4FZLA

High resolution structure of truncated bacteriocin syringacin m from pseudomonas syringae pv. tomato dc3000
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
239
structure length
239
Chain Sequence
GMQNPVATVLLLQGDLYCSPNCLATFQDQARRDSFGIQSKVALKTFAAADQREAEGRDLRTAYNEIATDIGRSQQINENIIKYPPGNHVLSGGLMTPFHALAHGMFGLGAPLTFPIQNVGLNVDIRGIPDVMNVIQSARPVGTSSLDVNFAYDVGKDSNASWLTLGNITLRLVGTIDKNASGAWTFSGEIRAFNDVYDANPSNHRGWLGENLTSLLSAVPFTSYSIEIPGSLPVTVSGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Lipid II-degrading Bacteriocin Syringacin M Suggests Unexpected Evolutionary Relationships between Colicin M-like Bacteriocins.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Antimicrobial protein
molecule keywords Bacteriocin
total genus 73
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.790 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4fzlA01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4fzlA02
4G75A 4N59A 4G76A 3DA3A 2XTRA 4FZNA 3DA4A 4N58A 2XMXA 4FZLA 4FZMA 2XTQA
chains in the Genus database with same CATH superfamily
2YMLA 4Y2QA 3H0MB 4C8KA 4PHEA 3T3FA 3ZI4A 4EENA 4B9MA 3QU4A 5GTHU 5IIIA 1ORMA 3PV8A 5D46A 3PQSA 3LVWA 4PPXA 1ZHTA 2LM4A 1JI7A 3TKAA 4AP9A 4JUZA 3SI8A 2K4TA 4J9NA 1URJA 4DFMA 4FQEA 3AL0B 1ZETA 4AFKA 3H0LB 2NRXA 5AFUK 1A6SA 3ZDAA 4F72A 4PR7A 4ZOHC 2WB1F 3C23A 4F5OA 4RJWA 3WI4A 4F5NA 1JIHA 3ZDCA 4FRTA 3TANA 5KT3A 2I6XA 5KG1A 2WFAA 2C2DA 2LM1A 3SAHA 3WI5A 5DL6A 1RQNA 3QUQA 4DL7A 1N62A 5KG0A 1RG6A 2R4PA 2ASJA 4IQTA 5ALIA 1X42A 3RFAA 1KSPA 2IMWP 2P6RA 1UT5A 4TUSA 4JB3A 5TISO 1ZXIA 4UARA 4I28A 4YXJA 3ORYA 2ZFGA 5C0YA 2NRWA 3Q8PB 2XY5A 5IIJA 4FFDA 3RR8A 2HOIA 4DQRA 3KKAA 2ODJA 4P0QA 2NO4A 3B9JA 1L5UA 3HT3A 2BCUA 9ICUA 4KN4A 3HRDD 4J9PA 1CRXA 4XA5A 4C8LA 2IHNA 4C8NA 3TAQA 5G39A 1PRNA 4KR4A 3PGRA 1S77D 4PGXA 3RJIA 3VE2A 4KLDA 2KEYA 4BWMA 3GZFA 5J2JA 4ED0A 8ICOA 3PZPA 8ICVA 2MNHA 1NK8A 3NRWA 1QSYA 4O3NA 2HDOA 5L1JA 3OGUA 3RB4A 9ICOA 1OW5A 3PORA 2D8CA 1Z3EB 2BZFA 1BPYA 2W9BB 2C2EA 4F5RA 4EYIB 2E3TA 1GFPA 1N56A 5G26A 3L5KA 5B5EU 5ALQA 3SV4A 8ICWA 5HMMA 1KLNA 3PSPA 3HOLA 3IG8A 2YNKA 4DLGA 2NRTA 1QSSA 2R8JA 5AKZA 1PK1B 5ALFA 4GC6A 1WUDA 5AK5A 2FMSA 2KD1A 3HW8A 1ZQHA 3C21A 1IG6A 1NZBA 3H40A 2R4LA 7ICLA 1KKXA 2ALZA 2J1NA 5AM2A 3C2MA 2XGPA 5J2GA 3PW0A 2C28A 5AI9A 5KAIU 4RQ4A 2HVIA 1G90A 4ICAA 3C2KA 4DFPA 2EDUA 5F9NA 2G09A 2HMXA 4PHPA 5KFDA 3QRAA 4AZLA 4N59A 4PHDA 2JGAA 2XIDA 4Q45A 2UVWA 4X5VA 4F4KA 4AYMC 2ERVA 4O5CA 4N74A 4OJPA 3H7IA 5AIBA 2F8LA 4UAYA 1C20A 1NKBA 2BCQA 3SQIA 3Q8LA 2IHMA 4DQSA 4GCPA 1ZD3A 3MFIA 1ZYQA 3EUB2 2DBYA 1TK8A 3L3FX 2V9WA 5L9XA 1X9WA 1ECWA 2WHEA 3UMBA 1ZQGA 9ICHA 1SIJA 3IHQB 3EMNX 3PVXA 4RNNA 1DK3A 2AQ0A 1NK9A 4NXZA 3QE9Y 5FVNA 1SL0A 1ZQZA 4WJ3B 5JRTA 1NK0A 2HW3A 4FO6A 1WG8A 2R18A 3PSFA 3KZIO 3AAAA 3SYBA 3T5LA 4O4XA 3LDAA 3ALRA 5HP4A 1QQ7A 1J97A 2KSOB 3NGDA 2FGQX 2IOHA 5KG4A 3FYHA 2XY7A 3FC4A 4NLBA 3HW9A 3VZWX 4F4XA 3LWLA 5AI4A 2B21A 4PJ0U 1ZQDA 2HCFA 2JEJA 2XMXA 4NV0A 4M6WA 3RF9A 1NK5A 2H3VA 1TK0A 4BWJA 1ZQPA 4UBCA 4US9A 9ICSA 3K75D 2BDUA 5J2BA 5H2FU 5KFBA 2Y1JA 2NRZA 4LSFA 4IRCA 4FE3A 9ICAA 3DV9A 1QQ5A 3BRYA 5IINA 2A3VA 4I2JA 4NLKA 5EOZA 2KICA 2ZXIA 3N28A 3BZCA 3OJUA 2R8HA 5KFRA 3THVA 7ICEA 3SD7A 3QZ8A 1KEJA 8ICEA 3SEIA 4TQRA 3RBEA 1NJWA 4EBCA 4O3RA 5C5JA 4CTDA 4ECVA 3RJEA 4I2EA 4B9TA 2ISPA 2W3RA 3TAPA 1AQ6A 4JMUA 2ES6A 4Y2SA 7ICQA 5ALWA 2KJ5A 3UAQA 4QIWC 4IL6U 4UASA 4UB8U 4C69X 1S0OA 9ICXA 4KLQA 1XSNA 3EWAA 5ALVA 4Q8FA 4KMOB 4DS5A 5CR0A 3QEBZ 4O3SA 9ICIA 2J6UA 3PW2A 4RJXA 4QWEA 3HP6A 4DLEA 2HHWA 4EEYA 2AXTU 3UXNA 1ZQRA 2JQYA 1GFMA 1YZ6A 5ALHA 3RAXA 3H4DA 2KC0A 1RYRA 5HR7A 1S10A 3RH4A 8ICUA 4J9LA 2R8GA 4DOAA 2E8MA 1ZQFA 1ZHXA 4O3MA 1YZ7A 9ICGA 3AA6B 5KT4A 3V7KA 1ZQOA 2WJRA 4Y2JA 1RDFA 3QEAZ 9ICFA 3FM9A 5KAFO 4YFKA 2G07A 3AMZA 4QWDA 3F5EA 4QWCA 2ODGA 4IR1A 4XQ8A 1L7OA 4J9OA 4OJOA 4KLTA 3AA0A 2HHVA 4JWNA 3BS5B 1WWUA 5J2CA 3KBBA 1ZQEA 3C5GA 2EAOA 3VZTX 5DBBA 4USAA 4ED1A 2WAQC 2W7PA 4AYEC 3QU5A 3TQ1A 3T5JA 7ICTA 2WF8A 8ICRA 4IRKA 4EBEA 2PI4A 4DCCA 2JEFA 1LKYB 2GO7A 2F1JA 4OJ6A 1SZHA 5FP0A 3PMNA 4K3BA 3TADA 4DOCA 3UQ0A 3BQ0A 4B9NA 3QX7A 3RJFA 4J9RA 1NOMA 1XO0A 3ONNA 5ALYA 4CF3A 5CWRA 3OSPA 4UB1A 2QB1A 2EANA 1BGXT 4MF2A 1UA1A 9ICCA 4QZ9A 5F9LA 2BQRA 8ICSA 2PFPA 2F1TA 2BCVA 4C80A 1CEZA 2I9GA 2NRVA 4NLZA 4RQMA 4KN7A 4AYID 4RQ8A 1S0VA 2F76X 2JH1A 4O5KA 5AIAA 3TZGA 2OWOA 2X27X 3RH5A 1UQVA 4K4IA 1T1LA 4FRXA 4NWIA 2ZIWB 3WU2O 3POXA 2PKEA 3H8SA 5F3XB 4ECTA 1FIQA 2KZ7B 3WK9A 4O4UA 2W43A 1ZRNA 2KJ8A 4I2HA 2ISOA 4RZRA 2E5SA 4KLGA 2YMMA 9ICEA 3D2NA 2QTKA 3T79A 4MF8A 3LK42 3SAFA 5J2IA 3PY8A 3UMGA 4OJ5A 5DKWA 3WKCA 1T7PA 2ZIUB 2FLNA 5KFMA 4Z6CA 2J6SA 5A0LA 5AICA 3D2QA 4TQSA 2BHNA 2AJQA 2KP7A 3OHBA 3C5FA 2A19A 2V4QA 1FFVA 1X9XA 3LK3A 3FAHA 3NUQA 5T14A 3MABA 4I27A 3TI0A 3AA0B 2V4RA 4LSHA 1A0PA 2K4HA 7ICNA 5D49A 1X9MA 3JPOA 1ZD4A 4F2RA 8ICHA 2WAQF 1U4BA 4M2YA 2P6UA 8ICQA 3WU2U 3SAGA 3PGSA 3RBDA 9ICBA 2HHQA 4P0PA 1T3NA 2WB1C 5AKIA 2ZJ5A 4YG2A 1BNOA 1ZQSA 1S97A 4KLLA 4ZH4A 4O3ZA 2BR0A 2LYHA 3A0BO 1HJPA 4C0ZA 4MFAA 2XE2A 4QZBA 1B0XA 3HKZF 4EELA 1Z00B 1Q46A 8ICYA 2HBJA 3EYZA 5J0WA 4RQ5A 2JMGA 3M7DA 3GP6A 2W11A 4Y2RA 2IWWA 3WK8A 1X6IA 3TFRA 3AM9A 4BX9C 1Z00A 5DB7A 4JK1A 1VDVA 1BVSA 4DFDA 4JV2A 3C5OA 1S76D 4AYDC 2VA3A 3N7PD 5KG2A 4US8A 4AKRB 1L8LA 4PH5A 3HWBA 5KFJA 