4FZLA

High resolution structure of truncated bacteriocin syringacin m from pseudomonas syringae pv. tomato dc3000
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
239
structure length
239
Chain Sequence
GMQNPVATVLLLQGDLYCSPNCLATFQDQARRDSFGIQSKVALKTFAAADQREAEGRDLRTAYNEIATDIGRSQQINENIIKYPPGNHVLSGGLMTPFHALAHGMFGLGAPLTFPIQNVGLNVDIRGIPDVMNVIQSARPVGTSSLDVNFAYDVGKDSNASWLTLGNITLRLVGTIDKNASGAWTFSGEIRAFNDVYDANPSNHRGWLGENLTSLLSAVPFTSYSIEIPGSLPVTVSGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacteriocin
publication title The Crystal Structure of the Lipid II-degrading Bacteriocin Syringacin M Suggests Unexpected Evolutionary Relationships between Colicin M-like Bacteriocins.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Antimicrobial protein
total genus 73
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.790 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4fzlA01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4fzlA02
4N58A 4FZLA 2XTQA 4G76A 2XMXA 3DA3A 3DA4A 4G75A 2XTRA 4N59A 4FZMA 4FZNA
chains in the Genus database with same CATH superfamily
3WU2O 2ATLA 4ECRA 4DFPA 3KFUF 1MSWD 2R8KA 1ZQOA 2HI0A 1HXXA 3UMCA 5TISU 5DQHA 1NK4A 5B66O 5KFNA 3Q8SB 3K75D 3D2NA 5JRTA 2W81C 5E79O 2IA6A 3JPNA 3PX6A 2K4HA 3OTQA 2Y1JA 1J2MA 1TVAA 2ZXIA 1HUZA 2FI1A 1TK0A 2IOFK 5AM1A 2W9BB 1JXLA 3ALRA 2QLTA 2MUTA 2W9BA 3QUQA 2AGOA 4F5QA 5GTIO 2DF4B 4QIWC 5DLGA 2XY5A 1XNSA 4YFKA 4BWMA 2GO7A 2OHFA 1XO0A 4Z6FA 3GP6A 5IIOA 4QIWF 4YXJA 4ECZA 3AA1B 3GQCA 3GFKB 4F4XA 5KFIA 4WJ3B 3PMNA 1TV9A 3IG8A 3PGSA 3AA1A 1ED1A 4J9NA 1CRXA 2XCPA 2F1VA 4AYEC 2KD1A 1ZJMA 2AU0A 1U4BA 2OCEA 4AKRA 1KN5A 5AIBA 8ICBA 3QNMA 2F8LA 5G3AA 1ZQSA 1OPFA 3GIKA 3PO4A 3H8WA 2WF8A 2HBJA 3IP4B 4ELVA 1GFPA 4NLCA 4EZ6A 2XTRA 4LSIA 2KFZA 4PJ0U 5ALOA 1Z4NA 1OSMA 5KAFO 2BPCA 4UB6O 1J2NA 2R4NA 1N62A 4I2IA 2W7PA 9ICMA 2HW3A 2DQNB 5J8YA 4MFFA 4MEXA 3BZKA 2AQ0A 1BPEA 1M6YA 3G7GA 2MHLA 5ALTA 3AAEB 3WKAA 5DB8A 3AU6A 4AYBC 4O3RA 1YZ6A 4DQIA 7ICUA 3AAEA 4LZGA 3SMVA 2JGAA 4FBTA 1XSLA 2NV3A 2E8PA 1KFTA 1E54A 3T20A 2ES6A 1RXVA 3IV6A 4O3WA 4ELTA 3UQ2A 4Z6CA 4AZLA 3PW5A 4M9JA 4GLXA 2PFPA 1ZQ1C 1HJPA 4RQMA 4C4RA 5HR7A 5KG3A 2NRVA 2ZUBA 4KX5A 3BS5B 4RQ3A 1URJA 3PF1A 5J0PA 1XO1A 3BS5A 4KLLA 2W54A 4RUAA 3A0BU 5IILA 1T94A 1UT8A 3V8UA 2YN4A 4C8MA 4G76A 4DSLA 1N2XA 4Y2VA 4J9LA 2E8OA 3SD7A 5BOLA 2JH1A 3H7IA 2KTQA 5J8YC 4KN7A 1OXJA 4NXZA 2JR5A 1V85A 1DGSA 4RQ2A 2HOQA 1BNOA 5DLFA 2E1EA 3RR7A 4F5RA 2F77X 2XE5A 4ACOA 4OD0A 5PRNA 4M0AA 3HRDD 1Z1VA 3OHBA 4X5VA 2BCRA 4KLSA 2AXTO 1GO3F 4DO9A 1QSYA 1L7NA 2HBLA 3SQIA 3LK2B 3M9NB 4HAIA 2H3FA 3LK2A 1D9FA 2JH7A 4QZAA 3PW4A 4KRAA 1RQNA 1JALA 5J2KA 2W11A 2KXPA 4C4VB 2F1CX 5KFXA 3OHAA 3UXPA 1Q3UA 4US9A 4I27A 4C4VA 3CW2C 3JPTA 4P4PA 4AYDC 4YP3A 3BS7A 4YD1A 4AUIA 1B4FA 1ZQGA 4U7CA 4KLOA 1NK0A 5J2EA 3M8RA 3VE2A 2JXJA 2F44A 2OM6A 4I2GA 5KT4A 7ICIA 4TUPA 1HUOA 5AIAA 1ZYQA 3RJIA 3PSTA 3PSFA 2VJ4A 4MFCA 5DG8A 3NVZA 4GF4A 1ZQEA 2DPIA 4PHDA 3RH4A 4N58A 1S9FA 5ALWA 2N2MA 1BPZA 5AFUL 3LK41 2BR0A 2QKQA 2K89A 3ED5A 4CRXA 4J9QA 5ADXK 2A19A 3MBYA 2FLLA 4FESA 5D5DA 3HT3A 1N5XA 1D8YA 2KFNA 9ICPA 1NJZA 4UQGA 5HR6A 3MDAA 5J2HA 5KFMA 3GV8B 4J9PA 3PR4A 2HVHA 4JUZA 3BZCA 3AU2A 4DSFA 3JPPA 2Y0SC 2NRWA 3NRWA 2BPFA 4ELUA 1L3VA 4UATA 3PNCA 5HHHA 1D8BA 2W9CB 9ICGA 1P4TA 2ASDA 2G08A 2Y0SF 3F53A 5AM0A 1NKEA 2WJRA 3S6JA 2W9CA 4JV0A 3GU3A 2YMPA 4NM1A 2F1HA 5ALQA 1RYRA 8ICTA 4R8UB 3TADA 1ZRNA 4PR7A 3WK4A 5ALFA 1SXDA 3MDCA 4DOBA 1UCVA 1RG6A 2BCQA 4US8A 5ALGA 5ALZA 1S5LU 1U49A 3IG5A 2ODJA 3BQ1A 2KG5A 5H2FU 4XUSA 5KFJA 2BDPA 1ZQNA 1Q8KA 1JX4A 4XA5A 1ECWA 2V4RA 2PRNA 1JUDA 5KG5A 1ZQYA 2HHXA 5KFHA 5D49A 3C2LA 4OJLA 1L6NA 1BNPA 3POQA 1ZHTA 1L7PA 5CJ7A 9ICLA 8ICFA 4BXOA 3GV7B 2WTFA 4FSOA 4YQWA 4YD2A 3TANA 2B6GA 4USAA 5EE0A 2ISPA 3GIIA 3T5LA 3UU2A 5KFUA 4GXJA 4KLTA 5AK4A 3T5JA 1ZQJA 4FO6A 3DDHA 2PFQA 1ZOLA 2N1RA 4UW9A 5ALSA 4QZ9A 5ALDA 3PQUA 4UB1A 5C0YA 1KFDA 4BUMX 2PKEA 3OSPA 3RB0A 2UVRA 3DZMA 4Y2QA 3RB6A 4DQRA 4MF2A 3PSPA 1S97A 4RJWA 2XICA 2ALZA 2E5SA 2HHQA 1K5OA 4G9BA 2XTQA 3GZFA 3QE9Y 3OPXA 4B9UA 3ZDAA 8ICLA 2LI6A 4NLBA 2KIVA 2VA2A 4MFAA 3SAFA 1ZQHA 6PRNA 4M04A 4ECUA 3CP8A 3IDWA 4C8NA 4KLUA 4XNKA 2KNJA 4O0IA 3H4DA 4J9KA 2XY6A 2BGWA 3C2KA 3QX7A 4GC7A 4RQ8A 3JTYA 3N7RC 4F5PA 3LYSA 2LYBA 3WK8A 3JCUO 4FRTA 5AKHA 5AI8A 3JPRA 8ICXA 1MPFA 1A76A 1DGJA 2H5XA 5ADXL 9ICSA 3DWOX 4NL9C 3UPGA 3L4PA 1PK1B 4Q43A 1UA1A 4F3OA 4TURA 3BQ0A 3A0HU 4UB8O 2ZIWB 2JQYA 5CP2A 4F50A 3A2SX 2ZIWA 2RRDA 5J0UA 3PGUA 3VZTX 3F5AA 5J2BA 4P2HA 3D6JA 4ECVA 5KFOA 3D2SA 1F44A 2KEYA 1QLNA 5DBAA 4ED1A 1X6IA 9ICQA 2R8AA 2JV3A 1NJWA 4KLHA 5IINA 1BVSA 4UB4A 2LHTA 3IM1A 1CUKA 4NM2A 2HHWA 5AKGA 5KFFA 2JMMA 5FP0A 3SAHA 2KK0A 4UARA 2H3QA 4RNOA 2Q0ZX 5GTHO 1ZQRA 4KITB 5KT5A 2YPVA 4CGZA 1YS5A 5KFTA 5KG7A 2NRZA 2OYYA 3ZI4A 3ORYA 1L7MA 4HYKA 2W43A 1RYUA 3PR5B 2FMQA 1FFVA 5J2CA 2Y1IA 4OO1J 1BPDA 4EZ9A 5ALPA 1IZNB 4ED3A 1NJYA 2HHTA 9ICBA 3M7DA 2B0CA 1U9LA 3TARA 3EWAA 1IZNA 2GE4A 3PZPA 2OMFA 4RQ1A 1L5UA 2ISOA 2RDJA 5EE9A 4J9SA 1L3SA 3QUCA 2KZZA 2WFAA 3KD3A 4F8RA 1F0MA 5DG7A 1QJ9A 5AKKA 2FPKA 1QTMA 5AM2A 4RPZA 1F5SA 2G5IB 4ECTA 3UPQA 1S77D 3RF9A 3LK42 3SYBA 1WYGA 2G07A 1A6SA 8ICNA 2YY6A 2AQ4A 1N5WA 3SZ2A 5T5FA 3T3FA 4IRKA 5AI6A 2DUYA 1N61A 4DFJA 2J6TA 2ZJ8A 5J29A 4YR3A 1X9SA 4FQEA 2OEHA 2R4OA 2K4TA 4BX9C 4QWCA 