4FZLA

High resolution structure of truncated bacteriocin syringacin m from pseudomonas syringae pv. tomato dc3000
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
239
structure length
239
Chain Sequence
GMQNPVATVLLLQGDLYCSPNCLATFQDQARRDSFGIQSKVALKTFAAADQREAEGRDLRTAYNEIATDIGRSQQINENIIKYPPGNHVLSGGLMTPFHALAHGMFGLGAPLTFPIQNVGLNVDIRGIPDVMNVIQSARPVGTSSLDVNFAYDVGKDSNASWLTLGNITLRLVGTIDKNASGAWTFSGEIRAFNDVYDANPSNHRGWLGENLTSLLSAVPFTSYSIEIPGSLPVTVSGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacteriocin
publication title The Crystal Structure of the Lipid II-degrading Bacteriocin Syringacin M Suggests Unexpected Evolutionary Relationships between Colicin M-like Bacteriocins.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Antimicrobial protein
total genus 73
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.790 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4fzlA01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4fzlA02
4N59A 2XTRA 4G75A 4G76A 4FZMA 4FZNA 4N58A 2XMXA 3DA4A 2XTQA 3DA3A 4FZLA
chains in the Genus database with same CATH superfamily
3KD3A 1ZQMA 2ESEA 4KMUA 4ED0A 3H7IA 4XA5A 2DPIA 1SWWA 4Q43A 3H0RB 4NM2A 2P35A 5JTIA 4CF4A 4BJQA 2PI4A 2Y7SA 3QU7A 3QNMA 9ICRA 4UBCA 2A1JB 1Z4NA 2PFPA 3TAQA 3NJTA 3JTYA 6PRNA 5J0XA 1T4GA 3WK4A 5DL8A 2HOIA 1THQA 3EMNX 5KAFO 4NJ8A 1NJXA 4FESA 1MN8A 2JZBA 5DQHA 3C23A 4J9RA 1UQVA 2H3FA 2AQ0A 1B4FA 1PK1A 4LSEA 2MAXA 1NK0A 5EE3A 5KFHA 5KAIU 2YMQA 3QU5A 5A0LA 2K8BB 1KRPA 3GILA 1HUZA 1S5LO 4KLUA 2W8LA 1PRNA 9ICAA 1GO3F 7ICNA 3UM9A 1T8EA 5ALLA 2ZLDA 1DK3A 2WF6A 3QRCA 4FRTA 3PSFA 5KFIA 5AM2A 3MFHA 3RR7A 7ICVA 4DL5A 4BWMA 4O3XB 2ZIVA 4G75A 2XE1A 4UAYA 2I6XA 3AM9A 4J9QA 5KFVA 2MUTB 2I5HA 4M9NA 4Y2VA 5ALMA 4AFKA 4U6PA 3PW0A 4G9BA 4QWCA 5AKHA 3QUQA 3B0YA 5ALXA 4C4VA 2I9GA 1SWVA 1X66A 4GIBA 1B0XA 4O3ZA 5ALIA 3E0FA 1RPLA 2F1TA 1IIPA 1D9FA 4BX9C 2F76X 8ICRA 3ZDAA 3LYSA 4E1SA 3LK3B 4DFJA 4O3QA 4QWDA 5KG0A 2HHXA 3LVVA 1ZJMA 4B6JA 2W7PA 2F3NA 4EBCA 1XSLA 4AKMA 5DBAA 2F8KA 3KKAC 3RH6A 4CGZA 2MU2A 3BRYA 2IBKA 4OJ6A 2QB1A 4RNOA 5D4BA 3PO5A 4I28A 4DQRA 5EWEA 4KLQA 2WVPA 3Q8QB 3BDPA 2HI0A 3M9NB 2VKQA 4ZH4A 3ZD9A 4IQTA 4QZ9A 2BQRA 1C7YA 1COKA 2HVHA 2Y1IA 3IN5A 4MF8A 5DBBA 5EE0A 2E8MA 2WTFA 3G6VA 2KVCA 2QKQA 8ICHA 4MHVA 4F8RA 4QJFB 4QQ1A 3C21A 4D65A 5F3XB 1UHUA 3NGDA 8ICKA 4RQ5A 1V38A 5JU5A 4J9LA 3K4GA 2K8CB 1H6S1 3KHGA 2C2DA 1HUOA 3C28A 3GIKA 2JZBB 2JR5A 3BQTA 2DKXA 1O08A 2X9KA 4NLZA 3IV6A 2NRVA 1PK1B 4ECYA 8ICJA 2ODJA 4UARA 4PZNA 5DL7A 4Q8FA 3GFKB 4PHDA 1IG6A 2HHUA 1A76A 3GIIA 2LM4A 1S77D 3TADC 1WWUA 3SQIA 4X5VA 2ZUDA 4DL7A 5GTHU 2C22A 1ZQNA 2ASDA 1KTQA 1B22A 7ICTA 3SYSA 1PVPA 2YMLA 2ZTCA 3TI0A 7ICOA 4I2JA 2ZIVB 3HX0A 4CF3A 3BQ1A 1ZQRA 1FEZA 2H3QA 3CYMA 5ALFA 1S0OA 5KT2A 5AM4A 2GWSA 4RQNA 4F3OA 1OSMA 1DRGA 4C4VB 2HSZA 3AAAA 8ICYA 3AL0B 3KHRA 3UQ2A 1ZQIA 4PGQA 3JPRA 3UMBA 4Y2YA 2I1QA 4KLGA 4DL6A 2WF9A 3M7DA 4G3IA 3SEIA 1X2IA 4RQ1A 4DSJA 4C69X 1NJZA 3C5FA 5GV0A 5IIKA 3NRWA 5KFKA 2LMRA 4F5QA 3OHBA 4DLGA 4UW9A 1ZHTA 3T5JA 2EAMA 2OHFA 2ZJ8A 4DSKA 4O3PA 4A8EA 4NY8A 1ZQSA 2CPRA 4IQWA 8ICAA 4DWIA 3H0LB 4FZLA 3JPQA 4IL6U 4P0QB 1NJWA 2E3TA 1XS9D 5AFUL 2JH1A 1X9WA 1K1QA 4C8KA 2JGAA 2ZIXA 1Z19A 1ORMA 3GP6A 9ICNA 2N2MA 2Z7JA 3QUTA 3ETRA 4QWBA 3UXNA 4B9TA 2UVVA 3IG5A 5J0QA 3T79A 3SAHA 1ZQWA 3KBBA 4C80A 2PXIA 1N60A 1ZHWA 5L9XA 4DQPA 5ALWA 2EDUA 1LVHA 4IRCA 1OW5A 4F4BA 5CR0A 1KBUA 4F4KA 1QLNA 1Z1BA 3HT3A 4ED7A 2ZFGA 2NRZA 4DQSA 2KP7A 1VJ5A 4CDGA 1GFMA 5KFPA 4M6WA 5DB9A 2F1CX 2KJ8A 5C5JA 4UB5A 2EAPA 1T7PA 2F8LA 2XE5A 2ZUCA 4ED2A 1XSNA 2Y9UA 3DWNA 1N5WA 2DQNB 3AMZA 1RYSA 1NI3A 2QLTA 1C20A 3NVYA 3G6XA 2LYBA 4QZEA 3SR6A 2NRWA 4C8MA 3D2SA 1SKSA 3EZ5A 4UB4A 5J2KA 2Y0LA 1UA0A 4RJXA 2QARA 2R8KA 2R88A 3R9KA 1ECWA 3Q8PB 9ICKA 3AAAB 4IRKA 1TK5A 2LM1A 2HHVA 4MF2A 4Y2PA 5J2AA 3MFIA 3CNHA 1WG8A 5AI8A 4M9HA 2G06A 1ZD2P 4DOCA 2E8NA 3NVVA 4ECUA 9ICQA 5F9NA 3PZPA 2A3VA 8ICTA 2P6UA 3V7KA 5DB6A 1ZETA 5J2IA 2GE4A 2H3ZA 5JRTA 1KDHA 3K75D 2W11A 2KKVA 2KTQA 1YT3A 5J2HA 2CN1A 4DSIA 2KFZA 2AXTO 2XE2A 2ZXIA 4FRXA 4JB3A 3WK8A 9ICJA 4GXKA 4FQEA 2Y1JA 4N59A 1ZQJA 5J29A 3OTQA 4F5PA 3SV4A 4M9GA 3TARA 3POUA 5HR7A 1ZQDA 4K3CA 3KTQA 3DDHA 2MHLA 5HMLA 3IG8A 4ICAA 3OSNA 2ZIXB 1X9XA 4FZMA 3A0HO 3HPOA 5F9LA 4KN7A 1OXJA 5B66U 3HJEA 1JN3A 3RTVA 4ECSA 1ZYQA 3T5HA 4K4HA 2IMWP 2JEIA 1LKYA 3ORYA 3PF1A 1PUZA 2AHOB 3RBEA 3UMGA 4YR2A 1A6SA 2ASJA 4AYMC 5AK5A 4LVSA 2V9WA 1QQ6A 4QZDA 4PL1A 4UASA 4I2EA 3BQ0A 3T5LA 4M9JA 2W7OA 1URJA 3G7GA 3POXA 3SD7A 1ZQZA 3KKAA 2FDRA 2MNHA 5GTIO 4BWJA 1NKEA 5AKGA 4JV2A 4M6WB 1L8OA 2CXYA 3HKZF 5KAFU 5KFBA 1JX4A 4C4TA 3UPGA 2WFAA 2LFUA 3AAEA 2KIWA 4XRHA 4GF4A 4RT3A 3WI4A 4ZOHC 1ZQLA 4MEYA 3BS7A 2YB4A 1TFRA 3PORA 5AM3A 3QU4A 2M06A 3EPIA 5KFNA 4US8A 4R63A 5AI4A 1S5LU 2G5IB 2ZTDA 3M9MB 4F72A 1DGJA 4ED1A 1S0MA 4C0ZA 2KJ9A 3MR2A 4UAUA 5AIAA 3HP6A 4CCHA 8ICVA 4O0IA 3AA7A 3H8JA 1IM4A 1U48A 5J2FA 3RH5A 4C8LA 1X6IA 4YXJA 9ICLA 3FC4A 5CRXA 2ZJAA 5AKYA 1ZQHA 1XC9A 1N62A 2PMZC 1JI7A 2ZG6A 3PSPA 2BPFA 4O3OA 2FPKA 3KVDD 1Q8KA 2D6FC 3TADA 2G07A 1SGGA 5KL1B 2BQUA 3PO4A 3HWTA 1FO4A 3F2CA 1D8YA 3PR5B 2Q0ZX 2EH9A 5K4LA 5HHHA 4F71A 5IIJA 4DL2A 1IXRA 4JV0A 2ERVA 4QWAA 2ZJ5A 2FLPA 4KLLA 3CRXA 2BCUA 4QZCA 5EE1A 1NJYA 2BCVA 4MFCA 5AM0A 4O5CA 1YZ7A 2A19A 4AYNA 2E5SA 2KSOA 4Y2QA 5KG4A 2IHNA 4DS5A 3GU3A 3QUBA 