3KVDD 2VKQA 5KG3A 2QARB 2ZIWA 3CYMA 4GIBA 2WF9A 3BQ2A 3I28A 1TAUA 4EBDA 5AM1A 3RB0A 4RQ3A 1SKSA 2KIWA 5KAFU 3AAEA 4KX3A 2FPMA 5AKGA 3OSNA 5AI8A 3AN1A 4BGDA 5ALPA 3TARA 3F53A 4Z3TA 2C2RA 1ZQBA 4M9GA 1BXWA 4XNLA 5TZVA 3LK3B 2CXYA 8ICBA 1CUKA 4M9JA 4MEYA 4ECSA 1N48A 3AAEB 2W9AA 2KVSA 3H0RB 3ISDA 1NJXA 1HXUA 4OJLA 4CF4A 5J2FA 1X2IA 2JHDA 2Z7JA 1MQ3A 4DSJA 1ZQ1C 5HHHA 1COOA 2MRLA 2VIXA 2I1QA 3JPSA 2BCRA 3PF1A 4QZAA 5J8YA 1S0NA 2XC9A 4F4BA 4FSPA 4DL3A 4F4YA 5KFUA 5J0UA 4YR3A 2RP5A 1KDHA 3OPXA 3GIJA 4JWMA 4C7YA 2RDIA 4GHBA 5KFCA 3KKAC 4O0IA 5J2KA 2KZMA 4PL2A 4YD2A 4OD0A 3CW2C 1A76A 2YQEA 5KT7A 3UMCA 2E8NA 3E0FA 1NZPA 4DQQA 4MEXA 3MFHA 1MSWD 2QB0B 4KLHA 4DSIA 4UAZA 5B66O 2PMZF 1DXSA 1NKEA 1U49A 5J8YC 4D5UA 1ZQVA 1XWLA 5CHGA 4DOBA 1ZQCA 7ICSA 1JROA 1DOQA 8ICLA 4U6PA 2Y0KA 3AQEA 1QJPA 3PNCA 5GTHO 3HOEA 4FSOA 3T0SA 1QSLA 3MR6A 1X6JA 2FDRA 3O0EA 1OUQA 2W9MA 5DBAA 5JDPA 4ED7A 4FS1A 3BRZA 3S6JA 3QU9A 4C4VA 2VA8A 4F8RA 2FJ6A 1F44A 3Q8SB 3V6HA 2XE5A 1M6YA 1WCNA 2W3SA 1H6S1 4ELUA 3T5KA 1GO3F 4UW9A 4KTQA 4A8EA 2K60A 1UCVA 7PRNA 3LYSA 2F77X 4JCHA 4BJQA 3IDWA 3V6JA 4CDGA 4F5PA 4XNKA 3UPGA 4P4PA 3GIMA 4GF4A 4DL6A 1T94A 3ETLA 3N7RC 4O9MA 2YX8A 5AKXA 4B9UA 2KOBA 1KFDA 3MR5A 2NYVA 4K4HA 3PRNA 1SXDA 1QLNA 3ZDBA 1HIWA 1BPDA 2OM6A 5J2EA 5DQHA 4RPXA 5D4BA 2UVRA 1SGGA 2Q0ZX 4IL6O 4ELTA 3BS0A 2FMQA 4O3YA 3OTQA 3JPNA 3PW4A 4K4GA 1PUZA 1K5OA 1ZQAA 3RBHA 2KG5A 1KFTA 1HUOA 5J0XA 2Y0HA 1MC8A 1L3SA 3U26A 3N4MB 5KFVA 1SV0C 4Z6FA 2YB1A 1S8OA 5KL1B 2OH2A 8ICIA 1Q8KA 3QU7A 8ICKA 1HXXA 4GCQA 2R8KA 5T5FA 2HHUA 3MDCA 2XG6A 5G5GA 1MN8A 2EH9A 5KFPA 2R88A 3BZKA 1LVHA 2JEGA 1S0MA 3D6JA 4R65A 4M9HA 1SWVA 2OYYA 4CCHA 2EAPA 1XNSA 4UATA 4M9LA 4MHVA 4YR0A 5DG9A 5ALZA 3OJSA 5CP2A 5AI6A 1ZJNA 2FGRA 2K4IA 3SYSA 3NVZA 8ICGA 1YT3A 1DGJA 3MGHA 4QZHA 1COKA 5KG5A 3NASA 3Q8MA 2YN4A 5KTQA 4QJFB 2AH5A 5CB1A 5ALJA 2Y7SA 3IM1A 3WKBA 2HHTA 3DEEA 4DS4A 4O3QA 1UT8A 3DDHA 3NVWA 1C7YA 4DSFA 5KFIA 4C8OA 1L7PA 2ZIVB 1RZTA 7ICRA 2H3IA 3R9KA 4UB5A 1UA0A 4DL5A 2C22A 3VZUX 3NJTA 2EZXA 3HPOA 9ICLA 1ZQKA 1MA7A 3PX4A 3KTQA 2PFQA 3A0HO 3V6KA 2ZLDA 4C4RA 4GCSA 5DL5A 3KZXA 2KMDA 1J2NA 2I5HA 3PX0A 4DL4A 2KZ7A 4Z6EA 1PZNA 3HILA 5DDMA 8ICPA 4QZFA 3RJKA 1IIPA 3QXGA 1RPLA 2FMPA 3ISBA 2M06A 4B6JA 2ESEA 2IWVA 1EXNA 3F2DA 2M0NA 3K1ZA 2KV2A 2YMPA 2CN1A 3BJYA 4RLBA 3GFKB 2HBKA 5DBCA 4O3XB 5G5HA 2F1IA 2YY6A 5IIOA 2YMQA 1ZQJA 3DWNA 4KRAA 2MU2A 5JTIA 3EPGA 4E0DA 2XTQA 5AM0A 4ED2A 3QUTA 5AI5A 2E8OA 2W9CA 2LI6A 2ZUCA 2AHOB 1ZQMA 1RQLA 1NNLA 9ICVA 4ECQA 3SZDA 2EZYA 2LMRA 3GV8B 1D8BA 3LK41 8ICZA 2W8KA 4RUCA 4R63A 4RL9A 3PQUA 1PK3A 3RJGA 5AFUL 3BS5A 2G5IB 4PGQA 2OHFA 1SL1A 4BUGA 3HWTA 2GLEA 3IP4B 1NJYA 7ICMA 3M9MB 2DWQA 1L3TA 1N5WA 4PZNA 2EZZA 1JXLA 3POUA 3AU2A 1NKCA 2D3DA 2HBMA 4GFJA 3WK5A 3I76A 2E8PA 2XI9A 1ZQLA 5H2FO 4J03A 1SZPA 2PORA 3RRGA 5DGBA 2WVPA 5J0OA 2AGOA 4Z6DA 4ECRA 2BCSA 2W55A 4DSKA 3RJHA 4EEKA 1SV4A 3HKZC 4DF4A 3RAQA 4Q8EA 1WCLA 2KHQA 3AA1B 4CF5A 1L6NA 1ZQWA 9ICTA 2PMZC 3M9OB 1TFRA 3LK2A 1QCKA 4J9KA 4NJ8A 1IZNA 4R8UB 4ECXA 3M6KA 1DK2A 2XO7A 4KLSA 4AUIA 3POQA 4QZEA 4TUQA 1NK6A 2PFOA 4I2AA 2LYAA 4RUAA 4FUVA 2JEIA 8ICFA 2Y9UA 4IQUA 4LZDA 3SZ2A 1U48A 4DSEA 3EZ5A 4ELVA 1AROP 1D9DA 1ZJMA 4GXKA 1KRPA 1WYGA 4I2IA 3OHAA 2OEHA 2DQNB 2WJQA 4E1TA 5GTIU 4P0QB 4ED8A 4JV1A 4QZCA 3GV5B 1XO1A 5HHIA 4DFJA 5KAIO 5KFHA 3A0HU 3CP8A 3F2BA 1XSLA 1BH3A 1N2XA 3NVYA 4NLGA 1N61A 4HYKA 1JMSA 1K1QA 5IIMA 4AYNA 2XY6A 2DPIA 5J2HA 4RQ2A 1NK7A 5L1IA 3E2EA 2HHSA 4Y2PA 2HOFA 3SMVA 5EWGA 2WF7A 1ZQIA 2KFZA 8ICNA 4MFFA 4UB6O 4C00A 3H8MA 5PRNA 5J0SA 5AHXA 2VA2A 4M6WB 4FS2A 3PMLA 4F5QA 3IG5A 5DG8A 2A1JA 3FDSA 2KK0A 4YMMA 5J0PA 1ZQQA 4G75A 5KFAA 7ICUA 3WKAA 4FZLA 4BXOB 1J2MA 3HJEA 3MGVA 5EE0A 1Q9FA 1T16A 3G7GA 2R4NA 3H8JA 5K4LA 3RTVA 3FYXA 4DQPA 4JFBA 2JR5A 3CRXA 4D65A 5B66U 4AKMA 2HI0A 3J81j 2EAMA 2X9KA 2KDYA 4F92B 4J9MA 3RB3A 1SXEA 2DGZA 3I1YA 2R8AA 1NJZA 7ICOA 4QW8A 2Y1IA 2EQYA 3KD3A 2XGQA 4J9SA 3BS7A 4KLJA 3AA7B 2OMFA 3PW7A 4Y2XA 3M9NB 2ZIXB 1S9FA 4QWBA 5KG7A 2G0AA 4OO1J 5DG7A 3AU6A 1X40A 2KKPA 4B9SA 2FPKA 4UB2A 5AKHA 3KZIU 4PL1A 2W03A 1H38A 1V9PA 4C4SA 4RNOA 4P2HA 7ICFA 1TVAA 1BPXA 2NO5A 4KLIA 1YS5A 5KT5A 3T24A 4YXMA 3AA1A 5G3AA 4I29A 1KFSA 1TAMA 2LPEA 2IBKA 5DQIA 5DLGA 5ALMA 8ICTA 5DQGA 2W80C 5J2AA 5J0RA 4ED3A 4UBBA 1TK5A 3K1RB 1OXJA 4RT2A 1SKRA 5ALKA 5J0QA 5HMLA 2KKVA 3SR6A 1D8LA 4RQ7A 3MDAA 7ICJA 1GFQA 2BQ3A 1PHOA 2RLTA 3MC1A 2PXIA 4KX5A 4FZMA 1QH9A 5KFKA 3VCBA 3VC8A 2W9CB 4NL9A 1BPEA 1U45A 4U9CA 2AXTO 3BQ7A 3WKEA 4NLNA 1MPFA 9ICRA 2MUTA 4KLMA 5AKKA 3TADC 2XCPA 5AK3A 9ICNA 4PZOA 5DL8A 4DEZA 2P66A 8ICAA 5DDYA 1P7DA 4IS7A 4LJXA 4UB8O 4Q44A 3LWMA 1QJ9A 2F1CX 3JPTA 2O6KA 3NS1A 4E1SA 1N63A 2F1HA 5G38A 2ZTDA 2GE4A 3UU2A 1L7NA 2JXJA 3JPRA 4FMSA 2PI5A 4Q43A 1JN3A 3M6ZA 4HAIA 2KJ9A 4I2CA 2ZIUA 5B5EO 1Z4NA 4YP3A 2W8LA 2ATLA 1GFNA 2J4UP 2K4EA 1D8YA 1A77A 4F4WA 5ALGA 2W81C 2N2LA 4IRDA 1XC9A 3BQTA 2M07A 4LSEA 1T3QA 3PR4A 4R8UA 2K8AA 3QZ7A 4M47A 5ALSA 4QW9A 2RQ5A 4C4VB 1JRPA 2VJ4A 3D2SA 4N75A 2R4OA 3L4PA 1ZQUA 2ZG6A 2ZIVA 1LKYA 3BQ1A 4K3CA 6PRNA 2LKYA 9ICKA 8PRNA 5AM5A 2GWSA 2CPRA 4R64A 3IRUA 3PGUA 4UAVA 4YMNA 7ICVA 1KQQA 2LYBA 2QARA 1XSPA 5IYUA 2E1EA 1O08A 3ZDEA 2KVCA 2F2AB 4JV0A 1ZQTA 5KFXA 4KLFA 3K19A 3UPQA 2XE3A 1IZNB 3KHGA 5TISU 4UB6U 2B0CA 2K8BB 1FO4A 8ICCA 3MR2A 2AQ4A 5BOLA 2KTQA 4EZ6A 2HHXA 5DL7A 2DL0A 