1N63A 3HX0A 2AGQA 2KVCA 9ICWA 4KMOB 2BDUA 4A8EA 1X9MA 2MAXA 3HILA 4FZMA 1L8LA 9ICJA 3EPGA 4O9MA 1IM4A 1ZQZA 3SV3A 4K4HA 3C5OA 2I6XA 3E58A 4ZOHC 5AI0A 5HHIA 3PSIA 3NVWA 1BT9A 4QZHA 3ZDBA 1S8OA 5G26A 2YMQA 4DL6A 5KFPA 4Z6DA 2XY7A 4I2AA 3SZVA 5L1KA 3KZIO 1XSPA 5KFBA 1FFUA 2PI4A 1T1LA 4P4OA 4UAVA 3WKEA 3RTVA 4Q45A 4Z3TA 2FJ6A 1WUDA 1NI3A 3I28A 8ICHA 1KDHA 4KLGA 9ICNA 3AMZA 4ECXA 3RJFA 2AHOB 2EAOA 4NY8A 3MFIA 9ICVA 4Y2XA 4M9LA 2R89A 1UHUA 5J0TA 4Q44A 3NVVA 3ZD8A 1U47A 3G6XA 5KFLA 4PGYA 1ZQQA 1XWLA 3AA6B 2DGZA 1D9DA 4IL6U 5TISO 5G39A 2OH2A 3AA6A 4Y2UA 1SKWA 5DB7A 2H3ZA 4J9OA 7ICMA 8ICSA 8ICWA 2W04A 4RPXA 2ZLDA 5KFSA 1U45A 3V6HA 4J03A 5DG9A 1L8OA 4DFMA 2ERVA 5DL8A 2NO5A 4C7ZA 3QUBA 4PHPA 1B22A 5B5EU 1L3UA 1RYSA 4DSKA 4JMUA 3LK9A 2XGQA 3WK9A 3HWBA 1ZQUA 2PFOA 3C28A 3C23A 2WJQA 4PL1A 5DB6A 1IG6A 3TQ1A 4QWBA 8ICKA 4FFDA 3NS1A 2XE2A 1DOQA 5KFCA 4LSEA 1HXUA 7ICHA 2AJQA 2YMMA 1TK8A 4EBCA 3UXNA 4GHBA 3ICXA 3QRAA 4E1SA 4QZGA 3PX0A 4GXIA 2NO4A 2I9GA 4B61A 4LSHA 4KX3A 3GDXA 3QU7A 4PJ0O 1RPLA 2HMXA 2L5YA 3ZDCA 1L7OA 3TKAA 1AROP 4R65A 2HBKA 7ICTA 2KDYA 4JFBA 1KSPA 3WI5A 1QQ7A 1N60A 2LM1A 8ICZA 3PX4A 5AKLA 3FAHA 2VIXA 5A0LA 1PK3A 3CRXA 4MF8A 2LHFA 2K60A 2G5HB 4F72A 3SEIA 2KZMA 2LFUA 4KR4A 2QARB 4O5KA 4AYMC 2BCSA 5KAIU 2VA8A 2QARA 9ICHA 3LDAA 1FO4A 2O4VA 4DWIA 2EZYA 3H0RB 1LKYB 4DLEA 4R64A 3RAXA 3SYSA 2KKPA 5BOMA 4YXMA 5IIJA 3AA0B 2KE7A 4NV0A 5ALYA 4I2JA 8ICYA 9ICIA 3EW9A 3CNHA 3F5EA 1Z19A 3AA0A 3RH5A 1GFNA 2XC9A 2Z7JA 4DOAA 1C20A 3UMGA 4F91B 5KG6A 1JXEA 4PZNA 4KLEA 5ALRA 2WVPA 4RJXA 5G5GA 3C2MA 1G90A 3SR6A 5ALIA 1A0PA 2C22A 4B9VA 1CI4A 3A0BO 5KG4A 3V72A 3PVXA 2M06A 2DWQA 2ZIUB 5KL8B 4NLGA 1MQ2A 2ZIUA 3LWMA 5KG0A 3KOOA 4O3QA 1Q9FA 3NGDA 3RJJA 1RDFA 4ZH4A 2V4QA 3MR6A 1ZJNA 4K3BA 2M0NA 3BQTA 1BGXT 4Y2JA 4OJPA 1N48A 4O3ZA 3OJUA 3O0FA 3PV8A 2FPLA 3GIMA 5GV0A 1RQLA 3PW2A 5CRXA 1TAMA 1S0MA 2KVSA 4F4YA 4O4UA 2IWVA 3H4BA 1KBUA 5DBBA 2RDIA 4UASA 2LPEA 1N56A 1XC9A 2DFLA 3MABA 4D5UA 2D8CA 1WCNA 2BQ3A 4ECSA 1GFOA 4U9CA 1FEZA 4PH5A 4AYNA 4F2SA 3HW9A 1SWVA 7ICNA 3LK3B 5AKYA 1Z1BA 2Y2XA 3T5KA 1T7PA 2E8NA 3MFHA 3LK3A 2G06A 4MEYA 2D3DA 2ZG6A 3C21A 5ALKA 4K3CA 4ED8A 4R8UA 4M9GA 3SYZA 2ODGA 4K4IA 2J1NA 2ZJAA 2H3IA 3C29A 5ALXA 4F5OA 3PRNA 4RQ7A 5IIIA 5J0WA 4RNMA 3QEAZ 1H6S1 2KIWA 5DL7A 1HEKA 4ECQA 2BCUA 4Y2YA 5AI4A 2KICA 4CTDA 2Q4TA 1COOA 5AK3A 5EE3A 2W9AA 1VLBA 5AM3A 1KL9A 3TI0A 3MC1A 4JV2A 2I5HA 3B0XA 2W9MA 4PZOA 4TUQA 1X6JA 5ALHA 3AN1A 4LVSA 2K0LA 1UPHA 4RT2A 4ED7A 3MR3A 3C1YA 7ICLA 2EAMA 1WCLA 9ICUA 1Z00B 2P35A 5J2GA 1D8LA 2HVIA 4UAUA 1Z00A 2ASLA 3BRZA 4DL3A 3POUA 3TFRA 1MA7A 2WF7A 1VDVA 3TADC 1PVPA 1UA0A 1T3NA 5F9NA 5HNKA 5J0RA 4FBUA 2FGRA 2R8HA 4B9SA 9ICXA 2QB0B 5KT2A 3BS0A 2G0AA 3DEEA 4Q8FA 5IIKA 1OW5A 5KFAA 1SKSA 1ZQIA 1SGGA 2FLNA 5KFDA 3SY9A 5J2JA 5KFKA 4EENA 3NVYA 1S5LO 5F3XB 3M6ZA 5AHXA 4YMNA 3T5HA 5H2FO 5CEHA 3MGVA 2K8AA 3JPOA 4RQ5A 1JMSA 4UBBA 1SL1A 3BDPA 1HXTA 2KJ9A 5L9XA 3AM9A 4YR2A 1ZQCA 2XG6A 3SAGA 3RH6A 2WF5A 4IRDA 2KN7A 3VC8A 1KW4A 1X9WA 3AUOA 1PZNA 1XSNA 5J0XA 4PGXA 1TKDA 2DL0A 2R4PA 2VKQA 3F2CA 2K4EA 3RRHA 2MU2A 5HP4A 1ZQTA 1DRGA 2XMXA 4CDGA 4UB2A 2R8GA 3ETLA 5J2DA 1WWVA 4RZRA 2JEGA 2W8KA 3KKAA 4DL7A 1PK1A 9ICTA 4C0ZA 4U6PA 3V7LA 4DS5A 2GWSA 4B9MA 3NUQA 1B0XA 1TAQA 4C4TA 3ISBA 2OXOA 3ISCA 4KLMA 4FT6A 5L1MA 2YNKA 3M8SA 5L1JA 2CXYA 1PRNA 1SV0A 2YX8A 4RNNA 2ZIXB 3NJTA 2FE9A 4DQQA 2C2DA 2AGPA 2UVVA 4CNQA 3HP6A 4G3IA 3SI8A 5DDYA 4AYID 4JV1A 3WKBA 3KHHA 4PHAA 4ICAA 4TUSA 4IQVA 4YMMA 5IIMA 3QU4A 1NJXA 3UMBA 1S0VA 2HCFA 2WF9A 4NLKA 1YZ7A 1JRPA 5KFGA 1NK9A 4FZNA 4AFKA 2XE3A 5JU5A 3V6KA 1ZXIA 2KJ8A 4Y2PA 8ICIA 3WU2U 2FPMA 7ICPA 3WK5A 1ZQAA 1ZQWA 4O3YA 4DL4A 1MM5A 4UB3A 3KKAC 9ICCA 5B66U 3AA7B 5E79U 4CF3A 2LMRA 2W3RA 4BJQA 3GV5B 3N7SC 3AA7A 1ZQXA 3G6YA 3A0HO 8ICUA 4LJXA 1ZHYA 5CHGA 4F5NA 3EUB2 2ZIVB 3VY8X 4DLGA 4QW8A 2ZUDA 2ZIVA 2FLPA 5GTIU 5KT7A 4M9HA 4Z6EA 3KVDD 5CWRA 2ZTCA 5AI5A 2HBMA 2BQRA 1ZQLA 3WKCA 4NLNA 4O3NA 4DQSA 3NRZA 3RJKA 1FIQA 2F1IA 4RLBA 5JTIA 2G09A 4YVZA 2MNHA 2DKXA 3RB4A 4FS1A 4QZEA 5J0YA 2YB1A 2IMWP 3QU5A 2IHMA 2E8MA 2X9KA 3T24A 3H40A 4DSJA 2XO7A 1RM6C 2HSZA 2JMGA 2K8BB 3NTUA 3E0FA 5EWEA 2LYAA 5AKIA 3K4GA 4GCQA 3ISDA 5HMMA 2BZFA 4F93B 2GH1A 2XVTA 4DFDA 5CB1A 3BQ2A 4O5CA 3M6KA 4AP9A 4OJ5A 1KFSA 3RRGA 2BQUA 2BCVA 3B9JA 2R88A 5KAFU 7ICQA 1GFQA 1SIJA 4QNLA 4FZLA 4UB6U 2C2RA 2WAQC 3FDSA 1BH3A 8ICJA 1GFMA 4JCHA 4R63A 5EWFA 2WAQF 1QJPA 3VCBA 2NRTA 8ICPA 4NJ8A 5DQIA 5TZVA 1RXWA 3WI4A 3M9MB 1NK8A 4FSPA 1AQ6A 1ZQDA 1QJ8A 1ORMA 1X2IA 2Y9TA 5DBCA 2MUTB 1XU4A 3AQFA 3PY8A 5AK5A 3BRYA 3DA4A 2RQ5A 1THQA 2W80C 1ZQPA 2YTUA 3MGHA 4N74A 4OJ6A 3Q8KA 4UAYA 2DKZA 4I2DA 4I2CA 5J0OA 3K1RB 3RBDA 3HOEA 3JPSA 3M1YA 9ICOA 1NK5A 1UQVA 4DOCA 4I2HA 4F2RA 1L3TA 4ECYA 4DSEA 4KLFA 4C8LA 3ZDDA 4FE3A 4RUCA 4AKRB 4DS4A 2Y7SA 2ZJ5A 5L1IA 5DL6A 4KLIA 4C00A 5AFUK 4YG2A 2XE1A 1QSLA 7ICOA 1ZRMA 3V7KA 5G5HA 3AL0B 3N7PD 2JEIA 1SZPA 5K4LA 1H38A 3FYHA 3MGIA 5AI9A 1V38A 4O3OA 8ICVA 3TAPA 2MSNA 3SENA 1ZHZA 4C69X 3RR8A 2UVWA 7ICFA 5ALNA 5KFQA 2JRZA 3RAQA 1ZQMA 1KKXA 2EQYA 1S10A 3F2DA 4GC6A 8ICMA 1QQ6A 2E1FA 3T79A 5KFVA 4PL2A 2KV2A 3PW0A 4EYIB 2AXTU 5T14A 4QQ1A 2ESEA 5DB9A 2J6SA 4O3PA 3TACB 4RQ4A 1V9PA 2RP5A 4AYBF 2JZBB 5L1LA 1NKCA 2C2EA 4NLZA 4AKMA 1Q46A 1Z3EB 4IS7A 2K8CB 1V97A 2JZBA 4EELA 3Q8PB 4Q8EA 1TK5A 4J9MA 3H0MB 5EE2A 3MR2A 3PW7A 2EZXA 7ICRA 