1U9LA 4F4WA 3HOLA 2O4VA 1ZQFA 1LKYB 2K8AA 1ZQBA 1KSPA 5KFFA 4DS4A 8ICNA 2AGPA 4O4UA 3VY8X 3ZDBA 2KXPA 2XCAA 4O3WA 1VDVA 4P4MA 3UMCA 4OD0A 1L6NA 1IV8A 4GC6A 1SV0A 3WK6A 4I2GA 3RFAA 4KLIA 5KFYA 4IC9A 1L5UA 4E1TA 2LHTA 2O6KA 4RT2A 3RB6A 2KMDA 3OGUA 3HOEA 2KOBA 5ALRA 8ICOA 4C4RA 1SXEA 3A0BO 5J2GA 1KEJA 3DEEA 3AAEB 5IINA 4RQ7A 1CI4A 2DWQA 4ECZA 4CTDA 4EYHB 2IHMA 8ICEA 3KZIO 1A0PA 2WB1F 2J6SA 3RJKA 3WU2O 2HBLA 1PHOA 2R89A 4GFJA 1JIHA 4DFDA 2UVWA 9ICOA 4RLBA 3MABA 3LVWA 1V97A 4UB8O 3GQCA 2AGQA 5KFUA 2VIXA 2FGQX 2K4IA 9ICFA 3ISCA 4DL4A 3UXOA 4QZIA 5ALHA 3SAGA 3AA7B 4C00A 3AEVA 1ZQUA 3LWMA 9ICEA 2MSNA 3IHQB 2F1JA 4DOAA 1U45A 3PGUA 3QEBZ 5J2CA 3PMLA 1Q46A 5EOZA 2NV3A 3TFRA 2HVIA 1J2NA 1U49A 1N56A 1F0MA 1NKBA 4FBTA 3EPGA 2W8KA 1RXVA 1AQ6A 4Z6CA 3PNCA 3TKAA 2X27X 3GV5B 1MSWD 1D8BA 2V4QA 3C1YA 2W55A 8ICPA 2NRXA 3RRGA 3Q8KA 1VLBA 4IRDA 4O3SA 2KZ3A 2LPEA 5D49A 2KZMA 2K4EA 5T5FA 4EX7A 2WB1C 1DXSA 4RQ6A 1BNOA 2PFQA 4YMOA 2HOFA 2GOLA 4CNQA 1ZD3A 2KSOB 2M07A 4N58A 2K89A 3M8RA 3HW9A 5IIIA 3MR3A 3ZD8A 2XMXA 5BPCA 5B5EO 2YPVA 3A2SX 1L3SA 2KXPB 4LSHA 2IOHA 4J9PA 3H8WA 3BJYA 4UB6O 2KDYA 3O0FA 4J9MA 1NK6A 3AA6A 3BS5A 2OH2A 9ICXA 4QIWF 3FAHA 3PX4A 3IRUA 2JHDA 1X6JA 2F1HA 4Y2TA 3RJIA 5ALUA 2VJ5A 4GCPA 4RPYA 2D3DA 4ELUA 3PW4A 3B0XA 5AKXA 5G5GA 2E1EA 1S0NA 4I27A 8ICQA 3CW2C 4QZGA 1ED1A 7ICIA 2LYHA 3LK9A 1ZQEA 3VZTX 1XWLA 4C8OA 2HHTA 3OJSA 2YN4A 1ZJNA 2Y2XA 4GLXA 5CB1A 1UCVA 5DBCA 2WAQC 5G39A 1ZQXA 3C1ZA 5DDYA 3V72A 4Z6DA 5AI6A 4B9MA 8ICWA 5KTQA 4F5OA 5KFDA 3PW5A 1ZQYA 3QU2A 1PVRA 1M6YA 2M0NA 5KT6A 3C2LA 5E79O 3WKCA 5KL8B 2OEHA 5DGAA 4YN4A 1FFVA 3RB0A 2UVUA 9ICVA 2ZTEA 4DQQA 5KFEA 2R4NA 5IIMA 2FPMA 3V8UA 2OCEA 4F93B 2DBYA 2XC9A 1DGSA 2N1RA 1BVSA 4BGDA 4PGYA 1A77A 2ISPA 1ZQPA 1B43A 3M8SA 2G0AA 3JPOA 4U9CA 3O0EA 4EBEA 7ICMA 1IZNA 3N28A 4QIWC 2FGRA 1U47A 1BT9A 3K19A 5AICA 4PUXA 1CRXA 3MR6A 3V6KA 1ZHYA 4KLDA 7ICHA 2LBOA 4FO6A 1CUKA 4F92B 5AM5A 5DKWA 2FLNA 4KLMA 3SAFA 4QWEA 3FM9A 1S8OA 3H4BA 4PZOA 3GZFA 4B9SA 3WKBA 3FYXA 3OSPA 7ICEA 2KFNA 4HAIA 2HHQA 1G90A 2YMMA 3SY9A 3ZDCA 3JCUO 4DL3A 4ELTA 1KFSA 4PPXA 1SV0C 3RB3A 3KZXA 8ICSA 9ICUA 5AKEA 2AXTU 1ZQCA 4KX3A 4DFPA 3PY8A 4R64A 4DO9A 4CE6A 1WCLA 4KLJA 2F77X 2JEGA 8ICIA 4YCXA 2YB1A 3TANA 3RB4A 3WI5A 4US9A 4ED8A 4LZDA 1HXUA 2XI9A 3FYHA 1RG6A 1QJ8A 2HBKA 3A0HU 1UA1A 4FSOA 2EZYA 4MFFA 2F44A 2PFOA 4AYDC 5AI0A 4I2HA 2W81C 2FPLA 2NYVA 2QTKA 5ALEA 3VZWX 3K1RB 2WJQA 1WYGA 2HBJA 2W43A 4XNLA 1TK0A 4FOZA 1S9FA 1UT8A 5J0RA 3EW9A 3Q8LA 3H40A 4YR3A 3N4MB 3NVZA 4YG2A 5ADXL 5GTIU 3ZDEA 4GHBA 4Q8EA 2KC0A 2IA6A 4NM1A 5KG5A 2B0CA 2ZIUA 3BZCA 3RRHA 1SL2A 1GFNA 4P0PA 5KT4A 4YVZA 3F2DA 1J97A 1NK4A 3SV3A 1L3TA 2KEYA 2W3SA 3RBHA 4KLTA 3RJHA 2KN7A 3NASA 2KE7A 4UBBA 4DFMA 3PVXA 4I2FA 5IYUA 3PQUA 3IP4B 5IIOA 3H4DA 1T3NA 1IZNB 3C5OA 4DLEA 5IILA 4FBUA 4JCHA 1V9PA 3RAXA 3AU6A 3DWOX 1BPXA 2F2AB 4C8NA 3NTUA 2DGZA 1HXTA 1N63A 1BPBA 2EZXA 3UXPA 4BDPA 5DG7A 3B9JA 4F91B 1QJPA 5AKZA 2DFLA 5CA7A 3QRAA 2FMQA 2BCQA 4F5NA 3SENA 4JV1A 5AFUK 4NV0A 1T1LA 1X42A 2KICA 3THVA 4PJ0O 2W9CA 3T24A 3BQ7A 5G38A 4F2SA 2C2RA 4UB1A 4F4YA 4FS1A 1RQLA 4TQRA 3I28A 8PRNA 3OHAA 2JXJA 4K4IA 4EEKA 4MFAA 3V6JA 3NSGA 5KG2A 3GV8B 2XY5A 4B9VA 1QCKA 5HNKA 4YR0A 2ZIWA 4RQ2A 2XTQA 4KLHA 4ACOA 1MQ2A 3BRZA 3V7JA 3PRNA 1TE2A 1X9SA 2DPJA 5T14A 1HEKA 2N2LA 4AYEC 4AZLA 4O3YA 4RQ0A 1QJ9A 1QQ5A 4CF5A 1MA7A 3QE9Y 3DA3A 3C2MA 1P4TA 1MM5A 5J2JA 1BPZA 5EWFA 2JH7A 3M1YA 3Q8SB 3PW2A 4I2CA 5KFGA 1HXXA 3MDAA 3N97B 3EWAA 2YQEA 2RP5A 3LK41 5AK4A 4TUSA 3LK42 2FMPA 5ALPA 7ICQA 2PMZF 3AQEA 5HHIA 5KFWA 1LB2B 2VA2A 4LSIA 4USAA 4D5UA 1U4BA 1BGXT 5ALOA 4Q44A 3GIMA 2K4PA 4J9KA 5C0YA 2ZIUB 3BQ2A 2K4HA 1WWVA 3I76A 4IR1A 4P0PB 5KFRA 3UU2A 3A0BU 3AA0A 3D6JA 5AIBA 2EZZA 2EANA 2KHVA 5KFTA 4B9LA 1Y88A 3KZIU 2R8HA 3C29A 3WU2U 2Y0SC 4M2YA 1JUDA 3HW8A 1S10A 8ICCA 4DOBA 4UB8U 3GDXA 2KIVA 4AKRA 2J6UA 4I2AA 2EQYA 2QARB 4Y2SA 3BZKA 3MC1A 3H8MA 4NLBA 2F1VA 2KZ7A 3T5KA 4Y2XA 4AP9A 3Q8RB 1XSPA 5H2FO 3F2BA 3SY7A 3PR4A 2W9CB 2YTUA 4F4ZA 4O4XA 4KRAA 3EYZA 4R66A 2LHFA 4F2RA 2P66A 4RU9A 4DF8A 2KZZA 3HWBA 3SZ2A 2OMFA 4Q45A 3QZ7A 2RLTA 3EUB2 1BPYA 1SL0A 5JDPA 4UAWA 3QXGA 1MC8A 1ZQTA 3IDWA 2KV2A 4FE3A 2BCRA 4DEZA 1RQNA 1Z4OA 1RYUA 5ALDA 3VE1A 1XU4A 2ZIWB 2KVSA 5DL5A 4GCSA 4EYIB 1ZQOA 4M0AA 4ECWA 3V7LA 2NO5A 5KG7A 1L7NA 4KLEA 3KHLA 4M47A 5J2DA 5B5EU 2C2EA 4P4OA 4IQVA 2K60A 2XICA 5AI5A 4UB6U 1BNPA 4RNNA 2IWVA 5ALJA 4XUSA 2KJ5A 4NXZA 4NL9C 3QU9A 4YFKA 4B9NA 4QZAA 1KFTA 3M6ZA 4AUIA 2DF4B 1L7PA 3PMNA 5AK3A 2CRXA 2WF7A 8ICZA 5J0SA 1L3VA 3ETLA 1FFUA 1X40A 4KN4A 1ZXIA 3AA0B 4KMOB 5CJ7A 4FZNA 5J2BA 4UAVA 4GC7A 4O49A 3F53A 2G08A 2OXOA 3RBDA 3QEAZ 4QZHA 2ISOA 3SI8A 1SXDA 4GCQA 5E79U 2XY7A 3SMVA 3S6JA 1CEZA 5KG6A 2OM6A 2JEFA 4EENA 2VANA 4EEYA 4AKRB 5TZVA 4NLKA 4LSFA 2FJ6A 3WKAA 3RJEA 5KFCA 2KZ7B 2R4OA 4J03A 2GH1A 1ZRNA 1S76D 3ICXA 4RQ4A 4ECTA 4C7YA 4NLNA 2J6TA 2H3VA 1NOMA 4FFDA 3ISBA 2R18A 3UAQA 3DV9A 4OO1J 4NLCA 2HW3A 4PR7A 1N2XA 3ONNA 1GFQA 1FIQA 5ALZA 3VZUX 1ZQVA 1ZRMA 2BDUA 2W04A 1QSYA 2L5YA 4FMSA 3D2NA 1NZBA 4KLFA 2K4TA 4FUVA 5EE2A 2ODGA 2OYYA 4RQ3A 1Q9GA 2AQ4A 2HOQA 5CP2A 3LK2A 4RLCA 2XVTA 2WAQF 3TAPA 3RJGA 1N5XA 1Q3UA 4AYBC 1KKXA 4RJWA 4GXIA 4I2DA 4CRXA 2B21A 1RXWA 4YQWA 4FSPA 4OJPA 2G5HB 2XG6A 1L8LA 2A1AA 3RJFA 4OCZA 4IQUA 1SL1A 5ALNA 2VJ4A 2BKEA 4B61A 1Q3VA 3ED5A 2R4LA 2Y0KA 1PZNA 4OJLA 5ALSA 4Y2UA 