1Y88A 3Q8KA 1XU4A 2IOFA 5ALTA 3PSTA 2BGWA 4FBTA 5AM4A 4FOZA 5J2DA 2DF4B 4NM1A 2KZ3A 2QB0A 5KFSA 4J9QA 1O03A 2R8IA 2KHVA 2FI1A 2KSOA 5CA7A 5JUMA 2JZBB 5ALEA 1QTMA 4CRXA 3SENA 4GXIA 4D64A 5J0TA 4F2SA 4B61A 4OCZA 3T5HA 3AQFA 4YVZA 1Z1BA 1VLBA 4TUPA 2W7OA 1L8OA 1TKDA 1F5SA 3MBYA 3M8RA 2W54A 2D6FC 4C4TA 5E79O 4CNQA 7ICPA 3AEVA 4B9LA 4IR9A 1UHUA 4MFCA 4EYHB 4F50A 4DQIA 1DRGA 5AKEA 4AYBF 2AU0A 2A1AA 3PW5A 9ICWA 3VE1A 4O49A 1RM6C 3UXPA 2Q4TA 2UVUA 1XS9D 4IQVA 3O0FA 4XUSA 3MGIA 2XTRA 3AAAB 1L3UA 5ALRA 4Y2VA 3TFSA 2KXPB 5EE3A 2ASLA 2PRNA 7ICHA 5E79U 2H3QA 4QZGA 3VY8X 4RQNA 2AGQA 3QYPA 4G76A 1PK1A 2K8CB 5DB8A 3IN5A 1JUDA 4ECUA 4O5EA 1KTQA 3ICXA 1BNPA 3RRHA 5CJ7A 1SWWA 5AI0A 5D5DA 2HBLA 3CNHA 4B9VA 2OCEA 2W04A 4I2FA 4FESA 2VJ5A 4ACOA 3DWOX 5AK4A 4QNLA 1S5LU 3WK6A 4UB4A 3GDXA 2H5XA 2Y0SF 2FLPA 2ASDA 3QNMA 2QLTA 9ICJA 3ZD8A 1DGSA 1Z4OA 3K4GA 4Y2TA 3C28A 5ADXL 2Y9TA 5KT2A 3KHRA 2HSZA 4QZIA 4ED6A 5ALDA 5HNKA 2Y0LA 1VJ5A 2YB4A 1PVPA 3NVVA 3DA4A 1ZHWA 4FT6A 2LBOA 4EZ9A 4LVSA 2XCAA 4AKRA 1THQA 7ICKA 1U9LA 1U47A 2ZTCA 5J0YA 1NI3A 2ZJAA 3T20A 5KL8B 3IV6A 3C2LA 4KITB 5EWFA 4BDPA 1X66A 4M04A 2KIVA 5IIKA 4O3OA 3UXOA 1KW4A 3RB6A 2WF6A 4GC7A 3BDPA 3N7SC 1N5XA 2F1VA 1L7MA 4N58A 2W9BA 3RR7A 1SKWA 2FPLA 3AUOA 3C1YA 5EE2A 4P4MA 2BQUA 4GXJA 3UQ2A 4I2BA 3V7JA 1B43A 1B4FA 3KOOA 2PFNA 2WF5A 5GV0A 5ALOA 5L1LA 4RT3A 3ZDDA 5KFLA 4EX7A 5GTIO 4DSLA 1ZD2P 3LK9A 2MHLA 1L3VA 3M1YA 1Q3UA 3GQCA 2XE1A 2MSNA 5EE1A 7ICIA 4RLCA 5KFGA 2MA1A 2G5HB 2KNJA 1V85A 2G08A 4I2DA 4YCXA 4IQWA 3V72A 1PVQA 2F44A 1PVRA 3GV7B 1ZOLA 3ISCA 1Z19A 3UM9A 5J29A 2LHTA 5KFWA 2RRDA 3F5AA 1WWVA 4P4OA 5DB6A 3Q8RB 1E54A 2JRZA 3B0XA 1KBUA 2Y0SC 2RDJA 5KFQA 3ETRA 4F91B 4DFKA 2DFLA 1OPFA 1D9FA 3QUCA 4PGYA 5HR6A 1BT9A 3HX0A 5AM3A 2ZUDA 5KFFA 2CRXA 4DF8A 2KE7A 1JXEA 1V38A 3H8WA 3MR3A 1CI4A 4UAWA 3WK7A 4ECWA 1T8EA 4I2GA 4DWIA 5KFYA 8ICJA 5KFTA 5AKLA 3SYZA 2DKZA 3AA7A 3N97B 1Q9GA 3PR5B 8ICXA 2NV3A 4PHAA 2K89A 2MAXA 5JU5A 2ZIXA 1RXVA 3V8UA 1ZHYA 4F4ZA 2R89A 4RQ1A 1Q3VA 2HVHA 2VANA 1TAQA 5AK6A 4QZ8A 1JX4A 2ZXHA 3GIIA 3JPPA 1RXWA 1SV0A 4M0AA 2KFNA 3NSGA 2LFUA 4YD1A 1F0MA 4G3IA 3WKDA 2XICA 4RU9A 2UVVA 4YMOA 3KFUF 2BPCA 1MQ2A 5ALUA 4PUXA 5DB9A 2BPGA 2OXOA 5EE9A 2B6GA 2WTFA 5BPCA 4YR2A 1HXTA 2N2MA 5EWEA 2KXPA 2N1RA 1GFOA 3TACB 2F3NA 2IA6A 3EW9A 2JZBA 2H3FA 2ZUBA 4O3WA 2A1JB 7ICGA 4BUMX 3G6XA 1JALA 5KFZA 1BPBA 3PX6A 3QRCA 1TE2A 4BXOA 1IV8A 1BPZA 2MUTB 1SL2A 3Q8QB 2F8KA 4P0PB 4YQWA 4GLXA 9ICQA 4IC9A 1Z1VA 3H4BA 1T4GA 1ZRMA 1MM4A 3DZMA 5ALXA 4Y2UA 4UAUA 3QUBA 2HOQA 2XVTA 3SY9A 4PJ0O 5KG6A 2ZTEA 3JTYA 4FBUA 2KZZA 1NK4A 3WK4A 4EX6A 2P35A 3C1ZA 2K4PA 3GU3A 2RHFA 3G6VA 2DPJA 4U7CA 1HUZA 4KLOA 3PO5A 1FFUA 3EPIA 4QIWF 4M9NA 2LHFA 4NLCA 4DL2A 4F71A 1V97A 1N60A 4UB3A 3SV3A 3JCUO 3RH6A 4AYBC 1K1SA 2FE9A 3PSIA 5BOMA 3F2CA 3A0BU 3GIKA 5DLFA 1ZQXA 1IM4A 4QQ1A 3A2SX 1LB2B 3JPQA 4KR8A 2ZJ8A 4DO9A 2BKEA 5ALNA 4NM2A 4CE6A 2DKXA 2GH1A 4XRHA 5KFNA 4RQ0A 1X9SA 1RYSA 2FLLA 3NTUA 4RPZA 5ADXK 3GILA 1HEKA 5KFOA 1P4TA 1RYUA 3E58A 3G6YA 4KLEA 3ED5A 3NRZA 4KMUA 2GOLA 2M9NA 3B0YA 4RNMA 3LK2B 1ED1A 1QQ6A 1ZD5A 4O3PA 3KHHA 4KLUA 4FZNA 2H3ZA 5L1MA 4QWAA 1ZQYA 4F93B 4LSIA 1LV5A 3PO4A 4CGZA 3SY7A 5L1KA 4NL9C 4TURA 4RPYA 5AKJA 2E1FA 9ICPA 4G9BA 3VY9X 3ZD9A 2K0LA 5AKYA 2J6TA 5DGAA 5ALLA 4YN4A 3M8SA 5IILA 2JV3A 5KT6A 1SB3C 3C29A 4RQ6A 3SZVA 5KNIA 9ICMA 4ECZA 1OSMA 5CRXA 1IXRA 1KN5A 1ZQNA 3KHLA 1QJ8A 1TV9A 2JMMA 5KFEA 1S5LO 4C8MA 5CEHA 4F3OA 2BDPA 3V7LA 3DA3A 2AGPA 2YTUA 4Y2YA 2YPVA 4C7ZA 4LZGA 2O4VA 4NY8A 1B22A 8ICMA 1FEZA 2DUYA 2L5YA 4QZDA 2KN7A 3LVVA 1KL9A 3QU2A 2QKQA 1UPHA 2JH7A 1MM5A 3RJJA 4UQGA 1ZHZA 2G06A 2Y2XA 2IOFK 4R66A 2BPFA 4ECYA 3AA6A
chains in the Genus database with same CATH topology
2ZIUB 3VE1A 4O49A 3H0MB 5A0LA 3D2QA 2Q4TA 3SZDA 1D8BA 2XTRA 3O0FA 3AAAB 3LK41 2KXPB 3LK3A 3NUQA 2PRNA 1ORMA 4RL9A 5T14A 3PQUA 3PQSA 3LVWA 3AA0B 2H3QA 5AFUL 3VY8X 2G5IB 4LSHA 1ZHTA 1A0PA 2K4HA 4BUGA 4G76A 2K8CB 3IP4B 3IN5A 2K4TA 2WAQF 1URJA 3ICXA 3AL0B 4AFKA 3H0LB 5AFUK 5D5DA 3POUA 1A6SA 3SAGA 2HBMA 2HBLA 4GFJA 2WB1F 4P0PA 2XI9A 2W04A 2WB1C 4FESA 4RJWA 3WI4A 2VJ5A 4ACOA 4FRTA 4QNLA 2PORA 4O3ZA 3SAHA 3WI5A 2Y0SF 5DL6A 4C0ZA 2XE2A 3HKZF 3HKZC 5ADXL 3C28A 3RFAA 2KHQA 3AA1B 1L6NA 2Y0LA 2PMZC 2HBJA 3LK2A 2YB4A 1PVPA 3DA4A 2JMGA 3M7DA 1IZNA 1ZHWA 4FT6A 3M6KA 2LBOA 2ZFGA 3GP6A 5C0YA 4AKRA 1THQA 4AUIA 2HOIA 3POQA 3T20A 2ODJA 4P0QA 2LYAA 5KL8B 4FUVA 4BX9C 3C5OA 1CRXA 4AYDC 3N7PD 1PRNA 4AKRB 4KR4A 3HWBA 3N7SC 3KVDD 2VKQA 2F1VA 2DQNB 3VE2A 4E1TA 2KEYA 4N58A 4P0QB 2ZIWA 3GZFA 3PZPA 3CYMA 2MNHA 5EE2A 2KIWA 3NRWA 3CP8A 3F2BA 3AAEA 4KX3A 1BH3A 4Z3TA 3F53A 3PORA 5GV0A 4AYNA 1BXWA 4XNLA 3LK3B 2MHLA 1GFPA 1Q3UA 5G26A 2HOFA 2XE1A 3SMVA 3AAEB 4RLCA 3H0RB 2MA1A 2G5HB 2KNJA 3PSPA 2G08A 3HOLA 1PVQA 3IG8A 1HXUA 2YNKA 4OJLA 1PVRA 1Z19A 5PRNA 2JHDA 2Z7JA 2LHTA 1ZQ1C 2RRDA 3F5AA 3IG5A 1WUDA 2KD1A 2MRLA 1E54A 1KBUA 2VIXA 2Y0SC 4G75A 1NZBA 1OPFA 3AA6A 2J1NA 4FZLA 4F4BA 3MGVA 4FSPA 1Q9FA 5HR6A 1BT9A 3G7GA 3FYXA 4JFBA 2RP5A 3CRXA 4D65A 2CRXA 4AKMA 3OPXA 1G90A 4GHBA 4ICAA 4PL2A 3AA7A 2G09A 2HMXA 2KDYA 3QRAA 4AZLA 1Q9GA 4N59A 2JGAA 2XIDA 2NV3A 3E0FA 2K89A 2DGZA 2ZIXA 4AYMC 2ERVA 3V8UA 1ZHYA 4OJPA 2PMZF 1Q3VA 2F8LA 2ZXHA 3AA7B 2OMFA 4D5UA 3SQIA 3NSGA 4GCPA 2LFUA 2ZIXB 3L3FX 4U6PA 2Y0KA 2G0AA 4OO1J 2XICA 3AQEA 1QJPA 1ECWA 2KKPA 3HOEA 3KFUF 4FSOA 3EMNX 