4FZLA

High resolution structure of truncated bacteriocin syringacin m from pseudomonas syringae pv. tomato dc3000
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
239
structure length
239
Chain Sequence
GMQNPVATVLLLQGDLYCSPNCLATFQDQARRDSFGIQSKVALKTFAAADQREAEGRDLRTAYNEIATDIGRSQQINENIIKYPPGNHVLSGGLMTPFHALAHGMFGLGAPLTFPIQNVGLNVDIRGIPDVMNVIQSARPVGTSSLDVNFAYDVGKDSNASWLTLGNITLRLVGTIDKNASGAWTFSGEIRAFNDVYDANPSNHRGWLGENLTSLLSAVPFTSYSIEIPGSLPVTVSGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein
molecule keywords Bacteriocin
publication title The Crystal Structure of the Lipid II-degrading Bacteriocin Syringacin M Suggests Unexpected Evolutionary Relationships between Colicin M-like Bacteriocins.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
total genus 73
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.790 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4fzlA01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4fzlA02
3DA4A 4N58A 2XTQA 4G76A 4N59A 4FZMA 3DA3A 2XTRA 4FZLA 2XMXA 4FZNA 4G75A
chains in the Genus database with same CATH superfamily
4DS5A 3Q8MA 4ECQA 4KLFA 4ECSA 1TK0A 3SZ2A 1OXJA 3VC8A 3OPXA 4J9QA 3BQ0A 4O3NA 2KKPA 3RBDA 1S97A 4XA5A 4O5EA 2F77X 2FMPA 1CI4A 3M9MB 3H4DA 5B5EU 2YTUA 4QNLA 4QZIA 3BQ2A 2KDYA 2ZJ5A 2G5HB 3IRUA 3HWBA 4D65A 5KFFA 1Q8KA 2LMRA 1QH9A 4X5VA 4GXKA 3HP6A 3FYHA 4C4TA 2YMMA 1NK9A 5TISO 2VJ4A 1KRPA 2P6UA 3N97B 4DSKA 2HSZA 2WJQA 3EZ5A 3N7PD 1NK6A 1XSPA 4F4WA 3OJSA 5GTHO 3PO4A 2FDRA 5ALDA 3V6JA 3NSGA 8ICYA 5AM1A 1JX4A 1U49A 4PHDA 4C8OA 4KN4A 2VJ5A 2G07A 1BH3A 3PW5A 2V4RA 4DL3A 4LSFA 3ZI4A 2M0NA 3JCUO 2F1CX 4PUXA 2XCAA 5BPCA 5KT2A 4KITB 5J8YC 5AM2A 1N48A 4NL9A 3SYZA 3N4MB 4UB6U 4E0DA 2HHUA 3AA0A 3PY8A 4I2EA 2R4OA 2PXIA 1MM4A 3KBBA 4O3SA 4QZBA 2DPJA 4ED1A 4F92B 4C0ZA 4Z6FA 1X40A 1XWLA 3JPQA 1FO4A 2H3FA 3D6JA 2M07A 1S9FA 1N56A 4O3PA 5EWFA 1C20A 4IL6O 2L5YA 4MFCA 5AI0A 3MABA 3GU3A 9ICNA 2C2EA 2BQRA 4Y2VA 4D5UA 1WG8A 4R65A 4KMOB 4JV2A 4GCQA 7ICPA 4KR8A 4EZ9A 3S6JA 1L6NA 1THQA 2EAPA 5H2FO 1U4BA 5G38A 4ECZA 3WU2U 2XY7A 5AK3A 1ZQIA 8ICGA 1CUKA 4KLIA 4QZFA 2WFAA 2LHTA 5CJ7A 7ICTA 1DGSA 2KVCA 2E1EA 3EWAA 4UAYA 3EPIA 3QX7A 2F1TA 3MDAA 1X2IA 5KFJA 2KG5A 4M04A 5ALTA 2R8KA 4MEXA 3EYZA 2NRZA 1SL1A 3WK9A 3H0MB 5IIIA 3OHBA 1S5LU 2K4IA 3PW7A 1U48A 3TAPA 3WK6A 3WI5A 2HHXA 3KHGA 9ICVA 1MM5A 2W3SA 3WK7A 4XNKA 4FRTA 2ISOA 3VY9X 1SL0A 4I2AA 4CRXA 2YY6A 3RJGA 3BRZA 1X6JA 4PHEA 1ZD3A 4IRKA 3SYSA 4LSIA 8ICWA 3NGDA 4DL5A 3IM1A 3POUA 5AKEA 5HNKA 3V7LA 2N2MA 2R88A 4YR0A 3A0BU 1RYRA 4U6PA 2LM1A 2KP7A 4MEYA 1UA0A 3QXGA 3A0HO 5KG4A 4F4XA 2WTFA 3KTQA 2HHSA 1F44A 3MGIA 4KX5A 4C4RA 3PX4A 8ICIA 5KFBA 2KE7A 8ICOA 4PZNA 1RXWA 1RM6C 4LVSA 3GV8B 4J9PA 3RH6A 4GCSA 4LJXA 2PMZF 1ZQJA 3RH4A 2ZUDA 1J2NA 5DG7A 2W9BB 3AAEB 4ECXA 5J29A 4U7CA 3T5JA 1ZQAA 1HIWA 5AHXA 2PFPA 3PO5A 2LKYA 3BRYA 4DL7A 4B9VA 4ELTA 2AJQA 1NJWA 1Q3VA 4IQWA 2RDIA 1SL2A 5E79U 5GV0A 5KAIO 4KR4A 4DL6A 5ALZA 4RU9A 3BQ7A 5J0WA 4MFAA 3DEEA 5ALPA 4RQ8A 2UVRA 3MGVA 2BCQA 3UQ0A 5JDPA 2GH1A 9ICBA 3LK2B 3NJTA 2DBYA 1Z00A 1PVRA 2E8NA 3K19A 3ALRA 2M9NA 2O4VA 4FFDA 2RRDA 3T5LA 2BCUA 5AFUK 1ZQXA 5L1MA 2ZTEA 1BPEA 3RF9A 2RLTA 1HXUA 1NK8A 2RHFA 2WAQF 1ZQZA 5AM0A 1N63A 4RQ0A 