2YX8A 5ALGA 4DSFA 2FE9A 1GFOA 3N7SC 3HILA 4GXJA 4RL9A 1J2MA 2HCFA 3WK5A 4EBDA 1SB3C 3PX0A 1D8LA 4KTQA 2R8GA 2PORA 5KFOA 2M9NA 2JMGA 4QZ8A 2KK0A 3F5AA 3F5EA 2RDJA 4O3MA 3VC8A 3V6HA 5J8YA 1L3UA 4QZBA 5J0YA 1ZQ1C 5D46A 5HMMA 5CHGA 2JV3A 5L1LA 3WK9A 4ECVA 4P0QA 2BZFA 4UQGA 2Y9TA 3VCBA 3RH4A 5ALQA 4F4XA 1UPHA 2XIDA 5ALVA 1SIJA 3IM1A 3TACB 4M04A 4TUPA 2HBMA 5AM1A 2XGQA 1NK7A 3TQ1A 4RPZA 1KLNA 5DG9A 5DL6A 1ZQAA 5L1KA 4O3NA 9ICMA 4DSLA 2WF8A 2KG5A 4U7CA 4KR4A 2LYAA 3FDSA 2BHNA 3Q8MA 1BH3A 3MGIA 4O5KA 5DQGA 4TURA 4J9OA 7ICKA 3N7PD 3GV7B 4PHPA 2WF5A 4K3BA 4P4PA 4LZGA 3M9OB 2AGOA 4AYID 2R4PA 4I2BA 5KAIO 3MBYA 4XNKA 9ICCA 3AA1A 1T16A 1F5SA 1TV9A 4Z3TA 1ZQQA 1N48A 5KFXA 3LK2B 3G6YA 3QYPA 1GFPA 3NRZA 9ICSA 9ICIA 2XGPA 4OJOA 7PRNA 1SV4A 2Y0HA 4JFBA 4JWMA 2GO7A 3VY9X 4KX5A 4PJ0U 4DSEA 4G76A 2ZUBA 1ZD4A 5EWGA 5TISU 1ZHXA 2ZXHA 5L1IA 4FS2A 2DKZA 2ASLA 4RUCA 4O9MA 1YS5A 2XTRA 4QW9A 1NK8A 2C28A 5J0PA 3PGRA 5J0TA 3AU2A 4PHAA 2HHSA 4XQ8A 1QSLA 1H38A 4I29A 3AQFA 3T3FA 4N74A 1T3QA 3LDAA 4J9SA 4EX6A 1JRPA 4YXMA 1SZPA 1E54A 3AA6B 4J9NA 3BS5B 2ES6A 3RF9A 1T94A 1NK9A 4RQMA 3ALRA 1KQQA 1N61A 3KOOA 1KN5A 4TUQA 1UT5A 1SKRA 3RR8A 1TVAA 3PW7A 5DLFA 5AK6A 3RJJA 2XE3A 3E58A 4RZRA 4DFKA 1ZHZA 1WUDA 4PGXA 4JMUA 3DA4A 2KKPA 3PQSA 2JMMA 3SZDA 2W9AA 1TAQA 8ICMA 4N75A 3TZGA 4RQ8A 4UB2A 2E8OA 3NS1A 4R8UA 2NO4A 1TAUA 4DCCA 5ALKA 9ICBA 2XY6A 2OWOA 1MQ3A 5ALYA 3E2EA 7ICGA 4OJ5A 2H5XA 3L5KA 3K1ZA 5KG3A 3JPSA 1WCNA 3SYZA 1JMSA 5KT5A 2ATLA 4PHEA 2LKYA 3T20A 4YMMA 5AHXA 2BR0A 2KNJA 4ECQA 4NL9A 4ED6A 4QNLA 1K5OA 2IOFA 1ZQGA 3LWLA 2BDPA 3AA1B 1YZ6A 5DGBA 3POQA 2RQ5A 1JXEA 3GIJA 2B6GA 9ICHA 5GTHO 5KFZA 2PI5A 4WJ3B 1OUQA 1S97A 3QZ8A 1PK3A 5H2FU 5DQIA 1MPFA 5PRNA 4YMNA 2AJQA 5L1JA 2BCSA 2W80C 2QB0A 1P7DA 5KFAA 4BUGA 1TAMA 1RM6C 4BUMX 2W3RA 3ZI4A 4HYKA 5TISO 4M9LA 1HJPA 5EE9A 3MR5A 2ALZA 7ICUA 2JQYA 4QW8A 4EZ9A 4DF4A 4UATA 1KW4A 2AU0A 2H3IA 3C5GA 2JEJA 5BOLA 1COOA 2E8PA 2HMXA 5J8YC 3JPNA 4UAZA 2W54A 3JPPA 5G5HA 4JUZA 5KT3A 1S0VA 2VA3A 2Y0SF 2WJRA 4I2IA 2XO7A 5HP4A 1RDFA 5KT7A 3C2KA 1KFDA 1ZQKA 3TFSA 7ICSA 4IR9A 5ADXK 3OPXA 3QX7A 2W9MA 3PSTA 2K0LA 4YP3A 2W9BA 2PRNA 4IS7A 3MGHA 5G26A 2V4RA 1L7MA 3M6KA 4EELA 4YD1A 4LJXA 4K4GA 1MM4A 1NK5A 3HRDD 2VA8A 3CP8A 2YMPA 1NKCA 4KLOA 1TKDA 7ICPA 1Z3EB 3SYBA 2Q4TA 3AUOA 4IL6O 4AYBF 2GLEA 8ICUA 3WKEA 4R8UB 4BXOA 5ALTA 4D64A 2MA1A 4QZFA 1QSSA 2FMSA 4DQIA 1PVQA 1NNLA 1BPDA 2DUYA 2IWWA 2WHEA 9ICTA 5J0OA 3ISDA 4FT6A 4KR8A 2PFNA 1O03A 1Z00A 8ICBA 4RNMA 4Y2JA 2YNKA 1XNSA 4MEXA 1TK8A 3D2QA 1Z1VA 4Y2RA 3L4PA 1D9DA 3RAQA 2R8AA 3KFUF 3PGSA 5KNIA 1BPEA 1HIWA 2PKEA 2EAOA 3UQ0A 5BOMA 3DZMA 4ED3A 5J2EA 5J0UA 2A1JA 4O3RA 1ZOLA 4C7ZA 5AKJA 1KL9A 4R65A 2E1FA 4NWIA 5KFLA 3H0MB 3SZVA 1DOQA 4O5EA 5DB8A 4ECXA 3MDCA 4EZ6A 3PSIA 1RYRA 4P2HA 3J81j 4ELVA 1NZPA 2BGWA 2QB0B 1JXLA 3NUQA 5DLGA 9ICPA 4F50A 3WK7A 3U26A 2P6RA 3N7RC 1EXNA 2IOFK 8ICLA 2XCPA 1BXWA 1JALA 2LI6A 4RPXA 2KD1A 2G09A 2MRLA 2J4UP 2NRTA 3QUCA 7ICLA 5KFJA 2F1IA 1X9MA 9ICGA 1SZHA 2D8CA 1QTMA 1QH9A 1K1SA 5JUMA 5DDMA 1QQ7A 4KLSA 2HHWA 2AH5A 4PH5A 7ICJA 5AKIA 1AROP 4Z6FA 2KHQA 1XO0A 5AI9A 5CEHA 3OJUA 4ECRA 1ZD5A 4Z6EA 2MUTA 1F44A 3MGVA 1JROA 4PL2A 3T0SA 8ICGA 5AKLA 3PV8A 2RRDA 5L1MA 2BPGA 4C4SA 2W9BB 4E0DA 1DK2A 2BPCA 2R8IA 4B9UA 2YY6A 5FP0A 9ICWA 2J1NA 2W03A 3BS0A 1V85A 3JPTA 3H8SA 4KITB 3ZDDA 1Q9FA 3HKZC 2HDOA 5KFSA 2RDIA 3AN1A 2FLLA 5KG1A 2RHFA 3PX6A 5HR6A 5FVNA 3I1YA 5KFMA 3LK3A 7ICFA 4JWNA 5G3AA 3L3FX 3NVWA 2R8JA 4BXOB 3VE2A 7ICRA 3UPQA 1SKWA 5D5DA 4NLGA 4TQSA 5DG8A 3KHHA 2JRZA 4RUAA 1RZTA 5B66O 4YD2A 1OPFA 4JK1A 4UB3A 8ICFA 5KFQA 1Z00B 1L7OA 2BQ3A 8ICXA 2DL0A 2FI1A 5CWRA 1LV5A 3WKDA 2UVRA 4F5RA 1XO1A 5J0WA 5DB7A 5AKKA
chains in the Genus database with same CATH topology
4PL1A 2W7OA 3VCBA 3H0RB 1URJA 3G7GA 3POXA 1UPHA 2XIDA 5ADXL 4BJQA 2Y7SA 4GHBA 2HBMA 2KC0A 2MNHA 5DL6A 2ZIUA 1GFNA 4P0PA 3JTYA 6PRNA 3HKZF 4U7CA 4KR4A 2LYAA 3F2DA 5DL8A 2HOIA 1THQA 3UPGA 1BH3A 3EMNX 2LFUA 3AAEA 4FESA 2KEYA 2KIWA 4GF4A 3RBHA 3WI4A 3N7PD 5IYUA 2YB4A 2H3FA 3PQUA 3IP4B 3PORA 1IZNB 3C5OA 2M06A 4LSEA 4JCHA 4AYID 5A0LA 2G5IB 2K8BB 4XNKA 3AA1A 2F2AB 1PRNA 4C0ZA 2KJ9A 1GO3F 4Z3TA 1HXTA 2DGZA 2ZLDA 3QRCA 3LK2B 4FRTA 3PSFA 3AA7A 1QJPA 1GFPA 4O3XB 2ZIVA 3QRAA 4G75A 4OJOA 7PRNA 2Y0HA 4JFBA 2XE1A 5CRXA 3VY9X 4KX5A 4G76A 4NV0A 5AFUK 2KICA 2PMZC 1ZHXA 3T24A 2ZXHA 2ZG6A 3PSPA 4AFKA 4U6PA 3KVDD 2D6FC 2G07A 5KL1B 1YS5A 2XTRA 3F2CA 4O3ZA 3E0FA 2F1TA 1IIPA 8PRNA 4BX9C 2F76X 3NSGA 2ERVA 3AQFA 3CRXA 3LYSA 4E1SA 3LK3B 1E54A 3AA6B 3LVVA 2ZIWA 2XTQA 3RF9A 2W7PA 4ACOA 1T94A 3PRNA 4AYNA 2E5SA 3ALRA 4AKMA 5T14A 3GU3A 4CGZA 1HEKA 3HOLA 2N2LA 2O4VA 4AYEC 4AZLA 4OJ6A 4O3YA 1QJ9A 2K8AA 1MA7A 3DA3A 1P4TA 2XE3A 1MM5A 1ZHZA 2VKQA 1WUDA 4JMUA 3DA4A 4O4UA 2KKPA 2JH7A 3VY8X 1HXXA 2KXPA 3PQSA 2JMMA 3SZDA 4O3WA 3IN5A 1L6NA 2RP5A 3LK41 3LK42 2KVCA 3TZGA 2PMZF 3AQEA 3RFAA 4IC9A 4LSIA 4E1TA 2LHTA 4D5UA 4QJFB 4QQ1A 4D65A 5C0YA 2ZIUB 4OJ5A 2K4HA 3K1ZA 3HOEA 2KOBA 4P0PB 3UU2A 3AA0A 2K8CB 1H6S1 2LKYA 3T20A 3DEEA 3AAEB 3C28A 2KHVA 2KNJA 1A0PA 2WB1F 3C29A 2Y0SC 2ODJA 2HBLA 1PHOA 4QNLA 5DL7A 4GFJA 4RLBA 3LVWA 4AKRA 3AA1B 3SQIA 2VIXA 3POQA 2FGQX 2K4IA 4NLBA 2F1VA 2KZ7A 3SYSA 1PVPA 4WJ3B 1OUQA 3SAGA 3AA7B 2ZIVB 2H3QA 1MPFA 5PRNA 3CYMA 3F2BA 3SY7A 2W80C 1P7DA 2NV3A 4O4XA 4BUGA 1TAMA 4BUMX 1OSMA 4KRAA 2LHFA 1DRGA 3AAAA 3HWBA 3AL0B 2H3IA 