4FZLA

High resolution structure of truncated bacteriocin syringacin m from pseudomonas syringae pv. tomato dc3000
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
239
structure length
239
Chain Sequence
b'GMQNPVATVLLLQGDLYCSPNCLATFQDQARRDSFGIQSKVALKTFAAADQREAEGRDLRTAYNEIATDIGRSQQINENIIKYPPGNHVLSGGLMTPFHALAHGMFGLGAPLTFPIQNVGLNVDIRGIPDVMNVIQSARPVGTSSLDVNFAYDVGKDSNASWLTLGNITLRLVGTIDKNASGAWTFSGEIRAFNDVYDANPSNHRGWLGENLTSLLSAVPFTSYSIEIPGSLPVTVSGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacteriocin
publication title The Crystal Structure of the Lipid II-degrading Bacteriocin Syringacin M Suggests Unexpected Evolutionary Relationships between Colicin M-like Bacteriocins.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Antimicrobial protein
total genus 73
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.790 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4fzlA01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4fzlA02
4G76A 4FZMA 4N58A 4G75A 3DA4A 4FZNA 4N59A 2XMXA 3DA3A 2XTQA 2XTRA 4FZLA
chains in the Genus database with same CATH superfamily
4C8LA 2Y0SC 2HBLA 3WKBA 2E1EA 4PL1A 5L1KA 2YN4A 4US9A 1OPFA 2JV3A 1ZQOA 2XC9A 5J0UA 5IIMA 3O0EA 2W9CA 5B5EU 4CNQA 1TKDA 2XE2A 2WF8A 2WF9A 2KKVA 3TQ1A 3ZDEA 4ECSA 4QIWC 9ICTA 4G76A 2JMGA 1KRPA 1AROP 1JUDA 4C8OA 2J1NA 2XE1A 2XE5A 4KRAA 4QZGA 2ASLA 2VJ4A 4UB8U 5F3XB 2DQNB 4PHEA 3KKAC 1WWUA 5KG7A 4K4IA 4B9MA 5ALLA 4QWCA 2IA6A 3RB6A 4FBUA 7ICQA 2ESEA 4RJWA 9ICPA 3MR6A 3JPRA 4PHPA 5J8YC 2JMMA 1P4TA 4Y2YA 4NL9C 2LI6A 2W9BB 8ICNA 2F44A 5FP0A 3TKAA 5KT7A 4DL3A 1COKA 3SENA 3HWTA 5FVNA 3ORYA 4UBBA 2Y1JA 2WJRA 4I2BA 1JN3A 4UB3A 1D8LA 3E58A 1PZNA 4ECQA 2MU2A 3M6ZA 1ZQBA 5L1MA 4FE3A 4GCPA 2BQUA 3H8MA 4I2CA 8ICKA 3F5AA 4GXJA 3PNCA 3QU7A 3TAQA 1SWWA 4P4OA 1X9WA 5EWFA 5J0YA 3Q8RB 1HUZA 5KT3A 3BS5B 1JMSA 4EBDA 3F5EA 3IG8A 2NRXA 3LK9A 2ZTCA 4RQ4A 3EPGA 3GU3A 3V7LA 8ICQA 2DF4B 2FGQX 1JXLA 4BGDA 4I27A 2M06A 3ETLA 2OH2A 8ICPA 1XS9D 3THVA 3Q8SB 1X66A 4O3YA 4QWEA 4F4YA 5J2HA 2WJQA 9ICOA 3GV5B 2O4VA 2Y7SA 4E1TA 5AKIA 4DQQA 3NTUA 3PSFA 4QWAA 4NM2A 4CGZA 4BDPA 4YMNA 1IZNB 4QW9A 4KLQA 2KV2A 5KFCA 3NRZA 3RAQA 9ICEA 3JPNA 1X2IA 2ZUCA 2WF5A 4C69X 3FC4A 3TANA 3RJHA 1NJWA 3POUA 1BT9A 1KQQA 1ZOLA 2WF6A 4F4BA 5IIJA 3CNHA 5KFBA 5AK6A 2AXTO 3RH6A 4RPZA 3PX0A 2YTUA 2CRXA 4TUSA 1ZQAA 5CA7A 5KFYA 3IHQB 4EX7A 4Y2RA 2LYHA 1H6S1 3M9MB 3TADC 2RRDA 3HRDD 3AUOA 4FT6A 4UAZA 3JPQA 1ZQ1C 4JUZA 8ICYA 1KLNA 5BOLA 3PQSA 4GHBA 5KFJA 2MUTB 4J03A 3PRNA 3NS1A 2P6UA 4YR0A 1RYSA 4O3MA 2AGQA 2KSOB 1MPFA 3T79A 4JB3A 3BQ1A 5AIBA 3ZD9A 2XTRA 2E8PA 4PJ0O 5KG6A 8ICGA 2LFUA 2GWSA 4M9NA 1JIHA 4Y2XA 4NLBA 4UB6O 2NO5A 2UVWA 1K1SA 2VANA 2G0AA 3PSPA 5D46A 4EYHB 2W8KA 2MAXA 2BQ3A 4FSPA 4C4SA 1BNOA 2KDYA 2W7PA 2R8IA 4IRCA 1SXDA 4O3PA 4HYKA 1Q3VA 3H40A 4KITB 4DFMA 5AI0A 2OWOA 3GZFA 3N7PD 4QZEA 5AK5A 3ALRA 3AA1A 2YMMA 1T94A 4UBCA 2E8OA 1KFTA 1X40A 2XVTA 5DGAA 2ZIXB 4CF3A 5BPCA 4F50A 2FPMA 3KKAA 3A0HO 3AAEB 1D9DA 7ICRA 3KVDD 5J0XA 5DL7A 2UVUA 4QZ8A 5J8YA 3LWLA 4DFPA 4ICAA 7ICTA 3LK2A 3WK9A 4NL9A 1RDFA 5ALEA 4RUCA 5DG7A 2ASJA 3SMVA 1RG6A 4AKRA 4QWDA 1NNLA 1A77A 2OMFA 2J4UP 1S0OA 1S0VA 3AA7B 1Z00A 9ICIA 2PRNA 4XA5A 2N2LA 4P4MA 3PW7A 2IBKA 5J2EA 2PORA 3VY9X 3ZDCA 4FQEA 2JHDA 2JH7A 2Y0KA 3UXNA 4NV0A 3H0RB 2RQ5A 2W54A 4QZAA 3PR4A 5HHIA 3EZ5A 4KLEA 5J2DA 2DKXA 3AEVA 5AKHA 2WAQC 3RFAA 5ALPA 3VZWX 3UPGA 1V9PA 2XGQA 4F4KA 1ZQYA 1FFVA 1UT5A 4DSFA 5F9NA 4KX3A 1NK5A 2FI1A 4N58A 2LHTA 4KMUA 5J2GA 3F2BA 2E8NA 5KL1B 5AM4A 2KN7A 4YD2A 1N56A 1LB2B 5B5EO 4DQPA 4G3IA 5GV0A 1QSSA 1QH9A 3AQEA 5AM0A 4F3OA 2KZMA 3C29A 2DWQA 4F4WA 3MC1A 1QJ8A 3HX0A 2WHEA 2PFPA 3AM9A 4UB8O 4IR9A 2J6SA 1ZXIA 2NYVA 4RNOA 1F5SA 2ZXHA 3G6YA 2BCRA 5D5DA 2BCSA 2KVSA 2F3NA 3D2QA 2B21A 1MQ2A 9ICNA 1LKYB 3NVZA 4OJOA 4ZOHC 1DK3A 4P0PB 3T5JA 2D8CA 5J0OA 5ALTA 4NM1A 4F5PA 3IN5A 2HHQA 3Q8LA 3HWBA 2ZUDA 3WK7A 2F1IA 2ALZA 2QARA 4Q45A 3NVYA 3PGSA 4UAUA 3NVWA 2A3VA 2HHWA 2BPCA 4TURA 1M6YA 2ZFGA 2O6KA 2OXOA 5KFLA 2YB4A 4I2AA 4EENA 1TK5A 1ZQHA 2KE7A 2XTQA 1ZQRA 2ISPA 9ICHA 2NRZA 8ICUA 2ASDA 1Z3EB 3SAGA 2V4QA 4AYNA 2FMSA 1HUOA 5DBAA 5HNKA 1X6JA 4ED0A 5H2FU 8ICZA 4K4GA 4JMUA 4DFJA 3BRZA 3MDCA 4IQTA 4IR1A 3S6JA 4DOBA 4JWMA 4ECUA 1C7YA 3PGRA 3GP6A 2ATLA 5ALDA 3LK3A 4YXJA 4MEXA 3C5GA 4B9VA 4O4UA 1GO3F 2QKQA 3K4GA 1CI4A 2BPFA 3QXGA 5J2KA 3RH4A 5ALRA 2RDJA 5DB8A 1HIWA 4NLCA 1S0NA 4KX5A 4UB1A 2YPVA 5L1JA 4GC6A 3KD3A 1U47A 3VY8X 2PI4A 5G39A 4RQMA 1Z19A 3D6JA 2KP7A 4RQ1A 5ALSA 4Q8FA 3DZMA 5HHHA 2H3IA 5KL8B 2OYYA 3RH5A 1PVPA 5KT4A 2FMPA 2DFLA 4NLNA 4J9SA 3AL0B 1YZ7A 4I2JA 2ZIWB 4JK1A 2ES6A 1XO1A 2JRZA 1SL1A 9ICAA 4YR2A 4F91B 1BVSA 1EXNA 3BQ2A 3PO4A 1E54A 3C1ZA 3UMGA 3QZ7A 3C2KA 4J9QA 9ICLA 1ZD4A 3OJUA 2HI0A 1LV5A 2HVIA 4NXZA 3U26A 4QJFB 4AYEC 2FMQA 1U49A 1WUDA 4OJ5A 1XSPA 3NSGA 2W3RA 1G90A 2PMZF 4TUPA 4R66A 4GXKA 5AICA 9ICSA 9ICMA 1ZQPA 5AKGA 2YB1A 1XWLA 5KG4A 4M9HA 3V6KA 1ZQNA 1WYGA 1AQ6A 1DGJA 4DFDA 3ISBA 3SY7A 4MFCA 5PRNA 1TAMA 4FZNA 3QRCA 5DDYA 1X6IA 2VIXA 2JGAA 5KTQA 4ECZA 4M6WA 9ICGA 4C7YA 3RB4A 3JPOA 2IOFA 2F1JA 7ICPA 1L6NA 2LPEA 1ZHXA 1HJPA 5EWEA 5KFTA 2E5SA 5KT5A 2R4PA 2FLLA 2LHFA 5DQHA 5AM5A 3KHHA 3J81j 4P2HA 5HMLA 4FS1A 4KTQA 9ICFA 5J0SA 3AA6A 3SI8A 3QEAZ 4OJLA 2ODGA 7ICSA 5CRXA 2FE9A 1J2NA 5IIIA 4DLEA 2HW3A 3DWNA 2KG5A 5GTIU 3DV9A 2R8HA 2EAMA 2A1JB 3QUTA 