3T0SA 4PUXA 4PL1A 3O0EA 2W03A 1OUQA 2OXOA 5FVNA 5JDPA 4WJ3B 2R18A 3PSFA 1HXTA 3AAAA 3SYBA 2N2MA 4O4XA 1YS5A 2N1RA 3ALRA 1F44A 1GFOA 2KXPA 2XE5A 3T24A 3AA1A 1H6S1 2FGQX 2H3FA 4O3WA 1TAMA 4BUMX 1GO3F 2W80C 4A8EA 4NLBA 3HW9A 7PRNA 3LYSA 2F77X 4JCHA 4BJQA 3VZWX 4CDGA 3QRCA 4XNKA 2KKVA 3UPGA 1GFQA 4GF4A 1PHOA 1T94A 4P0PB 4KX5A 4IC9A 2XMXA 3N7RC 4NV0A 4FZMA 2YX8A 3RF9A 3VCBA 2KOBA 1MM4A 3VC8A 2H3VA 2BDUA 3PRNA 4U9CA 2HOQA 4LSFA 4FE3A 1HIWA 2XVTA 1MPFA 3SY9A 2OM6A 2A3VA 5DL8A 2KICA 2ZXIA 1P7DA 3JTYA 1QJ9A 4O3YA 3GU3A 2RHFA 3RBHA 4U7CA 2Y0HA 4JMUA 4E1SA 4QIWF 2LHFA 2KJ5A 4NLCA 3UAQA 4QIWC 2GE4A 3UU2A 4C69X 2YB1A 4FMSA 5KL1B 2OH2A 4KMOB 4AYBC 4RJXA 1HXXA 3M6ZA 3PSIA 2KJ9A 4GCQA 2ZIUA 3F2CA 5T5FA 1GFMA 1GFNA 2KC0A 4QQ1A 3A2SX 2XG6A 2J4UP 2K4EA 5HR7A 4KR8A 2GH1A 2W81C 1ZHXA 2N2LA 4O3MA 2M07A 3AA6B 2OYYA 4LSEA 2K8AA 1XNSA 2G07A 5ADXK 3F5EA 1HEKA 2FGRA 2K4IA 3SYSA 1YT3A 1P4TA 2VJ4A 4OJOA 3D2SA 3AA0A 2ZG6A 2GOLA 2ZIVA 6PRNA 3LK2B 1ED1A 4QJFB 2LKYA 3VZTX 8PRNA 2Y7SA 4FZNA 2H3ZA 3DEEA 2CPRA 4LSIA 2WAQC 2W7PA 4AYEC 4CGZA 3SY7A 2LYBA 5IYUA 2E1EA 2E1FA 4OJ6A 1SZHA 2KVCA 2F2AB 2ZIVB 2H3IA 3VZUX 3VY9X 3K19A 2XE3A 1IZNB 2K0LA 1XO0A 3ONNA 1MA7A 2K8BB 3C29A 3SZVA 5DL7A 2ZLDA 2F1TA 1OSMA 5CRXA 4GCSA 5DL5A 3KZXA 3PSTA 1QJ8A 2JMMA 2KZ7A 4FOZA 1IIPA 2DF4B 4AYID 2F76X 2JH1A 2M06A 3TZGA 3DA3A 2X27X 2KHVA 3F2DA 2M0NA 2YPVA 4FRXA 4NWIA 2ZIWB 3K1ZA 3POXA 4CRXA 2KV2A 2O4VA 4D64A 2KZ7B 2CN1A 4B61A 4RLBA 4O4UA 2KJ8A 2HBKA 4O3XB 3AQFA 1Z1BA 2E5SA 2W7OA 3LVVA 3D2NA 2QTKA 3T79A 3LK42 4KRAA 2D6FC 1UPHA 2JH7A 1MM5A 3SAFA 2XTQA 1ZHZA 2G06A 2Y2XA 4OJ5A 1DRGA 4AYBF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G75 A;  4N59 A;  4G76 A;  3DA3 A;  2XTR A;  4FZN A;  3DA4 A;  4N58 A;  2XMX A;  4FZL A;  4FZM A;  2XTQ A; 
#chains in the Genus database with same CATH topology
 2YML A;  4Y2Q A;  3H0M B;  4C8K A;  4PHE A;  3T3F A;  3ZI4 A;  4EEN A;  4B9M A;  3QU4 A;  5GTH U;  5III A;  1ORM A;  3PV8 A;  5D46 A;  3PQS A;  3LVW A;  4PPX A;  1ZHT A;  2LM4 A;  1JI7 A;  3TKA A;  4AP9 A;  4JUZ A;  3SI8 A;  2K4T A;  4J9N A;  1URJ A;  4DFM A;  4FQE A;  3AL0 B;  1ZET A;  4AFK A;  3H0L B;  2NRX A;  5AFU K;  1A6S A;  3ZDA A;  4F72 A;  4PR7 A;  4ZOH C;  2WB1 F;  3C23 A;  4F5O A;  4RJW A;  3WI4 A;  4F5N A;  1JIH A;  3ZDC A;  4FRT A;  3TAN A;  5KT3 A;  2I6X A;  5KG1 A;  2WFA A;  2C2D A;  2LM1 A;  3SAH A;  3WI5 A;  5DL6 A;  1RQN A;  3QUQ A;  4DL7 A;  1N62 A;  5KG0 A;  1RG6 A;  2R4P A;  2ASJ A;  4IQT A;  5ALI A;  1X42 A;  3RFA A;  1KSP A;  2IMW P;  2P6R A;  1UT5 A;  4TUS A;  4JB3 A;  5TIS O;  1ZXI A;  4UAR A;  4I28 A;  4YXJ A;  3ORY A;  2ZFG A;  5C0Y A;  2NRW A;  3Q8P B;  2XY5 A;  5IIJ A;  4FFD A;  3RR8 A;  2HOI A;  4DQR A;  3KKA A;  2ODJ A;  4P0Q A;  2NO4 A;  3B9J A;  1L5U A;  3HT3 A;  2BCU A;  9ICU A;  4KN4 A;  3HRD D;  4J9P A;  1CRX A;  4XA5 A;  4C8L A;  2IHN A;  4C8N A;  3TAQ A;  5G39 A;  1PRN A;  4KR4 A;  3PGR A;  1S77 D;  4PGX A;  3RJI A;  3VE2 A;  4KLD A;  2KEY A;  4BWM A;  3GZF A;  5J2J A;  4ED0 A;  8ICO A;  3PZP A;  8ICV A;  2MNH A;  1NK8 A;  3NRW A;  1QSY A;  4O3N A;  2HDO A;  5L1J A;  3OGU A;  3RB4 A;  9ICO A;  1OW5 A;  3POR A;  2D8C A;  1Z3E B;  2BZF A;  1BPY A;  2W9B B;  2C2E A;  4F5R A;  4EYI B;  2E3T A;  1GFP A;  1N56 A;  5G26 A;  3L5K A;  5B5E U;  5ALQ A;  3SV4 A;  8ICW A;  5HMM A;  1KLN A;  3PSP A;  3HOL A;  3IG8 A;  2YNK A;  4DLG A;  2NRT A;  1QSS A;  2R8J A;  5AKZ A;  1PK1 B;  5ALF A;  4GC6 A;  1WUD A;  5AK5 A;  2FMS A;  2KD1 A;  3HW8 A;  1ZQH A;  3C21 A;  1IG6 A;  1NZB A;  3H40 A;  2R4L A;  7ICL A;  1KKX A;  2ALZ A;  2J1N A;  5AM2 A;  3C2M A;  2XGP A;  5J2G A;  3PW0 A;  2C28 A;  5AI9 A;  5KAI U;  4RQ4 A;  2HVI A;  1G90 A;  4ICA A;  3C2K A;  4DFP A;  2EDU A;  5F9N A;  2G09 A;  2HMX A;  4PHP A;  5KFD A;  3QRA A;  4AZL A;  4N59 A;  4PHD A;  2JGA A;  2XID A;  4Q45 A;  2UVW A;  4X5V A;  4F4K A;  4AYM C;  2ERV A;  4O5C A;  4N74 A;  4OJP A;  3H7I A;  5AIB A;  2F8L A;  4UAY A;  1C20 A;  1NKB A;  2BCQ A;  3SQI A;  3Q8L A;  2IHM A;  4DQS A;  4GCP A;  1ZD3 A;  3MFI A;  1ZYQ A;  3EUB 2;  2DBY A;  1TK8 A;  3L3F X;  2V9W A;  5L9X A;  1X9W A;  1ECW A;  2WHE A;  3UMB A;  1ZQG A;  9ICH A;  1SIJ A;  3IHQ B;  3EMN X;  3PVX A;  4RNN A;  1DK3 A;  2AQ0 A;  1NK9 A;  4NXZ A;  3QE9 Y;  5FVN A;  1SL0 A;  1ZQZ A;  4WJ3 B;  5JRT A;  1NK0 A;  2HW3 A;  4FO6 A;  1WG8 A;  2R18 A;  3PSF A;  3KZI O;  3AAA A;  3SYB A;  3T5L A;  4O4X A;  3LDA A;  3ALR A;  5HP4 A;  1QQ7 A;  1J97 A;  2KSO B;  3NGD A;  2FGQ X;  2IOH A;  5KG4 A;  3FYH A;  2XY7 A;  3FC4 A;  4NLB A;  3HW9 A;  3VZW X;  4F4X A;  3LWL A;  5AI4 A;  2B21 A;  4PJ0 U;  1ZQD A;  2HCF A;  2JEJ A;  2XMX A;  4NV0 A;  4M6W A;  3RF9 A;  1NK5 A;  2H3V A;  1TK0 A;  4BWJ A;  1ZQP A;  4UBC A;  4US9 A;  9ICS A;  3K75 D;  2BDU A;  5J2B A;  5H2F U;  5KFB A;  2Y1J A;  2NRZ A;  4LSF A;  4IRC A;  4FE3 A;  9ICA A;  3DV9 A;  1QQ5 A;  3BRY A;  5IIN A;  2A3V A;  4I2J A;  4NLK A;  5EOZ A;  2KIC A;  2ZXI A;  3N28 A;  3BZC A;  3OJU A;  2R8H A;  5KFR A;  3THV A;  7ICE A;  3SD7 A;  3QZ8 A;  1KEJ A;  8ICE A;  3SEI A;  4TQR A;  3RBE A;  1NJW A;  4EBC A;  4O3R A;  5C5J A;  4CTD A;  4ECV A;  3RJE A;  4I2E A;  4B9T A;  2ISP A;  2W3R A;  3TAP A;  1AQ6 A;  4JMU A;  2ES6 A;  4Y2S A;  7ICQ A;  5ALW A;  2KJ5 A;  3UAQ A;  4QIW C;  4IL6 U;  