FO4A 5IYUA 1FEZA 2J1NA 3EMNX 4EX7A 2OEHA 2W03A 1Q9GA 3GP6A 2FMSA 3F5AA 3IDWA 4JWMA 5KFIA 3RH6A 4KLSA 3GIIA 3HT3A 5ALSA 5KFFA 5BOMA 2WB1C 9ICIA 2ZUBA 3N7PD 2JR5A 4YG2A 2AH5A 3AUOA 5DGAA 4C69X 1PVQA 5AM3A 3TARA 1UCVA 1WCLA 1JRPA 4RQ8A 4DL4A 1IV8A 5J0TA 4RL9A 1JALA 4UB5A 2Y2XA 2HHVA 1ED1A 4KR4A 4GCPA 4XRHA 1VLBA 9ICVA 4BX9C 5KG3A 4Q43A 2HHXA 4MEXA 3UMGA 1RYSA 4R64A 4I27A 3IG8A 2W55A 5E79U 1ZD4A 4EBEA 5KL8B 3ETRA 3ISCA 5KFSA 1N63A 3E58A 2JXJA 5TZVA 4QW8A 1ZQAA 2P35A 1UA0A 1FFUA 1TK8A 8ICNA 2CRXA 3WKEA 3SZDA 5KFBA 5G3AA 1RXWA 5IINA 1KFSA 4F5RA 2FMPA 3PZPA 2JEJA 5HR6A 4UB2A 4TQSA 2XI9A 3SQIA 1L6NA 3F5EA 2E8OA 5K4LA 5JDPA 2W11A 2A1JA 2GWSA 1SB3C 4BXOB 4RJWA 5J0PA 2DKZA 4NM2A 3LK2A 2ZXHA 2F3NA 8ICTA 3PRNA 2GE4A 4G9BA 1Q46A 3WK4A 3THVA 4R63A 3K1ZA 3PSPA 1HXXA 5EWFA 4NLGA 1ZQTA 5IIOA 1ZQXA 4QZ9A 5KFKA 4UB4A 5IIJA 4ECTA 4NLZA 1L8OA 1PHOA 3PQUA 2XGPA 5KT2A 2J6SA 2IHMA 3KTQA 3PX6A 4UASA 4NY8A 1T4GA 4IL6U 2EAMA 2R8JA 5D46A 5DLGA 3NASA 4CF5A 1NJXA 2UVRA 4PHAA 5DDYA 2IOFA 3V6HA 4AFKA 5EE0A 4RUCA 3JPSA 5ALTA 5EWGA 2KZ3A 4RPYA 5AI8A 3LWLA 5CRXA 3T20A 1RG6A 1Z4OA 1T3NA 1PK1B 1ZHWA 1TFRA 2ES6A 4GFJA 5ALMA 1SIJA 3AU2A 3RBDA 3JPRA 5CB1A 2R89A 5G26A 3AL0B 1NOMA 4F4YA 2E8PA 1EXNA 4QZHA 4LZDA 4DOAA 4DQQA 2DF4B 4ED6A 3AM9A 5L1KA 2KHQA 2JMMA 1BGXT 3SV4A 4DL6A 2OYYA 4F2SA 4U6PA 2MAXA 8ICWA 5T14A 4CDGA 4YN4A 3A2SX 2EANA 3OJSA 7ICGA 1L3UA 3LK3A 5BOLA 2V9WA 4JV1A 4J03A 2ZJ5A 2NRZA 3C29A 4B61A 3BRYA 2F1HA 3DDHA 4ECZA 1WCNA 5DB6A 1L3SA 7ICRA 2XIDA 3PV8A 3B0YA 4PZNA 2Y0LA 1Z00A 1B43A 3RR8A 2O4VA 1S76D 5H2FU 2BKEA 4FT6A 1ZQQA 4FS2A 3AQFA 4P0PA 4US8A 2XCPA 4M9LA 4QWCA 3PX4A 8ICCA 4G76A 4ELUA 7ICVA 1TK0A 4NLCA 5KG0A 5TISO 2R8AA 4XQ8A 3FC4A 2KDYA 3PNCA 2ODGA 5DB7A 2OXOA 2KTQA 1QSLA 2W9BA 4LSIA 1PUZA 1JUDA 5AI0A 1XSLA 4IQWA 4IQVA 3RF9A 1LVHA 3V7JA 3LK41 2BQRA 3RTVA 3BJYA 1DRGA 2KHVA 1NJWA 5HHHA 2CXYA 5GTIO 2FMQA 1Z1VA 5AI6A 2G08A 2HVIA 4JUZA 3PW0A 1ZQCA 3H8SA 1NJZA 1ZQJA 3UM9A 4F5NA 2G07A 2BCSA 1NK6A 5CP2A 1S0VA 2BDPA 2JHDA 5ALRA 3RH5A 4DLGA 7ICNA 4F4ZA 3Q8RB 4Y2VA 3KKAC 4FMSA 3LWMA 3BS7A 1N5XA 4P2HA 1PVRA 2NYVA 3GFKB 3AN1A 4DEZA 4BXOA 2W3SA 1BNOA 4B9MA 4PGXA 1ZXIA 3SEIA 2XVTA 2Y1JA 9ICKA 5J2AA 1X6IA 3MR3A 4D65A 2V4RA 3OJUA 5KFHA 1FIQA 1BPBA 2DUYA 5AM2A 1NK9A 8ICUA 4NL9A 4O3PA 4ELVA 1GO3F 2BDUA 2K8CB 5KT5A 2W80C 4O3QA 4QZDA 1BPXA 1V38A 9ICAA 4Y2XA 4MFFA 4R8UB 2F8LA 2VKQA 4DCCA 3SYZA 1A0PA 1RYRA 4MF2A 3ZDDA 1GFMA 3C2MA 4C4SA 4ECUA 1AQ6A 3HPOA 2B0CA 4O3WA 2FDRA 2VANA 3QUCA 4RQ4A 3AAAB 5ALKA 3A0HO 1SV0A 4F4WA 4K4HA 1COKA 3HW8A 4KLHA 2D3DA 2JZBB 7ICMA 3M9OB 1XSPA 3LVWA 3KHGA 3M8SA 3LDAA 2KEYA 3S6JA 1HUZA 1IG6A 5J0QA 3WK8A 1TVAA 2YMPA 1ZD2P 5EWEA 1QCKA 1X42A 2NRXA 2A3VA 3U26A 5HMMA 3SZ2A 4GCQA 4C8NA 1S9FA 4C4RA 3RB3A 1UHUA 1OUQA 5DQIA 4MF8A 4ED7A 7ICUA 4TUSA 4BWMA 2W8KA 1BH3A 4USAA 2MSNA 3PVXA 1LKYA 2Y0HA 3IP4B 5AFUK 4IC9A 3NTUA 1QTMA 1QLNA 8ICAA 2VJ4A 7ICJA 2Y0SC 5DL6A 5AKHA 3PR5B 5AKGA 1HUOA 3AU6A 4C00A 1ZQKA 2OHFA 1U9LA 4N75A 1QQ7A 1X9XA 5JU5A 5KFNA 4QZIA 3MGVA 4KLJA 4Q8FA 4PGQA 4X5VA 5ALNA 9ICOA 3NVYA 2XE1A 4O3YA 2BQUA 3D2QA 4KTQA 5KT7A 4F4XA 2NV3A 3KHHA 5J0YA 2XCAA 4NLBA 1ZQBA 4GXJA 3ZD8A 4J9QA 4KLOA 4P4MA 5L1JA 1NZBA 4F8RA 4TURA 1K1QA 3HP6A 3BQ0A 3MGHA 4AKRB 1RQLA 3OSPA 2E1FA 4AYDC 2H3IA 1F5SA 4D5UA 2FJ6A 2ZIVB 5J2EA 2HSZA 2E8MA 3WK6A 2V4QA 3D2NA 1NK7A 3WK5A 1ZYQA 2MUTB 1JROA 3F2DA 1TAQA 4F2RA 4KLGA 5DL8A 1D8YA 1QQ5A 3RAXA 2JGAA 3AA1B 4KLTA 3LK9A 1BVSA 2E1EA 1S77D 5FP0A 1YS5A 2Z7JA 4KLLA 1GFNA 4O5CA 2NO5A 4HAIA 2ODJA 2Y7SA 3KOOA 5TISU 4Y2JA 1ZQDA 4NL9C 3C23A 3D2SA 2W54A 3EW9A 4RQMA 2C2RA 4Y2TA 5AKYA 1P4TA 2RRDA 3WKCA 2ZIUB 5ALVA 4ACOA 7ICIA 3ISDA 3KBBA 4I2IA 3RBEA 1C7YA 5GTIU 9ICBA 4F5PA 8ICJA 3O0FA 4PHDA 2W8LA 4R8UA 4IRCA 3POUA 4XUSA 1Q3UA 1V97A 3MDCA 2K4IA 1KQQA 2R4PA 2XMXA 2AGOA 4RT3A 4Z6DA 1A76A 2VA3A 3AQEA 5DG7A 2RHFA 4EZ9A 4ECRA 8ICMA 1NKEA 2LM4A 5ALPA 2AU0A 2AGQA 2ZLDA 1X9SA 2HBMA 3PQSA 4YFKA 1XC9A 5ALIA 5D4BA 1YT3A 1VDVA 2IOFK 2NRTA 1OXJA 4DSIA 5EE9A 2JZBA 2VJ5A 3H8JA 1SL2A 4RQ5A 1WG8A 2AJQA 1KTQA 1HIWA 1NKBA 2ZJAA 5DG8A 1SKSA 5EE2A 1WWVA 1TKDA 1J2MA 2BPCA 1X9WA 3VC8A 3PO4A 4O5EA 2M9NA 3IV6A 4F3OA 3SENA 1QJ9A 2EZYA 4AYNA 3AEVA 7ICKA 4J9MA 3K1RB 4K3BA 4QWDA 4DS4A 1UT5A 1JXLA 4US9A 3EPGA 4O49A 1Q9FA 3UMCA 5PRNA 2OH2A 8ICLA 1ZQOA 5ADXL 3T3FA 3CNHA 9ICFA 2F1VA 2Y9UA 4XNLA 3A0HU 2KMDA 1T94A 2FI1A 3H0MB 2XE3A 4K4IA 3RRGA 5GV0A 4XA5A 4F72A 4AZLA 5HNKA 3UAQA 2HHQA 4GCSA 3PY8A 4O4XA 1NNLA 4RPZA 2ASDA 3KZXA 4RNOA 4YQWA 4MFAA 3BS5B 9ICSA 4C8MA 4PL2A 3VZTX 4N58A 1IZNA 2QB0A 5ALGA 1UT8A 1N48A 1D9DA 1IM4A 2KZ7B 5AI9A 1SL1A 3B9JA 4FOZA 4XNKA 4JV2A 5EE1A 3QEBZ 2F2AB 1C20A 3AA7B 4KLIA 4RU9A 4RQ2A 3RB4A 4E0DA 2IHNA 4AKRA 2W43A 4FRXA 3PW4A 1ZQGA 3MFHA 3V6JA 2F76X 5J0WA 4KLUA 1VJ5A 2DPJA 4KRAA 