3Q8RB 2FJ6A 1BVSA 1S0OA 4F71A 4NLGA 1XO0A 1MSWD 3RJEA 2AGQA 2MHLA 4EBEA 1NKEA 4YD1A 4UQGA 4F93B 5DB9A 4GLXA 4PHAA 2JH7A 9ICSA 1GO3F 3GP6A 3WKCA 3U26A 4ECRA 2HW3A 4QQ1A 5EE9A 2X9KA 2A1JB 4JV0A 5JUMA 1B4FA 1SV0C 4AFKA 4GXJA 3QZ7A 1S0NA 2KOBA 5IILA 4P0PB 3QUQA 4ED0A 1B0XA 3ISDA 5D46A 2G5IB 3QU5A 4M2YA 3ED5A 5TISU 1WYGA 2I5HA 3UXOA 5J0PA 2AGOA 4G76A 4E1SA 4BUGA 2CN1A 4MHVA 4O4XA 2GE4A 1XC9A 3OSNA 4KLDA 2ZJAA 4FRXA 4ED8A 4DF8A 1LB2B 5KFOA 8ICEA 4KLUA 2F1HA 2HI0A 4I2BA 4OJ5A 3BZCA 3PMNA 5J0YA 3C2KA 4C8NA 3HT3A 2V4QA 2AXTO 3B9JA 5ALMA 4B9NA 3T20A 2ZTDA 4YR3A 9ICHA 5AKYA 4AP9A 3GIKA 2LFUA 4DSLA 2HMXA 3T79A 1KTQA 4F91B 5ALFA 2Z7JA 3ORYA 4TQSA 1JUDA 2E8MA 2KFZA 4IS7A 4KLHA 2JEGA 4R63A 4PHPA 3PSFA 5G26A 4QZDA 1ZJNA 1A6SA 5G5HA 3TQ1A 3D2QA 2Y0LA 4FZNA 4RT2A 3EW9A 5ALRA 3TADC 4QZGA 4Y2TA 2KHVA 5CWRA 2DWQA 7PRNA 1IM4A 2K89A 3PORA 2KC0A 3I28A 4IL6U 5HP4A 5J8YA 4KLEA 4KLQA 1ZQWA 2Y0SF 4RPXA 1L8LA 1D8YA 4PL2A 2E8PA 1ZHYA 2OH2A 2JZBB 5H2FU 2A1AA 2N1RA 4ELVA 9ICLA 2R4NA 5D4BA 3GZFA 4F8RA 1ZQOA 4Y2YA 5L1KA 5KFIA 4UB2A 4F5OA 1S8OA 5D49A 4RUAA 3DA4A 4EENA 8ICQA 2H3IA 1L3SA 1ZQBA 2MRLA 5A0LA 2PI5A 8ICHA 5IIKA 4M6WA 5J2BA 3C5OA 8ICFA 2Y7SA 4JCHA 1UT5A 4O4UA 5ALYA 4I2IA 1PUZA 2WB1C 3JPRA 4YD2A 4AZLA 5HMMA 4ACOA 3LYSA 2JV3A 2ODGA 4C7YA 1HXXA 3KZXA 4NM1A 1QQ7A 3PX6A 1RZTA 4UBCA 4JWMA 1XU4A 5DL6A 2NRXA 2JQYA 3UMCA 3F53A 4O5KA 2VKQA 2BKEA 4EZ6A 4NLZA 4O3XB 2DPIA 5L9XA 1T7PA 3K75D 5IINA 1UQVA 3ZD9A 4RL9A 2AQ0A 1HJPA 2PFOA 3O0FA 4UASA 4P4PA 2W9BA 3AAEA 4AKMA 3A0HU 4QIWF 4P0QB 1S76D 2RQ5A 1SB3C 4JB3A 3AN1A 4YVZA 1DGJA 3Q8PB 4B9MA 2W9CB 8ICTA 4PPXA 2YX8A 4GCPA 4G75A 2WF9A 1XSLA 5J2IA 4RLBA 5EWGA 2KJ8A 4C4VB 3E0FA 9ICOA 2Y0HA 3UPQA 1JIHA 5J0XA 4K3CA 3WK8A 2KEYA 2ASDA 4FZMA 1VLBA 4FO6A 3RFAA 2R8AA 3DA3A 5J0UA 4P2HA 4F4YA 1LKYA 2D6FC 5KAIU 4O3MA 5J2FA 2CRXA 1B22A 4QW8A 4AYDC 4J9NA 3K1RB 4JWNA 7ICIA 1WWUA 1L5UA 2ZG6A 1ZQNA 3RBHA 2F2AB 4MF2A 3AA1B 3V72A 1ZHTA 4A8EA 2R8IA 3TFSA 9ICQA 1NK0A 5G39A 1CEZA 4CF3A 5J2HA 5KNIA 5HR6A 1NNLA 4O3RA 3ICXA 3H8JA 2ZIXB 4DFJA 4QWCA 1QQ6A 4JMUA 1Z3EB 4FT6A 2A1JA 1SKWA 2PFQA 4I2DA 2NRTA 1ZQMA 3WKDA 4P0PA 4QJFB 2FLPA 8ICCA 2ZIVB 3WI4A 3SEIA 2J1NA 2JMMA 5ALSA 3C5FA 2FLNA 2P6RA 4J03A 1X9WA 8ICMA 1T1LA 2LYBA 1WWVA 1U45A 4CDGA 2KZZA 4KMUA 2WVPA 3ZDAA 2QARA 4ELUA 4F2RA 1DK2A 1QQ5A 4RQNA 3V6HA 8ICAA 3PQSA 8ICZA 5CHGA 4DOAA 2W04A 1BPXA 1Q3UA 2JGAA 2EAOA 1HUZA 3AA7B 2KZ3A 3GQCA 1F5SA 1SKRA 3AL0B 1JRPA 2HOFA 2KNJA 4YMMA 1ZQTA 3DDHA 2X27X 3OJUA 3SENA 1PRNA 5DBAA 4HAIA 4F4KA 2ZUBA 4R66A 2GLEA 4YXMA 1IZNB 4I2GA 4N59A 2PRNA 3TFRA 2AGPA 2IMWP 2C22A 2ES6A 2BDPA 1RXVA 1QSYA 3PX0A 2HBLA 1S10A 1TAQA 4JFBA 1Z4OA 5CRXA 2AXTU 2IOFK 1SV0A 3KFUF 1ECWA 2UVWA 8ICSA 2C2RA 5HMLA 2FLLA 3BS7A 3OGUA 4C69X 4YMNA 4M9HA 2HHVA 3BQTA 4DL4A 3ZDEA 2K4EA 4AYBC 2BDUA 2MSNA 4RJWA 4Y2PA 2ATLA 4QZCA 2JZBA 2KIVA 2FGQX 7ICQA 2LM4A 5ADXK 3KHHA 1JXLA 5DL8A 3RB3A 5KFCA 3RJFA 4UARA 1SZPA 4WJ3B 4NV0A 5KG6A 2F1JA 3AM9A 2WF5A 3RAXA 3ZDDA 3R9KA 4K4HA 1YZ7A 4B9LA 4C4SA 3N7SC 1K1SA 1RYUA 5L1IA 2GWSA 4U9CA 2AHOB 9ICUA 5FP0A 3QEAZ 2ASLA 1P7DA 4YN4A 3TADA 3BS5B 4YP3A 4PL1A 4K4IA 2XTQA 4RJXA 3AU2A 2K0LA 1ZD5A 5ALHA 2BCVA 1X9XA 3NTUA 4K3BA 5KT7A 3H8MA 5JU5A 5L1JA 1B43A 3UPGA 5AIAA 1BT9A 4LZDA 