4UAS A;  4UB8 U;  4C69 X;  1S0O A;  9ICX A;  4KLQ A;  1XSN A;  3EWA A;  5ALV A;  4Q8F A;  4KMO B;  4DS5 A;  5CR0 A;  3QEB Z;  4O3S A;  9ICI A;  2J6U A;  3PW2 A;  4RJX A;  4QWE A;  3HP6 A;  4DLE A;  2HHW A;  4EEY A;  2AXT U;  3UXN A;  1ZQR A;  2JQY A;  1GFM A;  1YZ6 A;  5ALH A;  3RAX A;  3H4D A;  2KC0 A;  1RYR A;  5HR7 A;  1S10 A;  3RH4 A;  8ICU A;  4J9L A;  2R8G A;  4DOA A;  2E8M A;  1ZQF A;  1ZHX A;  4O3M A;  1YZ7 A;  9ICG A;  3AA6 B;  5KT4 A;  3V7K A;  1ZQO A;  2WJR A;  4Y2J A;  1RDF A;  3QEA Z;  9ICF A;  3FM9 A;  5KAF O;  4YFK A;  2G07 A;  3AMZ A;  4QWD A;  3F5E A;  4QWC A;  2ODG A;  4IR1 A;  4XQ8 A;  1L7O A;  4J9O A;  4OJO A;  4KLT A;  3AA0 A;  2HHV A;  4JWN A;  3BS5 B;  1WWU A;  5J2C A;  3KBB A;  1ZQE A;  3C5G A;  2EAO A;  3VZT X;  5DBB A;  4USA A;  4ED1 A;  2WAQ C;  2W7P A;  4AYE C;  3QU5 A;  3TQ1 A;  3T5J A;  7ICT A;  2WF8 A;  8ICR A;  4IRK A;  4EBE A;  2PI4 A;  4DCC A;  2JEF A;  1LKY B;  2GO7 A;  2F1J A;  4OJ6 A;  1SZH A;  5FP0 A;  3PMN A;  4K3B A;  3TAD A;  4DOC A;  3UQ0 A;  3BQ0 A;  4B9N A;  3QX7 A;  3RJF A;  4J9R A;  1NOM A;  1XO0 A;  3ONN A;  5ALY A;  4CF3 A;  5CWR A;  3OSP A;  4UB1 A;  2QB1 A;  2EAN A;  1BGX T;  4MF2 A;  1UA1 A;  9ICC A;  4QZ9 A;  5F9L A;  2BQR A;  8ICS A;  2PFP A;  2F1T A;  2BCV A;  4C80 A;  1CEZ A;  2I9G A;  2NRV A;  4NLZ A;  4RQM A;  4KN7 A;  4AYI D;  4RQ8 A;  1S0V A;  2F76 X;  2JH1 A;  4O5K A;  5AIA A;  3TZG A;  2OWO A;  2X27 X;  3RH5 A;  1UQV A;  4K4I A;  1T1L A;  4FRX A;  4NWI A;  2ZIW B;  3WU2 O;  3POX A;  2PKE A;  3H8S A;  5F3X B;  4ECT A;  1FIQ A;  2KZ7 B;  3WK9 A;  4O4U A;  2W43 A;  1ZRN A;  2KJ8 A;  4I2H A;  2ISO A;  4RZR A;  2E5S A;  4KLG A;  2YMM A;  9ICE A;  3D2N A;  2QTK A;  3T79 A;  4MF8 A;  3LK4 2;  3SAF A;  5J2I A;  3PY8 A;  3UMG A;  4OJ5 A;  5DKW A;  3WKC A;  1T7P A;  2ZIU B;  2FLN A;  5KFM A;  4Z6C A;  2J6S A;  5A0L A;  5AIC A;  3D2Q A;  4TQS A;  2BHN A;  2AJQ A;  2KP7 A;  3OHB A;  3C5F A;  2A19 A;  2V4Q A;  1FFV A;  1X9X A;  3LK3 A;  3FAH A;  3NUQ A;  5T14 A;  3MAB A;  4I27 A;  3TI0 A;  3AA0 B;  2V4R A;  4LSH A;  1A0P A;  2K4H A;  7ICN A;  5D49 A;  1X9M A;  3JPO A;  1ZD4 A;  4F2R A;  8ICH A;  2WAQ F;  1U4B A;  4M2Y A;  2P6U A;  8ICQ A;  3WU2 U;  3SAG A;  3PGS A;  3RBD A;  9ICB A;  2HHQ A;  4P0P A;  1T3N A;  2WB1 C;  5AKI A;  2ZJ5 A;  4YG2 A;  1BNO A;  1ZQS A;  1S97 A;  4KLL A;  4ZH4 A;  4O3Z A;  2BR0 A;  2LYH A;  3A0B O;  1HJP A;  4C0Z A;  4MFA A;  2XE2 A;  4QZB A;  1B0X A;  3HKZ F;  4EEL A;  1Z00 B;  1Q46 A;  8ICY A;  2HBJ A;  3EYZ A;  5J0W A;  4RQ5 A;  2JMG A;  3M7D A;  3GP6 A;  2W11 A;  4Y2R A;  2IWW A;  3WK8 A;  1X6I A;  3TFR A;  3AM9 A;  4BX9 C;  1Z00 A;  5DB7 A;  4JK1 A;  1VDV A;  1BVS A;  4DFD A;  4JV2 A;  3C5O A;  1S76 D;  4AYD C;  2VA3 A;  3N7P D;  5KG2 A;  4US8 A;  4AKR B;  1L8L A;  4PH5 A;  3HWB A;  5KFJ A;  3KVD D;  2VKQ A;  5KG3 A;  2QAR B;  2ZIW A;  3CYM A;  4GIB A;  2WF9 A;  3BQ2 A;  3I28 A;  1TAU A;  4EBD A;  5AM1 A;  3RB0 A;  4RQ3 A;  1SKS A;  2KIW A;  5KAF U;  3AAE A;  4KX3 A;  2FPM A;  5AKG A;  3OSN A;  5AI8 A;  3AN1 A;  4BGD A;  5ALP A;  3TAR A;  3F53 A;  4Z3T A;  2C2R A;  1ZQB A;  4M9G A;  1BXW A;  4XNL A;  5TZV A;  3LK3 B;  2CXY A;  8ICB A;  1CUK A;  4M9J A;  4MEY A;  4ECS A;  1N48 A;  3AAE B;  2W9A A;  2KVS A;  3H0R B;  3ISD A;  1NJX A;  1HXU A;  4OJL A;  4CF4 A;  5J2F A;  1X2I A;  2JHD A;  2Z7J A;  1MQ3 A;  4DSJ A;  1ZQ1 C;  5HHH A;  1COO A;  2MRL A;  2VIX A;  2I1Q A;  3JPS A;  2BCR A;  3PF1 A;  4QZA A;  5J8Y A;  1S0N A;  2XC9 A;  4F4B A;  4FSP A;  4DL3 A;  4F4Y A;  5KFU A;  5J0U A;  4YR3 A;  2RP5 A;  1KDH A;  3OPX A;  3GIJ A;  4JWM A;  4C7Y A;  2RDI A;  4GHB A;  5KFC A;  3KKA C;  4O0I A;  5J2K A;  2KZM A;  4PL2 A;  4YD2 A;  4OD0 A;  3CW2 C;  1A76 A;  2YQE A;  5KT7 A;  3UMC A;  2E8N A;  3E0F A;  1NZP A;  4DQQ A;  4MEX A;  3MFH A;  1MSW D;  2QB0 B;  4KLH A;  4DSI A;  4UAZ A;  5B66 O;  2PMZ F;  1DXS A;  1NKE A;  1U49 A;  5J8Y C;  4D5U A;  1ZQV A;  1XWL A;  5CHG A;  4DOB A;  1ZQC A;  7ICS A;  1JRO A;  1DOQ A;  8ICL A;  4U6P A;  2Y0K A;  3AQE A;  1QJP A;  3PNC A;  5GTH O;  3HOE A;  4FSO A;  3T0S A;  1QSL A;  3MR6 A;  1X6J A;  2FDR A;  3O0E A;  1OUQ A;  2W9M A;  5DBA A;  5JDP A;  4ED7 A;  4FS1 A;  3BRZ A;  3S6J A;  3QU9 A;  4C4V A;  2VA8 A;  4F8R A;  2FJ6 A;  1F44 A;  3Q8S B;  3V6H A;  2XE5 A;  1M6Y A;  1WCN A;  2W3S A;  1H6S 1;  4ELU A;  3T5K A;  1GO3 F;  4UW9 A;  4KTQ A;  4A8E A;  2K60 A;  1UCV A;  7PRN A;  3LYS A;  2F77 X;  4JCH A;  4BJQ A;  3IDW A;  3V6J A;  4CDG A;  4F5P A;  4XNK A;  3UPG A;  4P4P A;  3GIM A;  4GF4 A;  4DL6 A;  1T94 A;  3ETL A;  3N7R C;  4O9M A;  2YX8 A;  5AKX A;  4B9U A;  2KOB A;  1KFD A;  3MR5 A;  2NYV A;  4K4H A;  3PRN A;  1SXD A;  1QLN A;  3ZDB A;  1HIW A;  1BPD A;  2OM6 A;  5J2E A;  5DQH A;  4RPX A;  5D4B A;  2UVR A;  1SGG A;  2Q0Z X;  4IL6 O;  4ELT A;  3BS0 A;  2FMQ A;  4O3Y A;  3OTQ A;  3JPN A;  3PW4 A;  4K4G A;  1PUZ A;  1K5O A;  1ZQA A;  3RBH A;  2KG5 A;  1KFT A;  1HUO A;  5J0X A;  2Y0H A;  1MC8 A;  1L3S A;  3U26 A;  3N4M B;  5KFV A;  1SV0 C;  4Z6F A;  2YB1 A;  1S8O A;  5KL1 B;  2OH2 A;  8ICI A;  1Q8K A;  3QU7 A;  8ICK A;  1HXX A;  4GCQ A;  2R8K A;  5T5F A;  2HHU A;  3MDC A;  2XG6 A;  5G5G A;  1MN8 A;  2EH9 A;  5KFP A;  2R88 A;  3BZK A;  1LVH A;  2JEG A;  1S0M A;  3D6J A;  4R65 A;  