5ALUA 4R66A 1D8LA 4KMUA 5AM4A 7ICHA 5J0XA 3BQ7A 5AI4A 1RYUA 3L5KA 4I2GA 4QNLA 1KDHA 4IR9A 4JV0A 3WI4A 3QU9A 1WYGA 4CGZA 3T5LA 4C8LA 4O4UA 3SR6A 3Q8SB 3KKAA 3QU5A 4EEKA 2K0LA 3F53A 4GIBA 3JPQA 9ICQA 3SD7A 3H4BA 2FLLA 2XTQA 1ZD3A 1ZOLA 2ZIUA 3J81j 4FQEA 4J9LA 5J2DA 3OHAA 4ECQA 3FDSA 2EZZA 2KKPA 1U49A 4UW9A 7ICEA 1HXTA 4C4VB 3NRZA 5DB9A 2BQ3A 3F2CA 2KJ5A 2W9CB 2FLNA 4DFMA 4Y2PA 3AA0A 4OJ5A 1MC8A 2YTUA 4MHVA 3NJTA 5AM0A 2KC0A 3JPNA 4PH5A 2EQYA 1V85A 5G38A 5EE3A 4LSEA 4FE3A 2JMGA 4F93B 4ECWA 3H7IA 1L3TA 2H3VA 2VA2A 2XGQA 4RQNA 5G39A 2P6RA 1ZQZA 2C2DA 8ICYA 4N74A 2ZTDA 3I28A 2WAQF 5D49A 5KNIA 4ED3A 3M8RA 2A1AA 2Y0KA 8ICVA 2IOHA 1ZQ1C 4FZLA 5ALQA 4UB8O 2L5YA 3UQ0A 3L3FX 4RLCA 5AK5A 4C7ZA 3PR4A 5DB8A 4UB3A 1T3QA 3IRUA 2YQEA 2E3TA 5B5EO 3PW7A 2NRWA 9ICRA 1URJA 4N59A 3N97B 1K5OA 2I9GA 1S10A 2ASJA 1DXSA 1HEKA 2IBKA 4IQUA 3NRWA 9ICHA 3HW9A 4O3SA 1F44A 4NV0A 3GV7B 1DOQA 9ICLA 4YR2A 2UVWA 3UXPA 4FSOA 4YMOA 1YZ6A 2H3FA 1S97A 3GV5B 5KAIO 4Q44A 3WKDA 1KKXA 1SWVA 3TFRA 1KEJA 3B0XA 3QRCA 4D64A 5KG5A 3RBHA 4LZGA 2DQNB 5AIAA 4UARA 2DPIA 5AKZA 3TKAA 4Z3TA 3BS5A 2OM6A 2QARB 4Z6FA 3G6VA 4ECSA 2XG6A 4F50A 2HHUA 4UB1A 1JI7A 1UA1A 4P4PA 1N61A 9ICXA 2KZ7A 2ATLA 3KFUF 4G3IA 2MNHA 2YX8A 4RNNA 3G6XA 2BCRA 1ORMA 4C0ZA 3TZGA 1U47A 2M07A 4F4BA 4Y2UA 4QZEA 2KK0A 2HCFA 3T79A 4DL3A 4C8KA 1E54A 3BRZA 2LHTA 2QTKA 4YMNA 3GILA 1BT9A 2PMZF 3OTQA 2HI0A 4GF4A 3KVDD 4RZRA 1ZETA 2FPKA 3MGIA 4C80A 3VCBA 3BDPA 1KRPA 2F8KA 3TAQA 9ICNA 1L5UA 3C5GA 5KFCA 2KXPB 4M04A 5J2HA 4LJXA 2KVSA 4FBUA 4CF4A 4TQRA 3PSTA 5C0YA 4CF3A 3PW5A 5ALWA 2XE5A 1ZQWA 1TK5A 3VZUX 1L3VA 3AMZA 2LFUA 5CA7A 3QZ8A 3TI0A 2ASLA 2JV3A 1J2NA 3RJFA 3IHQB 2PFPA 4EELA 7ICSA 3K75D 4UB6O 1Z3EB 3JPOA 4G75A 1OSMA 2ISPA 2Q0ZX 4RQ0A 8ICZA 5L9XA 1ZRNA 4B9NA 1ZHTA 1MSWD 2ISOA 2YNKA 1RM6C 2WF7A 4J9OA 1DGSA 5T5FA 1V9PA 4O3OA 1RQNA 1A77A 5L1MA 3SAGA 4EYIB 3DA3A 2YMQA 4UAVA 1MN8A 2AQ4A 2H3ZA 3H8MA 2W9CA 5F3XB 2AXTO 3PORA 5KFEA 4GLXA 2WJQA 2HBKA 4I2CA 2DKXA 5KFPA 2WVPA 1M6YA 3ORYA 4PPXA 2HW3A 4QQ1A 9ICCA 5G5GA 4EYHB 3HKZF 2RDJA 1WWUA 4HYKA 2Y9TA 4M6WB 4ECVA 8ICEA 5ALOA 3IG5A 1QQ6A 4ELTA 1PRNA 3MFIA 1KSPA 2JEFA 4AYMC 5ALDA 5CHGA 8ICKA 3KZIO 2CPRA 4IRKA 5AI5A 4UBCA 3MDAA 3BS0A 3LVVA 3Q8LA 1PK1A 5C5JA 4I2FA 2XY7A 1NK5A 2H3QA 1NK0A 4YXMA 1QJ8A 1X40A 2D6FC 4YP3A 1D9FA 3H40A 2BPGA 4M9JA 1QH9A 4KLDA 4O3RA 8ICHA 2H5XA 1PK3A 3JPPA 5FVNA 2HHSA 5AKKA 4J9NA 1BPZA 2C2EA 5EOZA 4DF4A 2LKYA 5DG9A 1NKCA 5KAFO 5GTHO 2YMMA 3QUBA 3MR2A 4ED1A 8ICPA 3ZDCA 2XC9A 1WUDA 1KFTA 5G5HA 3OSNA 5B66O 5KFVA 4NM1A 4TUQA 4UB8U 2Y1IA 3PGSA 5IILA 3UQ2A 4Q8EA 1MQ3A 9ICMA 2P6UA 2P66A 1SKWA 9ICEA 1F0MA 3WU2O 3ALRA 2BHNA 4O3XB 4IS7A 1UQVA 5B5EU 4IR1A 2C22A 2BCVA 2DWQA 3QU4A 5AICA 7ICPA 1AROP 3DWNA 4UAUA 4DL7A 2QKQA 3M6KA 2AQ0A 1MM4A 4CTDA 2IWWA 4KX3A 4M47A 1XO1A 2DGZA 4OJLA 3ZDAA 1N2XA 3TFSA 3FM9A 1HJPA 6PRNA 5KAIU 1TAMA 4F91B 2ZIWB 3MR5A 4K3CA 5ALEA 1ZQYA 1S0MA 1U48A 5AK3A 1PZNA 4QWEA 1L7NA 4ICAA 3EWAA 3ICXA 5J2FA 3POXA 3ONNA 4I29A 4QWBA 4F71A 5ALLA 1GFPA 4O9MA 8ICGA 3PO5A 8ICBA 4J9KA 4RJXA 3N7RC 7ICQA 3VE2A 5KTQA 2IA6A 3K19A 2RLTA 4F4KA 4C4TA 5KL1B 3TANA 4Y2QA 4CRXA 3HILA 4UQGA 1YZ7A 2ZUDA 8PRNA 3O0EA 3NUQA 1Z1BA 9ICTA 3LK2B 1JN3A 2WB1F 4B9UA 4RLBA 2JH1A 1CI4A 1SXDA 2JEIA 3BQ2A 2I1QA 4QZGA 2F77X 4B9LA 3GDXA 3TAPA 2K4EA 2FPMA 1Z19A 1T16A 2HOQA 1QSYA 4NLNA 3QXGA 2B6GA 4EZ6A 3WK7A 2RQ5A 3GU3A 4QW9A 4RQ6A 5DDMA 1L8LA 4CCHA 9ICPA 1MPFA 4DQSA 2PKEA 2KJ9A 3Q8KA 3SY7A 4DSKA 8ICXA 2NO4A 3MABA 2M0NA 1B4FA 3AAAA 2R8GA 1Y88A 3TADA 4UB6U 1U4BA 3DWOX 2JQYA 4M9NA 4UAYA 4FBTA 2WF9A 2D8CA 5KFRA 4QZFA 5KG6A 3RFAA 5CWRA 2UVVA 3KHRA 2HHWA 3ETLA 4KMOB 5IIIA 3SMVA 1GFOA 2AXTU 4RNMA 4OO1J 5KFTA 2CN1A 3BQ1A 1SZPA 5L1IA 1X66A 4YD2A 2HVHA 2C28A 2J6TA 4U9CA 5DBAA 3LK42 3QX7A 2XY5A 1XNSA 5HHIA 3MR6A 4DQPA 2LBOA 1KBUA 2LI6A 9ICUA 1Z4NA 3HX0A 2R8HA 3R9KA 4DFJA 2N1RA 1RXVA 2KIVA 2KVCA 2GLEA 3PGUA 2FLPA 3QEAZ 3UMBA 3Q8PB 3KZIU 4BUGA 3WI5A 3RJIA 3PSFA 3DV9A 3VY8X 4UATA 1XS9D 3LK3B 2YN4A 5AKJA 9ICWA 2MRLA 2R4LA 2W81C 5AKEA 3VE1A 1S0OA 4C7YA 3DEEA 2LYHA 5DGBA 2QB1A 4J9RA 2JRZA 4Z6CA 3A0BO 2KV2A 4UAWA 3POQA 3H4DA 2ZIXB 9ICGA 4BDPA 1Z00B 3AAEB 3TQ1A 5AK6A 3C2LA 2Q4TA 4MEYA 8ICIA 3M6ZA 1ZJNA 2F1JA 3V7LA 5DQHA 4P0PB 5ALJA 5J2GA 1XWLA 3EPIA 3EYZA 4DO9A 4RT2A 1N56A 3NVWA 4OJOA 5KAFU 3C1ZA 4FZNA 5GTHU 3LYSA 4EENA 2FGRA 2W9BB 3GIJA 2YPVA 5B66U 2ZXIA 4ED0A 5JTIA 1X6JA 3M7DA 3C1YA 4A8EA 4JFBA 3RJKA 2ZIVA 2ZIWA 5J2CA 5DQGA 3HWTA 1SKRA 1G90A 4OJPA 1NJYA 4QZ8A 2MUTA 5IIMA 3WU2U 3HOEA 4ED8A 2ALZA 4Q45A 2K4PA 1T1LA 3AA1A 3FYXA 3NS1A 4PHPA 4M2YA 2K4TA 1ZD5A 4Y2SA 4DF8A 2W04A 5KT3A 2WJRA 3D6JA 5KFLA 4EEYA 3EZ5A 2EAOA 1JX4A 1TAUA 4P4OA 1BNPA 2KZMA 3PMLA 3ISBA 2KICA 3EUB2 4KLFA 2W7OA 4YR3A 1SL0A 2X27X 4KLEA 3SYBA 3NVZA 4B6JA 1IIPA 4FESA 2K8AA 4Y2RA 4RUAA 1ZQEA 5HMLA 2WF5A 1P7DA 2KJ8A 4M0AA 4I2EA 1ZRMA 2F1IA 1S5LO 3MC1A 3ZDBA 5F9NA 2DL0A 5ADXK 4I2BA 3F2BA 4YCXA 5KFUA 4PJ0O 5AK4A 7ICLA 4FO6A 1U45A 3TADC 1ZHXA 3ZI4A 1XO0A 2G0AA 1JXEA 3QYPA 4Y2YA 4PGYA 2FE9A 4I2HA