3PW4A 1QJPA 2W43A 4JV2A 4Y2SA 3KZIU 1CEZA 3JCUO 2X27X 3MBYA 4O3WA 1UT8A 3M9OB 4GC7A 4Z6DA 2IWWA 1N62A 2B0CA 3AAAB 3RRGA 4ECRA 3BJYA 4R65A 3TZGA 4G75A 5AKZA 2YMLA 2DUYA 4CE6A 4KLLA 5KFHA 8ICXA 3OHBA 5ADXK 1KL9A 2B6GA 1PVRA 4OJ6A 3PW0A 3M8SA 2C2RA 2YX8A 1NZBA 2K4EA 3H8JA 4F2RA 3V8UA 4KLSA 4Z3TA 2E8MA 4AYBF 3QUCA 8ICVA 3RB3A 4YXMA 4RQ3A 2BKEA 4C4RA 2NRVA 1BNPA 2AQ0A 1O08A 5AI6A 4YMOA 4FRXA 3IM1A 3Q8PB 1PK1A 3DA4A 4AKRB 2W8LA 4CDGA 8ICJA 4AYDC 2DGZA 4DF4A 3UM9A 5JU5A 2JZBB 4QZCA 2M0NA 4DS5A 4QW8A 2K8AA 3PSTA 4BXOB 4B9NA 1Z4OA 2XY6A 5AKEA 4P0QA 1N2XA 4IQWA 2UVRA 5KFXA 2AHOB 4O3RA 2LYBA 4O9MA 4M9LA 3BZCA 1A6SA 3B0YA 3GV8B 1HXTA 4C4VA 2C28A 1MM5A 3AQFA 1DK2A 5ALIA 4O3QA 7ICHA 3M1YA 2OCEA 1ZJMA 7ICUA 4PHDA 4LSFA 4I28A 1IG6A 2YMPA 4GFJA 2XMXA 1L3SA 2HBKA 1L8LA 3LDAA 3SAFA 5KFEA 2XE3A 4O0IA 3BZKA 1QJ9A 4UAVA 4IL6U 3RAXA 1WCNA 4M04A 3UAQA 2QB0A 2HSZA 2KOBA 5J0QA 1BPEA 5DGBA 4ELVA 4GXIA 2OHFA 3RBHA 3ETRA 4QZHA 4ED6A 2PFQA 3RRHA 2K0LA 1TAUA 2YNKA 2ODJA 1B4FA 1N5WA 1QQ5A 1T8EA 4RNNA 5H2FO 2K4HA 1MSWD 3LVVA 1ED1A 1PUZA 4QZBA 5DL6A 4D65A 2IHMA 3UXPA 4RNMA 9ICBA 2EQYA 2H3ZA 3E0FA 4Z6FA 8PRNA 4YR3A 4QZ9A 3WKDA 2RP5A 3OJSA 5L1LA 4ECVA 3QE9Y 2R8GA 3TAPA 4AYMC 4KLUA 2KTQA 4Y2QA 1L5UA 1ZJNA 2HHTA 2XO7A 2HHUA 1KFSA 1U9LA 1ZYQA 4XNLA 3PW5A 4F5RA 2F77X 3KHRA 1PRNA 3LYSA 2R4LA 3GV7B 4GCSA 4EZ9A 4I2DA 1KKXA 3CW2C 5AKYA 8ICMA 1XNSA 4I2HA 7ICEA 1Q3UA 5AKXA 8ICSA 3V72A 2K8CB 2W03A 4YG2A 3KFUF 8ICCA 3BQ0A 4B9LA 4RLCA 1F44A 1ORMA 2XGPA 3L3FX 3SZ2A 5DL8A 4O5KA 1S5LU 4IRDA 4U9CA 1UQVA 2KFZA 4Y2JA 2QTKA 4DLGA 5F9LA 3N7SC 4RQ0A 3GIJA 5EE2A 4JV1A 3SEIA 4DQSA 2XIDA 2BDPA 1ZQXA 2HHVA 3F53A 2RHFA 8ICEA 5CR0A 5EOZA 1JRPA 4RQNA 2BZFA 1BGXT 3HILA 2CN1A 4PZNA 2BCVA 5J2FA 1NKEA 2KJ9A 4FZMA 3IDWA 1ZETA 1VLBA 4NLKA 1Q46A 4RU9A 1YZ6A 1ZQUA 2W81C 3F2CA 3K19A 4RLBA 3D2SA 2EDUA 5J2IA 4O5CA 5ALYA 5KFPA 1ZQVA 2FPLA 3PSIA 4GF4A 5KFKA 2BPGA 1ZHTA 2F2AB 5G5GA 2A19A 4UQGA 1X9MA 1ZQZA 4AKMA 1PHOA 3UPQA 1U48A 4JV0A 3Q8QB 4AYID 1KBUA 2E1FA 3K75D 2N1RA 2K8BB 1OUQA 3HOEA 2XCAA 4C8MA 3V6JA 4FSOA 2MNHA 2H3QA 4EEYA 4NWIA 4R8UA 1JI7A 1TV9A 5DKWA 4AFKA 2I9GA 2HBJA 3UXOA 5C0YA 4FO6A 2V9WA 1PVQA 2Q4TA 1GFOA 9ICKA 4B61A 2M9NA 4EELA 4TUQA 3WK4A 5DLFA 3BQ7A 2G5IB 4Y2UA 5GTIO 4RPXA 1BH3A 3BS5A 4USAA 3AA0B 1D9FA 3H4DA 4F5OA 1NKBA 2G5HB 5DDMA 3MGHA 4C4TA 2VA3A 3KZIO 1Q9FA 4QZDA 3MFHA 5KFQA 4YD1A 9ICVA 2R89A 3M9NB 5J0RA 3QU2A 1L7NA 3QUBA 3SY9A 4M6WB 4PL2A 4O49A 2IMWP 3VC8A 4AP9A 2BR0A 3GFKB 1U4BA 3WKAA 1X9SA 2KZ3A 3C2MA 2EZYA 2MHLA 3PX4A 3GIKA 3WKCA 4K3BA 3KHGA 7ICLA 2ZTEA 9ICQA 1T3QA 4A8EA 2FJ6A 4HAIA 3PF1A 5DQGA 1BPBA 4C0ZA 1QLNA 2JEGA 2K89A 4RQ2A 2JEIA 1ZHYA 4PGQA 3LK42 3SYZA 2ZLDA 8ICFA 4ED3A 1IZNA 2PFNA 3AA6B 3LK41 5ALFA 1HXXA 2NV3A 4M47A 3H8SA 3DEEA 3SZVA 3VE2A 3KHLA 1ZQQA 2WB1C 4BUGA 2ZIUB 3Q8MA 4CRXA 3ED5A 3T5HA 4G9BA 2XY7A 4F4XA 4FUVA 5HR6A 3UQ0A 2KZ7B 3IRUA 4KR8A 1CUKA 3RJFA 2F1TA 3PORA 3SQIA 4KLDA 1ZQWA 6PRNA 2PKEA 2WF7A 1NJZA 1NZPA 5AM1A 2J6TA 7ICMA 3GQCA 2EAOA 1Z1VA 1XU4A 4RQ8A 1Q8KA 2D6FC 2W9CB 3FDSA 2GOLA 4XRHA 3FYXA 3SR6A 4CF4A 2Q0ZX 3QYPA 1ZQEA 4NJ8A 4JFBA 8ICAA 1S76D 1GFPA 4Z6EA 3JTYA 4I2GA 2JEJA 5ALZA 2F76X 1QSLA 2KSOA 4BX9C 5DB6A 2AQ4A 5ALXA 2HOIA 4IQUA 2YMQA 5KFDA 4M9JA 1SGGA 7ICNA 1YS5A 1KFDA 4EYIB 3HKZF 5KFRA 1BPDA 2D3DA 2P6RA 2HOFA 4IL6O 2PXIA 2BCQA 4FOZA 5K4LA 3VZTX 3KBBA 4NLZA 1SWVA 2JR5A 1JX4A 1NOMA 5L9XA 1RQNA 5EE9A 3ZI4A 4O3NA 5IIOA 1ZD3A 1MM4A 4QQ1A 3R9KA 3RJJA 4RT2A 3MR5A 5AM3A 3RB0A 1O03A 3HJEA 1SL2A 4NY8A 1QQ7A 3SD7A 4MEYA 3FM9A 5L1IA 3SYBA 1ZQKA 1RPLA 2Y9TA 3OTQA 4R64A 5KFOA 2E3TA 4P0QB 5DB7A 3MDAA 1RYUA 3MFIA 4OO1J 3CP8A 3WKEA 4FBTA 1FO4A 8ICRA 5HP4A 3RJEA 2C2EA 4FZLA 4I2EA 3G6XA 4DL5A 4CCHA 4PZOA 9ICJA 3OGUA 4KLTA 3NGDA 2YY6A 3AAEA 2Z7JA 3T3FA 4DSKA 5ALKA 1RZTA 3MR2A 2BQRA 3KOOA 2Y0SF 5CB1A 7ICFA 5ALWA 5KFVA 1MA7A 2J6UA 2DPIA 5EE1A 4ECTA 1FFUA 3PMLA 1SZHA 3AA7A 3WK5A 3QEBZ 9ICWA 2EZXA 3I76A 5KAIU 1Y88A 3E2EA 5AI5A 4O3ZA 1VJ5A 2QB0B 4QIWF 1NK9A 3QRAA 1CRXA 2HBMA 5G26A 3LWMA 5DQIA 1ZQGA 1SL0A 1MQ3A 4DS4A 4DF8A 1QTMA 3CRXA 3ISCA 4JCHA 1UA1A 1S5LO 3NJTA 2K60A 5AK4A 2VKQA 5KFNA 5KFWA 3PZPA 2LBOA 5TISO 1XO0A 3ZDAA 5DBCA 5KFFA 3UQ2A 4Z6CA 5AI4A 4IQVA 8ICIA 5DG8A 3C1YA 1WG8A 2IOFK 2ZJ8A 2MSNA 3MABA 1NKCA 4OCZA 1ECWA 5DG9A 1L7MA 1IM4A 3GIIA 3UMBA 3PX6A 3IP4B 5KG3A 2ZG6A 1SV0C 5ALHA 1BPXA 2PI5A 5CJ7A 2ZUBA 2GO7A 5T5FA 1Z1BA 1A0PA 4Q43A 2V4RA 4C8KA 5AI8A 1BPZA 1ZQSA 4M9GA 4ED8A 5J29A 2BGWA 5IYUA 3HW8A 9ICUA 4CTDA 5D4BA 1TK0A 3FYHA 4PGYA 1RQLA 4RT3A 3SZDA 4B6JA 2WVPA 3A0BU 4YN4A 3ZDBA 2KIVA 3A2SX 1KSPA 1KDHA 4RQ7A 4QZIA 1LKYA 1FEZA 5AKJA 4P0PA 9ICXA 2KVCA 4PHAA 2L5YA 3H7IA 1XC9A 7ICVA 2KKPA 2AH5A 1T1LA 5G38A 4PUXA 4LJXA 4RL9A 4UB2A 5IIKA 2HHSA 3QUQA 3AA1B 3H8WA 5KG5A 5GTHU 1SXEA 1BXWA 2R8KA 2NRWA 3MR3A 4F5NA 1OW5A 1ZQDA 5J0PA 2FPKA 1GFNA 1ZRNA 4BJQA 1TE2A 2LM4A 5JDPA 4NLGA 2K4TA 4UB4A 3PY8A 3PGUA 3QNMA 3LK2B 5HMMA 5EWGA 3C28A 2PMZC 1S77D 1L7OA 2GLEA 1ZQJA 1V85A 1ZQMA 1ZQLA 1P7DA 1GFMA 4WJ3B 2G07A 2XY5A 1JROA 4F2SA 1T4GA 1Z00B 3ONNA 3POQA 3RJKA 3T20A 3I28A 4DL6A 5EE0A 2R8JA 4R63A 3AU2A 4R8UB 4PPXA 1C20A 1IIPA 3M6KA 3WK6A 2KXPA 8ICOA 4LSHA 4PH5A 1UCVA 3DA3A 2K4PA 4U7CA 3RBDA 1D8YA 1S0MA 2XG6A 3SV4A 4YQWA 2F1HA 2W9MA 4LSEA 5KG2A 4I29A 4YMMA 2G08A 2LKYA 2R18A 2G09A 2C22A 4MFFA 2R8AA 1VDVA 1X42A 5ALVA 3BS0A 2LMRA 5DL5A 4KLOA 4J9MA 1ZD2P 