4M9H A;  1SWV A;  2OYY A;  4CCH A;  2EAP A;  1XNS A;  4UAT A;  4M9L A;  4MHV A;  4YR0 A;  5DG9 A;  5ALZ A;  3OJS A;  5CP2 A;  5AI6 A;  1ZJN A;  2FGR A;  2K4I A;  3SYS A;  3NVZ A;  8ICG A;  1YT3 A;  1DGJ A;  3MGH A;  4QZH A;  1COK A;  5KG5 A;  3NAS A;  3Q8M A;  2YN4 A;  5KTQ A;  4QJF B;  2AH5 A;  5CB1 A;  5ALJ A;  2Y7S A;  3IM1 A;  3WKB A;  2HHT A;  3DEE A;  4DS4 A;  4O3Q A;  1UT8 A;  3DDH A;  3NVW A;  1C7Y A;  4DSF A;  5KFI A;  4C8O A;  1L7P A;  2ZIV B;  1RZT A;  7ICR A;  2H3I A;  3R9K A;  4UB5 A;  1UA0 A;  4DL5 A;  2C22 A;  3VZU X;  3NJT A;  2EZX A;  3HPO A;  9ICL A;  1ZQK A;  1MA7 A;  3PX4 A;  3KTQ A;  2PFQ A;  3A0H O;  3V6K A;  2ZLD A;  4C4R A;  4GCS A;  5DL5 A;  3KZX A;  2KMD A;  1J2N A;  2I5H A;  3PX0 A;  4DL4 A;  2KZ7 A;  4Z6E A;  1PZN A;  3HIL A;  5DDM A;  8ICP A;  4QZF A;  3RJK A;  1IIP A;  3QXG A;  1RPL A;  2FMP A;  3ISB A;  2M06 A;  4B6J A;  2ESE A;  2IWV A;  1EXN A;  3F2D A;  2M0N A;  3K1Z A;  2KV2 A;  2YMP A;  2CN1 A;  3BJY A;  4RLB A;  3GFK B;  2HBK A;  5DBC A;  4O3X B;  5G5H A;  2F1I A;  2YY6 A;  5IIO A;  2YMQ A;  1ZQJ A;  3DWN A;  4KRA A;  2MU2 A;  5JTI A;  3EPG A;  4E0D A;  2XTQ A;  5AM0 A;  4ED2 A;  3QUT A;  5AI5 A;  2E8O A;  2W9C A;  2LI6 A;  2ZUC A;  2AHO B;  1ZQM A;  1RQL A;  1NNL A;  9ICV A;  4ECQ A;  3SZD A;  2EZY A;  2LMR A;  3GV8 B;  1D8B A;  3LK4 1;  8ICZ A;  2W8K A;  4RUC A;  4R63 A;  4RL9 A;  3PQU A;  1PK3 A;  3RJG A;  5AFU L;  3BS5 A;  2G5I B;  4PGQ A;  2OHF A;  1SL1 A;  4BUG A;  3HWT A;  2GLE A;  3IP4 B;  1NJY A;  7ICM A;  3M9M B;  2DWQ A;  1L3T A;  1N5W A;  4PZN A;  2EZZ A;  1JXL A;  3POU A;  3AU2 A;  1NKC A;  2D3D A;  2HBM A;  4GFJ A;  3WK5 A;  3I76 A;  2E8P A;  2XI9 A;  1ZQL A;  5H2F O;  4J03 A;  1SZP A;  2POR A;  3RRG A;  5DGB A;  2WVP A;  5J0O A;  2AGO A;  4Z6D A;  4ECR A;  2BCS A;  2W55 A;  4DSK A;  3RJH A;  4EEK A;  1SV4 A;  3HKZ C;  4DF4 A;  3RAQ A;  4Q8E A;  1WCL A;  2KHQ A;  3AA1 B;  4CF5 A;  1L6N A;  1ZQW A;  9ICT A;  2PMZ C;  3M9O B;  1TFR A;  3LK2 A;  1QCK A;  4J9K A;  4NJ8 A;  1IZN A;  4R8U B;  4ECX A;  3M6K A;  1DK2 A;  2XO7 A;  4KLS A;  4AUI A;  3POQ A;  4QZE A;  4TUQ A;  1NK6 A;  2PFO A;  4I2A A;  2LYA A;  4RUA A;  4FUV A;  2JEI A;  8ICF A;  2Y9U A;  4IQU A;  4LZD A;  3SZ2 A;  1U48 A;  4DSE A;  3EZ5 A;  4ELV A;  1ARO P;  1D9D A;  1ZJM A;  4GXK A;  1KRP A;  1WYG A;  4I2I A;  3OHA A;  2OEH A;  2DQN B;  2WJQ A;  4E1T A;  5GTI U;  4P0Q B;  4ED8 A;  4JV1 A;  4QZC A;  3GV5 B;  1XO1 A;  5HHI A;  4DFJ A;  5KAI O;  5KFH A;  3A0H U;  3CP8 A;  3F2B A;  1XSL A;  1BH3 A;  1N2X A;  3NVY A;  4NLG A;  1N61 A;  4HYK A;  1JMS A;  1K1Q A;  5IIM A;  4AYN A;  2XY6 A;  2DPI A;  5J2H A;  4RQ2 A;  1NK7 A;  5L1I A;  3E2E A;  2HHS A;  4Y2P A;  2HOF A;  3SMV A;  5EWG A;  2WF7 A;  1ZQI A;  2KFZ A;  8ICN A;  4MFF A;  4UB6 O;  4C00 A;  3H8M A;  5PRN A;  5J0S A;  5AHX A;  2VA2 A;  4M6W B;  4FS2 A;  3PML A;  4F5Q A;  3IG5 A;  5DG8 A;  2A1J A;  3FDS A;  2KK0 A;  4YMM A;  5J0P A;  1ZQQ A;  4G75 A;  5KFA A;  7ICU A;  3WKA A;  4FZL A;  4BXO B;  1J2M A;  3HJE A;  3MGV A;  5EE0 A;  1Q9F A;  1T16 A;  3G7G A;  2R4N A;  3H8J A;  5K4L A;  3RTV A;  3FYX A;  4DQP A;  4JFB A;  2JR5 A;  3CRX A;  4D65 A;  5B66 U;  4AKM A;  2HI0 A;  3J81 j;  2EAM A;  2X9K A;  2KDY A;  4F92 B;  4J9M A;  3RB3 A;  1SXE A;  2DGZ A;  3I1Y A;  2R8A A;  1NJZ A;  7ICO A;  4QW8 A;  2Y1I A;  2EQY A;  3KD3 A;  2XGQ A;  4J9S A;  3BS7 A;  4KLJ A;  3AA7 B;  2OMF A;  3PW7 A;  4Y2X A;  3M9N B;  2ZIX B;  1S9F A;  4QWB A;  5KG7 A;  2G0A A;  4OO1 J;  5DG7 A;  3AU6 A;  1X40 A;  2KKP A;  4B9S A;  2FPK A;  4UB2 A;  5AKH A;  3KZI U;  4PL1 A;  2W03 A;  1H38 A;  1V9P A;  4C4S A;  4RNO A;  4P2H A;  7ICF A;  1TVA A;  1BPX A;  2NO5 A;  4KLI A;  1YS5 A;  5KT5 A;  3T24 A;  4YXM A;  3AA1 A;  5G3A A;  4I29 A;  1KFS A;  1TAM A;  2LPE A;  2IBK A;  5DQI A;  5DLG A;  5ALM A;  8ICT A;  5DQG A;  2W80 C;  5J2A A;  5J0R A;  4ED3 A;  4UBB A;  1TK5 A;  3K1R B;  1OXJ A;  4RT2 A;  1SKR A;  5ALK A;  5J0Q A;  5HML A;  2KKV A;  3SR6 A;  1D8L A;  4RQ7 A;  3MDA A;  7ICJ A;  1GFQ A;  2BQ3 A;  1PHO A;  2RLT A;  3MC1 A;  2PXI A;  4KX5 A;  4FZM A;  1QH9 A;  5KFK A;  3VCB A;  3VC8 A;  2W9C B;  4NL9 A;  1BPE A;  1U45 A;  4U9C A;  2AXT O;  3BQ7 A;  3WKE A;  4NLN A;  1MPF A;  9ICR A;  2MUT A;  4KLM A;  5AKK A;  3TAD C;  2XCP A;  5AK3 A;  9ICN A;  4PZO A;  5DL8 A;  4DEZ A;  2P66 A;  8ICA A;  5DDY A;  1P7D A;  4IS7 A;  4LJX A;  4UB8 O;  4Q44 A;  3LWM A;  1QJ9 A;  2F1C X;  3JPT A;  2O6K A;  3NS1 A;  4E1S A;  1N63 A;  2F1H A;  5G38 A;  2ZTD A;  2GE4 A;  3UU2 A;  1L7N A;  2JXJ A;  3JPR A;  4FMS A;  2PI5 A;  4Q43 A;  1JN3 A;  3M6Z A;  4HAI A;  2KJ9 A;  4I2C A;  2ZIU A;  5B5E O;  1Z4N A;  4YP3 A;  2W8L A;  2ATL A;  1GFN A;  2J4U P;  2K4E A;  1D8Y A;  1A77 A;  4F4W A;  5ALG A;  2W81 C;  2N2L A;  4IRD A;  1XC9 A;  3BQT A;  2M07 A;  4LSE A;  1T3Q A;  3PR4 A;  4R8U A;  2K8A A;  3QZ7 A;  4M47 A;  5ALS A;  4QW9 A;  2RQ5 A;  4C4V B;  1JRP A;  2VJ4 A;  3D2S A;  4N75 A;  2R4O A;  3L4P A;  1ZQU A;  2ZG6 A;  2ZIV A;  1LKY A;  3BQ1 A;  4K3C A;  6PRN A;  2LKY A;  9ICK A;  8PRN A;  5AM5 A;  2GWS A;  2CPR A;  4R64 A;  3IRU A;  3PGU A;  4UAV A;  4YMN A;  7ICV A;  1KQQ A;  2LYB A;  2QAR A;  1XSP A;  5IYU A;  2E1E A;  1O08 A;  3ZDE A;  2KVC A;  2F2A B;  4JV0 A;  1ZQT A;  5KFX A;  