2VJ5A 2C28A 1SZHA 5KFRA 2OWOA 2K4PA 1ZD2P 3QUTA 4EEYA 1ZD5A 1QSSA 2UVUA 2BPGA 4B9LA 5ALEA 2KOBA 2NYVA 3C5GA 1SL2A 4B9NA 2FDRA 4FRXA 8ICRA 1JIHA 4ECWA 4IL6O 3N97B 4F4BA 2FMPA 3H8JA 2CN1A 3Q8QB 2F2AB 1ZQBA 1A77A 5DDMA 2DBYA 5DQGA 2A1JB 4KLDA 4DSIA 8ICCA 2CPRA 3AQEA 2A1JA 2J4UP 1C7YA 2J6UA 4P4MA 1WWUA 1O08A 2I1QA 1BXWA 1JROA 4IR9A 4EYHB 5EWGA 3EPIA 4KN4A 5B5EO 3WK7A 5AKXA 1KEJA 1S0OA 3QU2A 3EMNX 5DKWA 1TE2A 4BUGA 1U48A 3D2QA 3HOLA 4IC9A 2XGPA 1LKYA 3EZ5A 7ICSA 4M6WB 5EE1A 2PI5A 5D46A 3QYPA 2EAPA 8ICAA 3OJSA 4M6WA 3OSNA 5HMLA 4P0QB 4Y2TA 2W3SA 2XCAA 3LWLA 1NZPA 4P0QA 2KMDA 1QH9A 1T4GA 3C1ZA 1X40A 1ZD3A 5DGAA 9ICAA 4KLJA 4DF8A 1X42A 4BDPA 1TAUA 2KXPB 2EANA 3IHQB 4RL9A 3H8MA 3Q8RB 2PMZC 4QZFA 4CF5A 4DCCA 5F9LA 2F1JA 1COKA 5ALJA 5D4BA 2BKEA 2R4LA 8ICQA 3KZXA 2QTKA 3N4MB 5ALLA 4CCHA 3CYMA 2PMZF 2CRXA 2MRLA 4ED0A 1O03A 4C4SA 1EXNA 2YQEA 7ICJA 2Y9UA 1ZETA 4EBDA 3RB3A 2R18A 5G38A 1XS9D 4O49A 2R8IA 3EYZA 1KRPA 4F4ZA 2KC0A 2IWWA 4YN4A 9ICKA 2QB1A 2M9NA 4OCZA 4QW9A 1S76D 1BPBA 4JK1A 1BPYA 2XIDA 1SL0A 2BHNA 1T16A 3KHLA 4QZCA 3TAQA 5AK6A 3R9KA 2A1AA 3VZWX 5KAIO 7ICEA 3E2EA 5JDPA 1X66A 4JB3A 3H8SA 5AM4A 2NRXA 5JUMA 4XNLA 3LVWA 4KMUA 2LBOA 4O5EA 2F76X 1LV5A 5KL1B 5IYUA 2KJ5A 2ZXHA 3MR5A 4Y2RA 2JEFA 2IOHA 4MHVA 1NZBA 1IIPA 4M47A 3PORA 4DF4A 1ZHWA 4XQ8A 3ZD9A 3VY9X 3PGRA 2Y0KA 4DL2A 3HW8A 4B6JA 4EX7A 2K4IA 2FGQX 3O0EA 4C8OA 2VA3A 3IRUA 2B21A 5ALVA 2W7OA 2W55A 3VE1A 2F3NA 1MQ3A 4QWAA 4QZBA 3FC4A 3UAQA 3T0SA 2P6RA 3PO5A 5AICA 2EDUA 2KZ3A 1NK7A 2FMSA 3I1YA 4RQNA 4C7YA 3JPQA 2R8JA 4PPXA 5J2AA 2RLTA 1NOMA 4ED6A 2GOLA 4RT3A 2HOIA 3BQ7A 5AKEA 7ICVA 3RJGA 5KNIA 3SV4A 4QZ8A 4F4KA 1IXRA 1QQ5A 1S0NA 4D64A 2ZTEA 5KFWA 2D6FC 7PRNA 4LSFA 2KZ7B 4UBCA 4RQ0A 1IV8A 3QXGA 4TQRA 4IR1A 4IQUA 2KZ7A 4BXOB 2ZFGA 2V9WA 4M9NA 3J81j 2IBKA 1Y88A 2XI9A 4M2YA 3H0LB 2EH9A 1SXEA 2IHNA 3BJYA 4KTQA 3ETRA 4GCPA 1Z4OA 4QWEA 4O3SA 1DK2A 4DEZA 2WF6A 3SY7A 3KHRA 3PMLA 2YB4A 2Y0HA 1Q3VA 2QB0A 3I76A 3L5KA 1PVQA 2WB1C 2Y0LA 4UB8U 8ICGA 1DK3A 1MC8A 3RBHA 3DA3A 4NL9A 4FS2A 9ICRA 4C80A 3KHGA 2AH5A 5KFZA 1T8EA 2WB1F 4PGQA 1JI7A 1KLNA 4DL5A 4KLQA 5C5JA 3RJHA 5ALMA 2PFNA 5DGBA 2RHFA 1KQQA 2LKYA 2W03A 4G75A 3UM9A 2LM4A 1JN3A 4PHEA 2F1TA 2X27X 2N2LA 5CA7A 3U26A 3V7JA 4P0PB 3RBEA 5KG1A 2JEJA 8ICEA 1MN8A 3DV9A 5AKZA 4P0PA 3ZDEA 5AKJA 2ZUCA 3QEBZ 2A3VA 2ZTDA 4B9TA 4E0DA 2HHVA 3HWTA 4I2BA 2WHEA 5EOZA 5GTHU 4IRCA 3L3FX 4FMSA 1SV4A 2VANA 2YMLA 3WKDA 1PUZA 3F2BA 3V6JA 2PORA 4GCSA 1SB3C 2MA1A 2KP7A 9ICFA 3KBBA 4CF4A 2EZZA 3QRCA 3FM9A 4DQPA 4YR0A 1DXSA 1VJ5A 4F71A 2P66A 3QU9A 4JWNA 1X9XA 4R66A 1KTQA 4F92B 5KFYA 3FYXA 2PXIA 4BGDA 2KHQA 1NK6A 5KTQA 1ZQKA 3TFSA 4QZDA 4E1TA 3NSGA 3PQSA 4DFKA 3OGUA 5FVNA 4TQSA 3G6VA 3IN5A 1ZQVA 4RPYA 4KR8A 2ZIXA 4I29A 3N28A 3GIJA 4LZDA 2HOFA 1K1SA 4RU9A 3RJEA 2KKVA 4GIBA 2HHUA 2HHSA 5KT3A 1RZTA 7ICKA 4GXKA 1WG8A 4O4XA 1T3QA 3HKZC 4EBEA 9ICEA 4K4GA 1ZHXA 5J0SA 8PRNA 2JHDA 2F8KA 3VZUX 5KG2A 1LB2B 3HKZF 4N75A 3K1ZA 3NASA 1NKBA 4QZIA 2IOFA 3QZ7A 4Y2SA 1SWWA 3AAAB 5ALUA 4RQ6A 4UAWA 2P6UA 5J2FA 4IQTA 3AAAA 1HIWA 4JWMA 4F4WA 8ICOA 1CEZA 3LVVA 2W8LA 2H3VA 4UAZA 3HJEA 1P7DA 4O3XB 4I2EA 1NNLA 5KFEA 4EX6A 3THVA 3GILA 4OJOA 4CE6A 3UQ0A 3Q8MA 1PVRA 4FOZA 4EEKA 1J97A 4XRHA 1QCKA 5DL5A 1BPXA 1B43A 4I28A 5BPCA 4UB5A 2GLEA 1SV0C 5AM5A 3K19A 3B0YA 4J9RA 4GFJA 3RFAA 3POXA 3TZGA 2HDOA 1Q9GA 2ASJA 5J0QA 1TFRA 4NWIA 1SKRA 2DPJA 3DWNA 4YCXA 3KZIU 3Q8LA 2LYHA 2KHVA 4QWDA 2E3TA 5J2IA 1ZQFA 3QZ8A 3ONNA 3HPOA 3WK6A 4IQWA 3UXOA 5KT6A 1YT3A 1LVHA 1OUQA 1ZD4A 4I2FA 4RLCA 2M07A 4BWJA 1MM4A 4D65A 4O3MA 1PHOA 1UT5A 4ED2A 5CR0A 4FUVA 2O6KA 2KSOB 4C8KA 3KTQA 3SZDA 7ICGA 4N59A 3M9OB 4QJFB 2KSOA 4PUXA 1K1QA 4YMOA 3C5FA 3AEVA
chains in the Genus database with same CATH topology
2LYBA 4FRTA 1MPFA 3KFUF 3LK3A 2G06A 5ADXL 2ZG6A 2KOBA 1HXXA 3UPGA 4FRXA 3D2NA 2W81C 4F4BA 2J1NA 2ZIWB 2K4HA 2CN1A 2ZXIA 2F2AB 2H3IA 3C29A 3A2SX 2ZIWA 2RRDA 3PRNA 3VZTX 3F5AA 3ALRA 2CPRA 3AQEA 1H6S1 2KIWA 2J4UP 5DL7A 1HEKA 1BXWA 3D2SA 1F44A 2DF4B 1XNSA 2KEYA 4QIWC 2KICA 2Q4TA 1XO0A 3EMNX 4BUGA 3GP6A 3D2QA 4QIWF 4IC9A 3HOLA 2LHTA 3AA1B 2JMMA 4WJ3B 3SAHA 3IG8A 2K0LA 4P0QB 3AA1A 1ED1A 1UPHA 2H3QA 1CRXA 2F1VA 4AYEC 2KD1A 4P0QA 4AKRA 2YPVA 4CGZA 1YS5A 2F8LA 1OPFA 2KXPB 2OYYA 4RL9A 2HBJA 3IP4B 3POUA 1GFPA 4NLCA 1MA7A 2XTRA 2PMZC 4LSIA 1PVPA 3KZXA 4OO1J 2QTKA 3CYMA 1OSMA 2PMZF 2CRXA 2MRLA 2FGRA 1IZNB 2G0AA 3M7DA 3DEEA 1IZNA 2GE4A 3PZPA 2OMFA 2W7PA 2R18A 2DQNB 4O49A 2KC0A 3SY9A 3G7GA 2MHLA 2XIDA 3AAEB 3M6ZA 4AYBC 1QJ9A 3MGVA 2K8AA 3AAEA 3SMVA 3VZWX 2JGAA 2G5IB 5JDPA 1HXTA 2NV3A 3RF9A 3LK42 2KJ9A 4XNLA 3SYBA 1E54A 3LVWA 2G07A 1A6SA 2LBOA 2XG6A 5T5FA 3SAGA 2F76X 3T20A 5KL1B 4O3WA 5IYUA 2KJ5A 2ZXHA 3VC8A 1NZBA 1IIPA 4AZLA 3PORA 1ZHWA 1ZQ1C 2VKQA 3F2CA 3VY9X 2K4EA 2K4TA 2Y0KA 5HR7A 1DRGA 2XMXA 4CDGA 2FGQX 2K4IA 3O0EA 4KX5A 4BX9C 1URJA 2KVCA 4KMOB 2W7OA 3VE1A 2BDUA 4C0ZA 1T94A 4A8EA 4U6PA 3V8UA 4G76A 3UAQA 4FZMA 3T0SA 3NUQA 2JH1A 2OXOA 3C5OA 4FT6A 2YNKA 2HOQA 3PSIA 1PRNA 2YX8A 2GOLA 1BT9A 2E1EA 2HOIA 2ZIXB 5G26A 2F77X 2XE5A 4ACOA 3SZVA 5PRNA 4AYID 4D64A 1GO3F 2D6FC 4ICAA 2HBLA 4Z3TA 7PRNA 3SQIA 1WUDA 3LK2B 2H3FA 4LSFA 2KZ7B 3LK2A 4FZNA 4AFKA 2XE3A 2KZ7A 2JH7A 4KRAA 2ZFGA 2KXPA 2KJ8A 1Q3UA 2XI9A 3H0LB 4AYDC 4O3YA 4GCPA 4AUIA 1MM5A 4U7CA 3SY7A 3AA6B 2DGZA 2YB4A 2Y0HA 3AA7B 1Q3VA 1PVQA 3VE2A 2OM6A 4BJQA 2WB1C 