2HVHA 5ALNA 4B9TA 4X5VA 3CYMA 5J2JA 2ZIWA 4D64A 2BHNA 4KLIA 2R88A 4IRKA 5DLGA 4YP3A 2R4NA 5BOMA 4J9LA 1JXEA 3WK8A 2XI9A 4F5QA 3PQUA 1J2MA 3TACB 4Y2PA 4FMSA 5J0WA 4O3XB 1WCLA 8ICHA 2RLTA 4DSJA 2EANA 2EZZA 5KT2A 1TVAA 1RXWA 1TK8A 2ZTDA 3WU2U 4EZ6A 3AN1A 4KMOB 1COOA 3JPSA 5AFUK 2ZIVA 4DWIA 3TI0A 2KD1A 3PMNA 4N59A 3LVWA 2HDOA 1QSYA 4ZH4A 4I2IA 4B9UA 1DOQA 5KAFU 3M8RA 3C21A 2KC0A 3L5KA 1KEJA 5C5JA 3OHAA 4AYBC 4J9PA 4DL4A 2QARB 4EEKA 3T5KA 1OSMA 1RM6C 4DOCA 3KZXA 4F72A 3POXA 1SV0A 4KN4A 2M07A 3RF9A 4ECYA 2F1VA 5AI9A 5KNIA 4MF2A 1N5XA 1MN8A 5IINA 2IWVA 2FDRA 4PGXA 1NJXA 2KJ5A 2IHNA 3EW9A 3QZ8A 4E0DA 3RJIA 4O5EA 5ALQA 5CHGA 3T0SA 1FIQA 5ALMA 3GIMA 4ELUA 4OD0A 2WAQF 1S9FA 1L3VA 3IV6A 1SV4A 2F8KA 4DSEA 4US8A 1THQA 4LZDA 2VA8A 1JALA 4IC9A 4EBCA 5TISU 3SYSA 3C5FA 3ZDDA 5KFGA 9ICRA 1N48A 3H0LB 4UAWA 2VJ5A 3VE1A 1ZQTA 1D8BA 3GILA 3H4BA 3QU9A 2G06A 3BS7A 2A1JA 5ALUA 4OJPA 5B66U 1ZRMA 3GDXA 1S10A 1NK7A 2ISOA 2DPJA 4UATA 1DGSA 7ICJA 2W55A 5CWRA 3TFSA 2NRTA 4MFAA 5KAIO 3K1RB 3LK3B 4J9RA 4KR4A 4XUSA 4FRTA 3T5LA 3WI5A 2AU0A 2EH9A 4TQRA 7ICKA 3AAAA 7ICOA 2HCFA 1NI3A 4BWJA 5AIAA 5KFUA 1URJA 2GE4A 4C00A 1MC8A 4RPYA 3OPXA 2KK0A 3HP6A 2FGRA 3MGIA 5ALJA 1N60A 4KN7A 3HPOA 3JPTA 2R4OA 3FAHA 5T14A 3N97B 4Y2VA 4KLHA 4MHVA 3RBEA 2N2MA 2K4IA 2KFNA 2W3SA 4ED7A 4DL7A 2WB1F 5ALOA 1LVHA 1N61A 5KFIA 2W7OA 1L7PA 4Q44A 4BWMA 1Z4NA 4DQRA 1A76A 4N75A 4YCXA 2W9BA 2OEHA 2KJ8A 1S8OA 2WTFA 2KHQA 3RR7A 1Q9GA 4KLJA 3BRYA 5KFMA 5IILA 1GFQA 4KLFA 1NK4A 4UB5A 3PR5B 2JZBA 3EMNX 1SKWA 4DFKA 4J9KA 4F4ZA 2GH1A 3C5OA 1WWVA 2A1AA 4ELTA 2KICA 2HMXA 4BXOA 3KTQA 3G6VA 4MF8A 5EE3A 4GIBA 4P4PA 5G5HA 4RJXA 4F92B 2CXYA 5KFZA 5AK3A 1V97A 3M7DA 3EWAA 5KT6A 3A0BO 1V38A 1KW4A 3WI4A 2VA2A 2I1QA 4ECXA 1S97A 2CPRA 2BCUA 5KFSA 5J0TA 3RTVA 4N74A 4QZFA 1SKRA 2IOHA 1H38A 3B9JA 4TQSA 5E79O 1T3NA 3I1YA 3IG5A 1K1QA 2H5XA 2AGPA 7ICIA 2W04A 4AUIA 1HXUA 1L8OA 1UHUA 1ZQCA 4U6PA 5GTHO 4LVSA 1L3TA 3BDPA 3VCBA 2I5HA 1PK3A 5J2AA 5CEHA 5J2CA 2F8LA 4J9OA 3PW2A 2P66A 4C7ZA 5KG0A 3RJGA 2ERVA 4DO9A 1B43A 5KFAA 2W80C 3V7JA 3V7KA 4D5UA 5DB9A 4UASA 4J9NA 2H3VA 5TZVA 2Y0HA 1T16A 4O4XA 5JTIA 4AZLA 3MGVA 4ACOA 3HOLA 2P35A 1K5OA 4F8RA 2HHXA 1NJYA 4EX6A 7ICGA 5JUMA 2I6XA 4JWNA 3AMZA 3TADA 4QNLA 1DXSA 3DDHA 4UARA 4GCQA 4LSIA 1IV8A 3VZUX 1B0XA 2MRLA 2KNJA 1NK0A 1RYRA 2MUTA 1ZQIA 1UA0A 2ZXIA 5CP2A 2PFOA 4O3SA 3AU6A 1ZHWA 4XQ8A 4DSLA 7PRNA 3QX7A 2LYAA 4EBEA 2KHVA 2KEYA 1N63A 4IS7A 4DL2A 4FFDA 1SZPA 2JH1A 4Y2TA 3ICXA 2F1CX 4ED2A 4M2YA 3F2DA 2LM1A 1PK1B 4BUMX 1T7PA 3OSNA 5ADXL 2KIWA 2AXTU 4DSIA 5DBBA 2RDIA 4CF5A 2Y2XA 2W11A 1ZQFA 8ICTA 4ECWA 1ZHZA 3HW9A 4Q8EA 2HOQA 4FS2A 3WU2O 4C80A 2QB1A 1QQ6A 1NK8A 2ZIXA 3NASA 1X9XA 3ZD8A 4C4VB 2KXPB 3NUQA 3O0FA 1SKSA 2MA1A 5KAFO 5D49A 3QU5A 1TAQA 3G7GA 2YQEA 4DEZA 4QWBA 8ICLA 4FESA 4PJ0U 2Y9UA 4UB6U 5AKLA 4YFKA 2H3FA 1BPYA 2W9AA 1SB3C 3TFRA 3Q8KA 3EYZA 5G3AA 1IXRA 2OM6A 4B9SA 3SV3A 2AJQA 4M0AA 5A0LA 5ALGA 1KN5A 4F71A 4K3CA 4DCCA 1XSNA 4DQIA 2JEFA 4PR7A 4GLXA 3OSPA 3UU2A 3PV8A 3UMCA 3ISDA 5AHXA 2WFAA 1J97A 4F93B 3D2NA 2ZIVB 1OXJA 1QCKA 2EAPA 3EPIA 1B22A 2DBYA 4RUAA 3C2LA 3A0HU 4XNKA 5B66O 1RXVA 3AA0A 4YVZA 1YT3A 3QU4A 4E1SA 3EUB2 5AKKA 4O3OA 2FLPA 2DL0A 3PO5A 2X9KA 4C8NA 2DKZA 3TARA 2AGOA 2QLTA 1XSLA 4KLGA 3HKZC 2ZJAA 2Y1IA 2C2DA 3N7RC 3RR8A 2FLNA 1U45A 2KMDA 3T24A 1F0MA 2XCPA 3C23A 3NRWA 5AM2A 4DOAA 5AFUL 1UPHA 2JQYA 3NVVA 1L3UA 2ZJ5A 3SAHA 3N28A 2KZZA 4KLMA 2NO4A 1DRGA 5J2BA 5JRTA 5KG1A 4I2FA 4K4HA 4ED1A 5HR7A 1SIJA 3JPPA 4UAYA 4RQ5A 3B0XA 3DWOX 1TFRA 1KTQA 3BQTA 2BDUA 9ICCA 2XICA 1HEKA 3V6HA 3H0MB 2JXJA 2ZIUA 5E79U 8ICBA 4LZGA 1NK6A 4UW9A 2Y0LA 1ZD5A 3PVXA 3K1ZA 3L4PA 4RQ6A 2KZ7A 2UVVA 4RZRA 3HT3A 8ICWA 3N4MB
chains in the Genus database with same CATH topology
2Y0SC 2G5IB 2HBLA 4AYBC 2E1EA 4PL1A 1HIWA 4NLCA 1BH3A 4KX5A 1OPFA 2YPVA 3AA0B 1OSMA 2G5HB 3VY8X 3O0EA 3KZXA 1Z19A 1Q9FA 3POXA 2XE2A 2M07A 2KKVA 3RF9A 2F1VA 4QIWC 2KJ5A 3SY9A 4G76A 2H3IA 4PL2A 2OYYA 5KL8B 2JMGA 3VC8A 1PVPA 4O49A 2J1NA 2XE1A 3T0SA 2XE5A 4KRAA 3AL0B 2WAQF 2ZIWB 2MHLA 2VJ4A 2DQNB 1THQA 4A8EA 4RJWA 4IC9A 1E54A 4C0ZA 2JMMA 2K89A 1P4TA 3SYSA 1ZHYA 3LK42 2ZLDA 3H0LB 3VE1A 2VJ5A 1IZNA 1D8BA 3AA6B 4QJFB 3LK41 2G06A 4AYEC 4OJPA 5FVNA 1HXXA 1WUDA 2NV3A 4OJ5A 3SZVA 3DEEA 3NSGA 3VE2A 1G90A 2WB1C 2PMZF 4BUGA 2ZIUB 3M6ZA 3LK3B 4CRXA 4KR4A 4FE3A 4FRTA 4GCPA 3WI5A 4FUVA 5HR6A 2KZ7B 2YB1A 3AAAA 3F5AA 4KR8A 2F1TA 3PORA 3SQIA 6PRNA 1URJA 2GE4A 3SY7A 3OPXA 5PRNA 1TAMA 3F5EA 3IG8A 4FZNA 2FGRA 3QRCA 2D6FC 2VIXA 2JGAA 3GU3A 2GOLA 5T14A 3FYXA 2DF4B 1L6NA 2FGQX 2N2MA 4JFBA 1ZHXA 2K4IA 2M06A 1GFPA 2OH2A 2WB1F 3JTYA 2E5SA 2W7OA 4O3YA 2F76X 2LHFA 4BX9C 2O4VA 2Y7SA 4E1TA 2KJ8A 2HOIA 3PSFA 3AA6A 2KHQA 1Q9GA 4OJLA 4CGZA 1YS5A 5CRXA 3HKZF 1GFQA 2HOFA 4FOZA 3EMNX 3VZTX 1IZNB 2GH1A 3C5OA 2KV2A 1QJPA 2KICA 2HMXA 1MM4A 4QQ1A 4C69X 2X27X 4RJXA 4O3WA 3POUA 1BT9A 3AAAB 3M7DA 4F4BA 3SYBA 3WI4A 3TZGA 4G75A 4P0QB 2CRXA 2CPRA 4OO1J 3CP8A 5ADXK 4FZLA 1PVRA 1H6S1 4OJ6A 2RRDA 2YX8A 3IG5A 1NZBA 2K4EA 3AAEA 4FT6A 2Z7JA 1ZQ1C 3PQSA 3V8UA 4GHBA 4Z3TA 2W04A 4AUIA 2Y0SF 4AYBF 1HXUA 1MA7A 3PRNA 4U6PA 3VCBA 4O3MA 1MPFA 1SZHA 3T79A 3AA7A 2XTRA 2F8LA 4FRXA 2LFUA 3DA4A 4AKRB 4O3ZA 4NLBA 4QIWF 3QRAA 4CDGA 1CRXA 2HBMA 5G26A 2DGZA 4AYDC 2G0AA 3PSPA 2ERVA 2M0NA 4FSPA 2W80C 2KDYA 2K8AA 3PSTA 4D5UA 3CRXA 4JCHA 2W7PA 2H3VA 2VKQA 2Y0HA 4P0QA 