4BXOB 4KN7A 2ZLDA 5J2CA 2N2LA 1MA7A 3QUTA 2E3TA 1XSNA 1BPZA 1ZYQA 5IIMA 1QSLA 5KT6A 4Q44A 1MC8A 1D9DA 5KT5A 9ICRA 4P0QA 2F1VA 4DL2A 2W80C 9ICMA 3WK5A 4D64A 8ICKA 4RT3A 3AQFA 5JRTA 2W9CA 3LK9A 1BNPA 2CPRA 3CYMA 3JPOA 4N74A 2XGPA 4OCZA 2EH9A 5KFEA 1KFTA 1NK4A 3PZPA 4KLMA 4PJ0U 3VY8X 4UAZA 2XC9A 2FPMA 3UM9A 5IYUA 7ICEA 4DOCA 3LK41 3F5EA 2BR0A 3LK3B 1UHUA 2FMQA 1QLNA 2NRVA 3PMLA 1ZHXA 4QZEA 2BHNA 3C2MA 1NK7A 2QKQA 2B0CA 3JPTA 3DV9A 3H7IA 2D3DA 3OTQA 4DQRA 2YPVA 2XVTA 4OJOA 3CW2C 2G08A 2BZFA 3L5KA 2KMDA 1ZQDA 1N61A 2ASJA 9ICTA 3JPSA 1KSPA 3MR5A 3Q8LA 1KL9A 7ICNA 3CRXA 2ZIXA 1UA1A 4F5QA 3LK42 4TUQA 4QWDA 4ECTA 3RJHA 5ALVA 2Y2XA 2K8AA 5ALWA 2F44A 2ZIVA 3PF1A 4B9SA 4DSIA 3AUOA 2HHTA 1OPFA 5AKHA 4ZH4A 1JXEA 3NVVA 1A77A 2K8BB 4NY8A 2J6SA 1Z1VA 3IG8A 5KL8B 2WF8A 3SV3A 2FI1A 1N2XA 4IRCA 2QTKA 1Z19A 4NXZA 4UB4A 1C7YA 3AA7A 2BPFA 3HW8A 1Z1BA 4ECYA 2DFLA 2XMXA 2W3RA 1L3UA 5J2JA 3HKZC 2GOLA 2KTQA 4OO1J 3IDWA 2ZIWB 2BQ3A 3WK4A 1PZNA 4CNQA 1L7OA 1COOA 1PVQA 1PK3A 4RQ3A 1OUQA 2KICA 6PRNA 5EE0A 4FSOA 2NO4A 3K1ZA 8ICUA 3QU4A 5ALXA 4C00A 3RJKA 4UB3A 4QZAA 2MUTB 2VA8A 5AM4A 4OJLA 1O03A 4YFKA 8ICJA 5KFDA 5ALLA 3PRNA 2KJ5A 3B0YA 4MFFA 1ZQRA 2V9WA 2LBOA 4P4MA 3H0RB 8ICLA 4K4GA 1BPYA 5KFNA 1SWVA 9ICXA 4UB1A 5FVNA 5AI4A 2W7PA 4KRAA 2JEFA 4Y2QA 1TK8A 5CP2A 4NM2A 4C8MA 2Y9UA 2IA6A 4KLGA 5ALNA 3RB6A 1COKA 5DLGA 4DEZA 3SMVA 3TAQA 3I76A 4PGQA 4J9KA 4Y2XA 3MDCA 3NVYA 2EZZA 2XE1A 3B0XA 3DWNA 5AI9A 1UCVA 3GIMA 1ZHZA 1FFUA 4TUPA 1HUOA 4J9RA 3PGSA 4IC9A 5AKXA 5C5JA 2R8JA 4YQWA 3MR3A 3T0SA 4XQ8A 4O3OA 1O08A 3ZDBA 3RR8A 2J6UA 5EE3A 1F0MA 2H3QA 1MN8A 3OSPA 1KFDA 4P4OA 3D2NA 1SWWA 3TARA 2NRWA 2AQ4A 3BS5A 1DK3A 5AM5A 4EX7A 1KDHA 3PGRA 4UAUA 5DG9A 4Q45A 4AYID 5KFSA 4PGYA 1RDFA 1V9PA 4LZGA 2B6GA 3PGUA 5C0YA 1X6IA 2QLTA 2BCSA 3AAAB 2JRZA 3PR5B 1ZQPA 3MR6A 2MAXA 4RLCA 4TURA 5ALEA 4TQRA 1ZQLA 4NLKA 4C8KA 3M6KA 4B6JA 5DBCA 4Z6DA 4Q43A 4CTDA 5EE2A 4FUVA 2KHQA 3QU2A 2XY6A 1T4GA 4Y2UA 3UAQA 2LPEA 4C7ZA 4EYHB 5AI8A 1KLNA 3V6KA 5BOMA 1XO1A 4RPYA 3THVA 3SY7A 3HOEA 4M9NA 4Q8EA 5ALIA 3V7JA 2EZYA 3JPNA 7ICVA 3LK3A 8ICBA 2JMGA 5G5GA 4R8UB 5KFHA 5KG7A 2E1FA 5KAFO 1UPHA 2KV2A 3CNHA 1ZQEA 1QJ9A 2OYYA 2QB1A 3T5KA 1JMSA 1JROA 5HHHA 5AKKA 3GILA 1KW4A 4M9GA 1RQNA 2G0AA 4IQTA 3DWOX 3V7KA 2Q4TA 4BJQA 4BX9C 3SQIA 2JEJA 1D8LA 2KZ7B 3IP4B 4RPZA 1SXDA 2DKZA 1DOQA 4F5NA 3T5HA 2WJRA 2EDUA 4Y2RA 3TACB 2DKXA 2H5XA 5DQGA 3GDXA 4PJ0O 7ICUA 3ETLA 3RRHA 2I9GA 5DBBA 5GTIU 4C8LA 4PR7A 2JHDA 2YB1A 3MC1A 4FS2A 5KL1B 5T5FA 3L4PA 5KFRA 4DFKA 5KFMA 2KJ9A 1L3VA 3QYPA 2ZJ8A 1RQLA 2F1IA 3LDAA 5KFLA 3G6VA 1OSMA 4US8A 3BDPA 2ZTCA 2HBMA 3QE9Y 5AI5A 3H8WA 1V85A 5F9LA 1P4TA 5KFYA 3LK2A 4EBDA 4AYMC 4I28A 1SKSA 3QUCA 3ZDCA 2NO5A 1Y88A 2HOQA 2W55A 2F8LA 1VJ5A 7ICLA 7ICOA 4IR9A 3GV5B 2R4PA 4BUMX 4EELA 2QB0B 3C29A 3EUB2 7ICRA 3NUQA 5DB7A 2F8KA 4BWJA 4O3QA 4C80A 5AKLA 4LSHA 1J2MA 5DL5A 3RB0A 5J2EA 1N60A 1QTMA 4RUCA 4O5CA 1Q9FA 2KXPB 4N58A 2W54A 4G9BA 3KKAC 2Q0ZX 4UATA 4Q8FA 1LVHA 3HPOA 2LI6A 2PMZC 1AROP 5AKIA 3SAGA 5D5DA 4KLOA 2VA2A 3N28A 3LVVA 2IBKA 4DCCA 1DXSA 4ECWA 1QCKA 3T3FA 1PVPA 1ZQGA 1D8BA 4RQ2A 1ZD4A 3J81j 2JEIA 4Z6CA 4O9MA 4DSFA 3GIIA 4NLNA 3SR6A 3BZKA 3SD7A 3UQ2A 3AMZA 1WCLA 4NWIA 1N5WA 4JK1A 1K1QA 4YG2A 4UB8O 2BGWA 5KT3A 