4FZLA

High resolution structure of truncated bacteriocin syringacin m from pseudomonas syringae pv. tomato dc3000
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
239
structure length
239
Chain Sequence
GMQNPVATVLLLQGDLYCSPNCLATFQDQARRDSFGIQSKVALKTFAAADQREAEGRDLRTAYNEIATDIGRSQQINENIIKYPPGNHVLSGGLMTPFHALAHGMFGLGAPLTFPIQNVGLNVDIRGIPDVMNVIQSARPVGTSSLDVNFAYDVGKDSNASWLTLGNITLRLVGTIDKNASGAWTFSGEIRAFNDVYDANPSNHRGWLGENLTSLLSAVPFTSYSIEIPGSLPVTVSGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Lipid II-degrading Bacteriocin Syringacin M Suggests Unexpected Evolutionary Relationships between Colicin M-like Bacteriocins.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Antimicrobial protein
molecule keywords Bacteriocin
total genus 73
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.790 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4fzlA01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4fzlA02
2XMXA 3DA3A 3DA4A 4FZLA 4N59A 2XTQA 2XTRA 4FZNA 4FZMA 4G75A 4G76A 4N58A
chains in the Genus database with same CATH superfamily
1RQNA 4MFFA 5IILA 2LHTA 4YQWA 4Y2VA 5HHIA 2OCEA 2DFLA 5KG4A 1CUKA 4Q43A 5KFIA 2ODGA 1ZD5A 5ALEA 2JZBA 2R8AA 4I2DA 5L1KA 4NLZA 2AGQA 2VA2A 3BQ7A 1KN5A 2OMFA 4C4SA 2FGQX 3SZVA 4RQ6A 3VC8A 4EBDA 2XE3A 4R8UB 3PV8A 1X9SA 2VA8A 4C4VB 9ICUA 2HHQA 3KBBA 3TANA 1NK0A 2JQYA 4O5CA 4FQEA 3PX4A 1AQ6A 2I6XA 1BPYA 4Y2SA 3RH5A 3TFRA 3D6JA 2BPCA 2ZIWA 1S0MA 8ICBA 2HHTA 2JH7A 5DL7A 2KJ9A 3GQCA 2JEFA 3RFAA 5KG2A 3WU2U 4J9OA 4ZOHC 5DDMA 2PMZF 2KICA 1J2MA 1T7PA 1NK5A 1BH3A 4IL6O 3JTYA 2ZIXA 2FJ6A 2VIXA 5J0UA 5BOLA 4QW8A 9ICVA 2DPIA 4LSIA 5KG5A 2R89A 4PZOA 4R66A 2XG6A 2WVPA 2MSNA 1JALA 4C4RA 4DSKA 2G08A 3A0BO 2YQEA 5L9XA 3NGDA 4TUSA 5J2FA 5KT3A 3PW5A 4FRTA 3MFHA 1S10A 5DB7A 2BDUA 4PJ0O 3NTUA 4KLMA 1ZD3A 1ZHXA 3PGUA 2FPKA 1KLNA 2LBOA 4J9MA 4P0QB 5KL8B 1SL0A 2FLPA 5GTIU 2W8KA 5HMLA 1QJ9A 5KFTA 3AA7A 3VY9X 2GOLA 1A0PA 5AI8A 1LVHA 2BCQA 3HX0A 5ALUA 4YR0A 4KLOA 4C8LA 1N63A 8ICPA 1TK0A 4YXJA 3GV7B 5J2DA 1N62A 3M8SA 4I2HA 5DGAA 2J6SA 2ASJA 3PW4A 3ISDA 2KV2A 4RNNA 4KN4A 3G6XA 4ECZA 4C8KA 3FC4A 9ICOA 2JRZA 3JPQA 1X6JA 3V6HA 2KFZA 1DOQA 2C2RA 2JHDA 2KKPA 3I28A 4TUPA 2FI1A 3PSTA 3SAFA 1SL2A 7ICKA 4A8EA 4DS5A 2KZ7A 2VANA 3VCBA 1S0VA 4IR9A 4PUXA 1ZQAA 4O3WA 3R9KA 3AAAA 4I2EA 4J9LA 4QZGA 3RH6A 3M1YA 5ALOA 4PZNA 3G6VA 4RZRA 2F1TA 3PO5A 4F71A 2GH1A 4RLBA 4J9RA 2LM4A 2ISOA 2R4LA 2Q4TA 2J1NA 3PX6A 3H7IA 1RDFA 1L6NA 5ALKA 2ZTCA 1Z1BA 2Y9TA 1AROP 5HHHA 4M0AA 2E1FA 2YMMA 3RJGA 4GXJA 2KJ8A 2DPJA 4U6PA 1DK2A 4TQRA 1GFMA 1MN8A 2F1JA 2ZIUB 3UPGA 5AM4A 1PZNA 2EAMA 3ZD9A 4C00A 1NK9A 1PVRA 5J0YA 2Y0SF 1K1QA 4M9JA 4XQ8A 4US9A 5KG3A 1Z3EB 4U9CA 2R4OA 2MA1A 2PFPA 4PPXA 4MEXA 2V9WA 5ALRA 8ICLA 3HKZC 3GIJA 1XC9A 3FM9A 4O3XB 5J0SA 3PY8A 2XICA 3TAQA 3SYBA 3PGSA 1B43A 3SZDA 2W7PA 1KFSA 1D8LA 5KFVA 2HOFA 9ICNA 2PORA 3GDXA 7PRNA 4AKMA 4NV0A 1SKWA 1BPZA 4FFDA 4FZMA 3TAPA 4OJ6A 3PSPA 3CP8A 3UXPA 3GIKA 2BGWA 2EZZA 1JXEA 3PQSA 4KMUA 3EWAA 2KK0A 5J0XA 1UCVA 9ICXA 3LK2B 2Y0LA 3QXGA 4XNKA 2WB1C 2Y2XA 3ISBA 3QUQA 4UB1A 4NL9C 9ICTA 3FYXA 5FVNA 2MU2A 2OEHA 3AQFA 3F5EA 5J2GA 1OPFA 2JR5A 1SKSA 2IWVA 2DL0A 1FFUA 1O03A 3SV3A 4RLCA 9ICSA 3PQUA 4YMNA 7ICLA 4DQRA 5ALMA 1P4TA 3HILA 4PJ0U 5KFHA 1S97A 2H3ZA 4F92B 2W80C 4O4XA 2ZLDA 1Q3VA 4ECVA 3POQA 3UQ2A 8ICNA 3GFKB 1VLBA 1ZD4A 3OGUA 2F1VA 1N60A 4F93B 1RPLA 4CE6A 3QRAA 2AHOB 3T5LA 4YR2A 5G5HA 3SENA 4UBBA 2KIWA 5GTHU 2HVIA 2BQ3A 3AU2A 4R8UA 2ZIVA 3LK3A 2N2MA 4Y2PA 2PXIA 1XO1A 2EZYA 4JWMA 4RPYA 1IXRA 4EX6A 1QJ8A 1XSPA 4NLCA 1X2IA 5KFMA 3M8RA 5J0QA 3VY8X 1OXJA 4G76A 5AICA 3M9OB 4RJWA 5EWFA 5IIIA 1KRPA 1U48A 4UASA 3KZIO 5ALIA 4DCCA 3RJFA 2W9MA 3C5FA 3ORYA 2HHSA 5CB1A 1HUZA 2XY6A 2EDUA 3PSIA 4GIBA 4KLJA 2YX8A 5DB6A 1T8EA 3LK42 5AK6A 2C2DA 2FMSA 4HAIA 4RPXA 4CF4A 1NOMA 1ZETA 3GV8B 2E8NA 4AYBC 1ZQCA 2IBKA 1V85A 1ZQXA 2C28A 4XRHA 3EPIA 4GC6A 2XGQA 2HHXA 5B66O 4AYID 3PO4A 3RJIA 2J4UP 1HIWA 1XNSA 2ZFGA 4UAZA 2YN4A 3AA6B 5B5EU 1SIJA 4P0QA 5DQHA 1DK3A 3M6ZA 2F1CX 1QSSA 3PMNA 4JMUA 4BWJA 4YMMA 5KAIU 1BPEA 3A2SX 1ZQNA 4U7CA 4K3CA 4NWIA 2LYBA 2I9GA 5KFXA 2W9BA 8ICMA 3MR5A 8ICFA 8ICQA 1SKRA 2K0LA 2BKEA 3JPNA 3RRGA 7ICIA 3T79A 5DL8A 5ALSA 9ICCA 5E79O 1ZQZA 2WB1F 1X9XA 4AKRA 2Y1JA 4GC7A 5DDYA 3DDHA 4IQVA 1ZXIA 4R63A 3UMCA 3NVWA 3C5GA 2ZUCA 4AYBF 1ZQIA 4Q8EA 2F77X 1L7NA 2KSOB 1FIQA 2ZIXB 5TISU 3OPXA 4NLNA 5DG9A 1DGJA 3C5OA 1NJYA 2AGPA 3QEAZ 1BNPA 2ZXIA 4G9BA 4OJOA 1ZQOA 2RP5A 5HP4A 2VA3A 1NNLA 3CNHA 2MAXA 5ALDA 3JPSA 1YS5A 8ICKA 2ODJA 5DBAA 4M2YA 3HKZF 2R8HA 5KFBA 2GLEA 4PGQA 1ZQPA 2WF5A 3Q8KA 4CTDA 3TI0A 2F76X 3BRZA 3MDCA 2FDRA 3QRCA 2VKQA 1PVPA 3WK6A 1JI7A 1S0OA 5DLFA 3SAGA 8ICYA 1UT5A 2WF9A 2BQRA 5J29A 5KFEA 4M6WA 1NKCA 4DQIA 2NO5A 5F9LA 3PX0A 5BPCA 2A1JA 1T1LA 4EELA 8ICAA 3OTQA 2NRWA 1RYRA 3G6YA 3GIMA 3EUB2 4F4YA 1KQQA 3C21A 3Q8RB 5AM0A 4JV0A 1WYGA 1KSPA 2MUTB 1SV4A 2K4PA 2Z7JA 8ICWA 3RJJA 1JMSA 1ZHYA 1ZQQA 3WKBA 1UHUA 3H0LB 1D9DA 3Q8PB 5CRXA 3HWBA 1U47A 5B5EO 4UB5A 4QNLA 5DQIA 4KN7A 3SAHA 2Q0ZX 1QTMA 3ICXA 5CP2A 1GO3F 4J9QA 3Q8LA 4DFDA 5B66U 3SR6A 5AKLA 4I2FA 5EOZA 2N1RA 3TZGA 5ALWA 3S6JA 3KHLA 2ZTEA 3QZ8A 1UA0A 3QU9A 1IG6A 4C69X 4RQ1A 1ZQYA 3I76A 3BS0A 3PR5B 2QARA 3GP6A 5J2JA 3RTVA 4DQQA 4F8RA 1Q9GA 4IQTA 4LZDA 5AI9A 1IZNA 4ECXA 1NK7A 3O0FA 4PHDA 8ICTA 4FZLA 5KL1B 2WFAA 3BZCA 1A76A 3KZIU 