3PZPA 1Q3VA 2LBOA 4O4XA 4AZLA 3MGVA 1XO0A 4ACOA 2LYBA 3HOLA 3GZFA 3N7PD 1A6SA 1HXTA 3ALRA 3AA1A 1MM5A 3AQFA 4QNLA 1T94A 4LSIA 4GCQA 3VZUX 2XVTA 2ZIXB 2MRLA 2KNJA 4LSFA 1ECWA 4GFJA 2XMXA 2ZXIA 2HBKA 3AAEB 3IP4B 3SAFA 2XE3A 1ZHWA 3KVDD 5DL7A 2ZG6A 4ICAA 3LK2A 1QJ9A 7PRNA 3UAQA 2LYAA 3SMVA 2KHVA 2KEYA 4AKRA 2JH1A 3ICXA 5T5FA 2OMFA 2KOBA 1Z1BA 1A0PA 2J4UP 3AA7B 3F2DA 2PRNA 2N2LA 5IYUA 3RBHA 4BUMX 2K0LA 2PORA 2YNKA 3SZDA 3VY9X 3A2SX 2ODJA 5ADXL 2KIWA 2JHDA 2JH7A 2Y0KA 2Y2XA 2K4HA 4NV0A 3LVVA 1ED1A 4P0PA 3H0RB 5DL6A 2KVCA 4D65A 1ZHZA 2KKPA 3HW9A 2HOQA 2H3ZA 4PUXA 3E0FA 4RL9A 8PRNA 2WAQC 2RP5A 2ZIXA 3RFAA 3VZWX 3UPGA 4AYMC 2KXPB 3AA1B 3NUQA 3O0FA 2MA1A 1BXWA 3G7GA 4XNLA 4KX3A 2F77X 1PRNA 3LYSA 1GFNA 4BJQA 4N58A 2LHTA 4FESA 3F2BA 4GCSA 5JDPA 5KL1B 2K4TA 2H3FA 1XNSA 3LK2B 3C28A 1Q3UA 2PMZC 2K8CB 2W03A 3KFUF 5GV0A 3AQEA 3C29A 4RLCA 1F44A 1ORMA 2OM6A 1P7DA 1GFMA 4WJ3B 2G07A 3L3FX 5DL8A 4U9CA 5A0LA 1QJ8A 3ONNA 3POQA 2QTKA 3T20A 3N7SC 2ZXHA 5EE2A 5D5DA 3UU2A 3D2QA 4OJOA 2XIDA 4P0PB 3D2NA 1IIPA 2ZIVB 3M6KA 3F53A 2RHFA 3IN5A 3HWBA 2KXPA 4XNKA 2CN1A 3AA0A 4LSHA 2KJ9A 4FZMA 1YT3A 2A3VA 4E1SA 3DA3A 4U7CA 2ZFGA 2XG6A 2OXOA 2W81C 4LSEA 2YB4A 3F2CA 3K19A 2G08A 2LKYA 2R18A 2G09A 4RLBA 3HKZC 3D2SA 3N7RC 5DL5A 2XTQA 3PSIA 4GF4A 3T24A 1ZHTA 2F2AB 3NRWA 3SAGA 4AKMA 3CYMA 2ZIWA 4D64A 4AYNA 1PHOA 5AFUL 4AYID 1UPHA 1KBUA 2E1FA 2N1RA 3SAHA 2K8BB 2XI9A 1OUQA 3HOEA 3PQUA 1DRGA 4FMSA 4JMUA 4O3XB 5HR7A 4FSOA 2MNHA 2H3QA 4NWIA 4AFKA 2HBJA 4KMOB 5C0YA 2BDUA 5AFUK 2XICA 2ZIVA 1HEKA 2KD1A 3GP6A 1PVQA 4N59A 3H0MB 2Q4TA 2ZIUA 3LVWA 1GFOA 3LK3A 2Y0LA 4O4UA 3K1ZA 4B61A 2KZ7A 1GO3F 2KC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G76 A;  4FZM A;  4N58 A;  4G75 A;  3DA4 A;  4FZN A;  4N59 A;  2XMX A;  3DA3 A;  2XTQ A;  2XTR A;  4FZL A; 
#chains in the Genus database with same CATH topology
 4C8L A;  2Y0S C;  2HBL A;  3WKB A;  2E1E A;  4PL1 A;  5L1K A;  2YN4 A;  4US9 A;  1OPF A;  2JV3 A;  1ZQO A;  2XC9 A;  5J0U A;  5IIM A;  3O0E A;  2W9C A;  5B5E U;  4CNQ A;  1TKD A;  2XE2 A;  2WF8 A;  2WF9 A;  2KKV A;  3TQ1 A;  3ZDE A;  4ECS A;  4QIW C;  9ICT A;  4G76 A;  2JMG A;  1KRP A;  1ARO P;  1JUD A;  4C8O A;  2J1N A;  2XE1 A;  2XE5 A;  4KRA A;  4QZG A;  2ASL A;  2VJ4 A;  4UB8 U;  5F3X B;  2DQN B;  4PHE A;  3KKA C;  1WWU A;  5KG7 A;  4K4I A;  4B9M A;  5ALL A;  4QWC A;  2IA6 A;  3RB6 A;  4FBU A;  7ICQ A;  2ESE A;  4RJW A;  9ICP A;  3MR6 A;  3JPR A;  4PHP A;  5J8Y C;  2JMM A;  1P4T A;  4Y2Y A;  4NL9 C;  2LI6 A;  2W9B B;  8ICN A;  2F44 A;  5FP0 A;  3TKA A;  5KT7 A;  4DL3 A;  1COK A;  3SEN A;  3HWT A;  5FVN A;  3ORY A;  4UBB A;  2Y1J A;  2WJR A;  4I2B A;  1JN3 A;  4UB3 A;  1D8L A;  3E58 A;  1PZN A;  4ECQ A;  2MU2 A;  3M6Z A;  1ZQB A;  5L1M A;  4FE3 A;  4GCP A;  2BQU A;  3H8M A;  4I2C A;  8ICK A;  3F5A A;  4GXJ A;  3PNC A;  3QU7 A;  3TAQ A;  1SWW A;  4P4O A;  1X9W A;  5EWF A;  5J0Y A;  3Q8R B;  1HUZ A;  5KT3 A;  3BS5 B;  1JMS A;  4EBD A;  3F5E A;  3IG8 A;  2NRX A;  3LK9 A;  2ZTC A;  4RQ4 A;  3EPG A;  3GU3 A;  3V7L A;  8ICQ A;  2DF4 B;  2FGQ X;  1JXL A;  4BGD A;  4I27 A;  2M06 A;  3ETL A;  2OH2 A;  8ICP A;  1XS9 D;  3THV A;  3Q8S B;  1X66 A;  4O3Y A;  4QWE A;  4F4Y A;  5J2H A;  2WJQ A;  9ICO A;  3GV5 B;  2O4V A;  2Y7S A;  4E1T A;  5AKI A;  4DQQ A;  3NTU A;  3PSF A;  4QWA A;  4NM2 A;  4CGZ A;  4BDP A;  4YMN A;  1IZN B;  4QW9 A;  4KLQ A;  2KV2 A;  5KFC A;  3NRZ A;  3RAQ A;  9ICE A;  3JPN A;  1X2I A;  2ZUC A;  2WF5 A;  4C69 X;  3FC4 A;  3TAN A;  3RJH A;  1NJW A;  3POU A;  1BT9 A;  1KQQ A;  1ZOL A;  2WF6 A;  4F4B A;  5IIJ A;  3CNH A;  5KFB A;  5AK6 A;  2AXT O;  3RH6 A;  4RPZ A;  3PX0 A;  2YTU A;  2CRX A;  4TUS A;  1ZQA A;  5CA7 A;  5KFY A;  3IHQ B;  4EX7 A;  4Y2R A;  2LYH A;  1H6S 1;  3M9M B;  3TAD C;  2RRD A;  3HRD D;  3AUO A;  4FT6 A;  4UAZ A;  3JPQ A;  1ZQ1 C;  4JUZ A;  8ICY A;  1KLN A;  5BOL A;  3PQS A;  4GHB A;  5KFJ A;  2MUT B;  4J03 A;  3PRN A;  3NS1 A;  2P6U A;  4YR0 A;  1RYS A;  4O3M A;  2AGQ A;  2KSO B;  1MPF A;  3T79 A;  4JB3 A;  3BQ1 A;  5AIB A;  3ZD9 A;  2XTR A;  2E8P A;  4PJ0 O;  5KG6 A;  8ICG A;  2LFU A;  2GWS A;  4M9N A;  1JIH A;  4Y2X A;  4NLB A;  4UB6 O;  2NO5 A;  2UVW A;  1K1S A;  2VAN A;  2G0A A;  3PSP A;  5D46 A;  4EYH B;  2W8K A;  2MAX A;  2BQ3 A;  4FSP A;  4C4S A;  1BNO A;  2KDY A;  2W7P A;  2R8I A;  4IRC A;  1SXD A;  4O3P A;  4HYK A;  1Q3V A;  3H40 A;  4KIT B;  4DFM A;  5AI0 A;  2OWO A;  3GZF A;  3N7P D;  4QZE A;  5AK5 A;  3ALR A;  3AA1 A;  2YMM A;  1T94 A;  4UBC A;  2E8O A;  1KFT A;  1X40 A;  2XVT A;  5DGA A;  2ZIX B;  4CF3 A;  5BPC A;  4F50 A;  2FPM A;  3KKA A;  3A0H O;  3AAE B;  1D9D A;  7ICR A;  3KVD D;  5J0X A;  5DL7 A;  2UVU A;  4QZ8 A;  5J8Y A;  3LWL A;  4DFP A;  4ICA A;  7ICT A;  3LK2 A;  3WK9 A;  4NL9 A;  1RDF A;  5ALE A;  4RUC A;  5DG7 A;  2ASJ A;  3SMV A;  1RG6 A;  4AKR A;  4QWD A;  1NNL A;  1A77 A;  2OMF A;  2J4U P;  1S0O A;  1S0V A;  3AA7 B;  1Z00 A;  9ICI A;  2PRN A;  4XA5 A;  2N2L A;  4P4M A;  3PW7 A;  2IBK A;  5J2E A;  2POR A;  3VY9 X;  3ZDC A;  4FQE A;  2JHD A;  2JH7 A;  2Y0K A;  3UXN A;  4NV0 A;  3H0R B;  2RQ5 A;  2W54 A;  4QZA A;  3PR4 A;  5HHI A;  3EZ5 A;  4KLE A;  5J2D A;  2DKX A;  3AEV A;  5AKH A;  2WAQ C;  3RFA A;  5ALP A;  3VZW X;  3UPG A;  1V9P A;  2XGQ A;  4F4K A;  1ZQY A;  1FFV A;  1UT5 A;  