chains in the Genus database with same CATH topology
3UU2A 2NV3A 2YB4A 5DL5A 1GFQA 4E1TA 4NLBA 4G75A 2HMXA 1OSMA 5IYUA 3T0SA 2J1NA 2ZG6A 1NZBA 3EMNX 2G5IB 1ZHTA 2YNKA 2W03A 4AUIA 1Q3VA 1Q9GA 5T5FA 3GP6A 1SZHA 3F5AA 4AKRB 3SAGA 2E1FA 3DA3A 4AYDC 2H3IA 2H3ZA 4D5UA 3PORA 2RP5A 2XICA 2ZIVB 2HBKA 2WB1C 2KNJA 3D2NA 4OJ6A 3N7PD 3F2DA 4QQ1A 5DL8A 3HKZF 2ZFGA 2JGAA 3AA1B 1PVQA 4C69X 2E1EA 1YS5A 2Z7JA 1GFNA 1A6SA 3E0FA 2KKVA 2ODJA 2Y7SA 3IG5A 2W7PA 1PRNA 4RL9A 2Y2XA 2K89A 1ED1A 1D8BA 4AYMC 3D2SA 4KR4A 4BJQA 2E5SA 4GCPA 4BUMX 4KX5A 4BX9C 2CPRA 2KIWA 2XE2A 1P4TA 3LVVA 2RRDA 2XTRA 3CP8A 2ZIUB 3IG8A 2LHFA 4ACOA 5KL8B 3UPGA 2H3QA 2G09A 1QJ8A 3O0FA 2GOLA 2D6FC 2ZIXA 3AAEA 2CRXA 3POUA 1Q3UA 2K4IA 3SZDA 5FVNA 2XMXA 3PZPA 5HR6A 3SYSA 2XI9A 3SQIA 3AQEA 1L6NA 3F5EA 1ECWA 3AA7A 2RHFA 5JDPA 2LKYA 4LSFA 4KR8A 2ZLDA 3HOLA 2HBMA 7PRNA 3PQSA 4RJWA 1WUDA 1YT3A 5A0LA 3LK2A 2ZXHA 3PRNA 2HBLA 2GE4A 3C5OA 2WAQC 2VJ5A 1OPFA 3K1ZA 3PSPA 1HXXA 4AYEC 2KD1A 2HOFA 3DA4A 4NWIA 3ALRA 1HIWA 1THQA 3HWBA 4O3XB 5EE2A 2N2LA 3VC8A 1PHOA 3AA6B 3PQUA 1ZHYA 1QJ9A 1MA7A 4AYNA 5AFUL 3M6KA 2FGQX 4U7CA 1MM4A 4O49A 1Q9FA 5PRNA 2OH2A 5ADXL 4PUXA 4KX3A 2MHLA 2DGZA 4OJLA 4AYBF 2F1VA 4XNLA 2Y0SF 4AFKA 1T94A 6PRNA 3H0MB 2XE3A 4P0QB 5CRXA 3T20A 5GV0A 1TAMA 3UAQA 4AZLA 5D5DA 4GCSA 2ZIWB 4O4XA 2K8BB 1ZHWA 2LYAA 4GFJA 2G06A 3KZXA 4ICAA 5G26A 3ICXA 3AL0B 3VZTX 4PL2A 4N58A 2HOIA 1IZNA 3POXA 2DF4B 3ONNA 2KZ7B 4O3ZA 2KHQA 1GFPA 2JMMA 4E1SA 2M06A 4JMUA 2OYYA 4RJXA 3N7RC 3VE2A 4FOZA 4XNKA 4U6PA 2F2AB 3K19A 5T14A 4CDGA 3AA7B 3A2SX 5KL1B 4CRXA 3LK3A 2G5HB 4QJFB 3C29A 4AKRA 4B61A 8PRNA 3O0EA 3NUQA 1Z1BA 3LK2B 4FRXA 4GHBA 2XIDA 2PMZC 2WB1F 4RLBA 2JH1A 2Y0LA 2F76X 2O4VA 2VIXA 2F77X 4KRAA 2K4EA 4FT6A 1Z19A 3AQFA 2HOQA 4FUVA 4P0PA 3GU3A 3G7GA 4QNLA 4G76A 4AYID 4NLCA 1MPFA 3WI4A 5HR7A 2KJ9A 2KDYA 4CGZA 3SY7A 4O4UA 2M0NA 2OXOA 3AAAA 3VZWX 4LSIA 2K0LA 3F53A 2N2MA 3RF9A 2K4HA 2F1TA 3CRXA 4JCHA 3LK41 2XTQA 3CYMA 2ZIUA 4FSPA 4WJ3B 1DRGA 2KHVA 3RFAA 2KKPA 1HXTA 2J4UP 2GH1A 2G08A 3F2CA 4KMOB 2KJ5A 3SMVA 1GFOA 4AYBC 4QIWF 2G07A 2R18A 3AA0A 4OO1J 2CN1A 4OJ5A 2JHDA 3SY9A 2KC0A 4U9CA 3LK42 1XNSA 3QRAA 1ZHZA 2LBOA 4LSEA 4FE3A 2JMGA 1KBUA 4FMSA 1IZNB 3HKZC 2H3VA 1PVRA 2N1RA 2WAQF 2KVCA 2Y0KA 3H0LB 2XVTA 1ZQ1C 3WI5A 4BUGA 4FZLA 2KXPA 3PSFA 3VY8X 4D65A 3SZVA 3V8UA 3LK3B 3L3FX 4RLCA 2MRLA 2W81C 3VE1A 1BXWA 1GO3F 2BDUA 3N7SC 3DEEA 2K8CB 4O3MA 2W80C 3C28A 3POQA 2KV2A 2ZIXB 3AA6A 2F8LA 2VKQA 3AAEB 4FZMA 2Q4TA 1URJA 4N59A 2JH7A 1A0PA 3M6ZA 2OMFA 1MM5A 4P0PB 1GFMA 1HEKA 3NSGA 3NRWA 4AKMA 3HW9A 4OJOA 2KOBA 4O3WA 1F44A 4NV0A 4FZNA 3LYSA 3IN5A 4PL1A 4FSOA 3AAAB 2FGRA 2H3FA 2LYBA 2YPVA 2ZXIA 3SAHA 1UPHA 4P0QA 3M7DA 4A8EA 4JFBA 2ZIVA 2ZIWA 3T24A 3LVWA 4LSHA 1G90A 2KEYA 4OJPA 3QRCA 4D64A 3RBHA 3HOEA 4FRTA 2DQNB 4Z3TA 2PORA 1H6S1 2OM6A 3AA1A 3FYXA 2XG6A 2K4TA 2W04A 3AA0B 2KZ7A 2A3VA 3KFUF 2MNHA 4GCQA 2YX8A 4QIWC 3VY9X 1QJPA 2YB1A 1ORMA 1OUQA 4C0ZA 3TZGA 2M07A 4F4BA 3T79A 2KICA 2W7OA 1BH3A 2X27X 1E54A 3SYBA 2LHTA 2QTKA 1PVPA 1BT9A 1IIPA 2PRNA 2PMZF 2Y0HA 4FESA 3IP4B 2K8AA 4GF4A 5AFUK 4IC9A 3H0RB 1P7DA 3KVDD 2KJ8A 3VCBA 2VJ4A 3OPXA 2KXPB 2Y0SC 5DL6A 5ADXK 2MA1A 3F2BA 5DL7A 3PSTA 3SAFA 3JTYA 3MGVA 5C0YA 2HBJA 1ZHXA 2XE5A 1XO0A 1HXUA 3VZUX 2LFUA 2G0AA 1CRXA 2ERVA 2XE1A 4O3YA 3GZFA 3D2QA 3PSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XTR A;  3DA3 A;  4N59 A;  4FZM A;  2XTQ A;  4FZN A;  4FZL A;  4G76 A;  3DA4 A;  4N58 A;  4G75 A;  2XMX A; 
#chains in the Genus database with same CATH topology
 3UU2 A;  4KIT B;  2YB4 A;  4JK1 A;  2ESE A;  1X2I A;  2HMX A;  3T0S A;  4NJ8 A;  5J0O A;  1NK8 A;  2ZG6 A;  4OCZ A;  3C2K A;  1JIH A;  2G5I B;  1CUK A;  3IM1 A;  4AUI A;  1Q3V A;  4CNQ A;  1SZH A;  4KLQ A;  3WK9 A;  1ZQU A;  3WKB A;  3QE9 Y;  1COO A;  2RP5 A;  5F9L A;  2XIC A;  3RRH A;  2R4N A;  2KNJ A;  3N28 A;  4OJ6 A;  1DK3 A;  8ICF A;  5KG7 A;  3RJJ A;  5AM1 A;  4NXZ A;  1TV9 A;  4R65 A;  2KSO B;  2ZFG A;  4IRD A;  4F5Q A;  5J8Y C;  1A6S A;  3E0F A;  2DBY A;  2KKV A;  4C8O A;  2W7P A;  4KLM A;  2K89 A;  1D8B A;  2VA8 A;  2FPL A;  3TAC B;  4BJQ A;  2E5S A;  4BUM X;  2R88 A;  4KX5 A;  5KT4 A;  2KIW A;  2XE2 A;  2ZTC A;  5DBC A;  3UXO A;  2XTR A;  3CP8 A;  5KFG A;  1N5W A;  2LHF A;  4JWN A;  4NLK A;  5J29 A;  4DFP A;  2QLT A;  5J0U A;  1LKY B;  1SGG A;  2EH9 A;  3UPG A;  2G09 A;  3HRD D;  5J2K A;  2GOL A;  7ICO A;  5AHX A;  4EBD A;  2ZIX A;  3C21 A;  3AAE A;  3OGU A;  2LM1 A;  3PF1 A;  4DQR A;  3RB6 A;  1FFV A;  2EZX A;  3DZM A;  2JEG A;  