1SL1A 1ZQRA 5BOMA 4DFMA 2G5HB 1MM4A 2DGZA 5ALZA 5DLGA 1TV9A 4O3RA 1SZHA 4KR4A 3U26A 2XE5A 4R64A 3AAEB 5EE1A 1J97A 1C20A 8ICSA 1X9WA 3AA0A 1N5WA 3MR3A 4JUZA 2AU0A 4IQUA 4K4GA 3LK2A 3F2CA 4EYIB 5AKKA 5KAFU 2ASLA 2KNJA 4F5QA 3UXOA 1KDHA 4I2BA 3FDSA 2PI4A 4J9PA 4QZ8A 5FP0A 2M0NA 4JB3A 2ZG6A 3BQ2A 1BPBA 4NM2A 1OUQA 4AYDC 1D8BA 1GFPA 2YMPA 2YB1A 3EMNX 3HJEA 3C2KA 2G07A 4UQGA 2E8MA 1Z19A 1XSNA 5KTQA 4IRKA 4NY8A 4RQNA 3ETRA 3H8MA 3MFIA 1PK1A 1LKYA 1SWWA 4ED3A 5AIBA 1JIHA 5ALFA 3HW8A 2OHFA 2LI6A 3QUBA 4IRDA 4KR8A 3QU4A 2M06A 3PF1A 3C23A 3WK8A 7ICUA 1MSWD 2FE9A 4XNLA 1T3QA 4F5PA 4ED7A 4AUIA 1JROA 4B9LA 1L7PA 5IIMA 3AUOA 2X27X 2E8OA 2K4IA 3WKAA 3H0MB 1CEZA 1S5LU 7ICGA 3JPOA 4DF4A 5J2AA 1TAQA 4KLLA 9ICLA 5AM5A 9ICHA 9ICGA 3AA1A 2RQ5A 4UB4A 3QU7A 2BQUA 1T3NA 3SY9A 3IM1A 2LFUA 1Z00A 4N74A 3ETLA 2D8CA 1N61A 1WG8A 3HW9A 1ZQGA 5ADXK 4OJPA 4F2SA 4LSFA 5KFSA 4J9NA 1EXNA 3KD3A 4KX5A 1KEJA 2GE4A 1N2XA 2OXOA 5F9NA 4TUQA 3T5KA 4DFJA 3QYPA 3H8SA 5G3AA 4Y2YA 3MR2A 4KLHA 3T20A 2PFQA 4MF8A 4J03A 2B21A 3UU2A 5KFUA 4EBCA 4RQ0A 5CEHA 2J6TA 4F5RA 2KXPA 3B9JA 2DQNB 2ZTDA 4KLQA 1T4GA 3RB3A 2R8JA 4O3ZA 4FE3A 3KHRA 1GFQA 9ICFA 4Q44A 4B9MA 1P7DA 4BDPA 4Y2TA 1SV0A 2KTQA 1ZQMA 4FMSA 1N5XA 4FSOA 2KZ3A 4MFAA 2IOFA 3NSGA 4QZEA 1NKBA 4QZIA 4IQWA 4C7YA 1B22A 3F5AA 2KVCA 2H3IA 3RJKA 1G90A 4M04A 2E5SA 5EE2A 1S9FA 3ONNA 1TKDA 3QX7A 2QB0A 3LWLA 4AKRB 3OHAA 4P0PA 4M9LA 1X40A 4RUCA 1CRXA 5AK4A 2NRTA 4I28A 2HBMA 4YD1A 4DS4A 1M6YA 5KFZA 1GFOA 5TISO 4LVSA 2VJ4A 5KFAA 3DWOX 2W9CB 2EANA 5D49A 2PMZC 2A3VA 4AYEC 2YMQA 2YPVA 2KZMA 5KNIA 3HRDD 5CWRA 4ICAA 3F2BA 2DBYA 5CJ7A 1S0NA 2W04A 4UBCA 5J8YC 1ZYQA 2JXJA 4UAYA 1ZHTA 5L1MA 3KHGA 3PW2A 3PZPA 3H8JA 1QSLA 4G3IA 1YZ7A 2M07A 1NJZA 3KVDD 4GCSA 3TACB 1O08A 3GV5B 4O3QA 3B0YA 3TADC 4MHVA 4NL9A 4N58A 3E2EA 4YFKA 5KT2A 3J81j 1SZPA 8ICOA 3HWTA 2H3FA 4YMOA 2JMGA 4DL2A 4FSPA 5J2EA 1B0XA 1T94A 1KW4A 2KEYA 1X66A 4I2GA 2UVRA 3C1ZA 1BVSA 3V6JA 3T5HA 1K1SA 2ASDA 2QB0B 4JV1A 3ZDBA 3NRWA 2ZJ5A 4C80A 1TK5A 1GFNA 1E54A 4D5UA 2IHNA 1FEZA 3EZ5A 4ECRA 4FT6A 4DSFA 2H5XA 2CN1A 3RJEA 2ZIVB 4GXIA 1F0MA 2HOQA 4QWEA 1UA1A 5DL5A 2C22A 2MNHA 1TFRA 2B0CA 5AM2A 2WAQF 1NK6A 2ZXHA 2A19A 1ZQEA 2KHQA 4RQ7A 4EENA 1S8OA 4B9VA 2R4NA 2BR0A 7ICNA 3RRHA 2W9AA 5F3XB 3RR8A 1BT9A 2V4RA 3B0XA 5AI0A 5KFNA 5ALVA 4DFKA 2XE1A 2K4TA 3VZUX 2XIDA 3BS7A 1SWVA 3WK4A 8ICUA 1YZ6A 2RHFA 1LB2B 3JPTA 3HPOA 1LKYB 2WAQC 1V9PA 4QWCA 1ZQUA 5L1LA 1KFTA 2WF6A 5KFJA 4F50A 4KLUA 4PR7A 3I1YA 4O3OA 2KIVA 2K4EA 2AQ0A 3TFSA 2MUTA 3AEVA 5G26A 5EE3A 5J2CA 2W11A 4I2IA 2NRVA 4DF8A 3NUQA 2XGPA 5DKWA 3DWNA 4ED1A 3WK5A 5DBBA 5ALYA 5EWEA 5J2IA 9ICKA 2AJQA 1RQLA 2LM1A 3BZKA 3V7LA 7ICPA 3RB6A 7ICFA 9ICAA 5L1IA 1IM4A 4QIWC 1TK8A 4Z6CA 1PVQA 1NK4A 3MABA 2A1JB 1HXUA 2WJQA 1UPHA 2XTRA 4Z6EA 1X42A 1L8LA 4DL7A 3K19A 1HJPA 4DOAA 1L7MA 2IOFK 1PHOA 3AM9A 3QNMA 1N56A 2OWOA 4Z6FA 3UPQA 2ZIWB 2ERVA 9ICQA 1S76D 3IN5A 5AM1A 4O3YA 1U49A 5J2KA 2ZIUA 4UB3A 4X5VA 2D6FC 1OSMA 2PKEA 3K1ZA 2LYHA 2XCPA 1Q9FA 1D8YA 1XSLA 3IHQB 5HMMA 1KTQA 2G09A 4E0DA 3AN1A 4Y2RA 1ZQJA 3SD7A 2HBKA 4QZHA 4B6JA 5AKIA 4ED6A 4AYNA 2R4PA 4C8MA 1ZQVA 2P66A 2RDJA 1RXWA 5IIJA 4NLGA 5HR6A 3NVZA 2R18A 2OH2A 3TADA 3N4MB 1L3TA 1WWUA 4ACOA 8ICIA 3SQIA 4QZ9A 4PGXA 1QH9A 3DV9A 3AA6A 4GCPA 4YCXA 1S77D 1DXSA 4Y2UA 4RL9A 4IS7A 2ZJAA 4RU9A 2BCSA 4TURA 2ZUBA 4DL3A 4KITB 3LYSA 2G06A 3D2QA 4USAA 4CCHA 4UB8U 3RJHA 4ECQA 4P4PA 3KKAC 3ZD8A 3POXA 4KX3A 2RLTA 5C5JA 4AYMC 4M9HA 3MGIA 3VZTX 4YXMA 2EAPA 3LDAA 8PRNA 2W43A 4O3PA 1TAMA 4MFCA 4Y2JA 3T0SA 1FO4A 1QJPA 4DEZA 2Y0SC 5J0RA 4KRAA 1QQ7A 4F4KA 7ICSA 4DQPA 5ADXL 5AKGA 5DG7A 4O3MA 4FS1A 2NV3A 1HEKA 1PRNA 7ICEA 4K3BA 1ZQDA 4RPZA 2R8IA 3K4GA 2QKQA 4YN4A 4DQSA 4F5OA 1ZQWA 3SV4A 4K4HA 1SGGA 8ICXA 3T5JA 5H2FU 1X9MA 4DO9A 1ZJMA 3QZ7A 1Q8KA 2P6UA 5JDPA 3UMBA 4KLGA 3CRXA 3C29A 3H4BA 5KAIO 1VDVA 2BPFA 4PL2A 4I2CA 2KZ7B 4J9KA 9ICMA 2DKXA 9ICEA 1ZJNA 2JEJA 4LSEA 5EWGA 5EE0A 1BPDA 2CPRA 3AU6A 4UB6U 4XA5A 3V72A 1URJA 1THQA 2YTUA 1DGSA 3RAXA 4B61A 1KFDA 2I1QA 5ALGA 4FESA 4F91B 1U45A 3HP6A 5DGBA 3M9MB 5GTIO 5IIOA 4AZLA 1N48A 4N75A 3IG5A 4CNQA 2IA6A 4RT2A 4P4MA 2BCRA 3IP4B 4PHEA 1IV8A 3M7DA 2NRZA 2K8CB 3L5KA 4LSHA 4QQ1A 4IC9A 3BS5A 4UAUA 2LKYA 4Z3TA 1U4BA 1D9FA 2JEGA 4TQSA 4OJLA 3DEEA 2DWQA 5ALLA 4NXZA 4YP3A 4B9NA 4F4WA 3WU2O 5KFCA 7ICMA 1L7OA 2JZBB 3KHHA 3QUTA 1XS9D 3RBDA 3Q8MA 4OO1J 1BPXA 3IV6A 5ALTA 5ALPA 1COKA 2XMXA 2E3TA 4KLEA 3IDWA 3V6KA 4RNMA 2KC0A 2JGAA 4BX9C 2FLNA 4BUMX 2R8GA 1BGXT 5GTHO 2Y0HA 2F8LA 5GV0A 3KOOA 5J2HA 3OSPA 4UB8O 4F5NA 2PRNA 4EEYA 1H6S1 1JRPA 1UQVA 5KFKA 4YVZA 2HDOA 2LMRA 4DL4A 1SXDA 4DFPA 8ICZA 2Y7SA 3LK41 2UVVA 1QCKA 4I2JA 5T14A 2KE7A 1V97A 3WI5A 1PUZA 2L5YA 5ALQA 5IINA 4O9MA 2KG5A 3FYHA 3MBYA 2A1AA 4ECSA 2OM6A 3M9NB 4F4XA 5KFQA 3SI8A 4FUVA 2UVUA 2YB4A 1QLNA 3WK9A 1JXLA 3LK3B 4Z6DA 4UW9A 4DL6A 5JRTA 1KKXA 4YG2A 7ICVA 2HSZA 4UATA 3V7JA 2OYYA 1RG6A 2AH5A 1PK3A 2BCVA 9ICIA 2HMXA 2P35A 4FBTA 4FRXA 1L3UA 3K75D 4N59A 4M47A 4RQMA 4OD0A 5D5DA 3SZ2A 3NVVA 3H8WA 2JV3A 3F2DA 3SY7A 2XVTA 9ICWA 3SYSA 4QIWF 2FLLA 2H3VA 4PGYA 1Y88A 4RNOA 4FZNA 2W3RA 1ZQHA 3WKCA 1K5OA 4EYHB 1NJWA 3WI4A 8ICHA 3C2LA 3PW7A 2XE2A 1XWLA 1NJXA 3MR6A 1ZQLA 4AFKA 5D46A 2RDIA 4I29A 2XY5A 3EPGA 2EH9A 2BHNA 3PVXA 2Y1IA 2HBJA 2AXTU 1WWVA 2HI0A 1YT3A 4E1SA 3JCUO 3RBHA 2F1HA 3JPPA 1V38A 4O3SA 4C8NA 4QZFA 3N7SC 1PK1B 1ZQ1C 