4DSF A;  5F9N A;  4KX3 A;  1NK5 A;  2FI1 A;  4N58 A;  2LHT A;  4KMU A;  5J2G A;  3F2B A;  2E8N A;  5KL1 B;  5AM4 A;  2KN7 A;  4YD2 A;  1N56 A;  1LB2 B;  5B5E O;  4DQP A;  4G3I A;  5GV0 A;  1QSS A;  1QH9 A;  3AQE A;  5AM0 A;  4F3O A;  2KZM A;  3C29 A;  2DWQ A;  4F4W A;  3MC1 A;  1QJ8 A;  3HX0 A;  2WHE A;  2PFP A;  3AM9 A;  4UB8 O;  4IR9 A;  2J6S A;  1ZXI A;  2NYV A;  4RNO A;  1F5S A;  2ZXH A;  3G6Y A;  2BCR A;  5D5D A;  2BCS A;  2KVS A;  2F3N A;  3D2Q A;  2B21 A;  1MQ2 A;  9ICN A;  1LKY B;  3NVZ A;  4OJO A;  4ZOH C;  1DK3 A;  4P0P B;  3T5J A;  2D8C A;  5J0O A;  5ALT A;  4NM1 A;  4F5P A;  3IN5 A;  2HHQ A;  3Q8L A;  3HWB A;  2ZUD A;  3WK7 A;  2F1I A;  2ALZ A;  2QAR A;  4Q45 A;  3NVY A;  3PGS A;  4UAU A;  3NVW A;  2A3V A;  2HHW A;  2BPC A;  4TUR A;  1M6Y A;  2ZFG A;  2O6K A;  2OXO A;  5KFL A;  2YB4 A;  4I2A A;  4EEN A;  1TK5 A;  1ZQH A;  2KE7 A;  2XTQ A;  1ZQR A;  2ISP A;  9ICH A;  2NRZ A;  8ICU A;  2ASD A;  1Z3E B;  3SAG A;  2V4Q A;  4AYN A;  2FMS A;  1HUO A;  5DBA A;  5HNK A;  1X6J A;  4ED0 A;  5H2F U;  8ICZ A;  4K4G A;  4JMU A;  4DFJ A;  3BRZ A;  3MDC A;  4IQT A;  4IR1 A;  3S6J A;  4DOB A;  4JWM A;  4ECU A;  1C7Y A;  3PGR A;  3GP6 A;  2ATL A;  5ALD A;  3LK3 A;  4YXJ A;  4MEX A;  3C5G A;  4B9V A;  4O4U A;  1GO3 F;  2QKQ A;  3K4G A;  1CI4 A;  2BPF A;  3QXG A;  5J2K A;  3RH4 A;  5ALR A;  2RDJ A;  5DB8 A;  1HIW A;  4NLC A;  1S0N A;  4KX5 A;  4UB1 A;  2YPV A;  5L1J A;  4GC6 A;  3KD3 A;  1U47 A;  3VY8 X;  2PI4 A;  5G39 A;  4RQM A;  1Z19 A;  3D6J A;  2KP7 A;  4RQ1 A;  5ALS A;  4Q8F A;  3DZM A;  5HHH A;  2H3I A;  5KL8 B;  2OYY A;  3RH5 A;  1PVP A;  5KT4 A;  2FMP A;  2DFL A;  4NLN A;  4J9S A;  3AL0 B;  1YZ7 A;  4I2J A;  2ZIW B;  4JK1 A;  2ES6 A;  1XO1 A;  2JRZ A;  1SL1 A;  9ICA A;  4YR2 A;  4F91 B;  1BVS A;  1EXN A;  3BQ2 A;  3PO4 A;  1E54 A;  3C1Z A;  3UMG A;  3QZ7 A;  3C2K A;  4J9Q A;  9ICL A;  1ZD4 A;  3OJU A;  2HI0 A;  1LV5 A;  2HVI A;  4NXZ A;  3U26 A;  4QJF B;  4AYE C;  2FMQ A;  1U49 A;  1WUD A;  4OJ5 A;  1XSP A;  3NSG A;  2W3R A;  1G90 A;  2PMZ F;  4TUP A;  4R66 A;  4GXK A;  5AIC A;  9ICS A;  9ICM A;  1ZQP A;  5AKG A;  2YB1 A;  1XWL A;  5KG4 A;  4M9H A;  3V6K A;  1ZQN A;  1WYG A;  1AQ6 A;  1DGJ A;  4DFD A;  3ISB A;  3SY7 A;  4MFC A;  5PRN A;  1TAM A;  4FZN A;  3QRC A;  5DDY A;  1X6I A;  2VIX A;  2JGA A;  5KTQ A;  4ECZ A;  4M6W A;  9ICG A;  4C7Y A;  3RB4 A;  3JPO A;  2IOF A;  2F1J A;  7ICP A;  1L6N A;  2LPE A;  1ZHX A;  1HJP A;  5EWE A;  5KFT A;  2E5S A;  5KT5 A;  2R4P A;  2FLL A;  2LHF A;  5DQH A;  5AM5 A;  3KHH A;  3J81 j;  4P2H A;  5HML A;  4FS1 A;  4KTQ A;  9ICF A;  5J0S A;  3AA6 A;  3SI8 A;  3QEA Z;  4OJL A;  2ODG A;  7ICS A;  5CRX A;  2FE9 A;  1J2N A;  5III A;  4DLE A;  2HW3 A;  3DWN A;  2KG5 A;  5GTI U;  3DV9 A;  2R8H A;  2EAM A;  2A1J B;  3QUT A;  3PW4 A;  1QJP A;  2W43 A;  4JV2 A;  4Y2S A;  3KZI U;  1CEZ A;  3JCU O;  2X27 X;  3MBY A;  4O3W A;  1UT8 A;  3M9O B;  4GC7 A;  4Z6D A;  2IWW A;  1N62 A;  2B0C A;  3AAA B;  3RRG A;  4ECR A;  3BJY A;  4R65 A;  3TZG A;  4G75 A;  5AKZ A;  2YML A;  2DUY A;  4CE6 A;  4KLL A;  5KFH A;  8ICX A;  3OHB A;  5ADX K;  1KL9 A;  2B6G A;  1PVR A;  4OJ6 A;  3PW0 A;  3M8S A;  2C2R A;  2YX8 A;  1NZB A;  2K4E A;  3H8J A;  4F2R A;  3V8U A;  4KLS A;  4Z3T A;  2E8M A;  4AYB F;  3QUC A;  8ICV A;  3RB3 A;  4YXM A;  4RQ3 A;  2BKE A;  4C4R A;  2NRV A;  1BNP A;  2AQ0 A;  1O08 A;  5AI6 A;  4YMO A;  4FRX A;  3IM1 A;  3Q8P B;  1PK1 A;  3DA4 A;  4AKR B;  2W8L A;  4CDG A;  8ICJ A;  4AYD C;  2DGZ A;  4DF4 A;  3UM9 A;  5JU5 A;  2JZB B;  4QZC A;  2M0N A;  4DS5 A;  4QW8 A;  2K8A A;  3PST A;  4BXO B;  4B9N A;  1Z4O A;  2XY6 A;  5AKE A;  4P0Q A;  1N2X A;  4IQW A;  2UVR A;  5KFX A;  2AHO B;  4O3R A;  2LYB A;  4O9M A;  4M9L A;  3BZC A;  1A6S A;  3B0Y A;  3GV8 B;  1HXT A;  4C4V A;  2C28 A;  1MM5 A;  3AQF A;  1DK2 A;  5ALI A;  4O3Q A;  7ICH A;  3M1Y A;  2OCE A;  1ZJM A;  7ICU A;  4PHD A;  4LSF A;  4I28 A;  1IG6 A;  2YMP A;  4GFJ A;  2XMX A;  1L3S A;  2HBK A;  1L8L A;  3LDA A;  3SAF A;  5KFE A;  2XE3 A;  4O0I A;  3BZK A;  1QJ9 A;  4UAV A;  4IL6 U;  3RAX A;  1WCN A;  4M04 A;  3UAQ A;  2QB0 A;  2HSZ A;  2KOB A;  5J0Q A;  1BPE A;  5DGB A;  4ELV A;  4GXI A;  2OHF A;  3RBH A;  3ETR A;  4QZH A;  4ED6 A;  2PFQ A;  3RRH A;  2K0L A;  1TAU A;  2YNK A;  2ODJ A;  1B4F A;  1N5W A;  1QQ5 A;  1T8E A;  4RNN A;  5H2F O;  2K4H A;  1MSW D;  3LVV A;  1ED1 A;  1PUZ A;  4QZB A;  5DL6 A;  4D65 A;  2IHM A;  3UXP A;  4RNM A;  9ICB A;  2EQY A;  2H3Z A;  3E0F A;  4Z6F A;  8PRN A;  4YR3 A;  4QZ9 A;  3WKD A;  2RP5 A;  3OJS A;  5L1L A;  4ECV A;  3QE9 Y;  2R8G A;  3TAP A;  4AYM C;  4KLU A;  2KTQ A;  4Y2Q A;  1L5U A;  1ZJN A;  2HHT A;  2XO7 A;  2HHU A;  1KFS A;  1U9L A;  1ZYQ A;  4XNL A;  3PW5 A;  4F5R A;  2F77 X;  3KHR A;  1PRN A;  3LYS A;  2R4L A;  3GV7 B;  4GCS A;  4EZ9 A;  4I2D A;  1KKX A;  3CW2 C;  5AKY A;  8ICM A;  1XNS A;  4I2H A;  7ICE A;  1Q3U A;  5AKX A;  8ICS A;  3V72 A;  2K8C B;  2W03 A;  4YG2 A;  3KFU F;  8ICC A;  3BQ0 A;  4B9L A;  4RLC A;  1F44 A;  1ORM A;  2XGP A;  3L3F X;  3SZ2 A;  5DL8 A;  4O5K A;  1S5L U;  4IRD A;  4U9C A;  1UQV A;  2KFZ A;  4Y2J A;  2QTK A;  4DLG A;  5F9L A;  3N7S C;  4RQ0 A;  3GIJ A;  5EE2 A;  4JV1 A;  3SEI A;  4DQS A;  2XID A;  2BDP A;  1ZQX A;  2HHV A;  3F53 A;  2RHF A;  8ICE