3SYS A;  1ECW A;  3AA7 A;  2PFO A;  2BCU A;  1KFD A;  4LSF A;  2KG5 A;  4MFC A;  5IIK A;  4KR8 A;  3OHB A;  3HOL A;  5AM5 A;  3QZ7 A;  7PRN A;  2KP7 A;  1ZJM A;  1KLN A;  8ICO A;  5A0L A;  1ZQR A;  4LVS A;  5AIB A;  2HBL A;  3V6K A;  3C5O A;  5BPC A;  2WAQ C;  2RDI A;  4I28 A;  1OPF A;  1X9M A;  4AYE C;  5KFJ A;  3T5H A;  2KD1 A;  2HOF A;  3DA4 A;  4NWI A;  2KZZ A;  5CJ7 A;  5CR0 A;  4RQ3 A;  5DLF A;  1THQ A;  3HWB A;  1B0X A;  1B22 A;  2N2L A;  2WF8 A;  4DQI A;  3UPQ A;  8ICS A;  3I1Y A;  4O3N A;  3A0B U;  3AA6 B;  3GV8 B;  1ZHY A;  1S0N A;  4RQ7 A;  5L1L A;  1MA7 A;  5KFW A;  4UAZ A;  5AFU L;  3RR7 A;  2FGQ X;  4GXK A;  4U7C A;  3RJH A;  4UBB A;  4YXJ A;  1RDF A;  3WKA A;  1NK4 A;  4RQ1 A;  4PUX A;  2MHL A;  3ED5 A;  1LV5 A;  4AYB F;  1N60 A;  4C4V A;  1KL9 A;  2Y0S F;  1Q8K A;  1BPY A;  4ZH4 A;  4IQT A;  4FFD A;  1K1S A;  4I2D A;  3JCU O;  4P0Q B;  2ZJ8 A;  1CEZ A;  5D5D A;  1XSN A;  2BCQ A;  4BGD A;  2ZUC A;  2K8B B;  5KFY A;  4YVZ A;  5ALH A;  1ZQP A;  2LYA A;  4CE6 A;  4DFD A;  2WFA A;  2G06 A;  4YR0 A;  1ZQF A;  5AKX A;  4M9H A;  3Q8M A;  8ICR A;  3KD3 A;  3NGD A;  3JPT A;  1T7P A;  2HOI A;  3BZK A;  2BGW A;  1KN5 A;  4DL5 A;  2IMW P;  3Q8Q B;  4O3Z A;  2F1C X;  1SV4 A;  1QSS A;  9ICJ A;  2K60 A;  2BPF A;  3MBY A;  4E1S A;  3SV3 A;  2M06 A;  4JMU A;  2PXI A;  1ZQS A;  2YY6 A;  2HHT A;  2WF6 A;  3RJE A;  1O08 A;  4FS1 A;  2WTF A;  2XY6 A;  3T5J A;  2G5H B;  4QJF B;  1BPE A;  1NI3 A;  3PMN A;  2KN7 A;  3QU2 A;  2R8K A;  4YMM A;  2B21 A;  5KFX A;  4DSJ A;  3BZC A;  4GHB A;  2PMZ C;  4ECX A;  1S5L U;  1SWW A;  4QZB A;  1BPD A;  3V7K A;  2VIX A;  4I2J A;  5AKL A;  5ALX A;  5J0S A;  1S8O A;  4PJ0 U;  4PR7 A;  4FUV A;  2PFQ A;  2EAP A;  2NRV A;  1N62 A;  2AGP A;  2KSO A;  3G7G A;  2W3R A;  1T8E A;  2UVU A;  3QUT A;  1ZQI A;  4AYI D;  3FAH A;  2I6X A;  2OWO A;  3UXN A;  5HR7 A;  1J97 A;  4QWA A;  3VZW X;  3K4G A;  2N2M A;  3E2E A;  2K4H A;  2BR0 A;  4B9V A;  2F1T A;  2EDU A;  3CRX A;  4JCH A;  1IXR A;  4DL2 A;  2A19 A;  3CYM A;  5E79 O;  4FSP A;  1SXE A;  4WJ3 B;  2W9M A;  3CW2 C;  1RPL A;  4JB3 A;  3T5K A;  2YML A;  2J4U P;  2QAR A;  4GC6 A;  2GH1 A;  4M9G A;  4AYB C;  3RH4 A;  1O03 A;  4QIW F;  1LB2 B;  3RAQ A;  2R18 A;  1JMS A;  2IWV A;  2PI4 A;  5ALZ A;  3GIK A;  5JUM A;  3PX0 A;  3SY9 A;  3FYH A;  3QRA A;  1ZHZ A;  4PZO A;  3M1Y A;  1IZN B;  2QB0 B;  2R8I A;  3HKZ C;  8ICQ A;  7ICF A;  2X9K A;  2R4O A;  5J2J A;  4ED2 A;  5HP4 A;  4DSF A;  5KFM A;  2O6K A;  3H0L B;  2F44 A;  4QZA A;  1H38 A;  2KXP A;  2OCE A;  3SZV A;  1OW5 A;  5KFA A;  4B9S A;  3V8U A;  1KW4 A;  4J9S A;  1L7P A;  4QZC A;  1BXW A;  3N7S C;  2LMR A;  2XO7 A;  4O3M A;  5AKI A;  4GC7 A;  3C28 A;  3PW2 A;  1XU4 A;  3ZD9 A;  4DFK A;  5KG1 A;  3ZDE A;  1ZQL A;  3G6Y A;  3AA6 A;  3L4P A;  5KG4 A;  1TE2 A;  1ZQN A;  4FZM A;  2JH7 A;  5KG2 A;  1RZT A;  5J0R A;  2AHO B;  4DSL A;  1DK2 A;  4F92 B;  5DBB A;  4OD0 A;  2MU2 A;  2OMF A;  1MQ2 A;  4Z6E A;  3M9M B;  4DWI A;  4PHE A;  1MM5 A;  1ZQV A;  5KT6 A;  5J2B A;  4TUP A;  1ZQH A;  3NSG A;  4IL6 O;  2A1J B;  4AKM A;  3PGR A;  2J6U A;  2KOB A;  3QNM A;  4RPX A;  3IN5 A;  4PL1 A;  2DFL A;  3N4M B;  2LYB A;  3SAH A;  1UPH A;  4DOC A;  4P0Q A;  5KFD A;  2I5H A;  4BWJ A;  3M9N B;  3T24 A;  4LSH A;  5CEH A;  2PI5 A;  4YD1 A;  5KFZ A;  5ALY A;  4O5K A;  2WHE A;  4O0I A;  4F5O A;  4K4G A;  4FRT A;  5KFQ A;  3HJE A;  5JRT A;  4EX6 A;  2POR A;  1H6S 1;  4M6W A;  1NZP A;  7ICT A;  4DLE A;  2GO7 A;  2W9A A;  3AA0 B;  5DKW A;  3QUQ A;  3QU7 A;  4KN7 A;  4ECY A;  4GXI A;  1ZQM A;  4QIW C;  3VY9 X;  1QJP A;  2YB1 A;  1DGJ A;  2ZTE A;  4J9P A;  1SV0 C;  3I76 A;  4I2A A;  4KN4 A;  4DOB A;  1PVP A;  2HDO A;  2PRN A;  4AP9 A;  4DSE A;  2KFN A;  4ZOH C;  3C5F A;  3H0R B;  2PFN A;  2BZF A;  3RJG A;  3OPX A;  4B9T A;  1L7O A;  3BQT A;  3V72 A;  3GIM A;  2MA1 A;  5H2F O;  5DL7 A;  4DS5 A;  4EBC A;  2KFZ A;  3SAF A;  3JTY A;  5J2I A;  2HBJ A;  2KE7 A;  1HXU A;  3RB0 A;  1CRX A;  2ERV A;  3H8W A;  2E8N A;  3GQC A;  3KHL A;  3GZF A;  3PSI A;  3NVV A;  5ALF A;  5DL5 A;  1GFQ A;  1L7M A;  4E1T A;  3SI8 A;  5KFO A;  5J8Y A;  2LPE A;  1FO4 A;  5IYU A;  1FEZ A;  2J1N A;  3EMN X;  4EX7 A;  2OEH A;  2W03 A;  1Q9G A;  3GP6 A;  2FMS A;  3F5A A;  3IDW A;  4JWM A;  5KFI A;  3RH6 A;  4KLS A;  3GII A;  3HT3 A;  5ALS A;  5KFF A;  5BOM A;  2WB1 C;  9ICI A;  2ZUB A;  3N7P D;  2JR5 A;  4YG2 A;  2AH5 A;  3AUO A;  5DGA A;  4C69 X;  1PVQ A;  5AM3 A;  3TAR A;  1UCV A;  1WCL A;  1JRP A;  4RQ8 A;  4DL4 A;  1IV8 A;  5J0T A;  4RL9 A;  1JAL A;  4UB5 A;  2Y2X A;  2HHV A;  1ED1 A;  4KR4 A;  4GCP A;  4XRH A;  1VLB A;  9ICV A;  4BX9 C;  5KG3 A;  4Q43 A;  2HHX A;  4MEX A;  3UMG A;  1RYS A;  4R64 