2OMFA 2X27X 1D8BA 2HMXA 5JDPA 2KV2A 4FE3A 3M7DA 2K4EA 5T5FA 4C69X 2Y0SF 3VE1A 2WB1C 2ZIWB 5DL5A 4GCSA 5GV0A 3NRWA 2HOFA 2GOLA 5ADXK 1ZHTA 3OPXA 2M07A 4N58A 3PSTA 2K0LA 2PRNA 2K89A 3HW9A 4A8EA 5G26A 2XMXA 3M6KA 2CPRA 1MM4A 2YPVA 3A2SX 3CP8A 2XICA 3H0LB 4FZLA 2KXPB 4LSHA 2KDYA 3SYBA 4P0QB 2Q4TA 3O0FA 3AA6A 2KJ5A 2OH2A 5AFUL 4QIWF 2JH1A 2JHDA 2VJ5A 4GCPA 2JGAA 2ZIXA 4D64A 2MA1A 1Z19A 1ORMA 3GP6A 3M6ZA 4AUIA 2E1EA 2DF4B 2N2MA 2Z7JA 2CRXA 1PVQA 1ED1A 3VZTX 3AA0B 4FT6A 4KR8A 4KMOB 2Y2XA 3IG5A 2YNKA 4FZNA 1XNSA 2WAQC 4O49A 3F53A 3T79A 2G08A 2OXOA 3SAHA 1ZHWA 3D2QA 4GCQA 1PVRA 3SMVA 3KFUF 2M0NA 4F4BA 2OM6A 5KL8B 1HIWA 1KBUA 4AKRB 1Z1BA 2ZFGA 4LSFA 4CDGA 1GFMA 2KZ7B 2E1FA 2KJ8A 2GH1A 4NWIA 3H0MB 3SZVA 3V8UA 3ICXA 2F8LA 2XE5A 2N1RA 2H3VA 3PSIA 2DQNB 2G0AA 4U9CA 3O0EA 2R18A 3UAQA 2LYBA 1IZNA 3NUQA 3D2SA 4OO1J 4QIWC 4NLCA 3ONNA 1GFQA 2FGRA 1BT9A 3N7RC 3K19A 2Y0LA 4PUXA 1CRXA 1ZHYA 4RJXA 3VZUX 1BXWA 1ECWA 2BDUA 2W04A 2KD1A 3AAAB 2G09A 2MRLA 2J4UP 4FMSA 2LBOA 3D2NA 1NZBA 2K4TA 4FUVA 5EE2A 2OYYA 1Q9GA 2HOQA 1SZHA 2G06A 3LK2A 4RLCA 3SAFA 2XVTA 2WAQF 3GZFA 3FYXA 1Q3UA 4AYBC 3PZPA 2A3VA 4RJWA 1G90A 3SY9A 2GE4A 2H3ZA 2KHQA 4CRXA 1XO0A 4FSPA 1F44A 2KKVA 3MGVA 4OJPA 2G5HB 4PL2A 1YT3A 3T0SA 2XG6A 3KZXA 2RRDA 2CN1A 4KX3A 2XE2A 2ZXIA 4FRXA 2J1NA 2W03A 1Q9FA 2VJ4A 2F77X 3HKZC 4B61A 1Q3VA 4N59A 2Y0KA 4OJLA 2YB1A 2YX8A 2RHFA 5HR6A 3WI5A 5FVNA 1GFOA 3N7SC 1HXUA 2XI9A 3LK3A 5HR7A 3POUA 4RL9A 1QJ8A 3L3FX 2HBKA 2PORA 2MHLA 4FSOA 3IG8A 2JMGA 4ICAA 3VE2A 2ZIXB 4FZMA 5D5DA 4AYDC 3F5AA 3F5EA 2W81C 4O3MA 3VC8A 1OPFA 2QTKA 1ZQ1C 1A6SA 3VZWX 4AYMC 2HBJA 4P0QA 4XNLA 4FOZA 4AYBF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N59 A;  2XTR A;  4G75 A;  4G76 A;  4FZM A;  4FZN A;  4N58 A;  2XMX A;  3DA4 A;  2XTQ A;  3DA3 A;  4FZL A; 
#chains in the Genus database with same CATH topology
 3KD3 A;  1ZQM A;  2ESE A;  4KMU A;  4ED0 A;  3H7I A;  4XA5 A;  2DPI A;  1SWW A;  4Q43 A;  3H0R B;  4NM2 A;  2P35 A;  5JTI A;  4CF4 A;  4BJQ A;  2PI4 A;  2Y7S A;  3QU7 A;  3QNM A;  9ICR A;  4UBC A;  2A1J B;  1Z4N A;  2PFP A;  3TAQ A;  3NJT A;  3JTY A;  6PRN A;  5J0X A;  1T4G A;  3WK4 A;  5DL8 A;  2HOI A;  1THQ A;  3EMN X;  5KAF O;  4NJ8 A;  1NJX A;  4FES A;  1MN8 A;  2JZB A;  5DQH A;  3C23 A;  4J9R A;  1UQV A;  2H3F A;  2AQ0 A;  1B4F A;  1PK1 A;  4LSE A;  2MAX A;  1NK0 A;  5EE3 A;  5KFH A;  5KAI U;  2YMQ A;  3QU5 A;  5A0L A;  2K8B B;  1KRP A;  3GIL A;  1HUZ A;  1S5L O;  4KLU A;  2W8L A;  1PRN A;  9ICA A;  1GO3 F;  7ICN A;  3UM9 A;  1T8E A;  5ALL A;  2ZLD A;  1DK3 A;  2WF6 A;  3QRC A;  4FRT A;  3PSF A;  5KFI A;  5AM2 A;  3MFH A;  3RR7 A;  7ICV A;  4DL5 A;  4BWM A;  4O3X B;  2ZIV A;  4G75 A;  2XE1 A;  4UAY A;  2I6X A;  3AM9 A;  4J9Q A;  5KFV A;  2MUT B;  2I5H A;  4M9N A;  4Y2V A;  5ALM A;  4AFK A;  4U6P A;  3PW0 A;  4G9B A;  4QWC A;  5AKH A;  3QUQ A;  3B0Y A;  5ALX A;  4C4V A;  2I9G A;  1SWV A;  1X66 A;  4GIB A;  1B0X A;  4O3Z A;  5ALI A;  3E0F A;  1RPL A;  2F1T A;  1IIP A;  1D9F A;  4BX9 C;  2F76 X;  8ICR A;  3ZDA A;  3LYS A;  4E1S A;  3LK3 B;  4DFJ A;  4O3Q A;  4QWD A;  5KG0 A;  2HHX A;  3LVV A;  1ZJM A;  4B6J A;  2W7P A;  2F3N A;  4EBC A;  1XSL A;  4AKM A;  5DBA A;  2F8K A;  3KKA C;  3RH6 A;  4CGZ A;  2MU2 A;  3BRY A;  2IBK A;  4OJ6 A;  2QB1 A;  4RNO A;  5D4B A;  3PO5 A;  4I28 A;  4DQR A;  5EWE A;  4KLQ A;  2WVP A;  3Q8Q B;  3BDP A;  2HI0 A;  3M9N B;  2VKQ A;  4ZH4 A;  3ZD9 A;  4IQT A;  4QZ9 A;  2BQR A;  1C7Y A;  1COK A;  2HVH A;  2Y1I A;  3IN5 A;  4MF8 A;  5DBB A;  5EE0 A;  2E8M A;  2WTF A;  3G6V A;  2KVC A;  2QKQ A;  8ICH A;  4MHV A;  4F8R A;  4QJF B;  4QQ1 A;  3C21 A;  4D65 A;  5F3X B;  1UHU A;  3NGD A;  8ICK A;  4RQ5 A;  1V38 A;  5JU5 A;  4J9L A;  3K4G A;  2K8C B;  1H6S 1;  3KHG A;  2C2D A;  1HUO A;  3C28 A;  3GIK A;  2JZB B;  2JR5 A;  3BQT A;  2DKX A;  1O08 A;  2X9K A;  4NLZ A;  3IV6 A;  2NRV A;  1PK1 B;  4ECY A;  8ICJ A;  2ODJ A;  4UAR A;  4PZN A;  5DL7 A;  4Q8F A;  3GFK B;  4PHD A;  1IG6 A;  2HHU A;  1A76 A;  3GII A;  2LM4 A;  1S77 D;  3TAD C;  1WWU A;  3SQI A;  4X5V A;  2ZUD A;  4DL7 A;  5GTH U;  2C22 A;  1ZQN A;  2ASD A;  1KTQ A;  1B22 A;  7ICT A;  3SYS A;  1PVP A;  2YML A;  2ZTC A;  3TI0 A;  7ICO A;  4I2J A;  2ZIV B;  3HX0 A;  4CF3 A;  3BQ1 A;  1ZQR A;  1FEZ A;  2H3Q A;  3CYM A;  5ALF A;  1S0O A;  5KT2 A;  5AM4 A;  2GWS A;  4RQN A;  4F3O A;  1OSM A;  1DRG A;  4C4V B;  2HSZ A;  3AAA A;  8ICY A;  3AL0 B;  3KHR A;  3UQ2 A;  1ZQI A;  4PGQ A;  3JPR A;  3UMB A;  4Y2Y A;  2I1Q A;  4KLG A;  4DL6 A;  2WF9 A;  3M7D A;  4G3I A;  3SEI A;  1X2I A;  4RQ1 A;  4DSJ A;  4C69 X;  1NJZ A;  3C5F A;  5GV0 A;  5IIK A;  3NRW A;  5KFK A;  2LMR A;  4F5Q A;  3OHB A;  4DLG A;  4UW9 A;  1ZHT A;  3T5J A;  2EAM A;  2OHF A;  2ZJ8 A;  4DSK A;  4O3P A;  4A8E A;  4NY8 A;  1ZQS A;  2CPR A;  4IQW A;  8ICA A;  4DWI A;  3H0L B;  4FZL A;  3JPQ A;  4IL6 U;  4P0Q B;  1NJW A;  2E3T A;  1XS9 D;  5AFU L;  2JH1 A;  1X9W A;  1K1Q A;  4C8K A;  2JGA A;  2ZIX A;  1Z19 A;  1ORM A;  3GP6 A;  9ICN A;  2N2M A;  2Z7J A;  3QUT A;  3ETR A;  4QWB A;  3UXN A;  4B9T A;  2UVV A;  3IG5 A;  5J0Q A;  3T79 A;  3SAH A;  1ZQW A;  3KBB A;  4C80 A;  2PXI A;  1N60 A;  1ZHW A;  5L9X A;  4DQP A;  5ALW A;  2EDU A;  1LVH A;  4IRC A;  1OW5 A;  4F4B A;  5CR0 A;  1KBU A;  4F4K A;  1QLN A;  1Z1B A;  3HT3 