A;  5CR0 A;  5EOZ A;  1JRP A;  4RQN A;  2BZF A;  1BGX T;  3HIL A;  2CN1 A;  4PZN A;  2BCV A;  5J2F A;  1NKE A;  2KJ9 A;  4FZM A;  3IDW A;  1ZET A;  1VLB A;  4NLK A;  1Q46 A;  4RU9 A;  1YZ6 A;  1ZQU A;  2W81 C;  3F2C A;  3K19 A;  4RLB A;  3D2S A;  2EDU A;  5J2I A;  4O5C A;  5ALY A;  5KFP A;  1ZQV A;  2FPL A;  3PSI A;  4GF4 A;  5KFK A;  2BPG A;  1ZHT A;  2F2A B;  5G5G A;  2A19 A;  4UQG A;  1X9M A;  1ZQZ A;  4AKM A;  1PHO A;  3UPQ A;  1U48 A;  4JV0 A;  3Q8Q B;  4AYI D;  1KBU A;  2E1F A;  3K75 D;  2N1R A;  2K8B B;  1OUQ A;  3HOE A;  2XCA A;  4C8M A;  3V6J A;  4FSO A;  2MNH A;  2H3Q A;  4EEY A;  4NWI A;  4R8U A;  1JI7 A;  1TV9 A;  5DKW A;  4AFK A;  2I9G A;  2HBJ A;  3UXO A;  5C0Y A;  4FO6 A;  2V9W A;  1PVQ A;  2Q4T A;  1GFO A;  9ICK A;  4B61 A;  2M9N A;  4EEL A;  4TUQ A;  3WK4 A;  5DLF A;  3BQ7 A;  2G5I B;  4Y2U A;  5GTI O;  4RPX A;  1BH3 A;  3BS5 A;  4USA A;  3AA0 B;  1D9F A;  3H4D A;  4F5O A;  1NKB A;  2G5H B;  5DDM A;  3MGH A;  4C4T A;  2VA3 A;  3KZI O;  1Q9F A;  4QZD A;  3MFH A;  5KFQ A;  4YD1 A;  9ICV A;  2R89 A;  3M9N B;  5J0R A;  3QU2 A;  1L7N A;  3QUB A;  3SY9 A;  4M6W B;  4PL2 A;  4O49 A;  2IMW P;  3VC8 A;  4AP9 A;  2BR0 A;  3GFK B;  1U4B A;  3WKA A;  1X9S A;  2KZ3 A;  3C2M A;  2EZY A;  2MHL A;  3PX4 A;  3GIK A;  3WKC A;  4K3B A;  3KHG A;  7ICL A;  2ZTE A;  9ICQ A;  1T3Q A;  4A8E A;  2FJ6 A;  4HAI A;  3PF1 A;  5DQG A;  1BPB A;  4C0Z A;  1QLN A;  2JEG A;  2K89 A;  4RQ2 A;  2JEI A;  1ZHY A;  4PGQ A;  3LK4 2;  3SYZ A;  2ZLD A;  8ICF A;  4ED3 A;  1IZN A;  2PFN A;  3AA6 B;  3LK4 1;  5ALF A;  1HXX A;  2NV3 A;  4M47 A;  3H8S A;  3DEE A;  3SZV A;  3VE2 A;  3KHL A;  1ZQQ A;  2WB1 C;  4BUG A;  2ZIU B;  3Q8M A;  4CRX A;  3ED5 A;  3T5H A;  4G9B A;  2XY7 A;  4F4X A;  4FUV A;  5HR6 A;  3UQ0 A;  2KZ7 B;  3IRU A;  4KR8 A;  1CUK A;  3RJF A;  2F1T A;  3POR A;  3SQI A;  4KLD A;  1ZQW A;  6PRN A;  2PKE A;  2WF7 A;  1NJZ A;  1NZP A;  5AM1 A;  2J6T A;  7ICM A;  3GQC A;  2EAO A;  1Z1V A;  1XU4 A;  4RQ8 A;  1Q8K A;  2D6F C;  2W9C B;  3FDS A;  2GOL A;  4XRH A;  3FYX A;  3SR6 A;  4CF4 A;  2Q0Z X;  3QYP A;  1ZQE A;  4NJ8 A;  4JFB A;  8ICA A;  1S76 D;  1GFP A;  4Z6E A;  3JTY A;  4I2G A;  2JEJ A;  5ALZ A;  2F76 X;  1QSL A;  2KSO A;  4BX9 C;  5DB6 A;  2AQ4 A;  5ALX A;  2HOI A;  4IQU A;  2YMQ A;  5KFD A;  4M9J A;  1SGG A;  7ICN A;  1YS5 A;  1KFD A;  4EYI B;  3HKZ F;  5KFR A;  1BPD A;  2D3D A;  2P6R A;  2HOF A;  4IL6 O;  2PXI A;  2BCQ A;  4FOZ A;  5K4L A;  3VZT X;  3KBB A;  4NLZ A;  1SWV A;  2JR5 A;  1JX4 A;  1NOM A;  5L9X A;  1RQN A;  5EE9 A;  3ZI4 A;  4O3N A;  5IIO A;  1ZD3 A;  1MM4 A;  4QQ1 A;  3R9K A;  3RJJ A;  4RT2 A;  3MR5 A;  5AM3 A;  3RB0 A;  1O03 A;  3HJE A;  1SL2 A;  4NY8 A;  1QQ7 A;  3SD7 A;  4MEY A;  3FM9 A;  5L1I A;  3SYB A;  1ZQK A;  1RPL A;  2Y9T A;  3OTQ A;  4R64 A;  5KFO A;  2E3T A;  4P0Q B;  5DB7 A;  3MDA A;  1RYU A;  3MFI A;  4OO1 J;  3CP8 A;  3WKE A;  4FBT A;  1FO4 A;  8ICR A;  5HP4 A;  3RJE A;  2C2E A;  4FZL A;  4I2E A;  3G6X A;  4DL5 A;  4CCH A;  4PZO A;  9ICJ A;  3OGU A;  4KLT A;  3NGD A;  2YY6 A;  3AAE A;  2Z7J A;  3T3F A;  4DSK A;  5ALK A;  1RZT A;  3MR2 A;  2BQR A;  3KOO A;  2Y0S F;  5CB1 A;  7ICF A;  5ALW A;  5KFV A;  1MA7 A;  2J6U A;  2DPI A;  5EE1 A;  4ECT A;  1FFU A;  3PML A;  1SZH A;  3AA7 A;  3WK5 A;  3QEB Z;  9ICW A;  2EZX A;  3I76 A;  5KAI U;  1Y88 A;  3E2E A;  5AI5 A;  4O3Z A;  1VJ5 A;  2QB0 B;  4QIW F;  1NK9 A;  3QRA A;  1CRX A;  2HBM A;  5G26 A;  3LWM A;  5DQI A;  1ZQG A;  1SL0 A;  1MQ3 A;  4DS4 A;  4DF8 A;  1QTM A;  3CRX A;  3ISC A;  4JCH A;  1UA1 A;  1S5L O;  3NJT A;  2K60 A;  5AK4 A;  2VKQ A;  5KFN A;  5KFW A;  3PZP A;  2LBO A;  5TIS O;  1XO0 A;  3ZDA A;  5DBC A;  5KFF A;  3UQ2 A;  4Z6C A;  5AI4 A;  4IQV A;  8ICI A;  5DG8 A;  3C1Y A;  1WG8 A;  2IOF K;  2ZJ8 A;  2MSN A;  3MAB A;  1NKC A;  4OCZ A;  1ECW A;  5DG9 A;  1L7M A;  1IM4 A;  3GII A;  3UMB A;  3PX6 A;  3IP4 B;  5KG3 A;  2ZG6 A;  1SV0 C;  5ALH A;  1BPX A;  2PI5 A;  5CJ7 A;  2ZUB A;  2GO7 A;  5T5F A;  1Z1B A;  1A0P A;  4Q43 A;  2V4R A;  4C8K A;  5AI8 A;  1BPZ A;  1ZQS A;  4M9G A;  4ED8 A;  5J29 A;  2BGW A;  5IYU A;  3HW8 A;  9ICU A;  4CTD A;  5D4B A;  1TK0 A;  3FYH A;  4PGY A;  1RQL A;  4RT3 A;  3SZD A;  4B6J A;  2WVP A;  3A0B U;  4YN4 A;  3ZDB A;  2KIV A;  3A2S X;  1KSP A;  1KDH A;  4RQ7 A;  4QZI A;  1LKY A;  1FEZ A;  5AKJ A;  4P0P A;  9ICX A;  2KVC A;  4PHA A;  2L5Y A;  3H7I A;  1XC9 A;  7ICV A;  2KKP A;  2AH5 A;  1T1L A;  5G38 A;  4PUX A;  4LJX A;  4RL9 A;  4UB2 A;  5IIK A;  2HHS A;  3QUQ A;  3AA1 B;  3H8W A;  5KG5 A;  5GTH U;  1SXE A;  1BXW A;  2R8K A;  2NRW A;  3MR3 A;  4F5N A;  1OW5 A;  1ZQD A;  5J0P A;  2FPK A;  1GFN A;  1ZRN A;  4BJQ A;  1TE2 A;  2LM4 A;  5JDP A;  4NLG A;  2K4T A;  4UB4 A;  3PY8 A;  3PGU A;  3QNM A;  3LK2 B;  5HMM A;  5EWG A;  3C28 A;  2PMZ C;  1S77 D;  1L7O A;  2GLE A;  1ZQJ A;  1V85 A;  1ZQM A;  1ZQL A;  1P7D A;  1GFM A;  4WJ3 B;  2G07 A;  2XY5 A;  1JRO A;  4F2S A;  1T4G A;  1Z00 B;  3ONN A;  3POQ A;  3RJK A;  3T20 A;  3I28 A;  4DL6 A;  5EE0 A;  2R8J A;  4R63 A;  3AU2 A;  4R8U B;  4PPX A;  1C20 A;  1IIP A;  3M6K A;  3WK6 A;  2KXP A;  8ICO A;  4LSH A;  4PH5 A;  1UCV A;  3DA3 A;  2K4P A;  4U7C A;  3RBD A;  1D8Y A;  1S0M A;  2XG6 A;  3SV4 A;  4YQW A;  2F1H A;  2W9M A;  4LSE A;  5KG2 A;  4I29 A;  