A;  4I27 A;  3IG8 A;  2W55 A;  5E79 U;  1ZD4 A;  4EBE A;  5KL8 B;  3ETR A;  3ISC A;  5KFS A;  1N63 A;  3E58 A;  2JXJ A;  5TZV A;  4QW8 A;  1ZQA A;  2P35 A;  1UA0 A;  1FFU A;  1TK8 A;  8ICN A;  2CRX A;  3WKE A;  3SZD A;  5KFB A;  5G3A A;  1RXW A;  5IIN A;  1KFS A;  4F5R A;  2FMP A;  3PZP A;  2JEJ A;  5HR6 A;  4UB2 A;  4TQS A;  2XI9 A;  3SQI A;  1L6N A;  3F5E A;  2E8O A;  5K4L A;  5JDP A;  2W11 A;  2A1J A;  2GWS A;  1SB3 C;  4BXO B;  4RJW A;  5J0P A;  2DKZ A;  4NM2 A;  3LK2 A;  2ZXH A;  2F3N A;  8ICT A;  3PRN A;  2GE4 A;  4G9B A;  1Q46 A;  3WK4 A;  3THV A;  4R63 A;  3K1Z A;  3PSP A;  1HXX A;  5EWF A;  4NLG A;  1ZQT A;  5IIO A;  1ZQX A;  4QZ9 A;  5KFK A;  4UB4 A;  5IIJ A;  4ECT A;  4NLZ A;  1L8O A;  1PHO A;  3PQU A;  2XGP A;  5KT2 A;  2J6S A;  2IHM A;  3KTQ A;  3PX6 A;  4UAS A;  4NY8 A;  1T4G A;  4IL6 U;  2EAM A;  2R8J A;  5D46 A;  5DLG A;  3NAS A;  4CF5 A;  1NJX A;  2UVR A;  4PHA A;  5DDY A;  2IOF A;  3V6H A;  4AFK A;  5EE0 A;  4RUC A;  3JPS A;  5ALT A;  5EWG A;  2KZ3 A;  4RPY A;  5AI8 A;  3LWL A;  5CRX A;  3T20 A;  1RG6 A;  1Z4O A;  1T3N A;  1PK1 B;  1ZHW A;  1TFR A;  2ES6 A;  4GFJ A;  5ALM A;  1SIJ A;  3AU2 A;  3RBD A;  3JPR A;  5CB1 A;  2R89 A;  5G26 A;  3AL0 B;  1NOM A;  4F4Y A;  2E8P A;  1EXN A;  4QZH A;  4LZD A;  4DOA A;  4DQQ A;  2DF4 B;  4ED6 A;  3AM9 A;  5L1K A;  2KHQ A;  2JMM A;  1BGX T;  3SV4 A;  4DL6 A;  2OYY A;  4F2S A;  4U6P A;  2MAX A;  8ICW A;  5T14 A;  4CDG A;  4YN4 A;  3A2S X;  2EAN A;  3OJS A;  7ICG A;  1L3U A;  3LK3 A;  5BOL A;  2V9W A;  4JV1 A;  4J03 A;  2ZJ5 A;  2NRZ A;  3C29 A;  4B61 A;  3BRY A;  2F1H A;  3DDH A;  4ECZ A;  1WCN A;  5DB6 A;  1L3S A;  7ICR A;  2XID A;  3PV8 A;  3B0Y A;  4PZN A;  2Y0L A;  1Z00 A;  1B43 A;  3RR8 A;  2O4V A;  1S76 D;  5H2F U;  2BKE A;  4FT6 A;  1ZQQ A;  4FS2 A;  3AQF A;  4P0P A;  4US8 A;  2XCP A;  4M9L A;  4QWC A;  3PX4 A;  8ICC A;  4G76 A;  4ELU A;  7ICV A;  1TK0 A;  4NLC A;  5KG0 A;  5TIS O;  2R8A A;  4XQ8 A;  3FC4 A;  2KDY A;  3PNC A;  2ODG A;  5DB7 A;  2OXO A;  2KTQ A;  1QSL A;  2W9B A;  4LSI A;  1PUZ A;  1JUD A;  5AI0 A;  1XSL A;  4IQW A;  4IQV A;  3RF9 A;  1LVH A;  3V7J A;  3LK4 1;  2BQR A;  3RTV A;  3BJY A;  1DRG A;  2KHV A;  1NJW A;  5HHH A;  2CXY A;  5GTI O;  2FMQ A;  1Z1V A;  5AI6 A;  2G08 A;  2HVI A;  4JUZ A;  3PW0 A;  1ZQC A;  3H8S A;  1NJZ A;  1ZQJ A;  3UM9 A;  4F5N A;  2G07 A;  2BCS A;  1NK6 A;  5CP2 A;  1S0V A;  2BDP A;  2JHD A;  5ALR A;  3RH5 A;  4DLG A;  7ICN A;  4F4Z A;  3Q8R B;  4Y2V A;  3KKA C;  4FMS A;  3LWM A;  3BS7 A;  1N5X A;  4P2H A;  1PVR A;  2NYV A;  3GFK B;  3AN1 A;  4DEZ A;  4BXO A;  2W3S A;  1BNO A;  4B9M A;  4PGX A;  1ZXI A;  3SEI A;  2XVT A;  2Y1J A;  9ICK A;  5J2A A;  1X6I A;  3MR3 A;  4D65 A;  2V4R A;  3OJU A;  5KFH A;  1FIQ A;  1BPB A;  2DUY A;  5AM2 A;  1NK9 A;  8ICU A;  4NL9 A;  4O3P A;  4ELV A;  1GO3 F;  2BDU A;  2K8C B;  5KT5 A;  2W80 C;  4O3Q A;  4QZD A;  1BPX A;  1V38 A;  9ICA A;  4Y2X A;  4MFF A;  4R8U B;  2F8L A;  2VKQ A;  4DCC A;  3SYZ A;  1A0P A;  1RYR A;  4MF2 A;  3ZDD A;  1GFM A;  3C2M A;  4C4S A;  4ECU A;  1AQ6 A;  3HPO A;  2B0C A;  4O3W A;  2FDR A;  2VAN A;  3QUC A;  4RQ4 A;  3AAA B;  5ALK A;  3A0H O;  1SV0 A;  4F4W A;  4K4H A;  1COK A;  3HW8 A;  4KLH A;  2D3D A;  2JZB B;  7ICM A;  3M9O B;  1XSP A;  3LVW A;  3KHG A;  3M8S A;  3LDA A;  2KEY A;  3S6J A;  1HUZ A;  1IG6 A;  5J0Q A;  3WK8 A;  1TVA A;  2YMP A;  1ZD2 P;  5EWE A;  1QCK A;  1X42 A;  2NRX A;  2A3V A;  3U26 A;  5HMM A;  3SZ2 A;  4GCQ A;  4C8N A;  1S9F A;  4C4R A;  3RB3 A;  1UHU A;  1OUQ A;  5DQI A;  4MF8 A;  4ED7 A;  7ICU A;  4TUS A;  4BWM A;  2W8K A;  1BH3 A;  4USA A;  2MSN A;  3PVX A;  1LKY A;  2Y0H A;  3IP4 B;  5AFU K;  4IC9 A;  3NTU A;  1QTM A;  1QLN A;  8ICA A;  2VJ4 A;  7ICJ A;  2Y0S C;  5DL6 A;  5AKH A;  3PR5 B;  5AKG A;  1HUO A;  3AU6 A;  4C00 A;  1ZQK A;  2OHF A;  1U9L A;  4N75 A;  1QQ7 A;  1X9X A;  5JU5 A;  5KFN A;  4QZI A;  3MGV A;  4KLJ A;  4Q8F A;  4PGQ A;  4X5V A;  5ALN A;  9ICO A;  3NVY A;  2XE1 A;  4O3Y A;  2BQU A;  3D2Q A;  4KTQ A;  5KT7 A;  4F4X A;  2NV3 A;  3KHH A;  5J0Y A;  2XCA A;  4NLB A;  1ZQB A;  4GXJ A;  3ZD8 A;  4J9Q A;  4KLO A;  4P4M A;  5L1J A;  1NZB A;  4F8R A;  4TUR A;  1K1Q A;  3HP6 A;  3BQ0 A;  3MGH A;  4AKR B;  1RQL A;  3OSP A;  2E1F A;  4AYD C;  2H3I A;  1F5S A;  4D5U A;  2FJ6 A;  2ZIV B;  5J2E A;  2HSZ A;  2E8M A;  3WK6 A;  2V4Q A;  3D2N A;  1NK7 A;  3WK5 A;  1ZYQ A;  2MUT B;  1JRO A;  3F2D A;  1TAQ A;  4F2R A;  4KLG A;  5DL8 A;  1D8Y A;  1QQ5 A;  3RAX A;  2JGA A;  3AA1 B;  4KLT A;  3LK9 A;  1BVS A;  2E1E A;  1S77 D;  5FP0 A;  1YS5 A;  2Z7J A;  4KLL A;  1GFN A;  4O5C A;  2NO5 A;  4HAI A;  2ODJ A;  2Y7S A;  3KOO A;  5TIS U;  4Y2J A;  1ZQD A;  4NL9 C;  3C23 A;  3D2S A;  2W54 A;  3EW9 A;  4RQM A;  2C2R A;  4Y2T A;  5AKY A;  1P4T A;  2RRD A;  3WKC A;  2ZIU B;  5ALV A;  4ACO A;  7ICI A;  3ISD A;  3KBB A;  4I2I A;  3RBE A;  1C7Y A;  5GTI U;  9ICB A;  4F5P A;  8ICJ A;  3O0F A;  4PHD A;  2W8L A;  4R8U A;  4IRC A;  3POU A;  4XUS A;  1Q3U A;  1V97 A;  3MDC A;  2K4I A;  1KQQ A;  2R4P A;  2XMX A;  2AGO A;  4RT3 A;  4Z6D A;  1A76 A;  2VA3 A;  3AQE A;  5DG7 A;  2RHF A;  4EZ9 A;  4ECR A;  8ICM A;  1NKE A;  2LM4 A;  5ALP A;  2AU0 A;  2AGQ A;  2ZLD A;  1X9S A;  2HBM A;  3PQS A;  4YFK A;  1XC9 A;  5ALI A;  5D4B A;  1YT3 A;  1VDV A;  2IOF K;  2NRT A;  1OXJ A;  4DSI A;  5EE9 A;  2JZB A;  2VJ5 A;  3H8J A;  1SL2 A;  4RQ5 A;  1WG8 A;  2AJQ A;  1KTQ A;  1HIW A;  1NKB A;  2ZJA A;  5DG8 A;  1SKS A;  5EE2 A;  1WWV A;  1TKD A;  1J2M A;  2BPC A;  1X9W A;  3VC8 A;  3PO4 A;  4O5E A;  2M9N A;  3IV6 A;  4F3O A;  3SEN A;  1QJ9 A;  2EZY A;  4AYN A;  3AEV A;  7ICK A;  4J9M A;  3K1R B;  4K3B A;  4QWD A;  4DS4 A;  1UT5 A;  1JXL A;  4US9 A;  3EPG A;  4O49 A;  1Q9F A;  3UMC A;  5PRN A;  2OH2 A;  8ICL A;  1ZQO A;  5ADX L;  3T3F A;  3CNH A;  9ICF A;  2F1V A;  2Y9U A;  4XNL A;  3A0H U;  2KMD A;  1T94 A;  2FI1 A;  3H0M B;  2XE3 A;  4K4I A;  3RRG A;  5GV0 A;  4XA5 A;  4F72 A;  4AZL A;  5HNK A;  3UAQ A;  2HHQ A;  4GCS A;  3PY8 A;  4O4X A;  1NNL A;  4RPZ A;  2ASD A;  3KZX A;  4RNO A;  4YQW A;  4MFA A;  3BS5 B;  9ICS A;  4C8M A;  4PL2 A;  3VZT X;  4N58 A;  1IZN A;  2QB0 A;  5ALG A;  1UT8 A;  1N48 A;  1D9D A;  1IM4 A;  2KZ7 B;  5AI9 A;  1SL1 A;  3B9J A;  4FOZ A;  4XNK A;  4JV2 A;  5EE1 A;  3QEB Z;  2F2A B;  1C20 A;  3AA7 B;  4KLI A;  4RU9 A;  4RQ2 A;  3RB4 A;  4E0D A;  2IHN A;  4AKR A;  2W43 A;  4FRX A;  3PW4 A;  1ZQG A;  3MFH A;  3V6J A;  2F76 X;  5J0W A;  4KLU A;  1VJ5 A;  2DPJ A;  4KRA A;  5ALU A;  4R66 A;  1D8L A;  4KMU A;  5AM4 A;  7ICH A;  5J0X A;  3BQ7 A;  5AI4 A;  1RYU A;  3L5K A;  4I2G A;  4QNL A;  1KDH A;  4IR9 A;  4JV0 A;  3WI4 A;  3QU9 A;  1WYG A;  4CGZ A;  3T5L A;  4C8L A;  4O4U A;  3SR6 A;  3Q8S B;  3KKA A;  3QU5 A;  4EEK A;  2K0L A;  3F53 A;  4GIB A;  3JPQ A;  9ICQ A;  3SD7 A;  3H4B A;  2FLL A;  2XTQ A;  1ZD3 A;  1ZOL A;  2ZIU A;  3J81 j;  4FQE A;  4J9L A;  5J2D A;  3OHA A;  4ECQ A;  3FDS A;  2EZZ A;  2KKP A;  1U49 A;  4UW9 A;  7ICE A;  1HXT A;  4C4V B;  3NRZ A;  5DB9 A;  2BQ3 A;  3F2C A;  2KJ5 A;  2W9C B;  2FLN A;  4DFM A;  4Y2P A;  3AA0 A;  4OJ5 A;  1MC8 A;  2YTU A;  4MHV A;  3NJT A;  5AM0 A;  2KC0 A;  3JPN A;  4PH5 A;  2EQY A;  1V85 A;  5G38 A;  5EE3 A;  4LSE A;  4FE3 A;  2JMG A;  4F93 B;  4ECW A;  3H7I A;  1L3T A;  2H3V A;  2VA2 A;  2XGQ A;  4RQN A;  5G39 A;  2P6R A;  1ZQZ A;  2C2D A;  8ICY A;  4N74 A;  2ZTD A;  3I28 A;  2WAQ F;  5D49 A;  5KNI A;  4ED3 A;  3M8R A;  2A1A A;  2Y0K A;  8ICV A;  2IOH A;  1ZQ1 C;  4FZL A;  5ALQ A;  4UB8 O;  2L5Y A;  3UQ0 A;  3L3F X;  4RLC A;  5AK5 A;  4C7Z A;  3PR4 A;  5DB8 A;  4UB3 A;  1T3Q A;  3IRU A;  2YQE A;  2E3T A;  5B5E O;  3PW7 A;  2NRW A;  9ICR A;  1URJ A;  4N59 A;  3N97 B;  1K5O A;  2I9G A;  1S10 A;  2ASJ A;  1DXS A;  1HEK A;  2IBK A;  4IQU A;  3NRW A;  9ICH A;  3HW9 A;  4O3S A;  1F44 A;  4NV0 A;  3GV7 B;  1DOQ A;  9ICL A;  4YR2 A;  2UVW A;  3UXP A;  4FSO A;  4YMO A;  1YZ6 A;  2H3F A;  1S97 A;  3GV5 B;  5KAI O;  4Q44 A;  3WKD A;  1KKX A;  1SWV A;  3TFR A;  1KEJ A;  3B0X A;  3QRC A;  4D64 A;  5KG5 A;  3RBH A;  4LZG A;  2DQN B;  5AIA A;  4UAR A;  2DPI A;  5AKZ A;  3TKA A;  4Z3T A;  3BS5 A;  2OM6 A;  2QAR B;  4Z6F A;  3G6V A;  4ECS A;  2XG6 A;  4F50 A;  2HHU A;  4UB1 A;  1JI7 A;  1UA1 A;  4P4P A;  1N61 A;  9ICX A;  2KZ7 A;  2ATL A;  3KFU F;  4G3I A;  2MNH A;  2YX8 A;  4RNN A;  3G6X A;  2BCR A;  1ORM A;  4C0Z A;  3TZG A;  1U47 A;  2M07 A;  4F4B A;  4Y2U A;  4QZE A;  2KK0 A;  2HCF A;  3T79 A;  4DL3 A;  4C8K A;  1E54 A;  3BRZ A;  2LHT A;  2QTK A;  4YMN A;  3GIL A;  1BT9 A;  2PMZ F;  3OTQ A;  2HI0 A;  4GF4 A;  3KVD D;  4RZR A;  1ZET A;  2FPK A;  3MGI A;  4C80 A;  3VCB A;  3BDP A;  1KRP A;  2F8K A;  3TAQ A;  9ICN A;  1L5U A;  3C5G A;  5KFC A;  2KXP B;  4M04 A;  5J2H A;  4LJX A;  2KVS A;  4FBU A;  4CF4 A;  4TQR A;  3PST A;  5C0Y A;  4CF3 A;  3PW5 A;  5ALW A;  2XE5 A;  1ZQW A;  1TK5 A;  3VZU X;  1L3V A;  3AMZ A;  2LFU A;  5CA7 A;  3QZ8 A;  3TI0 A;  2ASL A;  2JV3 A;  1J2N A;  3RJF A;  3IHQ B;  2PFP A;  4EEL A;  7ICS A;  3K75 D;  4UB6 O;  1Z3E B;  3JPO A;  4G75 A;  1OSM A;  2ISP A;  2Q0Z X;  4RQ0 A;  8ICZ A;  5L9X A;  1ZRN A;  4B9N A;  1ZHT A;  1MSW D;  2ISO A;  2YNK A;  1RM6 C;  2WF7 A;  4J9O A;  1DGS A;  5T5F A;  1V9P A;  4O3O A;  1RQN A;  1A77 A;  5L1M A;  3SAG A;  4EYI B;  3DA3 A;  2YMQ A;  4UAV A;  1MN8 A;  2AQ4 A;  2H3Z A;  3H8M A;  2W9C A;  5F3X B;  2AXT O;  3POR A;  5KFE A;  4GLX A;  2WJQ A;  2HBK