A;  4ED7 A;  2ZFG A;  2NRZ A;  4DQS A;  2KP7 A;  1VJ5 A;  4CDG A;  1GFM A;  5KFP A;  4M6W A;  5DB9 A;  2F1C X;  2KJ8 A;  5C5J A;  4UB5 A;  2EAP A;  1T7P A;  2F8L A;  2XE5 A;  2ZUC A;  4ED2 A;  1XSN A;  2Y9U A;  3DWN A;  1N5W A;  2DQN B;  3AMZ A;  1RYS A;  1NI3 A;  2QLT A;  1C20 A;  3NVY A;  3G6X A;  2LYB A;  4QZE A;  3SR6 A;  2NRW A;  4C8M A;  3D2S A;  1SKS A;  3EZ5 A;  4UB4 A;  5J2K A;  2Y0L A;  1UA0 A;  4RJX A;  2QAR A;  2R8K A;  2R88 A;  3R9K A;  1ECW A;  3Q8P B;  9ICK A;  3AAA B;  4IRK A;  1TK5 A;  2LM1 A;  2HHV A;  4MF2 A;  4Y2P A;  5J2A A;  3MFI A;  3CNH A;  1WG8 A;  5AI8 A;  4M9H A;  2G06 A;  1ZD2 P;  4DOC A;  2E8N A;  3NVV A;  4ECU A;  9ICQ A;  5F9N A;  3PZP A;  2A3V A;  8ICT A;  2P6U A;  3V7K A;  5DB6 A;  1ZET A;  5J2I A;  2GE4 A;  2H3Z A;  5JRT A;  1KDH A;  3K75 D;  2W11 A;  2KKV A;  2KTQ A;  1YT3 A;  5J2H A;  2CN1 A;  4DSI A;  2KFZ A;  2AXT O;  2XE2 A;  2ZXI A;  4FRX A;  4JB3 A;  3WK8 A;  9ICJ A;  4GXK A;  4FQE A;  2Y1J A;  4N59 A;  1ZQJ A;  5J29 A;  3OTQ A;  4F5P A;  3SV4 A;  4M9G A;  3TAR A;  3POU A;  5HR7 A;  1ZQD A;  4K3C A;  3KTQ A;  3DDH A;  2MHL A;  5HML A;  3IG8 A;  4ICA A;  3OSN A;  2ZIX B;  1X9X A;  4FZM A;  3A0H O;  3HPO A;  5F9L A;  4KN7 A;  1OXJ A;  5B66 U;  3HJE A;  1JN3 A;  3RTV A;  4ECS A;  1ZYQ A;  3T5H A;  4K4H A;  2IMW P;  2JEI A;  1LKY A;  3ORY A;  3PF1 A;  1PUZ A;  2AHO B;  3RBE A;  3UMG A;  4YR2 A;  1A6S A;  2ASJ A;  4AYM C;  5AK5 A;  4LVS A;  2V9W A;  1QQ6 A;  4QZD A;  4PL1 A;  4UAS A;  4I2E A;  3BQ0 A;  3T5L A;  4M9J A;  2W7O A;  1URJ A;  3G7G A;  3POX A;  3SD7 A;  1ZQZ A;  3KKA A;  2FDR A;  2MNH A;  5GTI O;  4BWJ A;  1NKE A;  5AKG A;  4JV2 A;  4M6W B;  1L8O A;  2CXY A;  3HKZ F;  5KAF U;  5KFB A;  1JX4 A;  4C4T A;  3UPG A;  2WFA A;  2LFU A;  3AAE A;  2KIW A;  4XRH A;  4GF4 A;  4RT3 A;  3WI4 A;  4ZOH C;  1ZQL A;  4MEY A;  3BS7 A;  2YB4 A;  1TFR A;  3POR A;  5AM3 A;  3QU4 A;  2M06 A;  3EPI A;  5KFN A;  4US8 A;  4R63 A;  5AI4 A;  1S5L U;  2G5I B;  2ZTD A;  3M9M B;  4F72 A;  1DGJ A;  4ED1 A;  1S0M A;  4C0Z A;  2KJ9 A;  3MR2 A;  4UAU A;  5AIA A;  3HP6 A;  4CCH A;  8ICV A;  4O0I A;  3AA7 A;  3H8J A;  1IM4 A;  1U48 A;  5J2F A;  3RH5 A;  4C8L A;  1X6I A;  4YXJ A;  9ICL A;  3FC4 A;  5CRX A;  2ZJA A;  5AKY A;  1ZQH A;  1XC9 A;  1N62 A;  2PMZ C;  1JI7 A;  2ZG6 A;  3PSP A;  2BPF A;  4O3O A;  2FPK A;  3KVD D;  1Q8K A;  2D6F C;  3TAD A;  2G07 A;  1SGG A;  5KL1 B;  2BQU A;  3PO4 A;  3HWT A;  1FO4 A;  3F2C A;  1D8Y A;  3PR5 B;  2Q0Z X;  2EH9 A;  5K4L A;  5HHH A;  4F71 A;  5IIJ A;  4DL2 A;  1IXR A;  4JV0 A;  2ERV A;  4QWA A;  2ZJ5 A;  2FLP A;  4KLL A;  3CRX A;  2BCU A;  4QZC A;  5EE1 A;  1NJY A;  2BCV A;  4MFC A;  5AM0 A;  4O5C A;  1YZ7 A;  2A19 A;  4AYN A;  2E5S A;  2KSO A;  4Y2Q A;  5KG4 A;  2IHN A;  4DS5 A;  3GU3 A;  3QUB A;  1U9L A;  4F4W A;  3HOL A;  2O4V A;  1ZQF A;  1LKY B;  2K8A A;  1ZQB A;  1KSP A;  5KFF A;  4DS4 A;  8ICN A;  2AGP A;  4O4U A;  3VY8 X;  3ZDB A;  2KXP A;  2XCA A;  4O3W A;  1VDV A;  4P4M A;  3UMC A;  4OD0 A;  1L6N A;  1IV8 A;  4GC6 A;  1SV0 A;  3WK6 A;  4I2G A;  3RFA A;  4KLI A;  5KFY A;  4IC9 A;  1L5U A;  4E1T A;  2LHT A;  2O6K A;  4RT2 A;  3RB6 A;  2KMD A;  3OGU A;  3HOE A;  2KOB A;  5ALR A;  8ICO A;  4C4R A;  1SXE A;  3A0B O;  5J2G A;  1KEJ A;  3DEE A;  3AAE B;  5IIN A;  4RQ7 A;  1CI4 A;  2DWQ A;  4ECZ A;  4CTD A;  4EYH B;  2IHM A;  8ICE A;  3KZI O;  1A0P A;  2WB1 F;  2J6S A;  3RJK A;  3WU2 O;  2HBL A;  1PHO A;  2R89 A;  4GFJ A;  1JIH A;  4DFD A;  2UVW A;  9ICO A;  4RLB A;  3MAB A;  3LVW A;  1V97 A;  4UB8 O;  3GQC A;  2AGQ A;  5KFU A;  2VIX A;  2FGQ X;  2K4I A;  9ICF A;  3ISC A;  4DL4 A;  3UXO A;  4QZI A;  5ALH A;  3SAG A;  3AA7 B;  4C00 A;  3AEV A;  1ZQU A;  3LWM A;  9ICE A;  2MSN A;  3IHQ B;  2F1J A;  4DOA A;  1U45 A;  3PGU A;  3QEB Z;  5J2C A;  3PML A;  1Q46 A;  5EOZ A;  2NV3 A;  3TFR A;  2HVI A;  1J2N A;  1U49 A;  1N56 A;  1F0M A;  1NKB A;  4FBT A;  3EPG A;  2W8K A;  1RXV A;  1AQ6 A;  4Z6C A;  3PNC A;  3TKA A;  2X27 X;  3GV5 B;  1MSW D;  1D8B A;  2V4Q A;  3C1Y A;  2W55 A;  8ICP A;  2NRX A;  3RRG A;  3Q8K A;  1VLB A;  4IRD A;  4O3S A;  2KZ3 A;  2LPE A;  5D49 A;  2KZM A;  2K4E A;  5T5F A;  4EX7 A;  2WB1 C;  1DXS A;  4RQ6 A;  1BNO A;  2PFQ A;  4YMO A;  2HOF A;  2GOL A;  4CNQ A;  1ZD3 A;  2KSO B;  2M07 A;  4N58 A;  2K89 A;  3M8R A;  3HW9 A;  5III A;  3MR3 A;  3ZD8 A;  2XMX A;  5BPC A;  5B5E O;  2YPV A;  3A2S X;  1L3S A;  2KXP B;  4LSH A;  2IOH A;  4J9P A;  3H8W A;  3BJY A;  4UB6 O;  2KDY A;  3O0F A;  4J9M A;  1NK6 A;  3AA6 A;  3BS5 A;  2OH2 A;  9ICX A;  4QIW F;  3FAH A;  3PX4 A;  3IRU A;  2JHD A;  1X6J A;  2F1H A;  4Y2T A;  3RJI A;  5ALU A;  2VJ5 A;  4GCP A;  4RPY A;  2D3D A;  4ELU A;  3PW4 A;  3B0X A;  5AKX A;  5G5G A;  2E1E A;  1S0N A;  4I27 A;  8ICQ A;  3CW2 C;  4QZG A;  1ED1 A;  7ICI A;  2LYH A;  3LK9 A;  1ZQE A;  3VZT X;  1XWL A;  4C8O A;  2HHT A;  3OJS A;  2YN4 A;  1ZJN A;  2Y2X A;  4GLX A;  5CB1 A;  1UCV A;  5DBC A;  2WAQ C;  5G39 A;  1ZQX A;  3C1Z A;  5DDY A;  3V72 A;  4Z6D A;  5AI6 A;  4B9M A;  8ICW A;  5KTQ A;  4F5O A;  5KFD A;  3PW5 A;  1ZQY A;  3QU2 A;  1PVR A;  1M6Y A;  2M0N A;  5KT6 A;  3C2L A;  5E79 O;  3WKC A;  5KL8 B;  2OEH A;  5DGA A;  4YN4 A;  1FFV A;  3RB0 A;  2UVU A;  9ICV A;  2ZTE A;  4DQQ A;  5KFE A;  2R4N A;  5IIM A;  