4YMM A;  2G08 A;  2LKY A;  2R18 A;  2G09 A;  2C22 A;  4MFF A;  2R8A A;  1VDV A;  1X42 A;  5ALV A;  3BS0 A;  2LMR A;  5DL5 A;  4KLO A;  4J9M A;  1ZD2 P;  2HVH A;  5ALN A;  4B9T A;  4X5V A;  3CYM A;  5J2J A;  2ZIW A;  4D64 A;  2BHN A;  4KLI A;  2R88 A;  4IRK A;  5DLG A;  4YP3 A;  2R4N A;  5BOM A;  4J9L A;  1JXE A;  3WK8 A;  2XI9 A;  4F5Q A;  3PQU A;  1J2M A;  3TAC B;  4Y2P A;  4FMS A;  5J0W A;  4O3X B;  1WCL A;  8ICH A;  2RLT A;  4DSJ A;  2EAN A;  2EZZ A;  5KT2 A;  1TVA A;  1RXW A;  1TK8 A;  2ZTD A;  3WU2 U;  4EZ6 A;  3AN1 A;  4KMO B;  1COO A;  3JPS A;  5AFU K;  2ZIV A;  4DWI A;  3TI0 A;  2KD1 A;  3PMN A;  4N59 A;  3LVW A;  2HDO A;  1QSY A;  4ZH4 A;  4I2I A;  4B9U A;  1DOQ A;  5KAF U;  3M8R A;  3C21 A;  2KC0 A;  3L5K A;  1KEJ A;  5C5J A;  3OHA A;  4AYB C;  4J9P A;  4DL4 A;  2QAR B;  4EEK A;  3T5K A;  1OSM A;  1RM6 C;  4DOC A;  3KZX A;  4F72 A;  3POX A;  1SV0 A;  4KN4 A;  2M07 A;  3RF9 A;  4ECY A;  2F1V A;  5AI9 A;  5KNI A;  4MF2 A;  1N5X A;  1MN8 A;  5IIN A;  2IWV A;  2FDR A;  4PGX A;  1NJX A;  2KJ5 A;  2IHN A;  3EW9 A;  3QZ8 A;  4E0D A;  3RJI A;  4O5E A;  5ALQ A;  5CHG A;  3T0S A;  1FIQ A;  5ALM A;  3GIM A;  4ELU A;  4OD0 A;  2WAQ F;  1S9F A;  1L3V A;  3IV6 A;  1SV4 A;  2F8K A;  4DSE A;  4US8 A;  1THQ A;  4LZD A;  2VA8 A;  1JAL A;  4IC9 A;  4EBC A;  5TIS U;  3SYS A;  3C5F A;  3ZDD A;  5KFG A;  9ICR A;  1N48 A;  3H0L B;  4UAW A;  2VJ5 A;  3VE1 A;  1ZQT A;  1D8B A;  3GIL A;  3H4B A;  3QU9 A;  2G06 A;  3BS7 A;  2A1J A;  5ALU A;  4OJP A;  5B66 U;  1ZRM A;  3GDX A;  1S10 A;  1NK7 A;  2ISO A;  2DPJ A;  4UAT A;  1DGS A;  7ICJ A;  2W55 A;  5CWR A;  3TFS A;  2NRT A;  4MFA A;  5KAI O;  3K1R B;  3LK3 B;  4J9R A;  4KR4 A;  4XUS A;  4FRT A;  3T5L A;  3WI5 A;  2AU0 A;  2EH9 A;  4TQR A;  7ICK A;  3AAA A;  7ICO A;  2HCF A;  1NI3 A;  4BWJ A;  5AIA A;  5KFU A;  1URJ A;  2GE4 A;  4C00 A;  1MC8 A;  4RPY A;  3OPX A;  2KK0 A;  3HP6 A;  2FGR A;  3MGI A;  5ALJ A;  1N60 A;  4KN7 A;  3HPO A;  3JPT A;  2R4O A;  3FAH A;  5T14 A;  3N97 B;  4Y2V A;  4KLH A;  4MHV A;  3RBE A;  2N2M A;  2K4I A;  2KFN A;  2W3S A;  4ED7 A;  4DL7 A;  2WB1 F;  5ALO A;  1LVH A;  1N61 A;  5KFI A;  2W7O A;  1L7P A;  4Q44 A;  4BWM A;  1Z4N A;  4DQR A;  1A76 A;  4N75 A;  4YCX A;  2W9B A;  2OEH A;  2KJ8 A;  1S8O A;  2WTF A;  2KHQ A;  3RR7 A;  1Q9G A;  4KLJ A;  3BRY A;  5KFM A;  5IIL A;  1GFQ A;  4KLF A;  1NK4 A;  4UB5 A;  3PR5 B;  2JZB A;  3EMN X;  1SKW A;  4DFK A;  4J9K A;  4F4Z A;  2GH1 A;  3C5O A;  1WWV A;  2A1A A;  4ELT A;  2KIC A;  2HMX A;  4BXO A;  3KTQ A;  3G6V A;  4MF8 A;  5EE3 A;  4GIB A;  4P4P A;  5G5H A;  4RJX A;  4F92 B;  2CXY A;  5KFZ A;  5AK3 A;  1V97 A;  3M7D A;  3EWA A;  5KT6 A;  3A0B O;  1V38 A;  1KW4 A;  3WI4 A;  2VA2 A;  2I1Q A;  4ECX A;  1S97 A;  2CPR A;  2BCU A;  5KFS A;  5J0T A;  3RTV A;  4N74 A;  4QZF A;  1SKR A;  2IOH A;  1H38 A;  3B9J A;  4TQS A;  5E79 O;  1T3N A;  3I1Y A;  3IG5 A;  1K1Q A;  2H5X A;  2AGP A;  7ICI A;  2W04 A;  4AUI A;  1HXU A;  1L8O A;  1UHU A;  1ZQC A;  4U6P A;  5GTH O;  4LVS A;  1L3T A;  3BDP A;  3VCB A;  2I5H A;  1PK3 A;  5J2A A;  5CEH A;  5J2C A;  2F8L A;  4J9O A;  3PW2 A;  2P66 A;  4C7Z A;  5KG0 A;  3RJG A;  2ERV A;  4DO9 A;  1B43 A;  5KFA A;  2W80 C;  3V7J A;  3V7K A;  4D5U A;  5DB9 A;  4UAS A;  4J9N A;  2H3V A;  5TZV A;  2Y0H A;  1T16 A;  4O4X A;  5JTI A;  4AZL A;  3MGV A;  4ACO A;  3HOL A;  2P35 A;  1K5O A;  4F8R A;  2HHX A;  1NJY A;  4EX6 A;  7ICG A;  5JUM A;  2I6X A;  4JWN A;  3AMZ A;  3TAD A;  4QNL A;  1DXS A;  3DDH A;  4UAR A;  4GCQ A;  4LSI A;  1IV8 A;  3VZU X;  1B0X A;  2MRL A;  2KNJ A;  1NK0 A;  1RYR A;  2MUT A;  1ZQI A;  1UA0 A;  2ZXI A;  5CP2 A;  2PFO A;  4O3S A;  3AU6 A;  1ZHW A;  4XQ8 A;  4DSL A;  7PRN A;  3QX7 A;  2LYA A;  4EBE A;  2KHV A;  2KEY A;  1N63 A;  4IS7 A;  4DL2 A;  4FFD A;  1SZP A;  2JH1 A;  4Y2T A;  3ICX A;  2F1C X;  4ED2 A;  4M2Y A;  3F2D A;  2LM1 A;  1PK1 B;  4BUM X;  1T7P A;  3OSN A;  5ADX L;  2KIW A;  2AXT U;  4DSI A;  5DBB A;  2RDI A;  4CF5 A;  2Y2X A;  2W11 A;  1ZQF A;  8ICT A;  4ECW A;  1ZHZ A;  3HW9 A;  4Q8E A;  2HOQ A;  4FS2 A;  3WU2 O;  4C80 A;  2QB1 A;  1QQ6 A;  1NK8 A;  2ZIX A;  3NAS A;  1X9X A;  3ZD8 A;  4C4V B;  2KXP B;  3NUQ A;  3O0F A;  1SKS A;  2MA1 A;  5KAF O;  5D49 A;  3QU5 A;  1TAQ A;  3G7G A;  2YQE A;  4DEZ A;  4QWB A;  8ICL A;  4FES A;  4PJ0 U;  2Y9U A;  4UB6 U;  5AKL A;  4YFK A;  2H3F A;  1BPY A;  2W9A A;  1SB3 C;  3TFR A;  3Q8K A;  3EYZ A;  5G3A A;  1IXR A;  2OM6 A;  4B9S A;  3SV3 A;  2AJQ A;  4M0A A;  5A0L A;  5ALG A;  1KN5 A;  4F71 A;  4K3C A;  4DCC A;  1XSN A;  4DQI A;  2JEF A;  4PR7 A;  4GLX A;  3OSP A;  3UU2 A;  3PV8 A;  3UMC A;  3ISD A;  5AHX A;  2WFA A;  1J97 A;  4F93 B;  3D2N A;  2ZIV B;  1OXJ A;  1QCK A;  2EAP A;  3EPI A;  1B22 A;  2DBY A;  4RUA A;  3C2L A;  3A0H U;  4XNK A;  5B66 O;  1RXV A;  3AA0 A;  4YVZ A;  1YT3 A;  3QU4 A;  4E1S A;  3EUB 2;  5AKK A;  4O3O A;  2FLP A;  2DL0 A;  3PO5 A;  2X9K A;  4C8N A;  2DKZ A;  3TAR A;  2AGO A;  2QLT A;  1XSL A;  4KLG A;  3HKZ C;  2ZJA A;  2Y1I A;  2C2D A;  3N7R C;  3RR8 A;  2FLN A;  1U45 A;  2KMD A;  3T24 A;  1F0M A;  2XCP A;  3C23 A;  3NRW A;  5AM2 A;  4DOA A;  5AFU L;  1UPH A;  2JQY A;  3NVV A;  1L3U A;  2ZJ5 A;  3SAH A;  3N28 A;  2KZZ A;  4KLM A;  2NO4 A;  1DRG A;  5J2B A;  5JRT A;  5KG1 A;  4I2F A;  4K4H A;  4ED1 A;  5HR7 A;  1SIJ A;  3JPP A;  4UAY A;  4RQ5 A;  3B0X A;  3DWO X;  1TFR A;  1KTQ A;  3BQT A;  2BDU A;  9ICC A;  2XIC A;  1HEK A;  3V6H A;  3H0M B;  2JXJ A;  2ZIU A;  5E79 U;  8ICB A;  4LZG A;  1NK6 A;  4UW9 A;  2Y0L A;  1ZD5 A;  3PVX A;  3K1Z A;  3L4P A;  4RQ6 A;  2KZ7 A;  2UVV A;  4RZR A;  3HT3 A;  8ICW A;  3N4M B; 