2C28A 2YMPA 4DFDA 5DB6A 3Q8SB 2DQNB 4ED6A 1IV8A 2YMQA 3PNCA 5DQHA 3SZDA 1NI3A 2A19A 3ISCA 1CRXA 3LWMA 2KN7A 1Z00B 2WAQC 4GC6A 4J9LA 4EYIB 4F4ZA 3KVDD 3HJEA 5K4LA 2OWOA 3QNMA 1L8OA 2KZMA 3ZD8A 4BDPA 1XNSA 2K4HA 1VDVA 1H6S1 2FPLA 2HBKA 2VIXA 3HWTA 2Y1JA 1JALA 1HEKA 5AFUL 5KFVA 1GFQA 3AAAA 2OCEA 1ZQCA 1PK1B 5AIBA 3SYBA 2WF6A 4O3ZA 3NASA 5KFGA 2BPCA 2ISPA 5KFTA 2UVUA 2I1QA 3LVWA 9ICPA 3ETRA 3EPGA 5EWEA 2XY5A 4IRDA 2ALZA 3SV4A 4FMSA 5AM3A 3PQUA 5AKJA 4QZ9A 2ERVA 5J0SA 2PFNA 3ONNA 3I1YA 1X66A 2Y9TA 2HHQA 4RNNA 3E2EA 9ICJA 8ICRA 1MQ2A 1Q46A 3C21A 5DDYA 4FE3A 4PGXA 4J9SA 5CA7A 3ISBA 3VZWX 4RZRA 1KQQA 4R8UA 1J97A 3UMGA 2R8GA 9ICKA 1L7NA 2W03A 5KG0A 4RQ1A 4UB5A 1ZQFA 2R18A 1KEJA 5IIJA 4HYKA 2HCFA 1GFNA 3PSIA 4F4BA 5DKWA 7ICGA 3WKEA 5CB1A 2OMFA 2XO7A 4DOBA 1MPFA 2KVSA 4GF4A 4I27A 2KZ7A 2WB1F 3RBEA 2G06A 5L1LA 4OD0A 2KK0A 2A3VA 2PORA 5B66O 2AU0A 4Y2JA 4QWBA 2XCPA 4GC7A 2XE5A 2BCRA 5KAFU 1KN5A 4YR2A 3NRZA 4PH5A 4AKRB 2K8CB 4O49A 3BS0A 2W81C 2AH5A 4I2JA 4UAVA 1ZJMA 5J0QA 2FE9A 5J0OA 3BQ1A 2Y0SC 2EAMA 3QU7A 1AQ6A 1FEZA 2PI4A 3QUBA 1SZHA 4CCHA 1KBUA 4RQMA 3NRWA 5CR0A 2XICA 4F5PA 1TFRA 5AKZA 3SAHA 3TI0A 4B9TA 3F5AA 3E58A 9ICCA 1BPBA 1ZQYA 1ZQHA 4QZHA 5J0TA 4C4VA 3SAFA 3Q8QB 5IIOA 3KHRA 1T16A 5KFWA 3G6XA 2DF4B 4RQ5A 3H8SA 4DSJA 2JH1A 4RNMA 3N7RC 3CP8A 5DGBA 2O6KA 8ICXA 2HBJA 3PV8A 1X9MA 1KFSA 1HXTA 3KZIU 5ALOA 5KT4A 2Y1IA 3H4BA 2QB0A 5KG3A 2ODJA 2P66A 2IWWA 4FS1A 5DLFA 4KLSA 8PRNA 1X9SA 3UXNA 4ECUA 5GTIO 2R89A 1A76A 3LWLA 4M9LA 3AA1A 2I6XA 4M6WB 3H0LB 5KG5A 4F5RA 1D9FA 1TKDA 5HR7A 7ICSA 5J2GA 3F2DA 1NKBA 8ICVA 2KXPA 1U47A 5F9NA 1N5XA 1JI7A 1YZ6A 1Z4NA 2OM6A 2BPGA 1ZRMA 5ALQA 2FMSA 4EX6A 1QSSA 9ICAA 3H40A 3T24A 5T14A 3QEBZ 1NZPA 5KFKA 3C1YA 5AK5A 3UMBA 4DQSA 4FQEA 3MFIA 3KD3A 5ALKA 2YN4A 3AQEA 3RB4A 4QIWC 2NV3A 2ZFGA 1SGGA 7ICMA 4F72A 3KHLA 1GFOA 4FBTA 3GIJA 2UVVA 1ZRNA 5KTQA 2OEHA 1Q9GA 3KOOA 1DRGA 1JN3A 3VZTX 3M8RA 3AA6B 5J2KA 4B61A 4UAWA 1U9LA 2E8OA 5CEHA 1NOMA 4ED7A 5AK4A 2KD1A 1S77D 3PR4A 5DQIA 4R64A 3POXA 4CGZA 2E5SA 1ZQVA 3M6ZA 3MFHA 3VZUX 3FDSA 1TV9A 3IV6A 4OJ6A 3NVZA 1IZNA 2HVHA 2W9MA 1T3QA 3UXPA 1E54A 9ICGA 2HDOA 4GHBA 1IIPA 2LHFA 3TKAA 2NYVA 1BPDA 1NJYA 3VE1A 3KKAA 5ALUA 3C28A 2P35A 2IOFA 1T94A 3D2SA 5J0RA 3NVWA 2JR5A 1LKYB 4UB8U 2XE2A 3M9NB 2K60A 4I2FA 2KIWA 1T3NA 2IWVA 4EEKA 3TZGA 1ZQ1C 4KTQA 2HHWA 1PK1A 3HW9A 3AEVA 4DQPA 3RJJA 2KSOB 1S0MA 2DL0A 4EEYA 2ZIUB 1BNOA 3FC4A 4DFPA 3RTVA 1T8EA 4GFJA 2KKVA 5JTIA 2IHMA 1TVAA 1URJA 4J9OA 4YXJA 4G3IA 4AYBF 4KX3A 2XTRA 3SZVA 3F2CA 4ECVA 1H38A 3PW0A 9ICIA 3RRGA 5AK6A 1YS5A 2B21A 1RYSA 2WHEA 2H3ZA 2W11A 1QJPA 4DWIA 5B5EO 2QARB 2F3NA 2K4TA 1ZQSA 5DGAA 1TAMA 3G7GA 5GTHU 1RG6A 2G09A 2VA3A 1BXWA 4YMOA 4DLEA 3DZMA 4NL9C 3V8UA 2ZUCA 1NKCA 3Q8KA 4DO9A 2PKEA 4E1TA 4RQ7A 2OXOA 3G6YA 4B9UA 2KFNA 4YCXA 1N62A 2YB4A 5DDMA 4F50A 4NJ8A 4FOZA 1BGXT 2R8HA 1ORMA 4XUSA 3MBYA 4XRHA 4DF4A 2IHNA 4AYNA 1ZD2P 3GV7B 4BXOA 3POQA 4GIBA 1GFMA 3AU6A 4QW9A 2XG6A 4AKRA 4US9A 2J6TA 1ED1A 1WCNA 3FYXA 3VE2A 1TK5A 3SI8A 3PVXA 5G3AA 2ZXIA 2ZXHA 4O0IA 7ICJA 4UB6O 3M7DA 1KKXA 4IR1A 1ZHWA 4Z6EA 1UT8A 4UW9A 5B66U 1XS9D 3QZ8A 2BQUA 5DL7A 3M1YA 1TAUA 4DQQA 2EQYA 4ICAA 4BGDA 2W7OA 2W43A 4N75A 3NS1A 5KFUA 1A0PA 3IHQB 5ALJA 3C1ZA 4EBCA 4M9JA 