2OH2A 2Y0LA 3AA6A 3N7SC 3AA7A 3RBHA 3DA3A 2H3ZA 3PSTA 3PSFA 2VJ4A 2W04A 2ZLDA 2WB1F 1ZHYA 2ZIVB 4GF4A 3VY8X 5DL8A 2ERVA 4N58A 2N2MA 5AFUL 2RHFA 2ZIVA 3LK41 2LKYA 2W03A 4G75A 3KVDD 2K89A 2HBMA 4CRXA 2F1TA 2X27X 5ADXK 4JMUA 2N2LA 4P0PB 3HWBA 4RLBA 4FESA 3C28A 5D5DA 2G09A 2MNHA 4P0PA 2A3VA 2YB1A 4PL1A 5HR6A 2XE2A 3T24A 3L3FX 4LSEA 1HXUA 4FMSA 2Y0SC 3NRWA 2JMGA 2K8BB 3E0FA 1D8BA 3F2BA 1P4TA 2G08A 2LYAA 4GHBA 3ICXA 3QRAA 2Y0SF 3F53A 2PORA 4GCSA 4E1SA 4GCQA 2MA1A 2GH1A 4B61A 2XVTA 4LSHA 3QRCA 4KX3A 3GU3A 3M6KA 4OJ5A 2HMXA 1GFQA 4QNLA 4FZLA 2WAQC 1BH3A 3FYXA 2HBKA 2KHQA 1GFMA 2KDYA 4JFBA 4JCHA 4E1TA 2WAQF 1QJPA 3NSGA 3PQSA 3WI5A 3VCBA 3WI4A 5FVNA 4FSPA 2VIXA 5A0LA 1QJ8A 3IN5A 3CRXA 1ORMA 2LHFA 4KR8A 2G5HB 3IG5A 2ZIXA 2ODJA 3AQFA 3DA4A 2LFUA 4KR4A 1THQA 2HOFA 4AYMC 2KKVA 2W80C 1ECWA 4OJ6A 2O4VA 2PRNA 4O4XA 3H0RB 3HKZC 3SYSA 3HOEA 4OJLA 1ZHXA 8PRNA 2JHDA 2KKPA 1L6NA 3VZUX 3HKZF 3AA0B 3K1ZA 3POQA 1ZHTA 4NV0A 4FE3A 4AKRB 3F5EA 1Z19A 3AA0A 4FSOA 1GFNA 3AAAB 2Y7SA 5DL6A 2Z7JA 5AFUK 2XE1A 3AAAA 1HIWA 3UU2A 3AL0B 3LVVA 3N7PD 2H3VA 1P7DA 4O3XB 4RJXA 1G90A 1A0PA 4OJOA 1PVRA 4FOZA 1ZHZA 2N1RA 4C69X 5DL5A 2M06A 3PQUA 5C0YA 3K19A 2ZIUB 4BUMX 4GFJA 5KL8B 3RFAA 3POXA 3TZGA 3F2DA 2ZIUA 3PSPA 1Q9GA 4RJWA 2XICA 4NWIA 2E5SA 1Q9FA 2E1FA 3T79A 4PL2A 2KV2A 2M0NA 2XTQA 5T14A 2KHVA 4OJPA 4O3ZA 3GZFA 3O0FA 4QQ1A 3OPXA 5GV0A 3ONNA 5CRXA 1TAMA 4NLBA 1YT3A 1OUQA 4RLCA 2RP5A 4AYBF 3SAFA 4O4UA 2M07A 1MM4A 6PRNA 4AKMA 4D65A 2K8CB 3CP8A 1KBUA 4O3MA 1PHOA 4FUVA 3H0MB 4XNKA 5EE2A 2KNJA 4D5UA 3SZDA 4N59A 4QJFB 2VJ5A 1GFOA 4U9CA 4PUXA 4AYNA 1SZHA 3HW9A 3N7RC 3JTYA 3LK3B 1Z1BA 2Y2XA 3LYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N58 A;  4FZL A;  2XTQ A;  4G76 A;  2XMX A;  3DA3 A;  3DA4 A;  4G75 A;  2XTR A;  4N59 A;  4FZM A;  4FZN A; 
#chains in the Genus database with same CATH topology
 3WU2 O;  2ATL A;  4ECR A;  4DFP A;  3KFU F;  1MSW D;  2R8K A;  1ZQO A;  2HI0 A;  1HXX A;  3UMC A;  5TIS U;  5DQH A;  1NK4 A;  5B66 O;  5KFN A;  3Q8S B;  3K75 D;  3D2N A;  5JRT A;  2W81 C;  5E79 O;  2IA6 A;  3JPN A;  3PX6 A;  2K4H A;  3OTQ A;  2Y1J A;  1J2M A;  1TVA A;  2ZXI A;  1HUZ A;  2FI1 A;  1TK0 A;  2IOF K;  5AM1 A;  2W9B B;  1JXL A;  3ALR A;  2QLT A;  2MUT A;  2W9B A;  3QUQ A;  2AGO A;  4F5Q A;  5GTI O;  2DF4 B;  4QIW C;  5DLG A;  2XY5 A;  1XNS A;  4YFK A;  4BWM A;  2GO7 A;  2OHF A;  1XO0 A;  4Z6F A;  3GP6 A;  5IIO A;  4QIW F;  4YXJ A;  4ECZ A;  3AA1 B;  3GQC A;  3GFK B;  4F4X A;  5KFI A;  4WJ3 B;  3PMN A;  1TV9 A;  3IG8 A;  3PGS A;  3AA1 A;  1ED1 A;  4J9N A;  1CRX A;  2XCP A;  2F1V A;  4AYE C;  2KD1 A;  1ZJM A;  2AU0 A;  1U4B A;  2OCE A;  4AKR A;  1KN5 A;  5AIB A;  8ICB A;  3QNM A;  2F8L A;  5G3A A;  1ZQS A;  1OPF A;  3GIK A;  3PO4 A;  3H8W A;  2WF8 A;  2HBJ A;  3IP4 B;  4ELV A;  1GFP A;  4NLC A;  4EZ6 A;  2XTR A;  4LSI A;  2KFZ A;  4PJ0 U;  5ALO A;  1Z4N A;  1OSM A;  5KAF O;  2BPC A;  4UB6 O;  1J2N A;  2R4N A;  1N62 A;  4I2I A;  2W7P A;  9ICM A;  2HW3 A;  2DQN B;  5J8Y A;  4MFF A;  4MEX A;  3BZK A;  2AQ0 A;  1BPE A;  1M6Y A;  3G7G A;  2MHL A;  5ALT A;  3AAE B;  3WKA A;  5DB8 A;  3AU6 A;  4AYB C;  4O3R A;  1YZ6 A;  4DQI A;  7ICU A;  3AAE A;  4LZG A;  3SMV A;  2JGA A;  4FBT A;  1XSL A;  2NV3 A;  2E8P A;  1KFT A;  1E54 A;  3T20 A;  2ES6 A;  1RXV A;  3IV6 A;  4O3W A;  4ELT A;  3UQ2 A;  4Z6C A;  4AZL A;  3PW5 A;  4M9J A;  4GLX A;  2PFP A;  1ZQ1 C;  1HJP A;  4RQM A;  4C4R A;  5HR7 A;  5KG3 A;  2NRV A;  2ZUB A;  4KX5 A;  3BS5 B;  4RQ3 A;  1URJ A;  3PF1 A;  5J0P A;  1XO1 A;  3BS5 A;  4KLL A;  2W54 A;  4RUA A;  3A0B U;  5IIL A;  1T94 A;  1UT8 A;  3V8U A;  2YN4 A;  4C8M A;  4G76 A;  4DSL A;  1N2X A;  4Y2V A;  4J9L A;  2E8O A;  3SD7 A;  5BOL A;  2JH1 A;  3H7I A;  2KTQ A;  5J8Y C;  4KN7 A;  1OXJ A;  4NXZ A;  2JR5 A;  1V85 A;  1DGS A;  4RQ2 A;  2HOQ A;  1BNO A;  5DLF A;  2E1E A;  3RR7 A;  4F5R A;  2F77 X;  2XE5 A;  4ACO A;  4OD0 A;  5PRN A;  4M0A A;  3HRD D;  1Z1V A;  3OHB A;  4X5V A;  2BCR A;  4KLS A;  2AXT O;  1GO3 F;  4DO9 A;  1QSY A;  1L7N A;  2HBL A;  3SQI A;  3LK2 B;  3M9N B;  4HAI A;  2H3F A;  3LK2 A;  1D9F A;  2JH7 A;  4QZA A;  3PW4 A;  4KRA A;  1RQN A;  1JAL A;  5J2K A;  2W11 A;  2KXP A;  4C4V B;  2F1C X;  5KFX A;  3OHA A;  3UXP A;  1Q3U A;  4US9 A;  4I27 A;  4C4V A;  3CW2 C;  3JPT A;  4P4P A;  4AYD C;  4YP3 A;  3BS7 A;  4YD1 A;  4AUI A;  1B4F A;  1ZQG A;  4U7C A;  4KLO A;  1NK0 A;  5J2E A;  3M8R A;  3VE2 A;  2JXJ A;  2F44 A;  2OM6 A;  4I2G A;  5KT4 A;  7ICI A;  4TUP A;  1HUO A;  5AIA A;  1ZYQ A;  3RJI A;  3PST A;  3PSF A;  2VJ4 A;  4MFC A;  5DG8 A;  3NVZ A;  4GF4 A;  1ZQE A;  2DPI A;  4PHD A;  3RH4 A;  4N58 A;  1S9F A;  5ALW A;  2N2M A;  1BPZ A;  5AFU L;  3LK4 1;  2BR0 A;  2QKQ A;  2K89 A;  3ED5 A;  4CRX A;  4J9Q A;  5ADX K;  2A19 A;  3MBY A;  2FLL A;  4FES A;  5D5D A;  3HT3 A;  1N5X A;  1D8Y A;  2KFN A;  9ICP A;  1NJZ A;  4UQG A;  5HR6 A;  3MDA A;  5J2H A;  5KFM A;  3GV8 B;  4J9P A;  3PR4 A;  2HVH A;  4JUZ A;  3BZC A;  3AU2 A;  4DSF A;  3JPP A;  2Y0S C;  2NRW A;  3NRW A;  2BPF A;  4ELU A;  1L3V A;  4UAT A;  3PNC A;  5HHH A;  1D8B A;  2W9C B;  9ICG A;  1P4T A;  2ASD A;  2G08 A;  2Y0S F;  3F53 A;  5AM0 A;  1NKE A;  2WJR A;  3S6J A;  2W9C A;  4JV0 A;  3GU3 A;  2YMP A;  4NM1 A;  2F1H A;  5ALQ A;  1RYR A;  8ICT A;  4R8U B;  3TAD A;  1ZRN