5KT7A 3SYZA 1FFVA 1WUDA 4P4OA 5AFUK 3E58A 4ED8A 2E1EA 4F4BA 4J9SA 3L4PA 5AIAA 4C0ZA 3TQ1A 2WF7A 2K4HA 2F1IA 3EYZA 1TAUA 3T3FA 2D3DA 2GO7A 5KFFA 4QW9A 1KL9A 3AA7B 2KDYA 2PI5A 2P6RA 2H3QA 2IWWA 3IG8A 1NZPA 2EQYA 1HUOA 3N7RC 3ISCA 3C2MA 7ICQA 3KTQA 2W54A 4F72A 4DLEA 4RQ2A 2JH1A 3PNCA 2QLTA 4O5KA 4NJ8A 5D4BA 3AA0B 4KTQA 3OJSA 1C7YA 2W9CA 3HOEA 3V7KA 5AI5A 3KFUF 5C0YA 1Z4NA 2YMLA 4ED2A 4FO6A 7ICTA 1F5SA 4DSJA 3PSFA 4BGDA 5KFLA 5IIKA 1S5LO 5DG8A 2IHMA 4D65A 5AKJA 4UB2A 1SXEA 3AQEA 3PR4A 2KMDA 2JMMA 3D2SA 1NK8A 2R88A 4KLTA 1L5UA 4NLBA 4B9TA 4ELVA 9ICPA 3AAAB 4DWIA 4IRCA 1B4FA 1HXTA 3ZDCA 5AKXA 2HVHA 3SEIA 5HR7A 8ICCA 4UB6O 2CRXA 1F44A 3MC1A 4JWNA 5DB8A 7ICHA 5AKHA 2W03A 3MGVA 4C4VA 4D64A 2KD1A 4PHAA 3H0RB 3GILA 3Q8QB 5T5FA 4BXOB 3NRZA 2KJ5A 5G39A 2F8KA 4JV2A 4MEYA 3WKEA 1BXWA 5H2FO 2DKZA 2MRLA 2BPGA 1L3VA 1ZOLA 1RYSA 4RQ8A 2QTKA 3LVWA 3NVYA 8ICGA 1A6SA 2KOBA 5KAFO 4ECYA 2HHUA 3ED5A 1BNOA 3A0HU 4BUGA 4QZAA 3VZWX 2HBLA 4GXKA 2QB1A 4QZBA 1RXVA 2XTQA 5KG1A 3QEBZ 1WCNA 8ICEA 4IL6U 4EZ6A 5JU5A 4WJ3B 2EZXA 3IRUA 3POUA 4R65A 2XC9A 2BZFA 4K4IA 1KBUA 5G5GA 4PL1A 2LYAA 5KT5A 4EZ9A 3FAHA 3ZDEA 1CI4A 3AL0B 5EE9A 3WKDA 2WJRA 3N7PD 3K1RB 5KG0A 2AXTO 1LV5A 2MHLA 4F4ZA 2N2LA 5AM3A 4KMOB 4MF2A 3N28A 2AQ4A 4PH5A 2V4QA 2R8KA 4YD2A 3GZFA 4C8OA 4DLGA 5AK3A 4M6WB 1ZQFA 2X9KA 5AK5A 4FBUA 4I27A 5ALXA 5KFDA 2ESEA 3THVA 4Y2XA 1COOA 5KFGA 2E8PA 1T16A 1MQ3A 3NASA 6PRNA 4QWAA 5KT4A 5KFPA 5AFUL 2FPLA 2BCUA 2LPEA 3RB0A 3LK9A 2KHVA 4HYKA 2VJ5A 4RJXA 9ICRA 1XO0A 3TKAA 3PORA 4JCHA 3Q8SB 2WF8A 1MQ2A 3E0FA 4UAVA 4NLKA 4ECUA 3JPRA 3BRYA 2W81C 3DA4A 1Q3UA 2JEIA 3CYMA 3GIIA 2ALZA 2WTFA 3QUCA 3C1YA 4GLXA 5G38A 3MGHA 2FMQA 2FGRA 5ALJA 1H38A 3OHBA 3BS5B 3RR7A 2IMWP 8ICRA 2WHEA 5DL6A 2YY6A 3KZXA 3PW0A 5A0LA 4QZCA 4O5EA 2W3SA 1ED1A 4RUAA 5J2BA 2F2AB 3AAEA 5DB9A 5ALHA 2UVWA 1JN3A 2W9BB 4GCQA 3L3FX 1TE2A 2HHWA 1IIPA 2Y0KA 2I5HA 5J8YA 2W7OA 3VE2A 3AMZA 3MDAA 2K89A 1HXXA 1Z4OA 4GFJA 3H4DA 2KVSA 4M9GA 1ORMA 5KG6A 4I2AA 5CHGA 4OCZA 4UAWA 5KT6A 5ALNA 2C2EA 3ZDDA 3UMGA 5KG7A 5HNKA 2XCAA 2EAOA 2NO4A 4DL5A 4KLIA 4F3OA 1QQ6A 3BJYA 3BDPA 1DRGA 4C7ZA 2F3NA 1Z00B 3M6KA 3UAQA 5J0PA 3O0EA 2J6UA 1X6IA 5TZVA 1NI3A 3ZI4A 2ATLA 4FS2A 4CF3A 4EBEA 5E79U 2XO7A 1SV0C 4ECTA 3LVVA 3A0HO 1ZRNA 1TVAA 2PFOA 3ZDAA 5J0WA 1MPFA 5AKEA 4QWBA 3EW9A 3QU5A 4Q8FA 3BQ0A 3PGRA 1ZHWA 1ZQBA 2HW3A 5AHXA 2DF4B 2Y9UA 4JK1A 4IR1A 4RQ4A 2ZUDA 1ZRMA 2RRDA 4DOCA 3WK7A 5CR0A 5AI4A 3UM9A 1WCLA 1QSYA 5AKYA 3HT3A 5K4LA 1J2NA 3UQ0A 4KLDA 4OJ5A 2YNKA 3AA1B 3QU2A 1ZQKA 3HOLA 4DSEA 4BWMA 3BQTA 5J0TA 4PHPA 3DZMA 2K8AA 3A0BU 4O0IA 2K60A 4M9NA 2KKVA 1UT8A 7ICRA 2GWSA 9ICBA 4RT3A 4ELTA 4EX7A 3NS1A 2ISPA 3SMVA 2AGOA 4LJXA 4CF5A 3C28A 4ECWA 5PRNA 5KFOA 5KFWA 3LWMA 4US8A 4KLFA 3GU3A 4Y2QA 3RH4A 4ED0A 1L8OA 2LHFA 5L1JA 4E1TA 1ZD2P 2ES6A 3KKAA 9ICJA 1NKEA 4B9SA 1JX4A 2F44A 3DA3A 2ZJ8A 3T24A 3H40A 4XUSA 5JTIA 4NM1A 2KN7A 4CDGA 5KFYA 5AKZA 3G7GA 4QJFB 5JUMA 1RYUA 4C4TA 5IYUA 2HHVA 5AI6A 1QQ5A 4P2HA 3OJUA 8ICJA 3RAQA 2G5IB 1ECWA 3BQ1A 2KSOA 1MA7A 3NJTA 3V8UA 1ZQTA 4RQ3A 2G0AA 4DOBA 2XY7A 2HCFA 4GHBA 2K8BB 2FMPA 4LZGA 3RBEA 2M9NA 5KFRA 1JUDA 2FPMA 1ZHZA 2CXYA 2DUYA 3ALRA 5DQGA 2KZZA 1RZTA 2W55A 2PFNA 4BXOA 4O3NA 1Z1VA 1VJ5A 4DSIA 4UARA 4CGZA 2QARB 4QZDA 4O4UA 4F2RA 4ZH4A 1MM5A 3TARA 3UXNA 2KXPB 2KP7A 1IZNB 4JFBA 4KLSA 1U9LA 1L3SA 2HOIA 3D2NA 2BDPA 4P0PB 3RB4A 3N97B 1NZBA 7ICJA 4FOZA 4ELUA 3VE1A 5J0OA 4QWDA 1MC8A 2NYVA 1XU4A 3CW2C 4AP9A 5DBCA 2NRXA 4DSLA 4GF4A 3PRNA 4EEKA 2IOHA 4O49A 3F53A 4Q45A 4YR3A 1ZQSA 4G75A 2XI9A 4CRXA 3PMLA 1Q46A 4B9UA 1A77A 5CA7A 2O4VA 2W8LA 3OSNA 4RQ5A 4BJQA 8ICVA 2B6GA 1SB3C 2KFNA 3QE9Y 3RF9A 1RM6C 2O6KA 1OW5A 7ICOA
chains in the Genus database with same CATH topology
3PSFA 4OJOA 2RP5A 2LHTA 4D65A 3AQEA 2JMMA 3D2SA 1YS5A 2ODJA 3HKZF 4QIWC 4NLBA 1PVQA 3AAAB 1HXTA 2OMFA 2F76X 1HXUA 1UPHA 5HR7A 2XTRA 2FGQX 2CRXA 3SZVA 3QRCA 2VKQA 3VC8A 1PVPA 2XE3A 1F44A 3SAGA 3K19A 2W03A 3MGVA 4D64A 2KD1A 3H0RB 1PHOA 5T5FA 2KJ5A 2ZIWB 2ZIWA 2ERVA 2JH7A 5DL7A 3IN5A 2KJ9A 1BXWA 4O3YA 2ZIUA 2D6FC 1OSMA 2MRLA 3RFAA 3K1ZA 2PMZF 2KICA 1Q9FA 2QTKA 1BH3A 3LVWA 3JTYA 1ZHYA 2Z7JA 2ZIXA 2VIXA 3H0LB 1A6SA 2KOBA 4BUGA 4LSIA 3VZWX 2G09A 2HBLA 5CRXA 3HWBA 2XG6A 4QNLA 3SAHA 2XTQA 2HBKA 3ICXA 1GO3F 2G08A 4AYNA 4WJ3B 3POUA 1KBUA 2N1RA 4PL1A 3TZGA 2LYAA 4C69X 4FRTA 3AL0B 5HR6A 3N7PD 2R18A 2OH2A 2BDUA 3GP6A 1Q9GA 4ACOA 2MHLA 1ZHXA 2N2LA 3SQIA 3AA6A 4KMOB 4GCPA 2LBOA 4P0QB 1IZNA 5KL8B 3O0FA 4FZLA 3GZFA 1QJ9A 5KL1B 4RL9A 3AA7A 3VY9X 2GOLA 1A0PA 3LYSA 2G06A 3D2QA 2G5HB 1MM4A 2DGZA 1SZHA 4KR4A 3POXA 4KX3A 6PRNA 2XE5A 4AYMC 3VZTX 5AFUL 3AAEB 8PRNA 2KHVA 3AA0A 1TAMA 2VJ5A 3LK2A 3F2CA 3T0SA 1QJPA 4RJXA 2KV2A 1XO0A 2Y0SC 2KNJA 4KRAA 3PORA 4JCHA 5ADXL 3E0FA 4O3MA 2KKPA 2NV3A 2JHDA 1HEKA 1PRNA 3PSTA 3SAFA 2W81C 2M0NA 2ZG6A 1Q3UA 3DA4A 3CYMA 4A8EA 1OUQA 4AYDC 1D8BA 1GFPA 2YB1A 3EMNX 2G07A 2KZ7A 3VCBA 1Z19A 2FGRA 4PUXA 4O3WA 3AAAA 5DL6A 3KZXA 5A0LA 5JDPA 2F1TA 3CRXA 3C29A 2GH1A 4RLBA 1ED1A 4KR8A 2F2AB 4PL2A 2KZ7B 2M06A 3AAEA 4GCQA 3L3FX 2Q4TA 2J1NA 1IIPA 2Y0KA 4LSEA 2W7OA 1L6NA 3VE2A 4XNLA 2CPRA 4AUIA 2K89A 1HXXA 1URJA 4GFJA 1Z1BA 1THQA 2E1FA 4B61A 2X27X 2KJ8A 4FESA 1ORMA 2K4IA 4U6PA 3H0MB 1GFMA 2ZIUB 4AZLA 3UPGA 3IG5A 1PVRA 3AA1A 2Y0SF 3IP4B 3M7DA 2K8CB 4LSHA 4QQ1A 4IC9A 2LKYA 4Z3TA 4U9CA 3SY9A 1DRGA 2MA1A 4OJLA 3DEEA 2LFUA 