3PSTA 3FM9A 4NLBA 4F3OA 2YMLA 3SY9A 4LSEA 3O0EA 3C5GA 4QWAA 3AA0B 4ED3A 4CF5A 1LV5A 1L7PA 1YT3A 1EXNA 1SXEA 2XI9A 5ADXL 4DLGA 1NK5A 4FBUA 3QRCA 4XNLA 4FSPA 3HX0A 2CXYA 2MA1A 3RR7A 2W9AA 5AICA 4DQIA 1OW5A 5AKGA 4M0AA 4O3WA 3WKAA 4DFMA 4IQVA 1V38A 3QRAA 5KG2A 4I2CA 4FESA 3EMNX 2C2DA 3WU2O 4BWMA 5KFQA 1ZETA 2M06A 8ICPA 3HRDD 1NJXA 1FFVA 5KFXA 3IG5A 4NLCA 3TANA 4O3YA 4TUSA 2DGZA 3FAHA 2WF7A 4ZOHC 1GFPA 2Y0KA 2YQEA 5PRNA 3QU9A 4J9MA 1L7MA 4UBBA 3OHAA 1RPLA 9ICWA 3L3FX 2GO7A 5TZVA 4F2SA 4IQUA 1K5OA 1TE2A 1S5LO 3HOLA 2DUYA 3MGHA 9ICEA 3KZIO 5DG8A 1WUDA 3IN5A 2RDJA 2W8LA 2R4LA 4DSEA 3AA6A 5F3XB 1S0VA 4FZLA 4ED2A 2JXJA 2XIDA 2IOHA 1IXRA 2YNKA 4PZOA 3BJYA 4KLJA 3C23A 1ZQKA 1SV4A 1FIQA 5KFPA 2W8KA 2HVIA 2EZXA 2ZIWA 4Y2SA 4I29A 4KLTA 3A0BO 1M6YA 2ESEA 5EE1A 1V97A 4RQ6A 3HKZF 1ZOLA 4AYEC 2J4UP 7ICHA 3PSPA 1ZXIA 2F76X 3HILA 1SIJA 3JPPA 3M9OB 4CE6A 2MUTA 2FGRA 2HOIA 5ALGA 7ICFA 5KG1A 3K4GA 2FPKA 4M47A 9ICFA 2MU2A 2OHFA 4KLLA 3M8SA 2XE3A 5KFZA 4I2HA 2H3VA 4QWEA 2VANA 5J2DA 2KSOA 2ZIUA 1IG6A 4MF8A 5J2AA 4CF4A 1G90A 2LYHA 3A2SX 4USAA 4DS4A 5AI6A 4GXIA 2RP5A 5KFAA 2LYAA 5E79O 1X42A 1ZQQA 3MR2A 3GFKB 1ZQUA 3RH5A 3RAQA 3C2LA 5BOLA 4OJPA 3RJIA 2D8CA 1QJ8A 4RQ4A 4Z3TA 3UU2A 1NJZA 4AUIA 8ICNA 2EANA 5HHIA 1PHOA 3WKBA 1L3TA 1NZBA 5EOZA 3JTYA 4JUZA 4QZ8A 4JV1A 3VCBA 1MQ3A 2MNHA 3F2BA 5DB8A 2XGQA 3PW4A 2K4PA 7ICKA 3PW2A 4RNOA
chains in the Genus database with same CATH topology
2LBOA 2XICA 2WB1C 4AZLA 3SAHA 4ACOA 3LYSA 3H0RB 3F5AA 1HXXA 3VC8A 3KZXA 3SAFA 5FVNA 3OPXA 2W7PA 5DL6A 2DF4B 3F53A 4KRAA 2KKPA 2VKQA 2JH1A 3N7RC 4O3XB 3CP8A 2F77X 2HBJA 4RL9A 1HXTA 4QNLA 2KDYA 3SMVA 3O0FA 2G5HB 3HWBA 4D65A 2ODJA 2XE1A 4AKMA 3AAEA 1ZHZA 8PRNA 4QIWF 2VJ4A 4P0QB 3AA1A 4IC9A 3H0LB 3T0SA 3N7PD 5HR7A 3F2DA 2YX8A 2KXPA 2H3QA 3NSGA 4G75A 4GCPA 3D2NA 4RLBA 2VJ5A 2G07A 2OM6A 1BH3A 2KJ8A 3E0FA 4LSFA 2M0NA 2Y0HA 4PUXA 4AYID 3T24A 5T14A 2KEYA 3AA0A 4FZMA 3AQEA 3RFAA 3DA3A 4QIWC 2NV3A 2ZFGA 5C0YA 1MM4A 1GFOA 2D6FC 3AAAB 4O3MA 2CRXA 4RLCA 4AYDC 1Q9GA 3VZTX 1DRGA 4C0ZA 3M6KA 3AA6B 4B61A 2ZG6A 3RBHA 5EE2A 2F2AB 3AA1B 4FUVA 2KHQA 2H3FA 2M07A 1ZHTA 4A8EA 3UAQA 2KD1A 5HR6A 3ICXA 2ZIXB 3POXA 3GU3A 4CGZA 2E5SA 3M6ZA 4JMUA 4FT6A 3VZUX 4D5UA 4OJ6A 3SY7A 4KMOB 1IZNA 4GCQA 3HOEA 4P0PA 4QJFB 1L6NA 1E54A 1THQA 4KR8A 2ZIVB 4GHBA 3WI4A 1IIPA 2LHFA 2J1NA 2JMMA 3VE1A 3C28A 1T94A 3LK3A 2LYBA 2JMGA 3D2SA 4CDGA 2E1FA 1UPHA 2KV2A 2LHTA 2XE2A 1QJ9A 2OYYA 2KVCA 2E1EA 2KIWA 3PQSA 3TZGA 1ZQ1C 2W04A 2F1TA 1Q3UA 2JGAA 3AA7B 3HW9A 2G0AA 3AL0B 2Q4TA 4BJQA 2ZIUB 4BX9C 2HOFA 3SQIA 2KNJA 2KZ7B 4GFJA 2KKVA 3H0MB 3IP4B 1URJA 2X27X 2K4IA 1PRNA 4AYBF 3WI5A 4KX3A 1MM5A 2XTRA 3SZVA 3F2CA 4XNKA 4FRTA 1IZNB 3VY9X 4N59A 2PRNA 4CRXA 1YS5A 2HBLA 4JFBA 3SYSA 5CRXA 4LSIA 2H3ZA 2JHDA 2YB1A 1QJPA 3KFUF 1ECWA 5KL1B 2K4TA 5T5FA 3POUA 1TAMA 3G7GA 2G09A 2KJ9A 2N2MA 1BXWA 4C69X 4U6PA 1OSMA 3V8UA 2HBMA 4E1TA 2K4EA 4AYBC 2OXOA 1F44A 2BDUA 1P4TA 4RJWA 3LK2A 4KX5A 4AYMC 2YB4A 2FGQX 2HOQA 4FOZA 5ADXK 5DL8A 1ORMA 2F8LA 4AYNA 4GCSA 4BUMX 4WJ3B 4NV0A 2PMZF 3POQA 1GFMA 2XG6A 4AKRA 3C29A 1ED1A 3AAEB 3FYXA 3NUQA 3VE2A 4U7CA 4LSHA 1HIWA 2ZXIA 2ZXHA 2LKYA 5DL5A 3N7SC 3M7DA 1Q3VA 1ZHWA 4U9CA 5GV0A 1Q9FA 2KXPB 4KR4A 4N58A 5DL7A 1P7DA 3DEEA 4ICAA 2W7OA 