#chains in the Genus database with same CATH homology
 2Y0S C;  2G5I B;  2HBL A;  4AYB C;  2E1E A;  4PL1 A;  1HIW A;  4NLC A;  1BH3 A;  4KX5 A;  1OPF A;  2YPV A;  3AA0 B;  1OSM A;  2G5H B;  3VY8 X;  3O0E A;  3KZX A;  1Z19 A;  1Q9F A;  3POX A;  2XE2 A;  2M07 A;  2KKV A;  3RF9 A;  2F1V A;  4QIW C;  2KJ5 A;  3SY9 A;  4G76 A;  2H3I A;  4PL2 A;  2OYY A;  5KL8 B;  2JMG A;  3VC8 A;  1PVP A;  4O49 A;  2J1N A;  2XE1 A;  3T0S A;  2XE5 A;  4KRA A;  3AL0 B;  2WAQ F;  2ZIW B;  2MHL A;  2VJ4 A;  2DQN B;  1THQ A;  4A8E A;  4RJW A;  4IC9 A;  1E54 A;  4C0Z A;  2JMM A;  2K89 A;  1P4T A;  3SYS A;  1ZHY A;  3LK4 2;  2ZLD A;  3H0L B;  3VE1 A;  2VJ5 A;  1IZN A;  1D8B A;  3AA6 B;  4QJF B;  3LK4 1;  2G06 A;  4AYE C;  4OJP A;  5FVN A;  1HXX A;  1WUD A;  2NV3 A;  4OJ5 A;  3SZV A;  3DEE A;  3NSG A;  3VE2 A;  1G90 A;  2WB1 C;  2PMZ F;  4BUG A;  2ZIU B;  3M6Z A;  3LK3 B;  4CRX A;  4KR4 A;  4FE3 A;  4FRT A;  4GCP A;  3WI5 A;  4FUV A;  5HR6 A;  2KZ7 B;  2YB1 A;  3AAA A;  3F5A A;  4KR8 A;  2F1T A;  3POR A;  3SQI A;  6PRN A;  1URJ A;  2GE4 A;  3SY7 A;  3OPX A;  5PRN A;  1TAM A;  3F5E A;  3IG8 A;  4FZN A;  2FGR A;  3QRC A;  2D6F C;  2VIX A;  2JGA A;  3GU3 A;  2GOL A;  5T14 A;  3FYX A;  2DF4 B;  1L6N A;  2FGQ X;  2N2M A;  4JFB A;  1ZHX A;  2K4I A;  2M06 A;  1GFP A;  2OH2 A;  2WB1 F;  3JTY A;  2E5S A;  2W7O A;  4O3Y A;  2F76 X;  2LHF A;  4BX9 C;  2O4V A;  2Y7S A;  4E1T A;  2KJ8 A;  2HOI A;  3PSF A;  3AA6 A;  2KHQ A;  1Q9G A;  4OJL A;  4CGZ A;  1YS5 A;  5CRX A;  3HKZ F;  1GFQ A;  2HOF A;  4FOZ A;  3EMN X;  3VZT X;  1IZN B;  2GH1 A;  3C5O A;  2KV2 A;  1QJP A;  2KIC A;  2HMX A;  1MM4 A;  4QQ1 A;  4C69 X;  2X27 X;  4RJX A;  4O3W A;  3POU A;  1BT9 A;  3AAA B;  3M7D A;  4F4B A;  3SYB A;  3WI4 A;  3TZG A;  4G75 A;  4P0Q B;  2CRX A;  2CPR A;  4OO1 J;  3CP8 A;  5ADX K;  4FZL A;  1PVR A;  1H6S 1;  4OJ6 A;  2RRD A;  2YX8 A;  3IG5 A;  1NZB A;  2K4E A;  3AAE A;  4FT6 A;  2Z7J A;  1ZQ1 C;  3PQS A;  3V8U A;  4GHB A;  4Z3T A;  2W04 A;  4AUI A;  2Y0S F;  4AYB F;  1HXU A;  1MA7 A;  3PRN A;  4U6P A;  3VCB A;  4O3M A;  1MPF A;  1SZH A;  3T79 A;  3AA7 A;  2XTR A;  2F8L A;  4FRX A;  2LFU A;  3DA4 A;  4AKR B;  4O3Z A;  4NLB A;  4QIW F;  3QRA A;  4CDG A;  1CRX A;  2HBM A;  5G26 A;  2DGZ A;  4AYD C;  2G0A A;  3PSP A;  2ERV A;  2M0N A;  4FSP A;  2W80 C;  2KDY A;  2K8A A;  3PST A;  4D5U A;  3CRX A;  4JCH A;  2W7P A;  2H3V A;  2VKQ A;  2Y0H A;  4P0Q A;  3PZP A;  1Q3V A;  2LBO A;  4O4X A;  4AZL A;  3MGV A;  1XO0 A;  4ACO A;  2LYB A;  3HOL A;  3GZF A;  3N7P D;  1A6S A;  1HXT A;  3ALR A;  3AA1 A;  1MM5 A;  3AQF A;  4QNL A;  1T94 A;  4LSI A;  4GCQ A;  3VZU X;  2XVT A;  2ZIX B;  2MRL A;  2KNJ A;  4LSF A;  1ECW A;  4GFJ A;  2XMX A;  2ZXI A;  2HBK A;  3AAE B;  3IP4 B;  3SAF A;  2XE3 A;  1ZHW A;  3KVD D;  5DL7 A;  2ZG6 A;  4ICA A;  3LK2 A;  1QJ9 A;  7PRN A;  3UAQ A;  2LYA A;  3SMV A;  2KHV A;  2KEY A;  4AKR A;  2JH1 A;  3ICX A;  5T5F A;  2OMF A;  2KOB A;  1Z1B A;  1A0P A;  2J4U P;  3AA7 B;  3F2D A;  2PRN A;  2N2L A;  5IYU A;  3RBH A;  4BUM X;  2K0L A;  2POR A;  2YNK A;  3SZD A;  3VY9 X;  3A2S X;  2ODJ A;  5ADX L;  2KIW A;  2JHD A;  2JH7 A;  2Y0K A;  2Y2X A;  2K4H A;  4NV0 A;  3LVV A;  1ED1 A;  4P0P A;  3H0R B;  5DL6 A;  2KVC A;  4D65 A;  1ZHZ A;  2KKP A;  3HW9 A;  2HOQ A;  2H3Z A;  4PUX A;  3E0F A;  4RL9 A;  8PRN A;  2WAQ C;  2RP5 A;  2ZIX A;  3RFA A;  3VZW X;  3UPG A;  4AYM C;  2KXP B;  3AA1 B;  3NUQ A;  3O0F A;  2MA1 A;  1BXW A;  3G7G A;  4XNL A;  4KX3 A;  2F77 X;  1PRN A;  3LYS A;  1GFN A;  4BJQ A;  4N58 A;  2LHT A;  4FES A;  3F2B A;  4GCS A;  5JDP A;  5KL1 B;  2K4T A;  2H3F A;  1XNS A;  3LK2 B;  3C28 A;  1Q3U A;  2PMZ C;  2K8C B;  2W03 A;  3KFU F;  5GV0 A;  3AQE A;  3C29 A;  4RLC A;  1F44 A;  1ORM A;  2OM6 A;  1P7D A;  1GFM A;  4WJ3 B;  2G07 A;  3L3F X;  5DL8 A;  4U9C A;  5A0L A;  1QJ8 A;  3ONN A;  3POQ A;  2QTK A;  3T20 A;  3N7S C;  2ZXH A;  5EE2 A;  5D5D A;  3UU2 A;  3D2Q A;  4OJO A;  2XID A;  4P0P B;  3D2N A;  1IIP A;  2ZIV B;  3M6K A;  3F53 A;  2RHF A;  3IN5 A;  3HWB A;  2KXP A;  4XNK A;  2CN1 A;  3AA0 A;  4LSH A;  2KJ9 A;  4FZM A;  1YT3 A;  2A3V A;  4E1S A;  3DA3 A;  4U7C A;  2ZFG A;  2XG6 A;  2OXO A;  2W81 C;  4LSE A;  2YB4 A;  3F2C A;  3K19 A;  2G08 A;  2LKY A;  2R18 A;  2G09 A;  4RLB A;  3HKZ C;  3D2S A;  3N7R C;  5DL5 A;  2XTQ A;  3PSI A;  4GF4 A;  3T24 A;  1ZHT A;  2F2A B;  3NRW A;  3SAG A;  4AKM A;  3CYM A;  2ZIW A;  4D64 A;  4AYN A;  1PHO A;  5AFU L;  4AYI D;  1UPH A;  1KBU A;  2E1F A;  2N1R A;  3SAH A;  2K8B B;  2XI9 A;  1OUQ A;  3HOE A;  3PQU A;  1DRG A;  4FMS A;  4JMU A;  4O3X B;  5HR7 A;  4FSO A;  2MNH A;  2H3Q A;  4NWI A;  4AFK A;  2HBJ A;  4KMO B;  5C0Y A;  2BDU A;  5AFU K;  2XIC A;  2ZIV A;  1HEK A;  2KD1 A;  3GP6 A;  1PVQ A;  4N59 A;  3H0M B;  2Q4T A;  2ZIU A;  3LVW A;  1GFO A;  3LK3 A;  2Y0L A;  4O4U A;  3K1Z A;  4B61 A;  2KZ7 A;  1GO3 F;  2KC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...