A;  4PR7 A;  3WK4 A;  5ALF A;  1SXD A;  3MDC A;  4DOB A;  1UCV A;  1RG6 A;  2BCQ A;  4US8 A;  5ALG A;  5ALZ A;  1S5L U;  1U49 A;  3IG5 A;  2ODJ A;  3BQ1 A;  2KG5 A;  5H2F U;  4XUS A;  5KFJ A;  2BDP A;  1ZQN A;  1Q8K A;  1JX4 A;  4XA5 A;  1ECW A;  2V4R A;  2PRN A;  1JUD A;  5KG5 A;  1ZQY A;  2HHX A;  5KFH A;  5D49 A;  3C2L A;  4OJL A;  1L6N A;  1BNP A;  3POQ A;  1ZHT A;  1L7P A;  5CJ7 A;  9ICL A;  8ICF A;  4BXO A;  3GV7 B;  2WTF A;  4FSO A;  4YQW A;  4YD2 A;  3TAN A;  2B6G A;  4USA A;  5EE0 A;  2ISP A;  3GII A;  3T5L A;  3UU2 A;  5KFU A;  4GXJ A;  4KLT A;  5AK4 A;  3T5J A;  1ZQJ A;  4FO6 A;  3DDH A;  2PFQ A;  1ZOL A;  2N1R A;  4UW9 A;  5ALS A;  4QZ9 A;  5ALD A;  3PQU A;  4UB1 A;  5C0Y A;  1KFD A;  4BUM X;  2PKE A;  3OSP A;  3RB0 A;  2UVR A;  3DZM A;  4Y2Q A;  3RB6 A;  4DQR A;  4MF2 A;  3PSP A;  1S97 A;  4RJW A;  2XIC A;  2ALZ A;  2E5S A;  2HHQ A;  1K5O A;  4G9B A;  2XTQ A;  3GZF A;  3QE9 Y;  3OPX A;  4B9U A;  3ZDA A;  8ICL A;  2LI6 A;  4NLB A;  2KIV A;  2VA2 A;  4MFA A;  3SAF A;  1ZQH A;  6PRN A;  4M04 A;  4ECU A;  3CP8 A;  3IDW A;  4C8N A;  4KLU A;  4XNK A;  2KNJ A;  4O0I A;  3H4D A;  4J9K A;  2XY6 A;  2BGW A;  3C2K A;  3QX7 A;  4GC7 A;  4RQ8 A;  3JTY A;  3N7R C;  4F5P A;  3LYS A;  2LYB A;  3WK8 A;  3JCU O;  4FRT A;  5AKH A;  5AI8 A;  3JPR A;  8ICX A;  1MPF A;  1A76 A;  1DGJ A;  2H5X A;  5ADX L;  9ICS A;  3DWO X;  4NL9 C;  3UPG A;  3L4P A;  1PK1 B;  4Q43 A;  1UA1 A;  4F3O A;  4TUR A;  3BQ0 A;  3A0H U;  4UB8 O;  2ZIW B;  2JQY A;  5CP2 A;  4F50 A;  3A2S X;  2ZIW A;  2RRD A;  5J0U A;  3PGU A;  3VZT X;  3F5A A;  5J2B A;  4P2H A;  3D6J A;  4ECV A;  5KFO A;  3D2S A;  1F44 A;  2KEY A;  1QLN A;  5DBA A;  4ED1 A;  1X6I A;  9ICQ A;  2R8A A;  2JV3 A;  1NJW A;  4KLH A;  5IIN A;  1BVS A;  4UB4 A;  2LHT A;  3IM1 A;  1CUK A;  4NM2 A;  2HHW A;  5AKG A;  5KFF A;  2JMM A;  5FP0 A;  3SAH A;  2KK0 A;  4UAR A;  2H3Q A;  4RNO A;  2Q0Z X;  5GTH O;  1ZQR A;  4KIT B;  5KT5 A;  2YPV A;  4CGZ A;  1YS5 A;  5KFT A;  5KG7 A;  2NRZ A;  2OYY A;  3ZI4 A;  3ORY A;  1L7M A;  4HYK A;  2W43 A;  1RYU A;  3PR5 B;  2FMQ A;  1FFV A;  5J2C A;  2Y1I A;  4OO1 J;  1BPD A;  4EZ9 A;  5ALP A;  1IZN B;  4ED3 A;  1NJY A;  2HHT A;  9ICB A;  3M7D A;  2B0C A;  1U9L A;  3TAR A;  3EWA A;  1IZN A;  2GE4 A;  3PZP A;  2OMF A;  4RQ1 A;  1L5U A;  2ISO A;  2RDJ A;  5EE9 A;  4J9S A;  1L3S A;  3QUC A;  2KZZ A;  2WFA A;  3KD3 A;  4F8R A;  1F0M A;  5DG7 A;  1QJ9 A;  5AKK A;  2FPK A;  1QTM A;  5AM2 A;  4RPZ A;  1F5S A;  2G5I B;  4ECT A;  3UPQ A;  1S77 D;  3RF9 A;  3LK4 2;  3SYB A;  1WYG A;  2G07 A;  1A6S A;  8ICN A;  2YY6 A;  2AQ4 A;  1N5W A;  3SZ2 A;  5T5F A;  3T3F A;  4IRK A;  5AI6 A;  2DUY A;  1N61 A;  4DFJ A;  2J6T A;  2ZJ8 A;  5J29 A;  4YR3 A;  1X9S A;  4FQE A;  2OEH A;  2R4O A;  2K4T A;  4BX9 C;  4QWC A;  1N63 A;  3HX0 A;  2AGQ A;  2KVC A;  9ICW A;  4KMO B;  2BDU A;  4A8E A;  1X9M A;  2MAX A;  3HIL A;  4FZM A;  1L8L A;  9ICJ A;  3EPG A;  4O9M A;  1IM4 A;  1ZQZ A;  3SV3 A;  4K4H A;  3C5O A;  2I6X A;  3E58 A;  4ZOH C;  5AI0 A;  5HHI A;  3PSI A;  3NVW A;  1BT9 A;  4QZH A;  3ZDB A;  1S8O A;  5G26 A;  2YMQ A;  4DL6 A;  5KFP A;  4Z6D A;  2XY7 A;  4I2A A;  3SZV A;  5L1K A;  3KZI O;  1XSP A;  5KFB A;  1FFU A;  2PI4 A;  1T1L A;  4P4O A;  4UAV A;  3WKE A;  3RTV A;  4Q45 A;  4Z3T A;  2FJ6 A;  1WUD A;  1NI3 A;  3I28 A;  8ICH A;  1KDH A;  4KLG A;  9ICN A;  3AMZ A;  4ECX A;  3RJF A;  2AHO B;  2EAO A;  4NY8 A;  3MFI A;  9ICV A;  4Y2X A;  4M9L A;  2R89 A;  1UHU A;  5J0T A;  4Q44 A;  3NVV A;  3ZD8 A;  1U47 A;  3G6X A;  5KFL A;  4PGY A;  1ZQQ A;  1XWL A;  3AA6 B;  2DGZ A;  1D9D A;  4IL6 U;  5TIS O;  5G39 A;  2OH2 A;  3AA6 A;  4Y2U A;  1SKW A;  5DB7 A;  2H3Z A;  4J9O A;  7ICM A;  8ICS A;  8ICW A;  2W04 A;  4RPX A;  2ZLD A;  5KFS A;  1U45 A;  3V6H A;  4J03 A;  5DG9 A;  1L8O A;  4DFM A;  2ERV A;  5DL8 A;  2NO5 A;  4C7Z A;  3QUB A;  4PHP A;  1B22 A;  5B5E U;  1L3U A;  1RYS A;  4DSK A;  4JMU A;  3LK9 A;  2XGQ A;  3WK9 A;  3HWB A;  1ZQU A;  2PFO A;  3C28 A;  3C23 A;  2WJQ A;  4PL1 A;  5DB6 A;  1IG6 A;  3TQ1 A;  4QWB A;  8ICK A;  4FFD A;  3NS1 A;  2XE2 A;  1DOQ A;  5KFC A;  4LSE A;  1HXU A;  7ICH A;  2AJQ A;  2YMM A;  1TK8 A;  4EBC A;  3UXN A;  4GHB A;  3ICX A;  3QRA A;  4E1S A;  4QZG A;  3PX0 A;  4GXI A;  2NO4 A;  2I9G A;  4B61 A;  4LSH A;  4KX3 A;  3GDX A;  3QU7 A;  4PJ0 O;  1RPL A;  2HMX A;  2L5Y A;  3ZDC A;  1L7O A;  3TKA A;  1ARO P;  4R65 A;  2HBK A;  7ICT A;  2KDY A;  4JFB A;  1KSP A;  3WI5 A;  1QQ7 A;  1N60 A;  2LM1 A;  8ICZ A;  3PX4 A;  5AKL A;  3FAH A;  2VIX A;  5A0L A;  1PK3 A;  3CRX A;  4MF8 A;  2LHF A;  2K60 A;  2G5H B;  4F72 A;  3SEI A;  2KZM A;  2LFU A;  4KR4 A;  2QAR B;  4O5K A;  4AYM C;  2BCS A;  5KAI U;  2VA8 A;  2QAR A;  9ICH A;  3LDA A;  1FO4 A;  2O4V A;  4DWI A;  2EZY A;  3H0R B;  1LKY B;  4DLE A;  4R64 A;  3RAX A;  3SYS A;  2KKP A;  5BOM A;  4YXM A;  5IIJ A;  3AA0 B;  2KE7 A;  4NV0 A;  5ALY A;  4I2J A;  8ICY A;  9ICI A;  3EW9 A;  3CNH A;  3F5E A;  1Z19 A;  3AA0 A;  3RH5 A;  1GFN A;  2XC9 A;  2Z7J A;  4DOA A;  1C20 A;  3UMG A;  4F91 B;  5KG6 A;  1JXE A;  4PZN A;  4KLE A;  5ALR A;  2WVP A;  4RJX A;  5G5G A;  3C2M A;  1G90 A;  3SR6 A;  5ALI A;  1A0P A;  2C22 A;  4B9V A;  1CI4 A;  3A0B O;  5KG4 A;  3V72 A;  3PVX A;  2M06 A;  2DWQ A;  2ZIU B;  5KL8 