3MGVA 4PL1A 2XTQA 4RJXA 5JDPA 2GH1A 1A0PA 2K0LA 3LK2B 2PMZC 3PSTA 4NLBA 1PVRA 3SY9A 3SAGA 3K19A 4LSEA 3O0EA 3ALRA 2O4VA 5D5DA 3AA0B 2RRDA 1YT3A 3UPGA 5AFUK 2XI9A 1BT9A 5ADXL 3LVVA 3RF9A 3QRCA 4XNLA 2ZLDA 1PVPA 4FSPA 1D8BA 1HXUA 1MA7A 2N2LA 2MA1A 2RHFA 2WAQF 4O3WA 1XO0A 3QRAA 4P0QA 4FESA 2F1VA 3EMNX 2MHLA 2W80C 4NWIA 4D64A 2M06A 3AQFA 2JH7A 3GP6A 1GO3F 2CPRA 3CYMA 4QQ1A 3IG5A 2DQNB 4NLCA 4O3YA 3PZPA 4AFKA 2KOBA 3SZDA 2DGZA 1GFPA 2Y0KA 4P0PB 3VY8X 1CRXA 5IYUA 5PRNA 2G5IB 3L3FX 2WAQC 3LK41 3F5EA 3LK3B 3KVDD 4G76A 1XNSA 3HOLA 2K4HA 4BUGA 4E1SA 1H6S1 2CN1A 2HBKA 4O4XA 2VIXA 2GE4A 1ZHXA 1HEKA 5AFUL 1GFQA 3AAAA 4FRXA 1WUDA 3IN5A 3SYBA 3AA6A 4OJ5A 4O3ZA 2YPVA 4FZLA 2XVTA 2XIDA 4OJOA 2G08A 2YNKA 3T20A 3LVWA 4FMSA 2ZIWA 2LFUA 2HMXA 3T79A 3PQUA 3CRXA 2ZIXA 3LK42 2Z7JA 3HKZF 2ERVA 4AYEC 2J4UP 3ONNA 2Y2XA 3PSFA 3PSPA 2K8AA 5G26A 2F76X 1A6SA 2ZIVA 3D2QA 2Y0LA 4FZNA 4FE3A 1OPFA 2FGRA 2HOIA 3VZWX 2KHVA 7PRNA 2K89A 3PORA 2K8BB 2KC0A 3IG8A 5KL8B 2W03A 2R18A 2QTKA 1Z19A 2XE3A 2Y0SF 1GFNA 3PSIA 2H3VA 3AA7A 4F4BA 1Z1BA 2OMFA 1MPFA 2XMXA 4GF4A 2ZIUA 4PL2A 1ZHYA 2OH2A 3HKZC 2KZ7A 1G90A 2WB1F 2G06A 3A2SX 2N1RA 2GOLA 4OO1J 2RP5A 2LYAA 2A3VA 2ZIWB 2PORA 2XE5A 1PVQA 1OUQA 2KICA 3GZFA 6PRNA 4FSOA 4OJPA 4AKRB 1QJ8A 3K1ZA 4Z3TA 3UU2A 2K8CB 3DA4A 4O49A 4AUIA 2W81C 1PHOA 2H3IA 2MRLA 5A0LA 1NZBA 3JTYA 4OJLA 2Y0SC 3VCBA 2MNHA 1SZHA 3F2BA 3C5OA 2Y7SA 1KBUA 3PRNA 2KJ5A 4O4UA 3NRWA 4JCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DA4 A;  4N58 A;  2XTQ A;  4G76 A;  4N59 A;  4FZM A;  3DA3 A;  2XTR A;  4FZL A;  2XMX A;  4FZN A;  4G75 A; 
#chains in the Genus database with same CATH topology
 4DS5 A;  3Q8M A;  4ECQ A;  4KLF A;  4ECS A;  1TK0 A;  3SZ2 A;  1OXJ A;  3VC8 A;  3OPX A;  4J9Q A;  3BQ0 A;  4O3N A;  2KKP A;  3RBD A;  1S97 A;  4XA5 A;  4O5E A;  2F77 X;  2FMP A;  1CI4 A;  3M9M B;  3H4D A;  5B5E U;  2YTU A;  4QNL A;  4QZI A;  3BQ2 A;  2KDY A;  2ZJ5 A;  2G5H B;  3IRU A;  3HWB A;  4D65 A;  5KFF A;  1Q8K A;  2LMR A;  1QH9 A;  4X5V A;  4GXK A;  3HP6 A;  3FYH A;  4C4T A;  2YMM A;  1NK9 A;  5TIS O;  2VJ4 A;  1KRP A;  2P6U A;  3N97 B;  4DSK A;  2HSZ A;  2WJQ A;  3EZ5 A;  3N7P D;  1NK6 A;  1XSP A;  4F4W A;  3OJS A;  5GTH O;  3PO4 A;  2FDR A;  5ALD A;  3V6J A;  3NSG A;  8ICY A;  5AM1 A;  1JX4 A;  1U49 A;  4PHD A;  4C8O A;  4KN4 A;  2VJ5 A;  2G07 A;  1BH3 A;  3PW5 A;  2V4R A;  4DL3 A;  4LSF A;  3ZI4 A;  2M0N A;  3JCU O;  2F1C X;  4PUX A;  2XCA A;  5BPC A;  5KT2 A;  4KIT B;  5J8Y C;  5AM2 A;  1N48 A;  4NL9 A;  3SYZ A;  3N4M B;  4UB6 U;  4E0D A;  2HHU A;  3AA0 A;  3PY8 A;  4I2E A;  2R4O A;  2PXI A;  1MM4 A;  3KBB A;  4O3S A;  4QZB A;  2DPJ A;  4ED1 A;  4F92 B;  4C0Z A;  4Z6F A;  1X40 A;  1XWL A;  3JPQ A;  1FO4 A;  2H3F A;  3D6J A;  2M07 A;  1S9F A;  1N56 A;  4O3P A;  5EWF A;  1C20 A;  4IL6 O;  2L5Y A;  4MFC A;  5AI0 A;  3MAB A;  3GU3 A;  9ICN A;  2C2E A;  2BQR A;  4Y2V A;  4D5U A;  1WG8 A;  4R65 A;  4KMO B;  4JV2 A;  4GCQ A;  7ICP A;  4KR8 A;  4EZ9 A;  3S6J A;  1L6N A;  1THQ A;  2EAP A;  5H2F O;  1U4B A;  5G38 A;  4ECZ A;  3WU2 U;  2XY7 A;  5AK3 A;  1ZQI A;  8ICG A;  1CUK A;  4KLI A;  4QZF A;  2WFA A;  2LHT A;  5CJ7 A;  7ICT A;  1DGS A;  2KVC A;  2E1E A;  3EWA A;  4UAY