A;  4I2C A;  2DKX A;  5KFP A;  2WVP A;  1M6Y A;  3ORY A;  4PPX A;  2HW3 A;  4QQ1 A;  9ICC A;  5G5G A;  4EYH B;  3HKZ F;  2RDJ A;  1WWU A;  4HYK A;  2Y9T A;  4M6W B;  4ECV A;  8ICE A;  5ALO A;  3IG5 A;  1QQ6 A;  4ELT A;  1PRN A;  3MFI A;  1KSP A;  2JEF A;  4AYM C;  5ALD A;  5CHG A;  8ICK A;  3KZI O;  2CPR A;  4IRK A;  5AI5 A;  4UBC A;  3MDA A;  3BS0 A;  3LVV A;  3Q8L A;  1PK1 A;  5C5J A;  4I2F A;  2XY7 A;  1NK5 A;  2H3Q A;  1NK0 A;  4YXM A;  1QJ8 A;  1X40 A;  2D6F C;  4YP3 A;  1D9F A;  3H40 A;  2BPG A;  4M9J A;  1QH9 A;  4KLD A;  4O3R A;  8ICH A;  2H5X A;  1PK3 A;  3JPP A;  5FVN A;  2HHS A;  5AKK A;  4J9N A;  1BPZ A;  2C2E A;  5EOZ A;  4DF4 A;  2LKY A;  5DG9 A;  1NKC A;  5KAF O;  5GTH O;  2YMM A;  3QUB A;  3MR2 A;  4ED1 A;  8ICP A;  3ZDC A;  2XC9 A;  1WUD A;  1KFT A;  5G5H A;  3OSN A;  5B66 O;  5KFV A;  4NM1 A;  4TUQ A;  4UB8 U;  2Y1I A;  3PGS A;  5IIL A;  3UQ2 A;  4Q8E A;  1MQ3 A;  9ICM A;  2P6U A;  2P66 A;  1SKW A;  9ICE A;  1F0M A;  3WU2 O;  3ALR A;  2BHN A;  4O3X B;  4IS7 A;  1UQV A;  5B5E U;  4IR1 A;  2C22 A;  2BCV A;  2DWQ A;  3QU4 A;  5AIC A;  7ICP A;  1ARO P;  3DWN A;  4UAU A;  4DL7 A;  2QKQ A;  3M6K A;  2AQ0 A;  1MM4 A;  4CTD A;  2IWW A;  4KX3 A;  4M47 A;  1XO1 A;  2DGZ A;  4OJL A;  3ZDA A;  1N2X A;  3TFS A;  3FM9 A;  1HJP A;  6PRN A;  5KAI U;  1TAM A;  4F91 B;  2ZIW B;  3MR5 A;  4K3C A;  5ALE A;  1ZQY A;  1S0M A;  1U48 A;  5AK3 A;  1PZN A;  4QWE A;  1L7N A;  4ICA A;  3EWA A;  3ICX A;  5J2F A;  3POX A;  3ONN A;  4I29 A;  4QWB A;  4F71 A;  5ALL A;  1GFP A;  4O9M A;  8ICG A;  3PO5 A;  8ICB A;  4J9K A;  4RJX A;  3N7R C;  7ICQ A;  3VE2 A;  5KTQ A;  2IA6 A;  3K19 A;  2RLT A;  4F4K A;  4C4T A;  5KL1 B;  3TAN A;  4Y2Q A;  4CRX A;  3HIL A;  4UQG A;  1YZ7 A;  2ZUD A;  8PRN A;  3O0E A;  3NUQ A;  1Z1B A;  9ICT A;  3LK2 B;  1JN3 A;  2WB1 F;  4B9U A;  4RLB A;  2JH1 A;  1CI4 A;  1SXD A;  2JEI A;  3BQ2 A;  2I1Q A;  4QZG A;  2F77 X;  4B9L A;  3GDX A;  3TAP A;  2K4E A;  2FPM A;  1Z19 A;  1T16 A;  2HOQ A;  1QSY A;  4NLN A;  3QXG A;  2B6G A;  4EZ6 A;  3WK7 A;  2RQ5 A;  3GU3 A;  4QW9 A;  4RQ6 A;  5DDM A;  1L8L A;  4CCH A;  9ICP A;  1MPF A;  4DQS A;  2PKE A;  2KJ9 A;  3Q8K A;  3SY7 A;  4DSK A;  8ICX A;  2NO4 A;  3MAB A;  2M0N A;  1B4F A;  3AAA A;  2R8G A;  1Y88 A;  3TAD A;  4UB6 U;  1U4B A;  3DWO X;  2JQY A;  4M9N A;  4UAY A;  4FBT A;  2WF9 A;  2D8C A;  5KFR A;  4QZF A;  5KG6 A;  3RFA A;  5CWR A;  2UVV A;  3KHR A;  2HHW A;  3ETL A;  4KMO B;  5III A;  3SMV A;  1GFO A;  2AXT U;  4RNM A;  4OO1 J;  5KFT A;  2CN1 A;  3BQ1 A;  1SZP A;  5L1I A;  1X66 A;  4YD2 A;  2HVH A;  2C28 A;  2J6T A;  4U9C A;  5DBA A;  3LK4 2;  3QX7 A;  2XY5 A;  1XNS A;  5HHI A;  3MR6 A;  4DQP A;  2LBO A;  1KBU A;  2LI6 A;  9ICU A;  1Z4N A;  3HX0 A;  2R8H A;  3R9K A;  4DFJ A;  2N1R A;  1RXV A;  2KIV A;  2KVC A;  2GLE A;  3PGU A;  2FLP A;  3QEA Z;  3UMB A;  3Q8P B;  3KZI U;  4BUG A;  3WI5 A;  3RJI A;  3PSF A;  3DV9 A;  3VY8 X;  4UAT A;  1XS9 D;  3LK3 B;  2YN4 A;  5AKJ A;  9ICW A;  2MRL A;  2R4L A;  2W81 C;  5AKE A;  3VE1 A;  1S0O A;  4C7Y A;  3DEE A;  2LYH A;  5DGB A;  2QB1 A;  4J9R A;  2JRZ A;  4Z6C A;  3A0B O;  2KV2 A;  4UAW A;  3POQ A;  3H4D A;  2ZIX B;  9ICG A;  4BDP A;  1Z00 B;  3AAE B;  3TQ1 A;  5AK6 A;  3C2L A;  2Q4T A;  4MEY A;  8ICI A;  3M6Z A;  1ZJN A;  2F1J A;  3V7L A;  5DQH A;  4P0P B;  5ALJ A;  5J2G A;  1XWL A;  3EPI A;  3EYZ A;  4DO9 A;  4RT2 A;  1N56 A;  3NVW A;  4OJO A;  5KAF U;  3C1Z A;  4FZN A;  5GTH U;  3LYS A;  4EEN A;  2FGR A;  2W9B B;  3GIJ A;  2YPV A;  5B66 U;  2ZXI A;  4ED0 A;  5JTI A;  1X6J A;  3M7D A;  3C1Y A;  4A8E A;  4JFB A;  3RJK A;  2ZIV A;  2ZIW A;  5J2C A;  5DQG A;  3HWT A;  1SKR A;  1G90 A;  4OJP A;  1NJY A;  4QZ8 A;  2MUT A;  5IIM A;  3WU2 U;  3HOE A;  4ED8 A;  2ALZ A;  4Q45 A;  2K4P A;  1T1L A;  3AA1 A;  3FYX A;  3NS1 A;  4PHP A;  4M2Y A;  2K4T A;  1ZD5 A;  4Y2S A;  4DF8 A;  2W04 A;  5KT3 A;  2WJR A;  3D6J A;  5KFL A;  4EEY A;  3EZ5 A;  2EAO A;  1JX4 A;  1TAU A;  4P4O A;  1BNP A;  2KZM A;  3PML A;  3ISB A;  2KIC A;  3EUB 2;  4KLF A;  2W7O A;  4YR3 A;  1SL0 A;  2X27 X;  4KLE A;  3SYB A;  3NVZ A;  4B6J A;  1IIP A;  4FES A;  2K8A A;  4Y2R A;  4RUA A;  1ZQE A;  5HML A;  2WF5 A;  1P7D A;  2KJ8 A;  4M0A A;  4I2E A;  1ZRM A;  2F1I A;  1S5L O;  3MC1 A;  3ZDB A;  5F9N A;  2DL0 A;  5ADX K;  4I2B A;  3F2B A;  4YCX A;  5KFU A;  4PJ0 O;  5AK4 A;  7ICL A;  4FO6 A;  1U45 A;  3TAD C;  1ZHX A;  3ZI4 A;  1XO0 A;  2G0A A;  1JXE A;  3QYP A;  4Y2Y A;  4PGY A;  2FE9 A;  4I2H A; 
#chains in the Genus database with same CATH homology