2FPM A;  3V8U A;  2OCE A;  4F93 B;  2DBY A;  2XC9 A;  1DGS A;  2N1R A;  1BVS A;  4BGD A;  4PGY A;  1A77 A;  2ISP A;  1ZQP A;  1B43 A;  3M8S A;  2G0A A;  3JPO A;  4U9C A;  3O0E A;  4EBE A;  7ICM A;  1IZN A;  3N28 A;  4QIW C;  2FGR A;  1U47 A;  1BT9 A;  3K19 A;  5AIC A;  4PUX A;  1CRX A;  3MR6 A;  3V6K A;  1ZHY A;  4KLD A;  7ICH A;  2LBO A;  4FO6 A;  1CUK A;  4F92 B;  5AM5 A;  5DKW A;  2FLN A;  4KLM A;  3SAF A;  4QWE A;  3FM9 A;  1S8O A;  3H4B A;  4PZO A;  3GZF A;  4B9S A;  3WKB A;  3FYX A;  3OSP A;  7ICE A;  2KFN A;  4HAI A;  2HHQ A;  1G90 A;  2YMM A;  3SY9 A;  3ZDC A;  3JCU O;  4DL3 A;  4ELT A;  1KFS A;  4PPX A;  1SV0 C;  3RB3 A;  3KZX A;  8ICS A;  9ICU A;  5AKE A;  2AXT U;  1ZQC A;  4KX3 A;  4DFP A;  3PY8 A;  4R64 A;  4DO9 A;  4CE6 A;  1WCL A;  4KLJ A;  2F77 X;  2JEG A;  8ICI A;  4YCX A;  2YB1 A;  3TAN A;  3RB4 A;  3WI5 A;  4US9 A;  4ED8 A;  4LZD A;  1HXU A;  2XI9 A;  3FYH A;  1RG6 A;  1QJ8 A;  2HBK A;  3A0H U;  1UA1 A;  4FSO A;  2EZY A;  4MFF A;  2F44 A;  2PFO A;  4AYD C;  5AI0 A;  4I2H A;  2W81 C;  2FPL A;  2NYV A;  2QTK A;  5ALE A;  3VZW X;  3K1R B;  2WJQ A;  1WYG A;  2HBJ A;  2W43 A;  4XNL A;  1TK0 A;  4FOZ A;  1S9F A;  1UT8 A;  5J0R A;  3EW9 A;  3Q8L A;  3H40 A;  4YR3 A;  3N4M B;  3NVZ A;  4YG2 A;  5ADX L;  5GTI U;  3ZDE A;  4GHB A;  4Q8E A;  2KC0 A;  2IA6 A;  4NM1 A;  5KG5 A;  2B0C A;  2ZIU A;  3BZC A;  3RRH A;  1SL2 A;  1GFN A;  4P0P A;  5KT4 A;  4YVZ A;  3F2D A;  1J97 A;  1NK4 A;  3SV3 A;  1L3T A;  2KEY A;  2W3S A;  3RBH A;  4KLT A;  3RJH A;  2KN7 A;  3NAS A;  2KE7 A;  4UBB A;  4DFM A;  3PVX A;  4I2F A;  5IYU A;  3PQU A;  3IP4 B;  5IIO A;  3H4D A;  1T3N A;  1IZN B;  3C5O A;  4DLE A;  5IIL A;  4FBU A;  4JCH A;  1V9P A;  3RAX A;  3AU6 A;  3DWO X;  1BPX A;  2F2A B;  4C8N A;  3NTU A;  2DGZ A;  1HXT A;  1N63 A;  1BPB A;  2EZX A;  3UXP A;  4BDP A;  5DG7 A;  3B9J A;  4F91 B;  1QJP A;  5AKZ A;  2DFL A;  5CA7 A;  3QRA A;  2FMQ A;  2BCQ A;  4F5N A;  3SEN A;  4JV1 A;  5AFU K;  4NV0 A;  1T1L A;  1X42 A;  2KIC A;  3THV A;  4PJ0 O;  2W9C A;  3T24 A;  3BQ7 A;  5G38 A;  4F2S A;  2C2R A;  4UB1 A;  4F4Y A;  4FS1 A;  1RQL A;  4TQR A;  3I28 A;  8PRN A;  3OHA A;  2JXJ A;  4K4I A;  4EEK A;  4MFA A;  3V6J A;  3NSG A;  5KG2 A;  3GV8 B;  2XY5 A;  4B9V A;  1QCK A;  5HNK A;  4YR0 A;  2ZIW A;  4RQ2 A;  2XTQ A;  4KLH A;  4ACO A;  1MQ2 A;  3BRZ A;  3V7J A;  3PRN A;  1TE2 A;  1X9S A;  2DPJ A;  5T14 A;  1HEK A;  2N2L A;  4AYE C;  4AZL A;  4O3Y A;  4RQ0 A;  1QJ9 A;  1QQ5 A;  4CF5 A;  1MA7 A;  3QE9 Y;  3DA3 A;  3C2M A;  1P4T A;  1MM5 A;  5J2J A;  1BPZ A;  5EWF A;  2JH7 A;  3M1Y A;  3Q8S B;  3PW2 A;  4I2C A;  5KFG A;  1HXX A;  3MDA A;  3N97 B;  3EWA A;  2YQE A;  2RP5 A;  3LK4 1;  5AK4 A;  4TUS A;  3LK4 2;  2FMP A;  5ALP A;  7ICQ A;  2PMZ F;  3AQE A;  5HHI A;  5KFW A;  1LB2 B;  2VA2 A;  4LSI A;  4USA A;  4D5U A;  1U4B A;  1BGX T;  5ALO A;  4Q44 A;  3GIM A;  2K4P A;  4J9K A;  5C0Y A;  2ZIU B;  3BQ2 A;  2K4H A;  1WWV A;  3I76 A;  4IR1 A;  4P0P B;  5KFR A;  3UU2 A;  3A0B U;  3AA0 A;  3D6J A;  5AIB A;  2EZZ A;  2EAN A;  2KHV A;  5KFT A;  4B9L A;  1Y88 A;  3KZI U;  2R8H A;  3C29 A;  3WU2 U;  2Y0S C;  4M2Y A;  1JUD A;  3HW8 A;  1S10 A;  8ICC A;  4DOB A;  4UB8 U;  3GDX A;  2KIV A;  4AKR A;  2J6U A;  4I2A A;  2EQY A;  2QAR B;  4Y2S A;  3BZK A;  3MC1 A;  3H8M A;  4NLB A;  2F1V A;  2KZ7 A;  3T5K A;  4Y2X A;  4AP9 A;  3Q8R B;  1XSP A;  5H2F O;  3F2B A;  3SY7 A;  3PR4 A;  2W9C B;  2YTU A;  4F4Z A;  4O4X A;  4KRA A;  3EYZ A;  4R66 A;  2LHF A;  4F2R A;  2P66 A;  4RU9 A;  4DF8 A;  2KZZ A;  3HWB A;  3SZ2 A;  2OMF A;  4Q45 A;  3QZ7 A;  2RLT A;  3EUB 2;  1BPY A;  1SL0 A;  5JDP A;  4UAW A;  3QXG A;  1MC8 A;  1ZQT A;  3IDW A;  2KV2 A;  4FE3 A;  2BCR A;  4DEZ A;  1RQN A;  1Z4O A;  1RYU A;  5ALD A;  3VE1 A;  1XU4 A;  2ZIW B;  2KVS A;  5DL5 A;  4GCS A;  4EYI B;  1ZQO A;  4M0A A;  4ECW A;  3V7L A;  2NO5 A;  5KG7 A;  1L7N A;  4KLE A;  3KHL A;  4M47 A;  5J2D A;  5B5E U;  2C2E A;  4P4O A;  4IQV A;  2K60 A;  2XIC A;  5AI5 A;  4UB6 U;  1BNP A;  4RNN A;  2IWV A;  5ALJ A;  4XUS A;  2KJ5 A;  4NXZ A;  4NL9 C;  3QU9 A;  4YFK A;  4B9N A;  4QZA A;  1KFT A;  3M6Z A;  4AUI A;  2DF4 B;  1L7P A;  3PMN A;  5AK3 A;  2CRX A;  2WF7 A;  8ICZ A;  5J0S A;  1L3V A;  3ETL A;  1FFU A;  1X40 A;  4KN4 A;  1ZXI A;  3AA0 B;  4KMO B;  5CJ7 A;  4FZN A;  5J2B A;  4UAV A;  4GC7 A;  4O49 A;  3F53 A;  2G08 A;  2OXO A;  3RBD A;  3QEA Z;  4QZH A;  2ISO A;  3SI8 A;  1SXD A;  4GCQ A;  5E79 U;  2XY7 A;  3SMV A;  3S6J A;  1CEZ A;  5KG6 A;  2OM6 A;  2JEF A;  4EEN A;  2VAN A;  4EEY A;  4AKR B;  5TZV A;  4NLK A;  4LSF A;  2FJ6 A;  3WKA A;  3RJE A;  5KFC A;  2KZ7 B;  2R4O A;  4J03 A;  2GH1 A;  1ZRN A;  1S76 D;  3ICX A;  4RQ4 A;  4ECT A;  4C7Y A;  4NLN A;  2J6T A;  2H3V A;  1NOM A;  4FFD A;  3ISB A;  2R18 A;  3UAQ A;  3DV9 A;  4OO1 J;  4NLC A;  2HW3 A;  4PR7 A;  1N2X A;  3ONN A;  1GFQ A;  1FIQ A;  5ALZ A;  3VZU X;  1ZQV A;  1ZRM A;  2BDU A;  2W04 A;  1QSY A;  2L5Y A;  4FMS A;  3D2N A;  1NZB A;  4KLF A;  2K4T A;  4FUV A;  5EE2 A;  2ODG A;  2OYY A;  4RQ3 A;  1Q9G A;  2AQ4 A;  2HOQ A;  5CP2 A;  3LK2 A;  4RLC A;  2XVT A;  2WAQ F;  3TAP A;  3RJG A;  1N5X A;  1Q3U A;  4AYB C;  1KKX A;  4RJW A;  4GXI A;  4I2D A;  4CRX A;  2B21 A;  1RXW A;  4YQW A;  4FSP A;  4OJP A;  2G5H B;  2XG6 A;  