B;  4NLG A;  1MQ2 A;  2ZIU A;  3LWM A;  5KG0 A;  3KOO A;  4O3Q A;  1Q9F A;  3NGD A;  3RJJ A;  1RDF A;  4ZH4 A;  2V4Q A;  3MR6 A;  1ZJN A;  4K3B A;  2M0N A;  3BQT A;  1BGX T;  4Y2J A;  4OJP A;  1N48 A;  4O3Z A;  3OJU A;  3O0F A;  3PV8 A;  2FPL A;  3GIM A;  5GV0 A;  1RQL A;  3PW2 A;  5CRX A;  1TAM A;  1S0M A;  2KVS A;  4F4Y A;  4O4U A;  2IWV A;  3H4B A;  1KBU A;  5DBB A;  2RDI A;  4UAS A;  2LPE A;  1N56 A;  1XC9 A;  2DFL A;  3MAB A;  4D5U A;  2D8C A;  1WCN A;  2BQ3 A;  4ECS A;  1GFO A;  4U9C A;  1FEZ A;  4PH5 A;  4AYN A;  4F2S A;  3HW9 A;  1SWV A;  7ICN A;  3LK3 B;  5AKY A;  1Z1B A;  2Y2X A;  3T5K A;  1T7P A;  2E8N A;  3MFH A;  3LK3 A;  2G06 A;  4MEY A;  2D3D A;  2ZG6 A;  3C21 A;  5ALK A;  4K3C A;  4ED8 A;  4R8U A;  4M9G A;  3SYZ A;  2ODG A;  4K4I A;  2J1N A;  2ZJA A;  2H3I A;  3C29 A;  5ALX A;  4F5O A;  3PRN A;  4RQ7 A;  5III A;  5J0W A;  4RNM A;  3QEA Z;  1H6S 1;  2KIW A;  5DL7 A;  1HEK A;  4ECQ A;  2BCU A;  4Y2Y A;  5AI4 A;  2KIC A;  4CTD A;  2Q4T A;  1COO A;  5AK3 A;  5EE3 A;  2W9A A;  1VLB A;  5AM3 A;  1KL9 A;  3TI0 A;  3MC1 A;  4JV2 A;  2I5H A;  3B0X A;  2W9M A;  4PZO A;  4TUQ A;  1X6J A;  5ALH A;  3AN1 A;  4LVS A;  2K0L A;  1UPH A;  4RT2 A;  4ED7 A;  3MR3 A;  3C1Y A;  7ICL A;  2EAM A;  1WCL A;  9ICU A;  1Z00 B;  2P35 A;  5J2G A;  1D8L A;  2HVI A;  4UAU A;  1Z00 A;  2ASL A;  3BRZ A;  4DL3 A;  3POU A;  3TFR A;  1MA7 A;  2WF7 A;  1VDV A;  3TAD C;  1PVP A;  1UA0 A;  1T3N A;  5F9N A;  5HNK A;  5J0R A;  4FBU A;  2FGR A;  2R8H A;  4B9S A;  9ICX A;  2QB0 B;  5KT2 A;  3BS0 A;  2G0A A;  3DEE A;  4Q8F A;  5IIK A;  1OW5 A;  5KFA A;  1SKS A;  1ZQI A;  1SGG A;  2FLN A;  5KFD A;  3SY9 A;  5J2J A;  5KFK A;  4EEN A;  3NVY A;  1S5L O;  5F3X B;  3M6Z A;  5AHX A;  4YMN A;  3T5H A;  5H2F O;  5CEH A;  3MGV A;  2K8A A;  3JPO A;  4RQ5 A;  1JMS A;  4UBB A;  1SL1 A;  3BDP A;  1HXT A;  2KJ9 A;  5L9X A;  3AM9 A;  4YR2 A;  1ZQC A;  2XG6 A;  3SAG A;  3RH6 A;  2WF5 A;  4IRD A;  2KN7 A;  3VC8 A;  1KW4 A;  1X9W A;  3AUO A;  1PZN A;  1XSN A;  5J0X A;  4PGX A;  1TKD A;  2DL0 A;  2R4P A;  2VKQ A;  3F2C A;  2K4E A;  3RRH A;  2MU2 A;  5HP4 A;  1ZQT A;  1DRG A;  2XMX A;  4CDG A;  4UB2 A;  2R8G A;  3ETL A;  5J2D A;  1WWV A;  4RZR A;  2JEG A;  2W8K A;  3KKA A;  4DL7 A;  1PK1 A;  9ICT A;  4C0Z A;  4U6P A;  3V7L A;  4DS5 A;  2GWS A;  4B9M A;  3NUQ A;  1B0X A;  1TAQ A;  4C4T A;  3ISB A;  2OXO A;  3ISC A;  4KLM A;  4FT6 A;  5L1M A;  2YNK A;  3M8S A;  5L1J A;  2CXY A;  1PRN A;  1SV0 A;  2YX8 A;  4RNN A;  2ZIX B;  3NJT A;  2FE9 A;  4DQQ A;  2C2D A;  2AGP A;  2UVV A;  4CNQ A;  3HP6 A;  4G3I A;  3SI8 A;  5DDY A;  4AYI D;  4JV1 A;  3WKB A;  3KHH A;  4PHA A;  4ICA A;  4TUS A;  4IQV A;  4YMM A;  5IIM A;  3QU4 A;  1NJX A;  3UMB A;  1S0V A;  2HCF A;  2WF9 A;  4NLK A;  1YZ7 A;  1JRP A;  5KFG A;  1NK9 A;  4FZN A;  4AFK A;  2XE3 A;  5JU5 A;  3V6K A;  1ZXI A;  2KJ8 A;  4Y2P A;  8ICI A;  3WU2 U;  2FPM A;  7ICP A;  3WK5 A;  1ZQA A;  1ZQW A;  4O3Y A;  4DL4 A;  1MM5 A;  4UB3 A;  3KKA C;  9ICC A;  5B66 U;  3AA7 B;  5E79 U;  4CF3 A;  2LMR A;  2W3R A;  4BJQ A;  3GV5 B;  3N7S C;  3AA7 A;  1ZQX A;  3G6Y A;  3A0H O;  8ICU A;  4LJX A;  1ZHY A;  5CHG A;  4F5N A;  3EUB 2;  2ZIV B;  3VY8 X;  4DLG A;  4QW8 A;  2ZUD A;  2ZIV A;  2FLP A;  5GTI U;  5KT7 A;  4M9H A;  4Z6E A;  3KVD D;  5CWR A;  2ZTC A;  5AI5 A;  2HBM A;  2BQR A;  1ZQL A;  3WKC A;  4NLN A;  4O3N A;  4DQS A;  3NRZ A;  3RJK A;  1FIQ A;  2F1I A;  4RLB A;  5JTI A;  2G09 A;  4YVZ A;  2MNH A;  2DKX A;  3RB4 A;  4FS1 A;  4QZE A;  5J0Y A;  2YB1 A;  2IMW P;  3QU5 A;  2IHM A;  2E8M A;  2X9K A;  3T24 A;  3H40 A;  4DSJ A;  2XO7 A;  1RM6 C;  2HSZ A;  2JMG A;  2K8B B;  3NTU A;  3E0F A;  5EWE A;  2LYA A;  5AKI A;  3K4G A;  4GCQ A;  3ISD A;  5HMM A;  2BZF A;  4F93 B;  2GH1 A;  2XVT A;  4DFD A;  5CB1 A;  3BQ2 A;  4O5C A;  3M6K A;  4AP9 A;  4OJ5 A;  1KFS A;  3RRG A;  2BQU A;  2BCV A;  3B9J A;  2R88 A;  5KAF U;  7ICQ A;  1GFQ A;  1SIJ A;  4QNL A;  4FZL A;  4UB6 U;  2C2R A;  2WAQ C;  3FDS A;  1BH3 A;  8ICJ A;  1GFM A;  4JCH A;  4R63 A;  5EWF A;  2WAQ F;  1QJP A;  3VCB A;  2NRT A;  8ICP A;  4NJ8 A;  5DQI A;  5TZV A;  1RXW A;  3WI4 A;  3M9M B;  1NK8 A;  4FSP A;  1AQ6 A;  1ZQD A;  1QJ8 A;  1ORM A;  1X2I A;  2Y9T A;  5DBC A;  2MUT B;  1XU4 A;  3AQF A;  3PY8 A;  5AK5 A;  3BRY A;  3DA4 A;  2RQ5 A;  1THQ A;  2W80 C;  1ZQP A;  2YTU A;  3MGH A;  4N74 A;  4OJ6 A;  3Q8K A;  4UAY A;  2DKZ A;  4I2D A;  4I2C A;  5J0O A;  3K1R B;  3RBD A;  3HOE A;  3JPS A;  3M1Y A;  9ICO A;  1NK5 A;  1UQV A;  4DOC A;  4I2H A;  4F2R A;  1L3T A;  4ECY A;  4DSE A;  4KLF A;  4C8L A;  3ZDD A;  4FE3 A;  4RUC A;  4AKR B;  4DS4 A;  2Y7S A;  2ZJ5 A;  5L1I A;  5DL6 A;  4KLI A;  4C00 A;  5AFU K;  4YG2 A;  2XE1 A;  1QSL A;  7ICO A;  1ZRM A;  3V7K A;  5G5H A;  3AL0 B;  3N7P D;  2JEI A;  1SZP A;  5K4L A;  1H38 A;  3FYH A;  3MGI A;  5AI9 A;  1V38 A;  4O3O A;  8ICV A;  3TAP A;  2MSN A;  3SEN A;  1ZHZ A;  4C69 X;  3RR8 A;  2UVW A;  7ICF A;  5ALN A;  5KFQ A;  2JRZ A;  3RAQ A;  1ZQM A;  1KKX A;  2EQY A;  1S10 A;  3F2D A;  4GC6 A;  8ICM A;  1QQ6 A;  2E1F A;  3T79 A;  5KFV A;  4PL2 A;  2KV2 A;  3PW0 A;  4EYI B;  2AXT U;  5T14 A;  4QQ1 A;  2ESE A;  5DB9 A;  2J6S A;  4O3P A;  3TAC B;  4RQ4 A;  1V9P A;  2RP5 A;  4AYB F;  2JZB B;  5L1L A;  1NKC A;  2C2E A;  4NLZ A;  