 3UU2 A;  2NV3 A;  2YB4 A;  5DL5 A;  1GFQ A;  4E1T A;  4NLB A;  4G75 A;  2HMX A;  1OSM A;  5IYU A;  3T0S A;  2J1N A;  2ZG6 A;  1NZB A;  3EMN X;  2G5I B;  1ZHT A;  2YNK A;  2W03 A;  4AUI A;  1Q3V A;  1Q9G A;  5T5F A;  3GP6 A;  1SZH A;  3F5A A;  4AKR B;  3SAG A;  2E1F A;  3DA3 A;  4AYD C;  2H3I A;  2H3Z A;  4D5U A;  3POR A;  2RP5 A;  2XIC A;  2ZIV B;  2HBK A;  2WB1 C;  2KNJ A;  3D2N A;  4OJ6 A;  3N7P D;  3F2D A;  4QQ1 A;  5DL8 A;  3HKZ F;  2ZFG A;  2JGA A;  3AA1 B;  1PVQ A;  4C69 X;  2E1E A;  1YS5 A;  2Z7J A;  1GFN A;  1A6S A;  3E0F A;  2KKV A;  2ODJ A;  2Y7S A;  3IG5 A;  2W7P A;  1PRN A;  4RL9 A;  2Y2X A;  2K89 A;  1ED1 A;  1D8B A;  4AYM C;  3D2S A;  4KR4 A;  4BJQ A;  2E5S A;  4GCP A;  4BUM X;  4KX5 A;  4BX9 C;  2CPR A;  2KIW A;  2XE2 A;  1P4T A;  3LVV A;  2RRD A;  2XTR A;  3CP8 A;  2ZIU B;  3IG8 A;  2LHF A;  4ACO A;  5KL8 B;  3UPG A;  2H3Q A;  2G09 A;  1QJ8 A;  3O0F A;  2GOL A;  2D6F C;  2ZIX A;  3AAE A;  2CRX A;  3POU A;  1Q3U A;  2K4I A;  3SZD A;  5FVN A;  2XMX A;  3PZP A;  5HR6 A;  3SYS A;  2XI9 A;  3SQI A;  3AQE A;  1L6N A;  3F5E A;  1ECW A;  3AA7 A;  2RHF A;  5JDP A;  2LKY A;  4LSF A;  4KR8 A;  2ZLD A;  3HOL A;  2HBM A;  7PRN A;  3PQS A;  4RJW A;  1WUD A;  1YT3 A;  5A0L A;  3LK2 A;  2ZXH A;  3PRN A;  2HBL A;  2GE4 A;  3C5O A;  2WAQ C;  2VJ5 A;  1OPF A;  3K1Z A;  3PSP A;  1HXX A;  4AYE C;  2KD1 A;  2HOF A;  3DA4 A;  4NWI A;  3ALR A;  1HIW A;  1THQ A;  3HWB A;  4O3X B;  5EE2 A;  2N2L A;  3VC8 A;  1PHO A;  3AA6 B;  3PQU A;  1ZHY A;  1QJ9 A;  1MA7 A;  4AYN A;  5AFU L;  3M6K A;  2FGQ X;  4U7C A;  1MM4 A;  4O49 A;  1Q9F A;  5PRN A;  2OH2 A;  5ADX L;  4PUX A;  4KX3 A;  2MHL A;  2DGZ A;  4OJL A;  4AYB F;  2F1V A;  4XNL A;  2Y0S F;  4AFK A;  1T94 A;  6PRN A;  3H0M B;  2XE3 A;  4P0Q B;  5CRX A;  3T20 A;  5GV0 A;  1TAM A;  3UAQ A;  4AZL A;  5D5D A;  4GCS A;  2ZIW B;  4O4X A;  2K8B B;  1ZHW A;  2LYA A;  4GFJ A;  2G06 A;  3KZX A;  4ICA A;  5G26 A;  3ICX A;  3AL0 B;  3VZT X;  4PL2 A;  4N58 A;  2HOI A;  1IZN A;  3POX A;  2DF4 B;  3ONN A;  2KZ7 B;  4O3Z A;  2KHQ A;  1GFP A;  2JMM A;  4E1S A;  2M06 A;  4JMU A;  2OYY A;  4RJX A;  3N7R C;  3VE2 A;  4FOZ A;  4XNK A;  4U6P A;  2F2A B;  3K19 A;  5T14 A;  4CDG A;  3AA7 B;  3A2S X;  5KL1 B;  4CRX A;  3LK3 A;  2G5H B;  4QJF B;  3C29 A;  4AKR A;  4B61 A;  8PRN A;  3O0E A;  3NUQ A;  1Z1B A;  3LK2 B;  4FRX A;  4GHB A;  2XID A;  2PMZ C;  2WB1 F;  4RLB A;  2JH1 A;  2Y0L A;  2F76 X;  2O4V A;  2VIX A;  2F77 X;  4KRA A;  2K4E A;  4FT6 A;  1Z19 A;  3AQF A;  2HOQ A;  4FUV A;  4P0P A;  3GU3 A;  3G7G A;  4QNL A;  4G76 A;  4AYI D;  4NLC A;  1MPF A;  3WI4 A;  5HR7 A;  2KJ9 A;  2KDY A;  4CGZ A;  3SY7 A;  4O4U A;  2M0N A;  2OXO A;  3AAA A;  3VZW X;  4LSI A;  2K0L A;  3F53 A;  2N2M A;  3RF9 A;  2K4H A;  2F1T A;  3CRX A;  4JCH A;  3LK4 1;  2XTQ A;  3CYM A;  2ZIU A;  4FSP A;  4WJ3 B;  1DRG A;  2KHV A;  3RFA A;  2KKP A;  1HXT A;  2J4U P;  2GH1 A;  2G08 A;  3F2C A;  4KMO B;  2KJ5 A;  3SMV A;  1GFO A;  4AYB C;  4QIW F;  2G07 A;  2R18 A;  3AA0 A;  4OO1 J;  2CN1 A;  4OJ5 A;  2JHD A;  3SY9 A;  2KC0 A;  4U9C A;  3LK4 2;  1XNS A;  3QRA A;  1ZHZ A;  2LBO A;  4LSE A;  4FE3 A;  2JMG A;  1KBU A;  4FMS A;  1IZN B;  3HKZ C;  2H3V A;  1PVR A;  2N1R A;  2WAQ F;  2KVC A;  2Y0K A;  3H0L B;  2XVT A;  1ZQ1 C;  3WI5 A;  4BUG A;  4FZL A;  2KXP A;  3PSF A;  3VY8 X;  4D65 A;  3SZV A;  3V8U A;  3LK3 B;  3L3F X;  4RLC A;  2MRL A;  2W81 C;  3VE1 A;  1BXW A;  1GO3 F;  2BDU A;  3N7S C;  3DEE A;  2K8C B;  4O3M A;  2W80 C;  3C28 A;  3POQ A;  2KV2 A;  2ZIX B;  3AA6 A;  2F8L A;  2VKQ A;  3AAE B;  4FZM A;  2Q4T A;  1URJ A;  4N59 A;  2JH7 A;  1A0P A;  3M6Z A;  2OMF A;  1MM5 A;  4P0P B;  1GFM A;  1HEK A;  3NSG A;  3NRW A;  4AKM A;  3HW9 A;  4OJO A;  2KOB A;  4O3W A;  1F44 A;  4NV0 A;  4FZN A;  3LYS A;  3IN5 A;  4PL1 A;  4FSO A;  3AAA B;  2FGR A;  2H3F A;  2LYB A;  2YPV A;  2ZXI A;  3SAH A;  1UPH A;  4P0Q A;  3M7D A;  4A8E A;  4JFB A;  2ZIV A;  2ZIW A;  3T24 A;  3LVW A;  4LSH A;  1G90 A;  2KEY A;  4OJP A;  3QRC A;  4D64 A;  3RBH A;  3HOE A;  4FRT A;  2DQN B;  4Z3T A;  2POR A;  1H6S 1;  2OM6 A;  3AA1 A;  3FYX A;  2XG6 A;  2K4T A;  2W04 A;  3AA0 B;  2KZ7 A;  2A3V A;  3KFU F;  2MNH A;  4GCQ A;  2YX8 A;  4QIW C;  3VY9 X;  1QJP A;  2YB1 A;  1ORM A;  1OUQ A;  4C0Z A;  3TZG A;  2M07 A;  4F4B A;  3T79 A;  2KIC A;  2W7O A;  1BH3 A;  2X27 X;  1E54 A;  3SYB A;  2LHT A;  2QTK A;  1PVP A;  1BT9 A;  1IIP A;  2PRN A;  2PMZ F;  2Y0H A;  4FES A;  3IP4 B;  2K8A A;  4GF4 A;  5AFU K;  4IC9 A;  3H0R B;  1P7D A;  3KVD D;  2KJ8 A;  3VCB A;  2VJ4 A;  3OPX A;  2KXP B;  2Y0S C;  5DL6 A;  5ADX K;  2MA1 A;  3F2B A;  5DL7 A;  3PST A;  3SAF A;  3JTY A;  3MGV A;  5C0Y A;  2HBJ A;  1ZHX A;  2XE5 A;  1XO0 A;  1HXU A;  3VZU X;  2LFU A;  2G0A A;  1CRX A;  2ERV A;  2XE1 A;  4O3Y A;  3GZF A;  3D2Q A;  3PSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...