1L8L A;  2A1A A;  3RJF A;  4OCZ A;  4IQU A;  1SL1 A;  5ALN A;  2VJ4 A;  2BKE A;  4B61 A;  1Q3V A;  3ED5 A;  2R4L A;  2Y0K A;  1PZN A;  4OJL A;  5ALS A;  4Y2U A;  2YX8 A;  5ALG A;  4DSF A;  2FE9 A;  1GFO A;  3N7S C;  3HIL A;  4GXJ A;  4RL9 A;  1J2M A;  2HCF A;  3WK5 A;  4EBD A;  1SB3 C;  3PX0 A;  1D8L A;  4KTQ A;  2R8G A;  2POR A;  5KFO A;  2M9N A;  2JMG A;  4QZ8 A;  2KK0 A;  3F5A A;  3F5E A;  2RDJ A;  4O3M A;  3VC8 A;  3V6H A;  5J8Y A;  1L3U A;  4QZB A;  5J0Y A;  1ZQ1 C;  5D46 A;  5HMM A;  5CHG A;  2JV3 A;  5L1L A;  3WK9 A;  4ECV A;  4P0Q A;  2BZF A;  4UQG A;  2Y9T A;  3VCB A;  3RH4 A;  5ALQ A;  4F4X A;  1UPH A;  2XID A;  5ALV A;  1SIJ A;  3IM1 A;  3TAC B;  4M04 A;  4TUP A;  2HBM A;  5AM1 A;  2XGQ A;  1NK7 A;  3TQ1 A;  4RPZ A;  1KLN A;  5DG9 A;  5DL6 A;  1ZQA A;  5L1K A;  4O3N A;  9ICM A;  4DSL A;  2WF8 A;  2KG5 A;  4U7C A;  4KR4 A;  2LYA A;  3FDS A;  2BHN A;  3Q8M A;  1BH3 A;  3MGI A;  4O5K A;  5DQG A;  4TUR A;  4J9O A;  7ICK A;  3N7P D;  3GV7 B;  4PHP A;  2WF5 A;  4K3B A;  4P4P A;  4LZG A;  3M9O B;  2AGO A;  4AYI D;  2R4P A;  4I2B A;  5KAI O;  3MBY A;  4XNK A;  9ICC A;  3AA1 A;  1T16 A;  1F5S A;  1TV9 A;  4Z3T A;  1ZQQ A;  1N48 A;  5KFX A;  3LK2 B;  3G6Y A;  3QYP A;  1GFP A;  3NRZ A;  9ICS A;  9ICI A;  2XGP A;  4OJO A;  7PRN A;  1SV4 A;  2Y0H A;  4JFB A;  4JWM A;  2GO7 A;  3VY9 X;  4KX5 A;  4PJ0 U;  4DSE A;  4G76 A;  2ZUB A;  1ZD4 A;  5EWG A;  5TIS U;  1ZHX A;  2ZXH A;  5L1I A;  4FS2 A;  2DKZ A;  2ASL A;  4RUC A;  4O9M A;  1YS5 A;  2XTR A;  4QW9 A;  1NK8 A;  2C28 A;  5J0P A;  3PGR A;  5J0T A;  3AU2 A;  4PHA A;  2HHS A;  4XQ8 A;  1QSL A;  1H38 A;  4I29 A;  3AQF A;  3T3F A;  4N74 A;  1T3Q A;  3LDA A;  4J9S A;  4EX6 A;  1JRP A;  4YXM A;  1SZP A;  1E54 A;  3AA6 B;  4J9N A;  3BS5 B;  2ES6 A;  3RF9 A;  1T94 A;  1NK9 A;  4RQM A;  3ALR A;  1KQQ A;  1N61 A;  3KOO A;  1KN5 A;  4TUQ A;  1UT5 A;  1SKR A;  3RR8 A;  1TVA A;  3PW7 A;  5DLF A;  5AK6 A;  3RJJ A;  2XE3 A;  3E58 A;  4RZR A;  4DFK A;  1ZHZ A;  1WUD A;  4PGX A;  4JMU A;  3DA4 A;  2KKP A;  3PQS A;  2JMM A;  3SZD A;  2W9A A;  1TAQ A;  8ICM A;  4N75 A;  3TZG A;  4RQ8 A;  4UB2 A;  2E8O A;  3NS1 A;  4R8U A;  2NO4 A;  1TAU A;  4DCC A;  5ALK A;  9ICB A;  2XY6 A;  2OWO A;  1MQ3 A;  5ALY A;  3E2E A;  7ICG A;  4OJ5 A;  2H5X A;  3L5K A;  3K1Z A;  5KG3 A;  3JPS A;  1WCN A;  3SYZ A;  1JMS A;  5KT5 A;  2ATL A;  4PHE A;  2LKY A;  3T20 A;  4YMM A;  5AHX A;  2BR0 A;  2KNJ A;  4ECQ A;  4NL9 A;  4ED6 A;  4QNL A;  1K5O A;  2IOF A;  1ZQG A;  3LWL A;  2BDP A;  3AA1 B;  1YZ6 A;  5DGB A;  3POQ A;  2RQ5 A;  1JXE A;  3GIJ A;  2B6G A;  9ICH A;  5GTH O;  5KFZ A;  2PI5 A;  4WJ3 B;  1OUQ A;  1S97 A;  3QZ8 A;  1PK3 A;  5H2F U;  5DQI A;  1MPF A;  5PRN A;  4YMN A;  2AJQ A;  5L1J A;  2BCS A;  2W80 C;  2QB0 A;  1P7D A;  5KFA A;  4BUG A;  1TAM A;  1RM6 C;  4BUM X;  2W3R A;  3ZI4 A;  4HYK A;  5TIS O;  4M9L A;  1HJP A;  5EE9 A;  3MR5 A;  2ALZ A;  7ICU A;  2JQY A;  4QW8 A;  4EZ9 A;  4DF4 A;  4UAT A;  1KW4 A;  2AU0 A;  2H3I A;  3C5G A;  2JEJ A;  5BOL A;  1COO A;  2E8P A;  2HMX A;  5J8Y C;  3JPN A;  4UAZ A;  2W54 A;  3JPP A;  5G5H A;  4JUZ A;  5KT3 A;  1S0V A;  2VA3 A;  2Y0S F;  2WJR A;  4I2I A;  2XO7 A;  5HP4 A;  1RDF A;  5KT7 A;  3C2K A;  1KFD A;  1ZQK A;  3TFS A;  7ICS A;  4IR9 A;  5ADX K;  3OPX A;  3QX7 A;  2W9M A;  3PST A;  2K0L A;  4YP3 A;  2W9B A;  2PRN A;  4IS7 A;  3MGH A;  5G26 A;  2V4R A;  1L7M A;  3M6K A;  4EEL A;  4YD1 A;  4LJX A;  4K4G A;  1MM4 A;  1NK5 A;  3HRD D;  2VA8 A;  3CP8 A;  2YMP A;  1NKC A;  4KLO A;  1TKD A;  7ICP A;  1Z3E B;  3SYB A;  2Q4T A;  3AUO A;  4IL6 O;  4AYB F;  2GLE A;  8ICU A;  3WKE A;  4R8U B;  4BXO A;  5ALT A;  4D64 A;  2MA1 A;  4QZF A;  1QSS A;  2FMS A;  4DQI A;  1PVQ A;  1NNL A;  1BPD A;  2DUY A;  2IWW A;  2WHE A;  9ICT A;  5J0O A;  3ISD A;  4FT6 A;  4KR8 A;  2PFN A;  1O03 A;  1Z00 A;  8ICB A;  4RNM A;  4Y2J A;  2YNK A;  1XNS A;  4MEX A;  1TK8 A;  3D2Q A;  1Z1V A;  4Y2R A;  3L4P A;  1D9D A;  3RAQ A;  2R8A A;  3KFU F;  3PGS A;  5KNI A;  1BPE A;  1HIW A;  2PKE A;  2EAO A;  3UQ0 A;  5BOM A;  3DZM A;  4ED3 A;  5J2E A;  5J0U A;  2A1J A;  4O3R A;  1ZOL A;  4C7Z A;  5AKJ A;  1KL9 A;  4R65 A;  2E1F A;  4NWI A;  5KFL A;  3H0M B;  3SZV A;  1DOQ A;  4O5E A;  5DB8 A;  4ECX A;  3MDC A;  4EZ6 A;  3PSI A;  1RYR A;  4P2H A;  3J81 j;  4ELV A;  1NZP A;  2BGW A;  2QB0 B;  1JXL A;  3NUQ A;  5DLG A;  9ICP A;  4F50 A;  3WK7 A;  3U26 A;  2P6R A;  3N7R C;  1EXN A;  2IOF K;  8ICL A;  2XCP A;  1BXW A;  1JAL A;  2LI6 A;  4RPX A;  2KD1 A;  2G09 A;  2MRL A;  2J4U P;  2NRT A;  3QUC A;  7ICL A;  5KFJ A;  2F1I A;  1X9M A;  9ICG A;  1SZH A;  2D8C A;  1QTM A;  1QH9 A;  1K1S A;  5JUM A;  5DDM A;  1QQ7 A;  4KLS A;  2HHW A;  2AH5 A;  4PH5 A;  7ICJ A;  5AKI A;  1ARO P;  4Z6F A;  2KHQ A;  1XO0 A;  5AI9 A;  5CEH A;  3OJU A;  4ECR A;  1ZD5 A;  4Z6E A;  2MUT A;  1F44 A;  3MGV A;  1JRO A;  4PL2 A;  3T0S A;  8ICG A;  5AKL A;  3PV8 A;  2RRD A;  5L1M A;  2BPG A;  4C4S A;  2W9B B;  4E0D A;  1DK2 A;  2BPC A;  2R8I A;  4B9U A;  2YY6 A;  5FP0 A;  9ICW A;  2J1N A;  2W03 A;  3BS0 A;  1V85 A;  3JPT A;  3H8S A;  4KIT B;  3ZDD A;  1Q9F A;  3HKZ C;  2HDO A;  5KFS A;  2RDI A;  3AN1 A;  2FLL A;  5KG1 A;  2RHF A;  3PX6 A;  5HR6 A;  5FVN A;  3I1Y A;  5KFM A;  3LK3 A;  7ICF A;  4JWN A;  5G3A A;  3L3F X;  3NVW A;  2R8J A;  4BXO B;  3VE2 A;  7ICR A;  3UPQ A;  1SKW A;  5D5D A;  4NLG A;  4TQS A;  5DG8 A;  3KHH A;  2JRZ A;  4RUA A;  1RZT A;  5B66 O;  4YD2 A;  1OPF A;  4JK1 A;  4UB3 A;  8ICF A;  5KFQ A;  1Z00 B;  1L7O A;  2BQ3 A;  8ICX A;  2DL0 A;  2FI1 A;  5CWR A;  1LV5 A;  3WKD A;  2UVR A;  4F5R A;  1XO1 A;  5J0W A;  5DB7 A;  5AKK A; 