3M6KA 3UAQA 3O0EA 3HW9A 5ADXK 3HKZC 4OJPA 4LSFA 4O3XB 4KX5A 2XICA 2GE4A 3SYBA 2OXOA 3SZDA 2W7PA 3LVVA 3T20A 2HOFA 4OO1J 1MPFA 2PORA 2XMXA 3UU2A 7PRNA 4AKMA 4NV0A 2KXPA 4FZMA 2DQNB 1ZHWA 4OJ6A 4O3ZA 2KC0A 2JGAA 3PSPA 2DF4B 4FE3A 4BX9C 1GFQA 3CP8A 4BUMX 1P7DA 2Y0HA 2RRDA 4FMSA 4FSOA 2F8LA 3NSGA 5GV0A 3PQSA 3LK2B 2Y0LA 4XNKA 2WB1C 2Y2XA 2PRNA 3F5AA 2KVCA 2H3IA 1H6S1 1G90A 4OJ5A 3FYXA 5FVNA 2E5SA 5EE2A 3ONNA 2YNKA 3AQFA 4AKRB 3F5EA 3AA1B 4P0PA 1OPFA 3HOLA 2Y7SA 3LK41 1CRXA 5T14A 4RLCA 2HBMA 3WI5A 3PQUA 1GFOA 2K8AA 1P4TA 2VJ4A 2H3ZA 2W80C 2A3VA 2PMZC 4AYEC 4O4XA 2OM6A 2YPVA 4FUVA 2ZLDA 2KKVA 1Q3VA 2YB4A 3POQA 3LK3B 4ICAA 3F2BA 2W04A 2F1VA 1ZHTA 3SMVA 2OYYA 3PZPA 3QRAA 3C28A 2M07A 3KVDD 4GCSA 2KIWA 2HMXA 4FRXA 5PRNA 4N59A 2ZIVA 4N58A 3GU3A 2N2MA 3LK3A 5D5DA 1QJ8A 2LHFA 4NLCA 4E1TA 2H3FA 3VY8X 3F2DA 3SY7A 2XVTA 2JMGA 4G76A 3SYSA 4QIWF 2H3VA 4FSPA 3DA3A 4RJWA 3T24A 1T94A 2KEYA 4FZNA 4CDGA 3G7GA 4QJFB 3WI4A 5IYUA 2XE2A 2G5IB 4AFKA 3NRWA 3PSIA 1GFNA 2YX8A 1E54A 3LK42 4D5UA 1ECWA 2HBJA 4FT6A 4E1SA 1MA7A 1YT3A 3V8UA 3RBHA 2G0AA 2CN1A 4AYBC 2K8BB 4GHBA 3N7SC 1ZQ1C 2ZIVB 1ZHZA 2HOQA 3ALRA 5DL5A 1WUDA 2MNHA 4AYID 5AFUK 2E1EA 4F4BA 2WAQF 2J4UP 1HIWA 2ZXHA 4CGZA 4C0ZA 1XNSA 2ZFGA 4O4UA 2K4HA 2KHQA 3AA6B 1MM5A 2KXPB 4P0QA 1IZNB 4JFBA 3M6ZA 2HOIA 4JMUA 3D2NA 3AA7B 2KDYA 1BT9A 3A2SX 4P0PB 4U7CA 2H3QA 1NZBA 4NWIA 2LYBA 3IG8A 2XE1A 3VZUX 2K4TA 4FOZA 2XIDA 3VE1A 2K0LA 3N7RC 2RHFA 3T79A 5DL8A 4GF4A 3PRNA 2WB1F 2WAQC 4AKRA 4O49A 3F53A 2JH1A 4G75A 2XI9A 4CRXA 4AYBF 3AA0B 2F77X 2O4VA 2K4EA 3HOEA 5G26A 4BJQA 2ZIXB 3OPXA 3KFUF 5C0YA 3C5OA 3RF9A 3NUQA 2ZXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XMX A;  3DA3 A;  3DA4 A;  4FZL A;  4N59 A;  2XTQ A;  2XTR A;  4FZN A;  4FZM A;  4G75 A;  4G76 A;  4N58 A; 
#chains in the Genus database with same CATH topology
 1RQN A;  4MFF A;  5IIL A;  2LHT A;  4YQW A;  4Y2V A;  5HHI A;  2OCE A;  2DFL A;  5KG4 A;  1CUK A;  4Q43 A;  5KFI A;  2ODG A;  1ZD5 A;  5ALE A;  2JZB A;  2R8A A;  4I2D A;  5L1K A;  4NLZ A;  2AGQ A;  2VA2 A;  3BQ7 A;  1KN5 A;  2OMF A;  4C4S A;  2FGQ X;  3SZV A;  4RQ6 A;  3VC8 A;  4EBD A;  2XE3 A;  4R8U B;  3PV8 A;  1X9S A;  2VA8 A;  4C4V B;  9ICU A;  2HHQ A;  3KBB A;  3TAN A;  1NK0 A;  2JQY A;  4O5C A;  4FQE A;  3PX4 A;  1AQ6 A;  2I6X A;  1BPY A;  4Y2S A;  3RH5 A;  3TFR A;  3D6J A;  2BPC A;  2ZIW A;  1S0M A;  8ICB A;  2HHT A;  2JH7 A;  5DL7 A;  2KJ9 A;  3GQC A;  2JEF A;  3RFA A;  5KG2 A;  3WU2 U;  4J9O A;  4ZOH C;  5DDM A;  2PMZ F;  2KIC A;  1J2M A;  1T7P A;  1NK5 A;  1BH3 A;  4IL6 O;  3JTY A;  2ZIX A;  2FJ6 A;  2VIX A;  5J0U A;  5BOL A;  4QW8 A;  9ICV A;  2DPI A;  4LSI A;  5KG5 A;  2R89 A;  4PZO A;  4R66 A;  2XG6 A;  2WVP A;  2MSN A;  1JAL A;  4C4R A;  4DSK A;  2G08 A;  3A0B O;  2YQE A;  5L9X A;  3NGD A;  4TUS A;  5J2F A;  5KT3 A;  3PW5 A;  4FRT A;  3MFH A;  1S10 A;  5DB7 A;  2BDU A;  4PJ0 O;  3NTU A;  4KLM A;  1ZD3 A;  1ZHX A;  3PGU A;  2FPK A;  1KLN A;  2LBO A;  4J9M A;  4P0Q B;  5KL8 B;  1SL0 A;  2FLP A;  5GTI U;  2W8K A;  5HML A;  1QJ9 A;  5KFT A;  3AA7 A;  3VY9 X;  2GOL A;  1A0P A;  5AI8 A;  1LVH A;  2BCQ A;  3HX0 A;  5ALU A;  4YR0 A;  4KLO A;  4C8L A;  1N63 A;  8ICP A;  1TK0 A;  4YXJ A;  3GV7 B;  5J2D A;  1N62 A;  3M8S A;  4I2H A;  5DGA A;  2J6S A;  2ASJ A;  3PW4 A;  3ISD A;  2KV2 A;  4RNN A;  4KN4 A;  3G6X A;  4ECZ A;  4C8K A;  3FC4 A;  9ICO A;  2JRZ A;  3JPQ A;  1X6J A;  3V6H A;  2KFZ A;  1DOQ A;  2C2R A;  2JHD A;  2KKP A;  3I28 A;  4TUP A;  2FI1 A;  3PST A;  3SAF A;  1SL2 A;  7ICK A;  4A8E A;  4DS5 A;  2KZ7 A;  2VAN A;  3VCB A;  1S0V A;  4IR9 A;  4PUX A;  1ZQA A;  4O3W A;  3R9K A;  3AAA A;  4I2E A;  4J9L A;  4QZG A;  3RH6 A;  3M1Y A;  5ALO A;  4PZN A;  3G6V A;  4RZR A;  2F1T A;  3PO5 A;  4F71 A;  2GH1 A;  4RLB A;  4J9R A;  2LM4 A;  2ISO A;  2R4L A;  2Q4T A;  2J1N A;  3PX6 A;  3H7I A;  1RDF A;  1L6N A;  5ALK A;  2ZTC A;  1Z1B A;  2Y9T A;  1ARO P;  5HHH A;  4M0A A;  2E1F A;  2YMM A;  3RJG A;  4GXJ A;  2KJ8 A;  2DPJ A;  4U6P A;  1DK2 A;  4TQR A;  1GFM A;  1MN8 A;  2F1J A;  2ZIU B;  3UPG A;  5AM4 A;  1PZN A;  2EAM A;  3ZD9 A;  4C00 A;  1NK9 A;  1PVR A;  5J0Y A;  2Y0S F;  1K1Q A;  4M9J A;  4XQ8 A;  4US9 A;  5KG3 A;  1Z3E B;  4U9C A;  2R4O A;  2MA1 A;  2PFP A;  4PPX A;  4MEX A;  2V9W A;  5ALR A;  8ICL A;  3HKZ C;  3GIJ A;  1XC9 A;  3FM9 A;  4O3X B;  5J0S A;  3PY8 A;  2XIC A;  3TAQ A;  3SYB A;  3PGS A;  1B43 A;  3SZD A;  2W7P A;  1KFS A;  1D8L A;  5KFV A;  2HOF A;  9ICN A;  2POR A;  3GDX A;  7PRN A;  4AKM A;  4NV0 A;  1SKW A;  1BPZ A;  4FFD A;  4FZM A;  3TAP A;  4OJ6 A;  3PSP A;  3CP8 A;  3UXP A;  3GIK A;  2BGW A;  2EZZ A;  1JXE A;  3PQS A;  4KMU A;  3EWA A;  2KK0 A;  5J0X A;  1UCV A;  9ICX A;  3LK2 B;  2Y0L A;  3QXG A;  4XNK A;  2WB1 C;  2Y2X A;  3ISB A;  3QUQ A;  4UB1 A;  4NL9 C;  9ICT A;  3FYX A;  5FVN A;  2MU2 A;  2OEH A;  3AQF A;  3F5E A;  5J2G A;  1OPF A;  2JR5 A;  1SKS A;  2IWV A;  2DL0 A;  1FFU A;  1O03 A;  3SV3 A;  4RLC A;  9ICS A;  3PQU A;  4YMN A;  7ICL A;  4DQR A;  5ALM A;  1P4T A;  3HIL A;  4PJ0 U;  5KFH A;  1S97 A;  2H3Z A;  4F92 B;  2W80 C;  4O4X A;  2ZLD A;  1Q3V A;  4ECV A;  3POQ A;  3UQ2 A;  8ICN A;  3GFK B;  1VLB A;  1ZD4 A;  3OGU A;  2F1V A;  1N60 A;  4F93 B;  1RPL A;  4CE6 A;  3QRA A;  2AHO B;  3T5L A;  4YR2 A;  5G5H A;  3SEN A;  