4AKM A;  1Q46 A;  1Z3E B;  4IS7 A;  2K8C B;  1V97 A;  2JZB A;  4EEL A;  3Q8P B;  4Q8E A;  1TK5 A;  4J9M A;  3H0M B;  5EE2 A;  3MR2 A;  3PW7 A;  2EZX A;  7ICR A;  2VJ5 A;  2C28 A;  1SZH A;  5KFR A;  2OWO A;  2K4P A;  1ZD2 P;  3QUT A;  4EEY A;  1ZD5 A;  1QSS A;  2UVU A;  2BPG A;  4B9L A;  5ALE A;  2KOB A;  2NYV A;  3C5G A;  1SL2 A;  4B9N A;  2FDR A;  4FRX A;  8ICR A;  1JIH A;  4ECW A;  4IL6 O;  3N97 B;  4F4B A;  2FMP A;  3H8J A;  2CN1 A;  3Q8Q B;  2F2A B;  1ZQB A;  1A77 A;  5DDM A;  2DBY A;  5DQG A;  2A1J B;  4KLD A;  4DSI A;  8ICC A;  2CPR A;  3AQE A;  2A1J A;  2J4U P;  1C7Y A;  2J6U A;  4P4M A;  1WWU A;  1O08 A;  2I1Q A;  1BXW A;  1JRO A;  4IR9 A;  4EYH B;  5EWG A;  3EPI A;  4KN4 A;  5B5E O;  3WK7 A;  5AKX A;  1KEJ A;  1S0O A;  3QU2 A;  3EMN X;  5DKW A;  1TE2 A;  4BUG A;  1U48 A;  3D2Q A;  3HOL A;  4IC9 A;  2XGP A;  1LKY A;  3EZ5 A;  7ICS A;  4M6W B;  5EE1 A;  2PI5 A;  5D46 A;  3QYP A;  2EAP A;  8ICA A;  3OJS A;  4M6W A;  3OSN A;  5HML A;  4P0Q B;  4Y2T A;  2W3S A;  2XCA A;  3LWL A;  1NZP A;  4P0Q A;  2KMD A;  1QH9 A;  1T4G A;  3C1Z A;  1X40 A;  1ZD3 A;  5DGA A;  9ICA A;  4KLJ A;  4DF8 A;  1X42 A;  4BDP A;  1TAU A;  2KXP B;  2EAN A;  3IHQ B;  4RL9 A;  3H8M A;  3Q8R B;  2PMZ C;  4QZF A;  4CF5 A;  4DCC A;  5F9L A;  2F1J A;  1COK A;  5ALJ A;  5D4B A;  2BKE A;  2R4L A;  8ICQ A;  3KZX A;  2QTK A;  3N4M B;  5ALL A;  4CCH A;  3CYM A;  2PMZ F;  2CRX A;  2MRL A;  4ED0 A;  1O03 A;  4C4S A;  1EXN A;  2YQE A;  7ICJ A;  2Y9U A;  1ZET A;  4EBD A;  3RB3 A;  2R18 A;  5G38 A;  1XS9 D;  4O49 A;  2R8I A;  3EYZ A;  1KRP A;  4F4Z A;  2KC0 A;  2IWW A;  4YN4 A;  9ICK A;  2QB1 A;  2M9N A;  4OCZ A;  4QW9 A;  1S76 D;  1BPB A;  4JK1 A;  1BPY A;  2XID A;  1SL0 A;  2BHN A;  1T16 A;  3KHL A;  4QZC A;  3TAQ A;  5AK6 A;  3R9K A;  2A1A A;  3VZW X;  5KAI O;  7ICE A;  3E2E A;  5JDP A;  1X66 A;  4JB3 A;  3H8S A;  5AM4 A;  2NRX A;  5JUM A;  4XNL A;  3LVW A;  4KMU A;  2LBO A;  4O5E A;  2F76 X;  1LV5 A;  5KL1 B;  5IYU A;  2KJ5 A;  2ZXH A;  3MR5 A;  4Y2R A;  2JEF A;  2IOH A;  4MHV A;  1NZB A;  1IIP A;  4M47 A;  3POR A;  4DF4 A;  1ZHW A;  4XQ8 A;  3ZD9 A;  3VY9 X;  3PGR A;  2Y0K A;  4DL2 A;  3HW8 A;  4B6J A;  4EX7 A;  2K4I A;  2FGQ X;  3O0E A;  4C8O A;  2VA3 A;  3IRU A;  2B21 A;  5ALV A;  2W7O A;  2W55 A;  3VE1 A;  2F3N A;  1MQ3 A;  4QWA A;  4QZB A;  3FC4 A;  3UAQ A;  3T0S A;  2P6R A;  3PO5 A;  5AIC A;  2EDU A;  2KZ3 A;  1NK7 A;  2FMS A;  3I1Y A;  4RQN A;  4C7Y A;  3JPQ A;  2R8J A;  4PPX A;  5J2A A;  2RLT A;  1NOM A;  4ED6 A;  2GOL A;  4RT3 A;  2HOI A;  3BQ7 A;  5AKE A;  7ICV A;  3RJG A;  5KNI A;  3SV4 A;  4QZ8 A;  4F4K A;  1IXR A;  1QQ5 A;  1S0N A;  4D64 A;  2ZTE A;  5KFW A;  2D6F C;  7PRN A;  4LSF A;  2KZ7 B;  4UBC A;  4RQ0 A;  1IV8 A;  3QXG A;  4TQR A;  4IR1 A;  4IQU A;  2KZ7 A;  4BXO B;  2ZFG A;  2V9W A;  4M9N A;  3J81 j;  2IBK A;  1Y88 A;  2XI9 A;  4M2Y A;  3H0L B;  2EH9 A;  1SXE A;  2IHN A;  3BJY A;  4KTQ A;  3ETR A;  4GCP A;  1Z4O A;  4QWE A;  4O3S A;  1DK2 A;  4DEZ A;  2WF6 A;  3SY7 A;  3KHR A;  3PML A;  2YB4 A;  2Y0H A;  1Q3V A;  2QB0 A;  3I76 A;  3L5K A;  1PVQ A;  2WB1 C;  2Y0L A;  4UB8 U;  8ICG A;  1DK3 A;  1MC8 A;  3RBH A;  3DA3 A;  4NL9 A;  4FS2 A;  9ICR A;  4C80 A;  3KHG A;  2AH5 A;  5KFZ A;  1T8E A;  2WB1 F;  4PGQ A;  1JI7 A;  1KLN A;  4DL5 A;  4KLQ A;  5C5J A;  3RJH A;  5ALM A;  2PFN A;  5DGB A;  2RHF A;  1KQQ A;  2LKY A;  2W03 A;  4G75 A;  3UM9 A;  2LM4 A;  1JN3 A;  4PHE A;  2F1T A;  2X27 X;  2N2L A;  5CA7 A;  3U26 A;  3V7J A;  4P0P B;  3RBE A;  5KG1 A;  2JEJ A;  8ICE A;  1MN8 A;  3DV9 A;  5AKZ A;  4P0P A;  3ZDE A;  5AKJ A;  2ZUC A;  3QEB Z;  2A3V A;  2ZTD A;  4B9T A;  4E0D A;  2HHV A;  3HWT A;  4I2B A;  2WHE A;  5EOZ A;  5GTH U;  4IRC A;  3L3F X;  4FMS A;  1SV4 A;  2VAN A;  2YML A;  3WKD A;  1PUZ A;  3F2B A;  3V6J A;  2POR A;  4GCS A;  1SB3 C;  2MA1 A;  2KP7 A;  9ICF A;  3KBB A;  4CF4 A;  2EZZ A;  3QRC A;  3FM9 A;  4DQP A;  4YR0 A;  1DXS A;  1VJ5 A;  4F71 A;  2P66 A;  3QU9 A;  4JWN A;  1X9X A;  4R66 A;  1KTQ A;  4F92 B;  5KFY A;  3FYX A;  2PXI A;  4BGD A;  2KHQ A;  1NK6 A;  5KTQ A;  1ZQK A;  3TFS A;  4QZD A;  4E1T A;  3NSG A;  3PQS A;  4DFK A;  3OGU A;  5FVN A;  4TQS A;  3G6V A;  3IN5 A;  1ZQV A;  4RPY A;  4KR8 A;  2ZIX A;  4I29 A;  3N28 A;  3GIJ A;  4LZD A;  2HOF A;  1K1S A;  4RU9 A;  3RJE A;  2KKV A;  4GIB A;  2HHU A;  2HHS A;  5KT3 A;  1RZT A;  7ICK A;  4GXK A;  1WG8 A;  4O4X A;  1T3Q A;  3HKZ C;  4EBE A;  9ICE A;  4K4G A;  1ZHX A;  5J0S A;  8PRN A;  2JHD A;  2F8K A;  3VZU X;  5KG2 A;  1LB2 B;  3HKZ F;  4N75 A;  3K1Z A;  3NAS A;  1NKB A;  4QZI A;  2IOF A;  3QZ7 A;  4Y2S A;  1SWW A;  3AAA B;  5ALU A;  4RQ6 A;  4UAW A;  2P6U A;  5J2F A;  4IQT A;  3AAA A;  1HIW A;  4JWM A;  4F4W A;  8ICO A;  1CEZ A;  3LVV A;  2W8L A;  2H3V A;  4UAZ A;  3HJE A;  1P7D A;  4O3X B;  4I2E A;  1NNL A;  5KFE A;  4EX6 A;  3THV A;  3GIL A;  4OJO A;  4CE6 A;  3UQ0 A;  3Q8M A;  1PVR A;  4FOZ A;  4EEK A;  1J97 A;  4XRH A;  1QCK A;  5DL5 A;  1BPX A;  1B43 A;  4I28 A;  5BPC A;  4UB5 A;  2GLE A;  1SV0 C;  5AM5 A;  3K19 A;  3B0Y A;  4J9R A;  4GFJ A;  3RFA A;  3POX A;  3TZG A;  2HDO A;  1Q9G A;  2ASJ A;  5J0Q A;  1TFR A;  4NWI A;  1SKR A;  2DPJ A;  3DWN A;  4YCX A;  3KZI U;  3Q8L A;  2LYH A;  2KHV A;  4QWD A;  2E3T A;  5J2I A;  1ZQF A;  3QZ8 A;  3ONN A;  3HPO A;  3WK6 A;  4IQW A;  3UXO A;  5KT6 A;  1YT3 A;  1LVH A;  1OUQ A;  1ZD4 A;  4I2F A;  4RLC A;  2M07 A;  4BWJ A;  1MM4 A;  4D65 A;  4O3M A;  1PHO A;  1UT5 A;  4ED2 A;  5CR0 A;  4FUV A;  2O6K A;  2KSO B;  4C8K A;  3KTQ A;  3SZD A;  7ICG A;  4N59 A;  3M9O B;  4QJF B;  2KSO A;  4PUX A;  1K1Q A;  4YMO A;  3C5F A;  3AEV A; 