#chains in the Genus database with same CATH homology
 4PL1 A;  2W7O A;  3VCB A;  3H0R B;  1URJ A;  3G7G A;  3POX A;  1UPH A;  2XID A;  5ADX L;  4BJQ A;  2Y7S A;  4GHB A;  2HBM A;  2KC0 A;  2MNH A;  5DL6 A;  2ZIU A;  1GFN A;  4P0P A;  3JTY A;  6PRN A;  3HKZ F;  4U7C A;  4KR4 A;  2LYA A;  3F2D A;  5DL8 A;  2HOI A;  1THQ A;  3UPG A;  1BH3 A;  3EMN X;  2LFU A;  3AAE A;  4FES A;  2KEY A;  2KIW A;  4GF4 A;  3RBH A;  3WI4 A;  3N7P D;  5IYU A;  2YB4 A;  2H3F A;  3PQU A;  3IP4 B;  3POR A;  1IZN B;  3C5O A;  2M06 A;  4LSE A;  4JCH A;  4AYI D;  5A0L A;  2G5I B;  2K8B B;  4XNK A;  3AA1 A;  2F2A B;  1PRN A;  4C0Z A;  2KJ9 A;  1GO3 F;  4Z3T A;  1HXT A;  2DGZ A;  2ZLD A;  3QRC A;  3LK2 B;  4FRT A;  3PSF A;  3AA7 A;  1QJP A;  1GFP A;  4O3X B;  2ZIV A;  3QRA A;  4G75 A;  4OJO A;  7PRN A;  2Y0H A;  4JFB A;  2XE1 A;  5CRX A;  3VY9 X;  4KX5 A;  4G76 A;  4NV0 A;  5AFU K;  2KIC A;  2PMZ C;  1ZHX A;  3T24 A;  2ZXH A;  2ZG6 A;  3PSP A;  4AFK A;  4U6P A;  3KVD D;  2D6F C;  2G07 A;  5KL1 B;  1YS5 A;  2XTR A;  3F2C A;  4O3Z A;  3E0F A;  2F1T A;  1IIP A;  8PRN A;  4BX9 C;  2F76 X;  3NSG A;  2ERV A;  3AQF A;  3CRX A;  3LYS A;  4E1S A;  3LK3 B;  1E54 A;  3AA6 B;  3LVV A;  2ZIW A;  2XTQ A;  3RF9 A;  2W7P A;  4ACO A;  1T94 A;  3PRN A;  4AYN A;  2E5S A;  3ALR A;  4AKM A;  5T14 A;  3GU3 A;  4CGZ A;  1HEK A;  3HOL A;  2N2L A;  2O4V A;  4AYE C;  4AZL A;  4OJ6 A;  4O3Y A;  1QJ9 A;  2K8A A;  1MA7 A;  3DA3 A;  1P4T A;  2XE3 A;  1MM5 A;  1ZHZ A;  2VKQ A;  1WUD A;  4JMU A;  3DA4 A;  4O4U A;  2KKP A;  2JH7 A;  3VY8 X;  1HXX A;  2KXP A;  3PQS A;  2JMM A;  3SZD A;  4O3W A;  3IN5 A;  1L6N A;  2RP5 A;  3LK4 1;  3LK4 2;  2KVC A;  3TZG A;  2PMZ F;  3AQE A;  3RFA A;  4IC9 A;  4LSI A;  4E1T A;  2LHT A;  4D5U A;  4QJF B;  4QQ1 A;  4D65 A;  5C0Y A;  2ZIU B;  4OJ5 A;  2K4H A;  3K1Z A;  3HOE A;  2KOB A;  4P0P B;  3UU2 A;  3AA0 A;  2K8C B;  1H6S 1;  2LKY A;  3T20 A;  3DEE A;  3AAE B;  3C28 A;  2KHV A;  2KNJ A;  1A0P A;  2WB1 F;  3C29 A;  2Y0S C;  2ODJ A;  2HBL A;  1PHO A;  4QNL A;  5DL7 A;  4GFJ A;  4RLB A;  3LVW A;  4AKR A;  3AA1 B;  3SQI A;  2VIX A;  3POQ A;  2FGQ X;  2K4I A;  4NLB A;  2F1V A;  2KZ7 A;  3SYS A;  1PVP A;  4WJ3 B;  1OUQ A;  3SAG A;  3AA7 B;  2ZIV B;  2H3Q A;  1MPF A;  5PRN A;  3CYM A;  3F2B A;  3SY7 A;  2W80 C;  1P7D A;  2NV3 A;  4O4X A;  4BUG A;  1TAM A;  4BUM X;  1OSM A;  4KRA A;  2LHF A;  1DRG A;  3AAA A;  3HWB A;  3AL0 B;  2H3I A;  2OMF A;  2X27 X;  1D8B A;  2HMX A;  5JDP A;  2KV2 A;  4FE3 A;  3M7D A;  2K4E A;  5T5F A;  4C69 X;  2Y0S F;  3VE1 A;  2WB1 C;  2ZIW B;  5DL5 A;  4GCS A;  5GV0 A;  3NRW A;  2HOF A;  2GOL A;  5ADX K;  1ZHT A;  3OPX A;  2M07 A;  4N58 A;  3PST A;  2K0L A;  2PRN A;  2K89 A;  3HW9 A;  4A8E A;  5G26 A;  2XMX A;  3M6K A;  2CPR A;  1MM4 A;  2YPV A;  3A2S X;  3CP8 A;  2XIC A;  3H0L B;  4FZL A;  2KXP B;  4LSH A;  2KDY A;  3SYB A;  4P0Q B;  2Q4T A;  3O0F A;  3AA6 A;  2KJ5 A;  2OH2 A;  5AFU L;  4QIW F;  2JH1 A;  2JHD A;  2VJ5 A;  4GCP A;  2JGA A;  2ZIX A;  4D64 A;  2MA1 A;  1Z19 A;  1ORM A;  3GP6 A;  3M6Z A;  4AUI A;  2E1E A;  2DF4 B;  2N2M A;  2Z7J A;  2CRX A;  1PVQ A;  1ED1 A;  3VZT X;  3AA0 B;  4FT6 A;  4KR8 A;  4KMO B;  2Y2X A;  3IG5 A;  2YNK A;  4FZN A;  1XNS A;  2WAQ C;  4O49 A;  3F53 A;  3T79 A;  2G08 A;  2OXO A;  3SAH A;  1ZHW A;  3D2Q A;  4GCQ A;  1PVR A;  3SMV A;  3KFU F;  2M0N A;  4F4B A;  2OM6 A;  5KL8 B;  1HIW A;  1KBU A;  4AKR B;  1Z1B A;  2ZFG A;  4LSF A;  4CDG A;  1GFM A;  2KZ7 B;  2E1F A;  2KJ8 A;  2GH1 A;  4NWI A;  3H0M B;  3SZV A;  3V8U A;  3ICX A;  2F8L A;  2XE5 A;  2N1R A;  2H3V A;  3PSI A;  2DQN B;  2G0A A;  4U9C A;  3O0E A;  2R18 A;  3UAQ A;  2LYB A;  1IZN A;  3NUQ A;  3D2S A;  4OO1 J;  4QIW C;  4NLC A;  3ONN A;  1GFQ A;  2FGR A;  1BT9 A;  3N7R C;  3K19 A;  2Y0L A;  4PUX A;  1CRX A;  1ZHY A;  4RJX A;  3VZU X;  1BXW A;  1ECW A;  2BDU A;  2W04 A;  2KD1 A;  3AAA B;  2G09 A;  2MRL A;  2J4U P;  4FMS A;  2LBO A;  3D2N A;  1NZB A;  2K4T A;  4FUV A;  5EE2 A;  2OYY A;  1Q9G A;  2HOQ A;  1SZH A;  2G06 A;  3LK2 A;  4RLC A;  3SAF A;  2XVT A;  2WAQ F;  3GZF A;  3FYX A;  1Q3U A;  4AYB C;  3PZP A;  2A3V A;  4RJW A;  1G90 A;  3SY9 A;  2GE4 A;  2H3Z A;  2KHQ A;  4CRX A;  1XO0 A;  4FSP A;  1F44 A;  2KKV A;  3MGV A;  4OJP A;  2G5H B;  4PL2 A;  1YT3 A;  3T0S A;  2XG6 A;  3KZX A;  2RRD A;  2CN1 A;  4KX3 A;  2XE2 A;  2ZXI A;  4FRX A;  2J1N A;  2W03 A;  1Q9F A;  2VJ4 A;  2F77 X;  3HKZ C;  4B61 A;  1Q3V A;  4N59 A;  2Y0K A;  4OJL A;  2YB1 A;  2YX8 A;  2RHF A;  5HR6 A;  3WI5 A;  5FVN A;  1GFO A;  3N7S C;  1HXU A;  2XI9 A;  3LK3 A;  5HR7 A;  3POU A;  4RL9 A;  1QJ8 A;  3L3F X;  2HBK A;  2POR A;  2MHL A;  4FSO A;  3IG8 A;  2JMG A;  4ICA A;  3VE2 A;  2ZIX B;  4FZM A;  5D5D A;  4AYD C;  3F5A A;  3F5E A;  2W81 C;  4O3M A;  3VC8 A;  1OPF A;  2QTK A;  1ZQ1 C;  1A6S A;  3VZW X;  4AYM C;  2HBJ A;  4P0Q A;  4XNL A;  4FOZ A;  4AYB F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...