4UBB A;  2KIW A;  5GTH U;  2HVI A;  2BQ3 A;  3AU2 A;  4R8U A;  2ZIV A;  3LK3 A;  2N2M A;  4Y2P A;  2PXI A;  1XO1 A;  2EZY A;  4JWM A;  4RPY A;  1IXR A;  4EX6 A;  1QJ8 A;  1XSP A;  4NLC A;  1X2I A;  5KFM A;  3M8R A;  5J0Q A;  3VY8 X;  1OXJ A;  4G76 A;  5AIC A;  3M9O B;  4RJW A;  5EWF A;  5III A;  1KRP A;  1U48 A;  4UAS A;  3KZI O;  5ALI A;  4DCC A;  3RJF A;  2W9M A;  3C5F A;  3ORY A;  2HHS A;  5CB1 A;  1HUZ A;  2XY6 A;  2EDU A;  3PSI A;  4GIB A;  4KLJ A;  2YX8 A;  5DB6 A;  1T8E A;  3LK4 2;  5AK6 A;  2C2D A;  2FMS A;  4HAI A;  4RPX A;  4CF4 A;  1NOM A;  1ZET A;  3GV8 B;  2E8N A;  4AYB C;  1ZQC A;  2IBK A;  1V85 A;  1ZQX A;  2C28 A;  4XRH A;  3EPI A;  4GC6 A;  2XGQ A;  2HHX A;  5B66 O;  4AYI D;  3PO4 A;  3RJI A;  2J4U P;  1HIW A;  1XNS A;  2ZFG A;  4UAZ A;  2YN4 A;  3AA6 B;  5B5E U;  1SIJ A;  4P0Q A;  5DQH A;  1DK3 A;  3M6Z A;  2F1C X;  1QSS A;  3PMN A;  4JMU A;  4BWJ A;  4YMM A;  5KAI U;  1BPE A;  3A2S X;  1ZQN A;  4U7C A;  4K3C A;  4NWI A;  2LYB A;  2I9G A;  5KFX A;  2W9B A;  8ICM A;  3MR5 A;  8ICF A;  8ICQ A;  1SKR A;  2K0L A;  2BKE A;  3JPN A;  3RRG A;  7ICI A;  3T79 A;  5DL8 A;  5ALS A;  9ICC A;  5E79 O;  1ZQZ A;  2WB1 F;  1X9X A;  4AKR A;  2Y1J A;  4GC7 A;  5DDY A;  3DDH A;  4IQV A;  1ZXI A;  4R63 A;  3UMC A;  3NVW A;  3C5G A;  2ZUC A;  4AYB F;  1ZQI A;  4Q8E A;  2F77 X;  1L7N A;  2KSO B;  1FIQ A;  2ZIX B;  5TIS U;  3OPX A;  4NLN A;  5DG9 A;  1DGJ A;  3C5O A;  1NJY A;  2AGP A;  3QEA Z;  1BNP A;  2ZXI A;  4G9B A;  4OJO A;  1ZQO A;  2RP5 A;  5HP4 A;  2VA3 A;  1NNL A;  3CNH A;  2MAX A;  5ALD A;  3JPS A;  1YS5 A;  8ICK A;  2ODJ A;  5DBA A;  4M2Y A;  3HKZ F;  2R8H A;  5KFB A;  2GLE A;  4PGQ A;  1ZQP A;  2WF5 A;  3Q8K A;  4CTD A;  3TI0 A;  2F76 X;  3BRZ A;  3MDC A;  2FDR A;  3QRC A;  2VKQ A;  1PVP A;  3WK6 A;  1JI7 A;  1S0O A;  5DLF A;  3SAG A;  8ICY A;  1UT5 A;  2WF9 A;  2BQR A;  5J29 A;  5KFE A;  4M6W A;  1NKC A;  4DQI A;  2NO5 A;  5F9L A;  3PX0 A;  5BPC A;  2A1J A;  1T1L A;  4EEL A;  8ICA A;  3OTQ A;  2NRW A;  1RYR A;  3G6Y A;  3GIM A;  3EUB 2;  4F4Y A;  1KQQ A;  3C21 A;  3Q8R B;  5AM0 A;  4JV0 A;  1WYG A;  1KSP A;  2MUT B;  1SV4 A;  2K4P A;  2Z7J A;  8ICW A;  3RJJ A;  1JMS A;  1ZHY A;  1ZQQ A;  3WKB A;  1UHU A;  3H0L B;  1D9D A;  3Q8P B;  5CRX A;  3HWB A;  1U47 A;  5B5E O;  4UB5 A;  4QNL A;  5DQI A;  4KN7 A;  3SAH A;  2Q0Z X;  1QTM A;  3ICX A;  5CP2 A;  1GO3 F;  4J9Q A;  3Q8L A;  4DFD A;  5B66 U;  3SR6 A;  5AKL A;  4I2F A;  5EOZ A;  2N1R A;  3TZG A;  5ALW A;  3S6J A;  3KHL A;  2ZTE A;  3QZ8 A;  1UA0 A;  3QU9 A;  1IG6 A;  4C69 X;  4RQ1 A;  1ZQY A;  3I76 A;  3BS0 A;  3PR5 B;  2QAR A;  3GP6 A;  5J2J A;  3RTV A;  4DQQ A;  4F8R A;  1Q9G A;  4IQT A;  4LZD A;  5AI9 A;  1IZN A;  4ECX A;  1NK7 A;  3O0F A;  4PHD A;  8ICT A;  4FZL A;  5KL1 B;  2WFA A;  3BZC A;  1A76 A;  3KZI U;  1SL1 A;  1ZQR A;  5BOM A;  4DFM A;  2G5H B;  1MM4 A;  2DGZ A;  5ALZ A;  5DLG A;  1TV9 A;  4O3R A;  1SZH A;  4KR4 A;  3U26 A;  2XE5 A;  4R64 A;  3AAE B;  5EE1 A;  1J97 A;  1C20 A;  8ICS A;  1X9W A;  3AA0 A;  1N5W A;  3MR3 A;  4JUZ A;  2AU0 A;  4IQU A;  4K4G A;  3LK2 A;  3F2C A;  4EYI B;  5AKK A;  5KAF U;  2ASL A;  2KNJ A;  4F5Q A;  3UXO A;  1KDH A;  4I2B A;  3FDS A;  2PI4 A;  4J9P A;  4QZ8 A;  5FP0 A;  2M0N A;  4JB3 A;  2ZG6 A;  3BQ2 A;  1BPB A;  4NM2 A;  1OUQ A;  4AYD C;  1D8B A;  1GFP A;  2YMP A;  2YB1 A;  3EMN X;  3HJE A;  3C2K A;  2G07 A;  4UQG A;  2E8M A;  1Z19 A;  1XSN A;  5KTQ A;  4IRK A;  4NY8 A;  4RQN A;  3ETR A;  3H8M A;  3MFI A;  1PK1 A;  1LKY A;  1SWW A;  4ED3 A;  5AIB A;  1JIH A;  5ALF A;  3HW8 A;  2OHF A;  2LI6 A;  3QUB A;  4IRD A;  4KR8 A;  3QU4 A;  2M06 A;  3PF1 A;  3C23 A;  3WK8 A;  7ICU A;  1MSW D;  2FE9 A;  4XNL A;  1T3Q A;  4F5P A;  4ED7 A;  4AUI A;  1JRO A;  4B9L A;  1L7P A;  5IIM A;  3AUO A;  2X27 X;  2E8O A;  2K4I A;  3WKA A;  3H0M B;  1CEZ A;  1S5L U;  7ICG A;  3JPO A;  4DF4 A;  5J2A A;  1TAQ A;  4KLL A;  9ICL A;  5AM5 A;  9ICH A;  9ICG A;  3AA1 A;  2RQ5 A;  4UB4 A;  3QU7 A;  2BQU A;  1T3N A;  3SY9 A;  3IM1 A;  2LFU A;  1Z00 A;  4N74 A;  3ETL A;  2D8C A;  1N61 A;  1WG8 A;  3HW9 A;  1ZQG A;  5ADX K;  4OJP A;  4F2S A;  4LSF A;  5KFS A;  4J9N A;  1EXN A;  3KD3 A;  4KX5 A;  1KEJ A;  2GE4 A;  1N2X A;  2OXO A;  5F9N A;  4TUQ A;  3T5K A;  4DFJ A;  3QYP A;  3H8S A;  5G3A A;  4Y2Y A;  3MR2 A;  4KLH A;  3T20 A;  2PFQ A;  4MF8 A;  4J03 A;  2B21 A;  3UU2 A;  5KFU A;  4EBC A;  4RQ0 A;  5CEH A;  2J6T A;  4F5R A;  2KXP A;  3B9J A;  2DQN B;  2ZTD A;  4KLQ A;  1T4G A;  3RB3 A;  2R8J A;  4O3Z A;  4FE3 A;  3KHR A;  1GFQ A;  9ICF A;  4Q44 A;  4B9M A;  1P7D A;  4BDP A;  4Y2T A;  1SV0 A;  2KTQ A;  1ZQM A;  4FMS A;  1N5X A;  4FSO A;  2KZ3 A;  4MFA A;  2IOF A;  3NSG A;  4QZE A;  1NKB A;  4QZI A;  4IQW A;  4C7Y A;  1B22 A;  3F5A A;  2KVC A;  2H3I A;  3RJK A;  1G90 A;  4M04 A;  2E5S A;  5EE2 A;  1S9F A;  3ONN A;  1TKD A;  3QX7 A;  2QB0 A;  3LWL A;  4AKR B;  3OHA A;  4P0P A;  4M9L A;  1X40 A;  4RUC A;  1CRX A;  5AK4 A;  2NRT A;  4I28 A;  2HBM A;  4YD1 A;  4DS4 A;  1M6Y A;  5KFZ A;  1GFO A;  5TIS O;  4LVS A;  2VJ4 A;  5KFA A;  3DWO X;  2W9C B;  2EAN A;  5D49 A;  2PMZ C;  2A3V A;  4AYE C;  2YMQ A;  2YPV A;  2KZM A;  5KNI A;  3HRD D;  5CWR A;  4ICA A;  3F2B A;  2DBY A;  5CJ7 A;  1S0N A;  2W04 A;  4UBC A;  5J8Y C;  1ZYQ A;  