4KLF A;  3K19 A;  3UPQ A;  2XE3 A;  1IZN B;  3KHG A;  5TIS U;  4UB6 U;  2B0C A;  2K8B B;  1FO4 A;  8ICC A;  3MR2 A;  2AQ4 A;  5BOL A;  2KTQ A;  4EZ6 A;  2HHX A;  5DL7 A;  2DL0 A;  1Y88 A;  3Q8K A;  1XU4 A;  2IOF A;  5ALT A;  3PST A;  2BGW A;  4FBT A;  5AM4 A;  4FOZ A;  5J2D A;  2DF4 B;  4NM1 A;  2KZ3 A;  2QB0 A;  5KFS A;  4J9Q A;  1O03 A;  2R8I A;  2KHV A;  2FI1 A;  2KSO A;  5CA7 A;  5JUM A;  2JZB B;  5ALE A;  1QTM A;  4CRX A;  3SEN A;  4GXI A;  4D64 A;  5J0T A;  4F2S A;  4B61 A;  4OCZ A;  3T5H A;  3AQF A;  4YVZ A;  1Z1B A;  1VLB A;  4TUP A;  2W7O A;  1L8O A;  1TKD A;  1F5S A;  3MBY A;  3M8R A;  2W54 A;  2D6F C;  4C4T A;  5E79 O;  4CNQ A;  7ICP A;  3AEV A;  4B9L A;  4IR9 A;  1UHU A;  4MFC A;  4EYH B;  4F50 A;  4DQI A;  1DRG A;  5AKE A;  4AYB F;  2AU0 A;  2A1A A;  3PW5 A;  9ICW A;  3VE1 A;  4O49 A;  1RM6 C;  3UXP A;  2Q4T A;  2UVU A;  1XS9 D;  4IQV A;  3O0F A;  4XUS A;  3MGI A;  2XTR A;  3AAA B;  1L3U A;  5ALR A;  4Y2V A;  3TFS A;  2KXP B;  5EE3 A;  2ASL A;  2PRN A;  7ICH A;  5E79 U;  2H3Q A;  4QZG A;  3VY8 X;  4RQN A;  2AGQ A;  3QYP A;  4G76 A;  1PK1 A;  2K8C B;  5DB8 A;  3IN5 A;  1JUD A;  4ECU A;  4O5E A;  1KTQ A;  3ICX A;  1BNP A;  3RRH A;  5CJ7 A;  1SWW A;  5AI0 A;  5D5D A;  2HBL A;  3CNH A;  4B9V A;  2OCE A;  2W04 A;  4I2F A;  4FES A;  2VJ5 A;  4ACO A;  3DWO X;  5AK4 A;  4QNL A;  1S5L U;  3WK6 A;  4UB4 A;  3GDX A;  2H5X A;  2Y0S F;  2FLP A;  2ASD A;  3QNM A;  2QLT A;  9ICJ A;  3ZD8 A;  1DGS A;  1Z4O A;  3K4G A;  4Y2T A;  3C28 A;  5ADX L;  2Y9T A;  5KT2 A;  3KHR A;  2HSZ A;  4QZI A;  4ED6 A;  5ALD A;  5HNK A;  2Y0L A;  1VJ5 A;  2YB4 A;  1PVP A;  3NVV A;  3DA4 A;  1ZHW A;  4FT6 A;  2LBO A;  4EZ9 A;  4LVS A;  2XCA A;  4AKR A;  1THQ A;  7ICK A;  1U9L A;  1U47 A;  2ZTC A;  5J0Y A;  1NI3 A;  2ZJA A;  3T20 A;  5KL8 B;  3IV6 A;  3C2L A;  4KIT B;  5EWF A;  4BDP A;  1X66 A;  4M04 A;  2KIV A;  5IIK A;  4O3O A;  3UXO A;  1KW4 A;  3RB6 A;  2WF6 A;  4GC7 A;  3BDP A;  3N7S C;  1N5X A;  2F1V A;  1L7M A;  4N58 A;  2W9B A;  3RR7 A;  1SKW A;  2FPL A;  3AUO A;  3C1Y A;  5EE2 A;  4P4M A;  2BQU A;  4GXJ A;  3UQ2 A;  4I2B A;  3V7J A;  1B43 A;  1B4F A;  3KOO A;  2PFN A;  2WF5 A;  5GV0 A;  5ALO A;  5L1L A;  4RT3 A;  3ZDD A;  5KFL A;  4EX7 A;  5GTI O;  4DSL A;  1ZD2 P;  3LK9 A;  2MHL A;  1L3V A;  3M1Y A;  1Q3U A;  3GQC A;  2XE1 A;  2MSN A;  5EE1 A;  7ICI A;  4RLC A;  5KFG A;  2MA1 A;  2G5H B;  2KNJ A;  1V85 A;  2G08 A;  4I2D A;  4YCX A;  4IQW A;  3V72 A;  1PVQ A;  2F44 A;  1PVR A;  3GV7 B;  1ZOL A;  3ISC A;  1Z19 A;  3UM9 A;  5J29 A;  2LHT A;  5KFW A;  2RRD A;  3F5A A;  1WWV A;  4P4O A;  5DB6 A;  3Q8R B;  1E54 A;  2JRZ A;  3B0X A;  1KBU A;  2Y0S C;  2RDJ A;  5KFQ A;  3ETR A;  4F91 B;  4DFK A;  2DFL A;  1OPF A;  1D9F A;  3QUC A;  4PGY A;  5HR6 A;  1BT9 A;  3HX0 A;  5AM3 A;  2ZUD A;  5KFF A;  2CRX A;  4DF8 A;  2KE7 A;  1JXE A;  1V38 A;  3H8W A;  3MR3 A;  1CI4 A;  4UAW A;  3WK7 A;  4ECW A;  1T8E A;  4I2G A;  4DWI A;  5KFY A;  8ICJ A;  5KFT A;  5AKL A;  3SYZ A;  2DKZ A;  3AA7 A;  3N97 B;  1Q9G A;  3PR5 B;  8ICX A;  2NV3 A;  4PHA A;  2K89 A;  2MAX A;  5JU5 A;  2ZIX A;  1RXV A;  3V8U A;  1ZHY A;  4F4Z A;  2R89 A;  4RQ1 A;  1Q3V A;  2HVH A;  2VAN A;  1TAQ A;  5AK6 A;  4QZ8 A;  1JX4 A;  2ZXH A;  3GII A;  3JPP A;  1RXW A;  1SV0 A;  4M0A A;  2KFN A;  3NSG A;  2LFU A;  4YD1 A;  1F0M A;  4G3I A;  3WKD A;  2XIC A;  4RU9 A;  2UVV A;  4YMO A;  3KFU F;  2BPC A;  1MQ2 A;  5ALU A;  4PUX A;  5DB9 A;  2BPG A;  2OXO A;  5EE9 A;  2B6G A;  2WTF A;  5BPC A;  4YR2 A;  1HXT A;  2N2M A;  5EWE A;  2KXP A;  2N1R A;  1GFO A;  3TAC B;  2F3N A;  2IA6 A;  3EW9 A;  2JZB A;  2H3F A;  2ZUB A;  4O3W A;  2A1J B;  7ICG A;  4BUM X;  3G6X A;  1JAL A;  5KFZ A;  1BPB A;  3PX6 A;  3QRC A;  1TE2 A;  4BXO A;  1IV8 A;  1BPZ A;  2MUT B;  1SL2 A;  3Q8Q B;  2F8K A;  4P0P B;  4YQW A;  4GLX A;  9ICQ A;  4IC9 A;  1Z1V A;  3H4B A;  1T4G A;  1ZRM A;  1MM4 A;  3DZM A;  5ALX A;  4Y2U A;  4UAU A;  3QUB A;  2HOQ A;  2XVT A;  3SY9 A;  4PJ0 O;  5KG6 A;  2ZTE A;  3JTY A;  4FBU A;  2KZZ A;  1NK4 A;  3WK4 A;  4EX6 A;  2P35 A;  3C1Z A;  2K4P A;  3GU3 A;  2RHF A;  3G6V A;  2DPJ A;  4U7C A;  1HUZ A;  4KLO A;  3PO5 A;  1FFU A;  3EPI A;  4QIW F;  4M9N A;  2LHF A;  4NLC A;  4DL2 A;  4F71 A;  1V97 A;  1N60 A;  4UB3 A;  3SV3 A;  3JCU O;  3RH6 A;  4AYB C;  1K1S A;  2FE9 A;  3PSI A;  5BOM A;  3F2C A;  3A0B U;  3GIK A;  5DLF A;  1ZQX A;  1IM4 A;  4QQ1 A;  3A2S X;  1LB2 B;  3JPQ A;  4KR8 A;  2ZJ8 A;  4DO9 A;  2BKE A;  5ALN A;  4NM2 A;  4CE6 A;  2DKX A;  2GH1 A;  4XRH A;  5KFN A;  4RQ0 A;  1X9S A;  1RYS A;  2FLL A;  3NTU A;  4RPZ A;  5ADX K;  3GIL A;  1HEK A;  5KFO A;  1P4T A;  1RYU A;  3E58 A;  3G6Y A;  4KLE A;  3ED5 A;  3NRZ A;  4KMU A;  2GOL A;  2M9N A;  3B0Y A;  4RNM A;  3LK2 B;  1ED1 A;  1QQ6 A;  1ZD5 A;  4O3P A;  3KHH A;  4KLU A;  4FZN A;  2H3Z A;  5L1M A;  4QWA A;  1ZQY A;  4F93 B;  4LSI A;  1LV5 A;  3PO4 A;  4CGZ A;  3SY7 A;  5L1K A;  4NL9 C;  4TUR A;  4RPY A;  5AKJ A;  2E1F A;  9ICP A;  4G9B A;  3VY9 X;  3ZD9 A;  2K0L A;  5AKY A;  2J6T A;  5DGA A;  5ALL A;  4YN4 A;  3M8S A;  5IIL A;  2JV3 A;  5KT6 A;  1SB3 C;  3C29 A;  4RQ6 A;  3SZV A;  5KNI A;  9ICM A;  4ECZ A;  1OSM A;  5CRX A;  1IXR A;  1KN5 A;  1ZQN A;  3KHL A;  1QJ8 A;  1TV9 A;  2JMM A;  5KFE A;  1S5L O;  4C8M A;  5CEH A;  4F3O A;  2BDP A;  3V7L A;  3DA3 A;  2AGP A;  2YTU A;  4Y2Y A;  2YPV A;  4C7Z A;  4LZG A;  2O4V A;  4NY8 A;  1B22 A;  8ICM A;  1FEZ A;  2DUY A;  2L5Y A;  4QZD A;  2KN7 A;  3LVV A;  1KL9 A;  3QU2 A;  2QKQ A;  1UPH A;  2JH7 A;  1MM5 A;  3RJJ A;  4UQG A;  1ZHZ A;  2G06 A;  2Y2X A;  2IOF K;  4R66 A;  2BPF A;  4ECY A;  3AA6 A; 