#chains in the Genus database with same CATH homology
 2LYB A;  4FRT A;  1MPF A;  3KFU F;  3LK3 A;  2G06 A;  5ADX L;  2ZG6 A;  2KOB A;  1HXX A;  3UPG A;  4FRX A;  3D2N A;  2W81 C;  4F4B A;  2J1N A;  2ZIW B;  2K4H A;  2CN1 A;  2ZXI A;  2F2A B;  2H3I A;  3C29 A;  3A2S X;  2ZIW A;  2RRD A;  3PRN A;  3VZT X;  3F5A A;  3ALR A;  2CPR A;  3AQE A;  1H6S 1;  2KIW A;  2J4U P;  5DL7 A;  1HEK A;  1BXW A;  3D2S A;  1F44 A;  2DF4 B;  1XNS A;  2KEY A;  4QIW C;  2KIC A;  2Q4T A;  1XO0 A;  3EMN X;  4BUG A;  3GP6 A;  3D2Q A;  4QIW F;  4IC9 A;  3HOL A;  2LHT A;  3AA1 B;  2JMM A;  4WJ3 B;  3SAH A;  3IG8 A;  2K0L A;  4P0Q B;  3AA1 A;  1ED1 A;  1UPH A;  2H3Q A;  1CRX A;  2F1V A;  4AYE C;  2KD1 A;  4P0Q A;  4AKR A;  2YPV A;  4CGZ A;  1YS5 A;  2F8L A;  1OPF A;  2KXP B;  2OYY A;  4RL9 A;  2HBJ A;  3IP4 B;  3POU A;  1GFP A;  4NLC A;  1MA7 A;  2XTR A;  2PMZ C;  4LSI A;  1PVP A;  3KZX A;  4OO1 J;  2QTK A;  3CYM A;  1OSM A;  2PMZ F;  2CRX A;  2MRL A;  2FGR A;  1IZN B;  2G0A A;  3M7D A;  3DEE A;  1IZN A;  2GE4 A;  3PZP A;  2OMF A;  2W7P A;  2R18 A;  2DQN B;  4O49 A;  2KC0 A;  3SY9 A;  3G7G A;  2MHL A;  2XID A;  3AAE B;  3M6Z A;  4AYB C;  1QJ9 A;  3MGV A;  2K8A A;  3AAE A;  3SMV A;  3VZW X;  2JGA A;  2G5I B;  5JDP A;  1HXT A;  2NV3 A;  3RF9 A;  3LK4 2;  2KJ9 A;  4XNL A;  3SYB A;  1E54 A;  3LVW A;  2G07 A;  1A6S A;  2LBO A;  2XG6 A;  5T5F A;  3SAG A;  2F76 X;  3T20 A;  5KL1 B;  4O3W A;  5IYU A;  2KJ5 A;  2ZXH A;  3VC8 A;  1NZB A;  1IIP A;  4AZL A;  3POR A;  1ZHW A;  1ZQ1 C;  2VKQ A;  3F2C A;  3VY9 X;  2K4E A;  2K4T A;  2Y0K A;  5HR7 A;  1DRG A;  2XMX A;  4CDG A;  2FGQ X;  2K4I A;  3O0E A;  4KX5 A;  4BX9 C;  1URJ A;  2KVC A;  4KMO B;  2W7O A;  3VE1 A;  2BDU A;  4C0Z A;  1T94 A;  4A8E A;  4U6P A;  3V8U A;  4G76 A;  3UAQ A;  4FZM A;  3T0S A;  3NUQ A;  2JH1 A;  2OXO A;  3C5O A;  4FT6 A;  2YNK A;  2HOQ A;  3PSI A;  1PRN A;  2YX8 A;  2GOL A;  1BT9 A;  2E1E A;  2HOI A;  2ZIX B;  5G26 A;  2F77 X;  2XE5 A;  4ACO A;  3SZV A;  5PRN A;  4AYI D;  4D64 A;  1GO3 F;  2D6F C;  4ICA A;  2HBL A;  4Z3T A;  7PRN A;  3SQI A;  1WUD A;  3LK2 B;  2H3F A;  4LSF A;  2KZ7 B;  3LK2 A;  4FZN A;  4AFK A;  2XE3 A;  2KZ7 A;  2JH7 A;  4KRA A;  2ZFG A;  2KXP A;  2KJ8 A;  1Q3U A;  2XI9 A;  3H0L B;  4AYD C;  4O3Y A;  4GCP A;  4AUI A;  1MM5 A;  4U7C A;  3SY7 A;  3AA6 B;  2DGZ A;  2YB4 A;  2Y0H A;  3AA7 B;  1Q3V A;  1PVQ A;  3VE2 A;  2OM6 A;  4BJQ A;  2WB1 C;  2OH2 A;  2Y0L A;  3AA6 A;  3N7S C;  3AA7 A;  3RBH A;  3DA3 A;  2H3Z A;  3PST A;  3PSF A;  2VJ4 A;  2W04 A;  2ZLD A;  2WB1 F;  1ZHY A;  2ZIV B;  4GF4 A;  3VY8 X;  5DL8 A;  2ERV A;  4N58 A;  2N2M A;  5AFU L;  2RHF A;  2ZIV A;  3LK4 1;  2LKY A;  2W03 A;  4G75 A;  3KVD D;  2K89 A;  2HBM A;  4CRX A;  2F1T A;  2X27 X;  5ADX K;  4JMU A;  2N2L A;  4P0P B;  3HWB A;  4RLB A;  4FES A;  3C28 A;  5D5D A;  2G09 A;  2MNH A;  4P0P A;  2A3V A;  2YB1 A;  4PL1 A;  5HR6 A;  2XE2 A;  3T24 A;  3L3F X;  4LSE A;  1HXU A;  4FMS A;  2Y0S C;  3NRW A;  2JMG A;  2K8B B;  3E0F A;  1D8B A;  3F2B A;  1P4T A;  2G08 A;  2LYA A;  4GHB A;  3ICX A;  3QRA A;  2Y0S F;  3F53 A;  2POR A;  4GCS A;  4E1S A;  4GCQ A;  2MA1 A;  2GH1 A;  4B61 A;  2XVT A;  4LSH A;  3QRC A;  4KX3 A;  3GU3 A;  3M6K A;  4OJ5 A;  2HMX A;  1GFQ A;  4QNL A;  4FZL A;  2WAQ C;  1BH3 A;  3FYX A;  2HBK A;  2KHQ A;  1GFM A;  2KDY A;  4JFB A;  4JCH A;  4E1T A;  2WAQ F;  1QJP A;  3NSG A;  3PQS A;  3WI5 A;  3VCB A;  3WI4 A;  5FVN A;  4FSP A;  2VIX A;  5A0L A;  1QJ8 A;  3IN5 A;  3CRX A;  1ORM A;  2LHF A;  4KR8 A;  2G5H B;  3IG5 A;  2ZIX A;  2ODJ A;  3AQF A;  3DA4 A;  2LFU A;  4KR4 A;  1THQ A;  2HOF A;  4AYM C;  2KKV A;  2W80 C;  1ECW A;  4OJ6 A;  2O4V A;  2PRN A;  4O4X A;  3H0R B;  3HKZ C;  3SYS A;  3HOE A;  4OJL A;  1ZHX A;  8PRN A;  2JHD A;  2KKP A;  1L6N A;  3VZU X;  3HKZ F;  3AA0 B;  3K1Z A;  3POQ A;  1ZHT A;  4NV0 A;  4FE3 A;  4AKR B;  3F5E A;  1Z19 A;  3AA0 A;  4FSO A;  1GFN A;  3AAA B;  2Y7S A;  5DL6 A;  2Z7J A;  5AFU K;  2XE1 A;  3AAA A;  1HIW A;  3UU2 A;  3AL0 B;  3LVV A;  3N7P D;  2H3V A;  1P7D A;  4O3X B;  4RJX A;  1G90 A;  1A0P A;  4OJO A;  1PVR A;  4FOZ A;  1ZHZ A;  2N1R A;  4C69 X;  5DL5 A;  2M06 A;  3PQU A;  5C0Y A;  3K19 A;  2ZIU B;  4BUM X;  4GFJ A;  5KL8 B;  3RFA A;  3POX A;  3TZG A;  3F2D A;  2ZIU A;  3PSP A;  1Q9G A;  4RJW A;  2XIC A;  4NWI A;  2E5S A;  1Q9F A;  2E1F A;  3T79 A;  4PL2 A;  2KV2 A;  2M0N A;  2XTQ A;  5T14 A;  2KHV A;  4OJP A;  4O3Z A;  3GZF A;  3O0F A;  4QQ1 A;  3OPX A;  5GV0 A;  3ONN A;  5CRX A;  1TAM A;  4NLB A;  1YT3 A;  1OUQ A;  4RLC A;  2RP5 A;  4AYB F;  3SAF A;  4O4U A;  2M07 A;  1MM4 A;  6PRN A;  4AKM A;  4D65 A;  2K8C B;  3CP8 A;  1KBU A;  4O3M A;  1PHO A;  4FUV A;  3H0M B;  4XNK A;  5EE2 A;  2KNJ A;  4D5U A;  3SZD A;  4N59 A;  4QJF B;  2VJ5 A;  1GFO A;  4U9C A;  4PUX A;  4AYN A;  1SZH A;  3HW9 A;  3N7R C;  3JTY A;  3LK3 B;  1Z1B A;  2Y2X A;  3LYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...