2JXJ A;  4UAY A;  1ZHT A;  5L1M A;  3KHG A;  3PW2 A;  3PZP A;  3H8J A;  1QSL A;  4G3I A;  1YZ7 A;  2M07 A;  1NJZ A;  3KVD D;  4GCS A;  3TAC B;  1O08 A;  3GV5 B;  4O3Q A;  3B0Y A;  3TAD C;  4MHV A;  4NL9 A;  4N58 A;  3E2E A;  4YFK A;  5KT2 A;  3J81 j;  1SZP A;  8ICO A;  3HWT A;  2H3F A;  4YMO A;  2JMG A;  4DL2 A;  4FSP A;  5J2E A;  1B0X A;  1T94 A;  1KW4 A;  2KEY A;  1X66 A;  4I2G A;  2UVR A;  3C1Z A;  1BVS A;  3V6J A;  3T5H A;  1K1S A;  2ASD A;  2QB0 B;  4JV1 A;  3ZDB A;  3NRW A;  2ZJ5 A;  4C80 A;  1TK5 A;  1GFN A;  1E54 A;  4D5U A;  2IHN A;  1FEZ A;  3EZ5 A;  4ECR A;  4FT6 A;  4DSF A;  2H5X A;  2CN1 A;  3RJE A;  2ZIV B;  4GXI A;  1F0M A;  2HOQ A;  4QWE A;  1UA1 A;  5DL5 A;  2C22 A;  2MNH A;  1TFR A;  2B0C A;  5AM2 A;  2WAQ F;  1NK6 A;  2ZXH A;  2A19 A;  1ZQE A;  2KHQ A;  4RQ7 A;  4EEN A;  1S8O A;  4B9V A;  2R4N A;  2BR0 A;  7ICN A;  3RRH A;  2W9A A;  5F3X B;  3RR8 A;  1BT9 A;  2V4R A;  3B0X A;  5AI0 A;  5KFN A;  5ALV A;  4DFK A;  2XE1 A;  2K4T A;  3VZU X;  2XID A;  3BS7 A;  1SWV A;  3WK4 A;  8ICU A;  1YZ6 A;  2RHF A;  1LB2 B;  3JPT A;  3HPO A;  1LKY B;  2WAQ C;  1V9P A;  4QWC A;  1ZQU A;  5L1L A;  1KFT A;  2WF6 A;  5KFJ A;  4F50 A;  4KLU A;  4PR7 A;  3I1Y A;  4O3O A;  2KIV A;  2K4E A;  2AQ0 A;  3TFS A;  2MUT A;  3AEV A;  5G26 A;  5EE3 A;  5J2C A;  2W11 A;  4I2I A;  2NRV A;  4DF8 A;  3NUQ A;  2XGP A;  5DKW A;  3DWN A;  4ED1 A;  3WK5 A;  5DBB A;  5ALY A;  5EWE A;  5J2I A;  9ICK A;  2AJQ A;  1RQL A;  2LM1 A;  3BZK A;  3V7L A;  7ICP A;  3RB6 A;  7ICF A;  9ICA A;  5L1I A;  1IM4 A;  4QIW C;  1TK8 A;  4Z6C A;  1PVQ A;  1NK4 A;  3MAB A;  2A1J B;  1HXU A;  2WJQ A;  1UPH A;  2XTR A;  4Z6E A;  1X42 A;  1L8L A;  4DL7 A;  3K19 A;  1HJP A;  4DOA A;  1L7M A;  2IOF K;  1PHO A;  3AM9 A;  3QNM A;  1N56 A;  2OWO A;  4Z6F A;  3UPQ A;  2ZIW B;  2ERV A;  9ICQ A;  1S76 D;  3IN5 A;  5AM1 A;  4O3Y A;  1U49 A;  5J2K A;  2ZIU A;  4UB3 A;  4X5V A;  2D6F C;  1OSM A;  2PKE A;  3K1Z A;  2LYH A;  2XCP A;  1Q9F A;  1D8Y A;  1XSL A;  3IHQ B;  5HMM A;  1KTQ A;  2G09 A;  4E0D A;  3AN1 A;  4Y2R A;  1ZQJ A;  3SD7 A;  2HBK A;  4QZH A;  4B6J A;  5AKI A;  4ED6 A;  4AYN A;  2R4P A;  4C8M A;  1ZQV A;  2P66 A;  2RDJ A;  1RXW A;  5IIJ A;  4NLG A;  5HR6 A;  3NVZ A;  2R18 A;  2OH2 A;  3TAD A;  3N4M B;  1L3T A;  1WWU A;  4ACO A;  8ICI A;  3SQI A;  4QZ9 A;  4PGX A;  1QH9 A;  3DV9 A;  3AA6 A;  4GCP A;  4YCX A;  1S77 D;  1DXS A;  4Y2U A;  4RL9 A;  4IS7 A;  2ZJA A;  4RU9 A;  2BCS A;  4TUR A;  2ZUB A;  4DL3 A;  4KIT B;  3LYS A;  2G06 A;  3D2Q A;  4USA A;  4CCH A;  4UB8 U;  3RJH A;  4ECQ A;  4P4P A;  3KKA C;  3ZD8 A;  3POX A;  4KX3 A;  2RLT A;  5C5J A;  4AYM C;  4M9H A;  3MGI A;  3VZT X;  4YXM A;  2EAP A;  3LDA A;  8PRN A;  2W43 A;  4O3P A;  1TAM A;  4MFC A;  4Y2J A;  3T0S A;  1FO4 A;  1QJP A;  4DEZ A;  2Y0S C;  5J0R A;  4KRA A;  1QQ7 A;  4F4K A;  7ICS A;  4DQP A;  5ADX L;  5AKG A;  5DG7 A;  4O3M A;  4FS1 A;  2NV3 A;  1HEK A;  1PRN A;  7ICE A;  4K3B A;  1ZQD A;  4RPZ A;  2R8I A;  3K4G A;  2QKQ A;  4YN4 A;  4DQS A;  4F5O A;  1ZQW A;  3SV4 A;  4K4H A;  1SGG A;  8ICX A;  3T5J A;  5H2F U;  1X9M A;  4DO9 A;  1ZJM A;  3QZ7 A;  1Q8K A;  2P6U A;  5JDP A;  3UMB A;  4KLG A;  3CRX A;  3C29 A;  3H4B A;  5KAI O;  1VDV A;  2BPF A;  4PL2 A;  4I2C A;  2KZ7 B;  4J9K A;  9ICM A;  2DKX A;  9ICE A;  1ZJN A;  2JEJ A;  4LSE A;  5EWG A;  5EE0 A;  1BPD A;  2CPR A;  3AU6 A;  4UB6 U;  4XA5 A;  3V72 A;  1URJ A;  1THQ A;  2YTU A;  1DGS A;  3RAX A;  4B61 A;  1KFD A;  2I1Q A;  5ALG A;  4FES A;  4F91 B;  1U45 A;  3HP6 A;  5DGB A;  3M9M B;  5GTI O;  5IIO A;  4AZL A;  1N48 A;  4N75 A;  3IG5 A;  4CNQ A;  2IA6 A;  4RT2 A;  4P4M A;  2BCR A;  3IP4 B;  4PHE A;  1IV8 A;  3M7D A;  2NRZ A;  2K8C B;  3L5K A;  4LSH A;  4QQ1 A;  4IC9 A;  3BS5 A;  4UAU A;  2LKY A;  4Z3T A;  1U4B A;  1D9F A;  2JEG A;  4TQS A;  4OJL A;  3DEE A;  2DWQ A;  5ALL A;  4NXZ A;  4YP3 A;  4B9N A;  4F4W A;  3WU2 O;  5KFC A;  7ICM A;  1L7O A;  2JZB B;  3KHH A;  3QUT A;  1XS9 D;  3RBD A;  3Q8M A;  4OO1 J;  1BPX A;  3IV6 A;  5ALT A;  5ALP A;  1COK A;  2XMX A;  2E3T A;  4KLE A;  3IDW A;  3V6K A;  4RNM A;  2KC0 A;  2JGA A;  4BX9 C;  2FLN A;  4BUM X;  2R8G A;  1BGX T;  5GTH O;  2Y0H A;  2F8L A;  5GV0 A;  3KOO A;  5J2H A;  3OSP A;  4UB8 O;  4F5N A;  2PRN A;  4EEY A;  1H6S 1;  1JRP A;  1UQV A;  5KFK A;  4YVZ A;  2HDO A;  2LMR A;  4DL4 A;  1SXD A;  4DFP A;  8ICZ A;  2Y7S A;  3LK4 1;  2UVV A;  1QCK A;  4I2J A;  5T14 A;  2KE7 A;  1V97 A;  3WI5 A;  1PUZ A;  2L5Y A;  5ALQ A;  5IIN A;  4O9M A;  2KG5 A;  3FYH A;  3MBY A;  2A1A A;  4ECS A;  2OM6 A;  3M9N B;  4F4X A;  5KFQ A;  3SI8 A;  4FUV A;  2UVU A;  2YB4 A;  1QLN A;  3WK9 A;  1JXL A;  3LK3 B;  4Z6D A;  4UW9 A;  4DL6 A;  5JRT A;  1KKX A;  4YG2 A;  7ICV A;  2HSZ A;  4UAT A;  3V7J A;  2OYY A;  1RG6 A;  2AH5 A;  1PK3 A;  2BCV A;  9ICI A;  2HMX A;  2P35 A;  4FBT A;  4FRX A;  1L3U A;  3K75 D;  4N59 A;  4M47 A;  4RQM A;  4OD0 A;  5D5D A;  3SZ2 A;  3NVV A;  3H8W A;  2JV3 A;  3F2D A;  3SY7 A;  2XVT A;  9ICW A;  3SYS A;  4QIW F;  2FLL A;  2H3V A;  4PGY A;  1Y88 A;  4RNO A;  4FZN A;  2W3R A;  1ZQH A;  3WKC A;  1K5O A;  4EYH B;  1NJW A;  3WI4 A;  8ICH A;  3C2L A;  3PW7 A;  2XE2 A;  1XWL A;  1NJX A;  3MR6 A;  1ZQL A;  4AFK A;  5D46 A;  2RDI A;  4I29 A;  2XY5 A;  3EPG A;  2EH9 