#chains in the Genus database with same CATH homology
 2ZIU B;  3VE1 A;  4O49 A;  3H0M B;  5A0L A;  3D2Q A;  2Q4T A;  3SZD A;  1D8B A;  2XTR A;  3O0F A;  3AAA B;  3LK4 1;  2KXP B;  3LK3 A;  3NUQ A;  2PRN A;  1ORM A;  4RL9 A;  5T14 A;  3PQU A;  3PQS A;  3LVW A;  3AA0 B;  2H3Q A;  5AFU L;  3VY8 X;  2G5I B;  4LSH A;  1ZHT A;  1A0P A;  2K4H A;  4BUG A;  4G76 A;  2K8C B;  3IP4 B;  3IN5 A;  2K4T A;  2WAQ F;  1URJ A;  3ICX A;  3AL0 B;  4AFK A;  3H0L B;  5AFU K;  5D5D A;  3POU A;  1A6S A;  3SAG A;  2HBM A;  2HBL A;  4GFJ A;  2WB1 F;  4P0P A;  2XI9 A;  2W04 A;  2WB1 C;  4FES A;  4RJW A;  3WI4 A;  2VJ5 A;  4ACO A;  4FRT A;  4QNL A;  2POR A;  4O3Z A;  3SAH A;  3WI5 A;  2Y0S F;  5DL6 A;  4C0Z A;  2XE2 A;  3HKZ F;  3HKZ C;  5ADX L;  3C28 A;  3RFA A;  2KHQ A;  3AA1 B;  1L6N A;  2Y0L A;  2PMZ C;  2HBJ A;  3LK2 A;  2YB4 A;  1PVP A;  3DA4 A;  2JMG A;  3M7D A;  1IZN A;  1ZHW A;  4FT6 A;  3M6K A;  2LBO A;  2ZFG A;  3GP6 A;  5C0Y A;  4AKR A;  1THQ A;  4AUI A;  2HOI A;  3POQ A;  3T20 A;  2ODJ A;  4P0Q A;  2LYA A;  5KL8 B;  4FUV A;  4BX9 C;  3C5O A;  1CRX A;  4AYD C;  3N7P D;  1PRN A;  4AKR B;  4KR4 A;  3HWB A;  3N7S C;  3KVD D;  2VKQ A;  2F1V A;  2DQN B;  3VE2 A;  4E1T A;  2KEY A;  4N58 A;  4P0Q B;  2ZIW A;  3GZF A;  3PZP A;  3CYM A;  2MNH A;  5EE2 A;  2KIW A;  3NRW A;  3CP8 A;  3F2B A;  3AAE A;  4KX3 A;  1BH3 A;  4Z3T A;  3F53 A;  3POR A;  5GV0 A;  4AYN A;  1BXW A;  4XNL A;  3LK3 B;  2MHL A;  1GFP A;  1Q3U A;  5G26 A;  2HOF A;  2XE1 A;  3SMV A;  3AAE B;  4RLC A;  3H0R B;  2MA1 A;  2G5H B;  2KNJ A;  3PSP A;  2G08 A;  3HOL A;  1PVQ A;  3IG8 A;  1HXU A;  2YNK A;  4OJL A;  1PVR A;  1Z19 A;  5PRN A;  2JHD A;  2Z7J A;  2LHT A;  1ZQ1 C;  2RRD A;  3F5A A;  3IG5 A;  1WUD A;  2KD1 A;  2MRL A;  1E54 A;  1KBU A;  2VIX A;  2Y0S C;  4G75 A;  1NZB A;  1OPF A;  3AA6 A;  2J1N A;  4FZL A;  4F4B A;  3MGV A;  4FSP A;  1Q9F A;  5HR6 A;  1BT9 A;  3G7G A;  3FYX A;  4JFB A;  2RP5 A;  3CRX A;  4D65 A;  2CRX A;  4AKM A;  3OPX A;  1G90 A;  4GHB A;  4ICA A;  4PL2 A;  3AA7 A;  2G09 A;  2HMX A;  2KDY A;  3QRA A;  4AZL A;  1Q9G A;  4N59 A;  2JGA A;  2XID A;  2NV3 A;  3E0F A;  2K89 A;  2DGZ A;  2ZIX A;  4AYM C;  2ERV A;  3V8U A;  1ZHY A;  4OJP A;  2PMZ F;  1Q3V A;  2F8L A;  2ZXH A;  3AA7 B;  2OMF A;  4D5U A;  3SQI A;  3NSG A;  4GCP A;  2LFU A;  2ZIX B;  3L3F X;  4U6P A;  2Y0K A;  2G0A A;  4OO1 J;  2XIC A;  3AQE A;  1QJP A;  1ECW A;  2KKP A;  3HOE A;  3KFU F;  4FSO A;  3EMN X;  3T0S A;  4PUX A;  4PL1 A;  3O0E A;  2W03 A;  1OUQ A;  2OXO A;  5FVN A;  5JDP A;  4WJ3 B;  2R18 A;  3PSF A;  1HXT A;  3AAA A;  3SYB A;  2N2M A;  4O4X A;  1YS5 A;  2N1R A;  3ALR A;  1F44 A;  1GFO A;  2KXP A;  2XE5 A;  3T24 A;  3AA1 A;  1H6S 1;  2FGQ X;  2H3F A;  4O3W A;  1TAM A;  4BUM X;  1GO3 F;  2W80 C;  4A8E A;  4NLB A;  3HW9 A;  7PRN A;  3LYS A;  2F77 X;  4JCH A;  4BJQ A;  3VZW X;  4CDG A;  3QRC A;  4XNK A;  2KKV A;  3UPG A;  1GFQ A;  4GF4 A;  1PHO A;  1T94 A;  4P0P B;  4KX5 A;  4IC9 A;  2XMX A;  3N7R C;  4NV0 A;  4FZM A;  2YX8 A;  3RF9 A;  3VCB A;  2KOB A;  1MM4 A;  3VC8 A;  2H3V A;  2BDU A;  3PRN A;  4U9C A;  2HOQ A;  4LSF A;  4FE3 A;  1HIW A;  2XVT A;  1MPF A;  3SY9 A;  2OM6 A;  2A3V A;  5DL8 A;  2KIC A;  2ZXI A;  1P7D A;  3JTY A;  1QJ9 A;  4O3Y A;  3GU3 A;  2RHF A;  3RBH A;  4U7C A;  2Y0H A;  4JMU A;  4E1S A;  4QIW F;  2LHF A;  2KJ5 A;  4NLC A;  3UAQ A;  4QIW C;  2GE4 A;  3UU2 A;  4C69 X;  2YB1 A;  4FMS A;  5KL1 B;  2OH2 A;  4KMO B;  4AYB C;  4RJX A;  1HXX A;  3M6Z A;  3PSI A;  2KJ9 A;  4GCQ A;  2ZIU A;  3F2C A;  5T5F A;  1GFM A;  1GFN A;  2KC0 A;  4QQ1 A;  3A2S X;  2XG6 A;  2J4U P;  2K4E A;  5HR7 A;  4KR8 A;  2GH1 A;  2W81 C;  1ZHX A;  2N2L A;  4O3M A;  2M07 A;  3AA6 B;  2OYY A;  4LSE A;  2K8A A;  1XNS A;  2G07 A;  5ADX K;  3F5E A;  1HEK A;  2FGR A;  2K4I A;  3SYS A;  1YT3 A;  1P4T A;  2VJ4 A;  4OJO A;  3D2S A;  3AA0 A;  2ZG6 A;  2GOL A;  2ZIV A;  6PRN A;  3LK2 B;  1ED1 A;  4QJF B;  2LKY A;  3VZT X;  8PRN A;  2Y7S A;  4FZN A;  2H3Z A;  3DEE A;  2CPR A;  4LSI A;  2WAQ C;  2W7P A;  4AYE C;  4CGZ A;  3SY7 A;  2LYB A;  5IYU A;  2E1E A;  2E1F A;  4OJ6 A;  1SZH A;  2KVC A;  2F2A B;  2ZIV B;  2H3I A;  3VZU X;  3VY9 X;  3K19 A;  2XE3 A;  1IZN B;  2K0L A;  1XO0 A;  3ONN A;  1MA7 A;  2K8B B;  3C29 A;  3SZV A;  5DL7 A;  2ZLD A;  2F1T A;  1OSM A;  5CRX A;  4GCS A;  5DL5 A;  3KZX A;  3PST A;  1QJ8 A;  2JMM A;  2KZ7 A;  4FOZ A;  1IIP A;  2DF4 B;  4AYI D;  2F76 X;  2JH1 A;  2M06 A;  3TZG A;  3DA3 A;  2X27 X;  2KHV A;  3F2D A;  2M0N A;  2YPV A;  4FRX A;  4NWI A;  2ZIW B;  3K1Z A;  3POX A;  4CRX A;  2KV2 A;  2O4V A;  4D64 A;  2KZ7 B;  2CN1 A;  4B61 A;  4RLB A;  4O4U A;  2KJ8 A;  2HBK A;  4O3X B;  3AQF A;  1Z1B A;  2E5S A;  2W7O A;  3LVV A;  3D2N A;  2QTK A;  3T79 A;  3LK4 2;  4KRA A;  2D6F C;  1UPH A;  2JH7 A;  1MM5 A;  3SAF A;  2XTQ A;  1ZHZ A;  2G06 A;  2Y2X A;  4OJ5 A;  1DRG A;  4AYB F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...