A;  2BHN A;  3PVX A;  2Y1I A;  2HBJ A;  2AXT U;  1WWV A;  2HI0 A;  1YT3 A;  4E1S A;  3JCU O;  3RBH A;  2F1H A;  3JPP A;  1V38 A;  4O3S A;  4C8N A;  4QZF A;  3N7S C;  1PK1 B;  1ZQ1 C;  5KT7 A;  3SYZ A;  1FFV A;  1WUD A;  4P4O A;  5AFU K;  3E58 A;  4ED8 A;  2E1E A;  4F4B A;  4J9S A;  3L4P A;  5AIA A;  4C0Z A;  3TQ1 A;  2WF7 A;  2K4H A;  2F1I A;  3EYZ A;  1TAU A;  3T3F A;  2D3D A;  2GO7 A;  5KFF A;  4QW9 A;  1KL9 A;  3AA7 B;  2KDY A;  2PI5 A;  2P6R A;  2H3Q A;  2IWW A;  3IG8 A;  1NZP A;  2EQY A;  1HUO A;  3N7R C;  3ISC A;  3C2M A;  7ICQ A;  3KTQ A;  2W54 A;  4F72 A;  4DLE A;  4RQ2 A;  2JH1 A;  3PNC A;  2QLT A;  4O5K A;  4NJ8 A;  5D4B A;  3AA0 B;  4KTQ A;  3OJS A;  1C7Y A;  2W9C A;  3HOE A;  3V7K A;  5AI5 A;  3KFU F;  5C0Y A;  1Z4N A;  2YML A;  4ED2 A;  4FO6 A;  7ICT A;  1F5S A;  4DSJ A;  3PSF A;  4BGD A;  5KFL A;  5IIK A;  1S5L O;  5DG8 A;  2IHM A;  4D65 A;  5AKJ A;  4UB2 A;  1SXE A;  3AQE A;  3PR4 A;  2KMD A;  2JMM A;  3D2S A;  1NK8 A;  2R88 A;  4KLT A;  1L5U A;  4NLB A;  4B9T A;  4ELV A;  9ICP A;  3AAA B;  4DWI A;  4IRC A;  1B4F A;  1HXT A;  3ZDC A;  5AKX A;  2HVH A;  3SEI A;  5HR7 A;  8ICC A;  4UB6 O;  2CRX A;  1F44 A;  3MC1 A;  4JWN A;  5DB8 A;  7ICH A;  5AKH A;  2W03 A;  3MGV A;  4C4V A;  4D64 A;  2KD1 A;  4PHA A;  3H0R B;  3GIL A;  3Q8Q B;  5T5F A;  4BXO B;  3NRZ A;  2KJ5 A;  5G39 A;  2F8K A;  4JV2 A;  4MEY A;  3WKE A;  1BXW A;  5H2F O;  2DKZ A;  2MRL A;  2BPG A;  1L3V A;  1ZOL A;  1RYS A;  4RQ8 A;  2QTK A;  3LVW A;  3NVY A;  8ICG A;  1A6S A;  2KOB A;  5KAF O;  4ECY A;  2HHU A;  3ED5 A;  1BNO A;  3A0H U;  4BUG A;  4QZA A;  3VZW X;  2HBL A;  4GXK A;  2QB1 A;  4QZB A;  1RXV A;  2XTQ A;  5KG1 A;  3QEB Z;  1WCN A;  8ICE A;  4IL6 U;  4EZ6 A;  5JU5 A;  4WJ3 B;  2EZX A;  3IRU A;  3POU A;  4R65 A;  2XC9 A;  2BZF A;  4K4I A;  1KBU A;  5G5G A;  4PL1 A;  2LYA A;  5KT5 A;  4EZ9 A;  3FAH A;  3ZDE A;  1CI4 A;  3AL0 B;  5EE9 A;  3WKD A;  2WJR A;  3N7P D;  3K1R B;  5KG0 A;  2AXT O;  1LV5 A;  2MHL A;  4F4Z A;  2N2L A;  5AM3 A;  4KMO B;  4MF2 A;  3N28 A;  2AQ4 A;  4PH5 A;  2V4Q A;  2R8K A;  4YD2 A;  3GZF A;  4C8O A;  4DLG A;  5AK3 A;  4M6W B;  1ZQF A;  2X9K A;  5AK5 A;  4FBU A;  4I27 A;  5ALX A;  5KFD A;  2ESE A;  3THV A;  4Y2X A;  1COO A;  5KFG A;  2E8P A;  1T16 A;  1MQ3 A;  3NAS A;  6PRN A;  4QWA A;  5KT4 A;  5KFP A;  5AFU L;  2FPL A;  2BCU A;  2LPE A;  3RB0 A;  3LK9 A;  2KHV A;  4HYK A;  2VJ5 A;  4RJX A;  9ICR A;  1XO0 A;  3TKA A;  3POR A;  4JCH A;  3Q8S B;  2WF8 A;  1MQ2 A;  3E0F A;  4UAV A;  4NLK A;  4ECU A;  3JPR A;  3BRY A;  2W81 C;  3DA4 A;  1Q3U A;  2JEI A;  3CYM A;  3GII A;  2ALZ A;  2WTF A;  3QUC A;  3C1Y A;  4GLX A;  5G38 A;  3MGH A;  2FMQ A;  2FGR A;  5ALJ A;  1H38 A;  3OHB A;  3BS5 B;  3RR7 A;  2IMW P;  8ICR A;  2WHE A;  5DL6 A;  2YY6 A;  3KZX A;  3PW0 A;  5A0L A;  4QZC A;  4O5E A;  2W3S A;  1ED1 A;  4RUA A;  5J2B A;  2F2A B;  3AAE A;  5DB9 A;  5ALH A;  2UVW A;  1JN3 A;  2W9B B;  4GCQ A;  3L3F X;  1TE2 A;  2HHW A;  1IIP A;  2Y0K A;  2I5H A;  5J8Y A;  2W7O A;  3VE2 A;  3AMZ A;  3MDA A;  2K89 A;  1HXX A;  1Z4O A;  4GFJ A;  3H4D A;  2KVS A;  4M9G A;  1ORM A;  5KG6 A;  4I2A A;  5CHG A;  4OCZ A;  4UAW A;  5KT6 A;  5ALN A;  2C2E A;  3ZDD A;  3UMG A;  5KG7 A;  5HNK A;  2XCA A;  2EAO A;  2NO4 A;  4DL5 A;  4KLI A;  4F3O A;  1QQ6 A;  3BJY A;  3BDP A;  1DRG A;  4C7Z A;  2F3N A;  1Z00 B;  3M6K A;  3UAQ A;  5J0P A;  3O0E A;  2J6U A;  1X6I A;  5TZV A;  1NI3 A;  3ZI4 A;  2ATL A;  4FS2 A;  4CF3 A;  4EBE A;  5E79 U;  2XO7 A;  1SV0 C;  4ECT A;  3LVV A;  3A0H O;  1ZRN A;  1TVA A;  2PFO A;  3ZDA A;  5J0W A;  1MPF A;  5AKE A;  4QWB A;  3EW9 A;  3QU5 A;  4Q8F A;  3BQ0 A;  3PGR A;  1ZHW A;  1ZQB A;  2HW3 A;  5AHX A;  2DF4 B;  2Y9U A;  4JK1 A;  4IR1 A;  4RQ4 A;  2ZUD A;  1ZRM A;  2RRD A;  4DOC A;  3WK7 A;  5CR0 A;  5AI4 A;  3UM9 A;  1WCL A;  1QSY A;  5AKY A;  3HT3 A;  5K4L A;  1J2N A;  3UQ0 A;  4KLD A;  4OJ5 A;  2YNK A;  3AA1 B;  3QU2 A;  1ZQK A;  3HOL A;  4DSE A;  4BWM A;  3BQT A;  5J0T A;  4PHP A;  3DZM A;  2K8A A;  3A0B U;  4O0I A;  2K60 A;  4M9N A;  2KKV A;  1UT8 A;  7ICR A;  2GWS A;  9ICB A;  4RT3 A;  4ELT A;  4EX7 A;  3NS1 A;  2ISP A;  3SMV A;  2AGO A;  4LJX A;  4CF5 A;  3C28 A;  4ECW A;  5PRN A;  5KFO A;  5KFW A;  3LWM A;  4US8 A;  4KLF A;  3GU3 A;  4Y2Q A;  3RH4 A;  4ED0 A;  1L8O A;  2LHF A;  5L1J A;  4E1T A;  1ZD2 P;  2ES6 A;  3KKA A;  9ICJ A;  1NKE A;  4B9S A;  1JX4 A;  2F44 A;  3DA3 A;  2ZJ8 A;  3T24 A;  3H40 A;  4XUS A;  5JTI A;  4NM1 A;  2KN7 A;  4CDG A;  5KFY A;  5AKZ A;  3G7G A;  4QJF B;  5JUM A;  1RYU A;  4C4T A;  5IYU A;  2HHV A;  5AI6 A;  1QQ5 A;  4P2H A;  3OJU A;  8ICJ A;  3RAQ A;  2G5I B;  1ECW A;  3BQ1 A;  2KSO A;  1MA7 A;  3NJT A;  3V8U A;  1ZQT A;  4RQ3 A;  2G0A A;  4DOB A;  2XY7 A;  2HCF A;  4GHB A;  2K8B B;  2FMP A;  4LZG A;  3RBE A;  2M9N A;  5KFR A;  1JUD A;  2FPM A;  1ZHZ A;  2CXY A;  2DUY A;  3ALR A;  5DQG A;  2KZZ A;  1RZT A;  2W55 A;  2PFN A;  4BXO A;  4O3N A;  1Z1V A;  1VJ5 A;  4DSI A;  4UAR A;  4CGZ A;  2QAR B;  4QZD A;  4O4U A;  4F2R A;  4ZH4 A;  1MM5 A;  3TAR A;  3UXN A;  2KXP B;  2KP7 A;  1IZN B;  4JFB A;  4KLS A;  1U9L A;  1L3S A;  2HOI A;  3D2N A;  2BDP A;  4P0P B;  3RB4 A;  3N97 B;  1NZB A;  7ICJ A;  4FOZ A;  4ELU A;  3VE1 A;  5J0O A;  4QWD A;  1MC8 A;  2NYV A;  1XU4 A;  3CW2 C;  4AP9 A;  5DBC A;  2NRX A;  4DSL A;  4GF4 A;  3PRN A;  4EEK A;  2IOH A;  4O49 A;  3F53 A;  4Q45 A;  4YR3 A;  1ZQS A;  4G75 A;  2XI9 A;  4CRX A;  3PML A;  1Q46 A;  4B9U A;  1A77 A;  5CA7 A;  2O4V A;  2W8L A;  3OSN A;  4RQ5 A;  4BJQ A;  8ICV A;  2B6G A;  1SB3 C;  2KFN A;  3QE9 Y;  3RF9 A;  1RM6 C;  2O6K A;  1OW5 A;  7ICO A; 
#chains in the Genus database with same CATH homology
 3PSF A;  4OJO A;  2RP5 A;  2LHT A;  4D65 A;  3AQE A;  2JMM A;  3D2S A;  1YS5 A;  2ODJ A;  3HKZ F;  4QIW C;  4NLB A;  1PVQ A;  3AAA B;  1HXT A;  2OMF A;  2F76 X;  1HXU A;  1UPH A;  5HR7 A;  2XTR A;  2FGQ X;  2CRX A;  3SZV A;  3QRC A;  2VKQ A;  3VC8 A;  1PVP A;  2XE3 A;  1F44 A;  3SAG A;  3K19 A;  2W03 A;  3MGV A;  4D64 A;  2KD1 A;  3H0R B;  1PHO A;  5T5F A;  2KJ5 A;  2ZIW B;  2ZIW A;  2ERV A;  2JH7 A;  5DL7 A;  3IN5 A;  2KJ9 A;  1BXW A;  4O3Y A;  2ZIU A;  2D6F C;  1OSM A;  2MRL A;  3RFA A;  3K1Z A;  2PMZ F;  2KIC A;  1Q9F A;  2QTK A;  1BH3 A;  3LVW A;  3JTY A;  1ZHY A;  2Z7J A;  2ZIX A;  2VIX A;  3H0L B;  1A6S A;  2KOB A;  4BUG A;  4LSI A;  3VZW X;  2G09 A;  2HBL A;  5CRX A;  3HWB A;  2XG6 A;  4QNL A;  3SAH A;  2XTQ A;  2HBK A;  3ICX A;  1GO3 F;  2G08 A;  4AYN A;  4WJ3 B;  3POU A;  1KBU A;  2N1R A;  4PL1 A;  3TZG A;  2LYA A;  4C69 X;  4FRT A;  3AL0 B;  5HR6 A;  3N7P D;  2R18 A;  2OH2 A;  2BDU A;  3GP6 A;  1Q9G A;  4ACO A;  2MHL A;  1ZHX A;  2N2L A;  3SQI A;  3AA6 A;  4KMO B;  4GCP A;  2LBO A;  4P0Q B;  1IZN A;  5KL8 B;  3O0F A;  4FZL A;  3GZF A;  1QJ9 A;  5KL1 B;  4RL9 A;  3AA7 A;  3VY9 X;  2GOL A;  1A0P A;  3LYS A;  2G06 A;  3D2Q A;  2G5H B;  1MM4 A;  2DGZ A;  1SZH A;  4KR4 A;  3POX A;  4KX3 A;  6PRN A;  2XE5 A;  4AYM C;  3VZT X;  5AFU L;  3AAE B;  8PRN A;  2KHV A;  3AA0 A;  1TAM A;  2VJ5 A;  3LK2 A;  3F2C A;  3T0S A;  1QJP A;  4RJX A;  2KV2 A;  1XO0 A;  2Y0S C;  2KNJ A;  4KRA A;  3POR A;  4JCH A;  5ADX L;  3E0F A;  4O3M A;  2KKP A;  2NV3 A;  2JHD A;  1HEK A;  1PRN A;  3PST A;  3SAF A;  2W81 C;  2M0N A;  2ZG6 A;  1Q3U A;  3DA4 A;  3CYM A;  4A8E A;  1OUQ A;  4AYD C;  1D8B A;  1GFP A;  2YB1 A;  3EMN X;  2G07 A;  2KZ7 A;  3VCB A;  1Z19 A;  2FGR A;  4PUX A;  4O3W A;  3AAA A;  5DL6 A;  3KZX A;  5A0L A;  5JDP A;  2F1T A;  3CRX A;  3C29 A;  2GH1 A;  4RLB A;  1ED1 A;  4KR8 A;  2F2A B;  4PL2 A;  2KZ7 B;  2M06 A;  3AAE A;  4GCQ A;  3L3F X;  2Q4T A;  2J1N A;  1IIP A;  2Y0K A;  4LSE A;  2W7O A;  1L6N A;  3VE2 A;  4XNL A;  2CPR A;  4AUI A;  2K89 A;  1HXX A;  1URJ A;  4GFJ A;  1Z1B A;  1THQ A;  2E1F A;  4B61 A;  2X27 X;  2KJ8 A;  4FES A;  1ORM A;  2K4I A;  4U6P A;  3H0M B;  1GFM A;  2ZIU B;  4AZL A;  3UPG A;  3IG5 A;  1PVR A;  3AA1 A;  2Y0S F;  3IP4 B;  3M7D A;  2K8C B;  4LSH A;  4QQ1 A;  4IC9 A;  2LKY A;  4Z3T A;  4U9C A;  3SY9 A;  1DRG A;  2MA1 A;  4OJL A;  3DEE A;  2LFU A;  3M6K A;  3UAQ A;  3O0E A;  3HW9 A;  5ADX K;  3HKZ C;  4OJP A;  4LSF A;  4O3X B;  4KX5 A;  2XIC A;  2GE4 A;  3SYB A;  2OXO A;  3SZD A;  2W7P A;  3LVV A;  3T20 A;  2HOF A;  4OO1 J;  1MPF A;  2POR A;  2XMX A;  3UU2 A;  7PRN A;  4AKM A;  4NV0 A;  2KXP A;  4FZM A;  2DQN B;  1ZHW A;  4OJ6 A;  4O3Z A;  2KC0 A;  2JGA A;  3PSP A;  2DF4 B;  4FE3 A;  4BX9 C;  1GFQ A;  3CP8 A;  4BUM X;  1P7D A;  2Y0H A;  2RRD A;  4FMS A;  4FSO A;  2F8L A;  3NSG A;  5GV0 A;  3PQS A;  3LK2 B;  2Y0L A;  4XNK A;  2WB1 C;  2Y2X A;  2PRN A;  3F5A A;  2KVC A;  2H3I A;  1H6S 1;  1G90 A;  4OJ5 A;  3FYX A;  5FVN A;  2E5S A;  5EE2 A;  3ONN A;  2YNK A;  3AQF A;  4AKR B;  3F5E A;  3AA1 B;  4P0P A;  1OPF A;  3HOL A;  2Y7S A;  3LK4 1;  1CRX A;  5T14 A;  4RLC A;  2HBM A;  3WI5 A;  3PQU A;  1GFO A;  2K8A A;  1P4T A;  2VJ4 A;  2H3Z A;  2W80 C;  2A3V A;  2PMZ C;  4AYE C;  4O4X A;  2OM6 A;  2YPV A;  4FUV A;  2ZLD A;  2KKV A;  1Q3V A;  2YB4 A;  3POQ A;  3LK3 B;  4ICA A;  3F2B A;  2W04 A;  2F1V A;  1ZHT A;  3SMV A;  2OYY A;  3PZP A;  3QRA A;  3C28 A;  2M07 A;  3KVD D;  4GCS A;  2KIW A;  2HMX A;  4FRX A;  5PRN A;  4N59 A;  2ZIV A;  4N58 A;  3GU3 A;  2N2M A;  3LK3 A;  5D5D A;  1QJ8 A;  2LHF A;  4NLC A;  4E1T A;  2H3F A;  3VY8 X;  3F2D A;  3SY7 A;  2XVT A;  2JMG A;  4G76 A;  3SYS A;  4QIW F;  2H3V A;  4FSP A;  3DA3 A;  4RJW A;  3T24 A;  1T94 A;  2KEY A;  4FZN A;  4CDG A;  3G7G A;  4QJF B;  3WI4 A;  5IYU A;  2XE2 A;  2G5I B;  4AFK A;  3NRW A;  3PSI A;  1GFN A;  2YX8 A;  1E54 A;  3LK4 2;  4D5U A;  1ECW A;  2HBJ A;  4FT6 A;  4E1S A;  1MA7 A;  1YT3 A;  3V8U A;  3RBH A;  2G0A A;  2CN1 A;  4AYB C;  2K8B B;  4GHB A;  3N7S C;  1ZQ1 C;  2ZIV B;  1ZHZ A;  2HOQ A;  3ALR A;  5DL5 A;  1WUD A;  2MNH A;  4AYI D;  5AFU K;  2E1E A;  4F4B A;  2WAQ F;  2J4U P;  1HIW A;  2ZXH A;  4CGZ A;  4C0Z A;  1XNS A;  2ZFG A;  4O4U A;  2K4H A;  2KHQ A;  3AA6 B;  1MM5 A;  2KXP B;  4P0Q A;  1IZN B;  4JFB A;  3M6Z A;  2HOI A;  4JMU A;  3D2N A;  3AA7 B;  2KDY A;  1BT9 A;  3A2S X;  4P0P B;  4U7C A;  2H3Q A;  1NZB A;  4NWI A;  2LYB A;  3IG8 A;  2XE1 A;  3VZU X;  2K4T A;  4FOZ A;  2XID A;  3VE1 A;  2K0L A;  3N7R C;  2RHF A;  3T79 A;  5DL8 A;  4GF4 A;  3PRN A;  2WB1 F;  2WAQ C;  4AKR A;  4O49 A;  3F53 A;  2JH1 A;  4G75 A;  2XI9 A;  4CRX A;  4AYB F;  3AA0 B;  2F77 X;  2O4V A;  2K4E A;  3HOE A;  5G26 A;  4BJQ A;  2ZIX B;  3OPX A;  3KFU F;  5C0Y A;  3C5O A;  3RF9 A;  3NUQ A;  2ZXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...