A;  3EPI A;  3QX7 A;  2F1T A;  3MDA A;  1X2I A;  5KFJ A;  2KG5 A;  4M04 A;  5ALT A;  2R8K A;  4MEX A;  3EYZ A;  2NRZ A;  1SL1 A;  3WK9 A;  3H0M B;  5III A;  3OHB A;  1S5L U;  2K4I A;  3PW7 A;  1U48 A;  3TAP A;  3WK6 A;  3WI5 A;  2HHX A;  3KHG A;  9ICV A;  1MM5 A;  2W3S A;  3WK7 A;  4XNK A;  4FRT A;  2ISO A;  3VY9 X;  1SL0 A;  4I2A A;  4CRX A;  2YY6 A;  3RJG A;  3BRZ A;  1X6J A;  4PHE A;  1ZD3 A;  4IRK A;  3SYS A;  4LSI A;  8ICW A;  3NGD A;  4DL5 A;  3IM1 A;  3POU A;  5AKE A;  5HNK A;  3V7L A;  2N2M A;  2R88 A;  4YR0 A;  3A0B U;  1RYR A;  4U6P A;  2LM1 A;  2KP7 A;  4MEY A;  1UA0 A;  3QXG A;  3A0H O;  5KG4 A;  4F4X A;  2WTF A;  3KTQ A;  2HHS A;  1F44 A;  3MGI A;  4KX5 A;  4C4R A;  3PX4 A;  8ICI A;  5KFB A;  2KE7 A;  8ICO A;  4PZN A;  1RXW A;  1RM6 C;  4LVS A;  3GV8 B;  4J9P A;  3RH6 A;  4GCS A;  4LJX A;  2PMZ F;  1ZQJ A;  3RH4 A;  2ZUD A;  1J2N A;  5DG7 A;  2W9B B;  3AAE B;  4ECX A;  5J29 A;  4U7C A;  3T5J A;  1ZQA A;  1HIW A;  5AHX A;  2PFP A;  3PO5 A;  2LKY A;  3BRY A;  4DL7 A;  4B9V A;  4ELT A;  2AJQ A;  1NJW A;  1Q3V A;  4IQW A;  2RDI A;  1SL2 A;  5E79 U;  5GV0 A;  5KAI O;  4KR4 A;  4DL6 A;  5ALZ A;  4RU9 A;  3BQ7 A;  5J0W A;  4MFA A;  3DEE A;  5ALP A;  4RQ8 A;  2UVR A;  3MGV A;  2BCQ A;  3UQ0 A;  5JDP A;  2GH1 A;  9ICB A;  3LK2 B;  3NJT A;  2DBY A;  1Z00 A;  1PVR A;  2E8N A;  3K19 A;  3ALR A;  2M9N A;  2O4V A;  4FFD A;  2RRD A;  3T5L A;  2BCU A;  5AFU K;  1ZQX A;  5L1M A;  2ZTE A;  1BPE A;  3RF9 A;  2RLT A;  1HXU A;  1NK8 A;  2RHF A;  2WAQ F;  1ZQZ A;  5AM0 A;  1N63 A;  4RQ0 A;  3Q8R B;  2FJ6 A;  1BVS A;  1S0O A;  4F71 A;  4NLG A;  1XO0 A;  1MSW D;  3RJE A;  2AGQ A;  2MHL A;  4EBE A;  1NKE A;  4YD1 A;  4UQG A;  4F93 B;  5DB9 A;  4GLX A;  4PHA A;  2JH7 A;  9ICS A;  1GO3 F;  3GP6 A;  3WKC A;  3U26 A;  4ECR A;  2HW3 A;  4QQ1 A;  5EE9 A;  2X9K A;  2A1J B;  4JV0 A;  5JUM A;  1B4F A;  1SV0 C;  4AFK A;  4GXJ A;  3QZ7 A;  1S0N A;  2KOB A;  5IIL A;  4P0P B;  3QUQ A;  4ED0 A;  1B0X A;  3ISD A;  5D46 A;  2G5I B;  3QU5 A;  4M2Y A;  3ED5 A;  5TIS U;  1WYG A;  2I5H A;  3UXO A;  5J0P A;  2AGO A;  4G76 A;  4E1S A;  4BUG A;  2CN1 A;  4MHV A;  4O4X A;  2GE4 A;  1XC9 A;  3OSN A;  4KLD A;  2ZJA A;  4FRX A;  4ED8 A;  4DF8 A;  1LB2 B;  5KFO A;  8ICE A;  4KLU A;  2F1H A;  2HI0 A;  4I2B A;  4OJ5 A;  3BZC A;  3PMN A;  5J0Y A;  3C2K A;  4C8N A;  3HT3 A;  2V4Q A;  2AXT O;  3B9J A;  5ALM A;  4B9N A;  3T20 A;  2ZTD A;  4YR3 A;  9ICH A;  5AKY A;  4AP9 A;  3GIK A;  2LFU A;  4DSL A;  2HMX A;  3T79 A;  1KTQ A;  4F91 B;  5ALF A;  2Z7J A;  3ORY A;  4TQS A;  1JUD A;  2E8M A;  2KFZ A;  4IS7 A;  4KLH A;  2JEG A;  4R63 A;  4PHP A;  3PSF A;  5G26 A;  4QZD A;  1ZJN A;  1A6S A;  5G5H A;  3TQ1 A;  3D2Q A;  2Y0L A;  4FZN A;  4RT2 A;  3EW9 A;  5ALR A;  3TAD C;  4QZG A;  4Y2T A;  2KHV A;  5CWR A;  2DWQ A;  7PRN A;  1IM4 A;  2K89 A;  3POR A;  2KC0 A;  3I28 A;  4IL6 U;  5HP4 A;  5J8Y A;  4KLE A;  4KLQ A;  1ZQW A;  2Y0S F;  4RPX A;  1L8L A;  1D8Y A;  4PL2 A;  2E8P A;  1ZHY A;  2OH2 A;  2JZB B;  5H2F U;  2A1A A;  2N1R A;  4ELV A;  9ICL A;  2R4N A;  5D4B A;  3GZF A;  4F8R A;  1ZQO A;  4Y2Y A;  5L1K A;  5KFI A;  4UB2 A;  4F5O A;  1S8O A;  5D49 A;  4RUA A;  3DA4 A;  4EEN A;  8ICQ A;  2H3I A;  1L3S A;  1ZQB A;  2MRL A;  5A0L A;  2PI5 A;  8ICH A;  5IIK A;  4M6W A;  5J2B A;  3C5O A;  8ICF A;  2Y7S A;  4JCH A;  1UT5 A;  4O4U A;  5ALY A;  4I2I A;  1PUZ A;  2WB1 C;  3JPR A;  4YD2 A;  4AZL A;  5HMM A;  4ACO A;  3LYS A;  2JV3 A;  2ODG A;  4C7Y A;  1HXX A;  3KZX A;  4NM1 A;  1QQ7 A;  3PX6 A;  1RZT A;  4UBC A;  4JWM A;  1XU4 A;  5DL6 A;  2NRX A;  2JQY A;  3UMC A;  3F53 A;  4O5K A;  2VKQ A;  2BKE A;  4EZ6 A;  4NLZ A;  4O3X B;  2DPI A;  5L9X A;  1T7P A;  3K75 D;  5IIN A;  1UQV A;  3ZD9 A;  4RL9 A;  2AQ0 A;  1HJP A;  2PFO A;  3O0F A;  4UAS A;  4P4P A;  2W9B A;  3AAE A;  4AKM A;  3A0H U;  4QIW F;  4P0Q B;  1S76 D;  2RQ5 A;  1SB3 C;  4JB3 A;  3AN1 A;  4YVZ A;  1DGJ A;  3Q8P B;  4B9M A;  2W9C B;  8ICT A;  4PPX A;  2YX8 A;  4GCP A;  4G75 A;  2WF9 A;  1XSL A;  5J2I A;  4RLB A;  5EWG A;  2KJ8 A;  4C4V B;  3E0F A;  9ICO A;  2Y0H A;  3UPQ A;  1JIH A;  5J0X A;  4K3C A;  3WK8 A;  2KEY A;  2ASD A;  4FZM A;  1VLB A;  4FO6 A;  3RFA A;  2R8A A;  3DA3 A;  5J0U A;  4P2H A;  4F4Y A;  1LKY A;  2D6F C;  5KAI U;  4O3M A;  5J2F A;  2CRX A;  1B22 A;  4QW8 A;  4AYD C;  4J9N A;  3K1R B;  4JWN A;  7ICI A;  1WWU A;  1L5U A;  2ZG6 A;  1ZQN A;  3RBH A;  2F2A B;  4MF2 A;  3AA1 B;  3V72 A;  1ZHT A;  4A8E A;  2R8I A;  3TFS A;  9ICQ A;  1NK0 A;  5G39 A;  1CEZ A;  4CF3 A;  5J2H A;  5KNI A;  5HR6 A;  1NNL A;  4O3R A;  3ICX A;  3H8J A;  2ZIX B;  4DFJ A;  4QWC A;  1QQ6 A;  4JMU A;  1Z3E B;  4FT6 A;  2A1J A;  1SKW A;  2PFQ A;  4I2D A;  2NRT A;  1ZQM A;  3WKD A;  4P0P A;  4QJF B;  2FLP A;  8ICC A;  2ZIV B;  3WI4 A;  3SEI A;  2J1N A;  2JMM A;  5ALS A;  3C5F A;  2FLN A;  2P6R A;  4J03 A;  1X9W A;  8ICM A;  1T1L A;  2LYB A;  1WWV A;  1U45 A;  4CDG A;  2KZZ A;  4KMU A;  2WVP A;  3ZDA A;  2QAR A;  4ELU A;  4F2R A;  1DK2 A;  1QQ5 A;  4RQN A;  3V6H A;  8ICA A;  3PQS A;  8ICZ A;  5CHG A;  4DOA A;  2W04 A;  1BPX A;  1Q3U A;  2JGA A;  2EAO A;  1HUZ A;  3AA7 B;  2KZ3 A;  3GQC A;  1F5S A;  1SKR A;  3AL0 B;  1JRP A;  2HOF A;  2KNJ A;  4YMM A;  1ZQT A;  3DDH A;  2X27 X;  3OJU A;  3SEN A;  1PRN A;  5DBA A;  4HAI A;  4F4K A;  2ZUB A;  4R66 A;  2GLE A;  4YXM A;  1IZN B;  4I2G A;  4N59 A;  2PRN A;  3TFR A;  2AGP A;  2IMW P;  2C22 A;  2ES6 A;  2BDP A;  1RXV A;  1QSY A;  3PX0 A;  2HBL A;  1S10 A;  1TAQ A;  4JFB A;  1Z4O A;  5CRX A;  2AXT U;  2IOF K;  1SV0 A;  3KFU F;  1ECW A;  2UVW A;  8ICS A;  2C2R A;  5HML A;  2FLL A;  3BS7 A;  3OGU A;  4C69 X;  4YMN A;  4M9H A;  2HHV A;  3BQT A;  4DL4 A;  3ZDE A;  2K4E A;  4AYB C;  2BDU A;  2MSN A;  4RJW A;  4Y2P A;  2ATL A;  4QZC A;  2JZB A;  2KIV A;  2FGQ X;  7ICQ A;  2LM4 A;  5ADX K;  3KHH A;  1JXL A;  5DL8 A;  3RB3 A;  5KFC A;  3RJF A;  4UAR A;  1SZP A;  4WJ3 B;  4NV0 A;  5KG6 A;  2F1J A;  3AM9 A;  2WF5 A;  3RAX A;  3ZDD A;  3R9K A;  4K4H A;  1YZ7 A;  4B9L A;  4C4S A;  3N7S C;  1K1S A;  1RYU A;  5L1I A;  2GWS A;  4U9C A;  2AHO B;  9ICU A;  5FP0 A;  3QEA Z;  2ASL A;  1P7D A;  4YN4 A;  3TAD A;  3BS5 B;  4YP3 A;  4PL1 A;  4K4I A;  2XTQ A;  4RJX A;  3AU2 A;  2K0L A;  1ZD5 A;  5ALH A;  2BCV A;  1X9X A;  3NTU A;  4K3B A;  5KT7 A;  3H8M A;  5JU5 A;  5L1J A;  1B43 A;  3UPG A;  5AIA A;  1BT9 A;  4LZD A;  4BXO B;  4KN7 A;  2ZLD A;  5J2C A;  2N2L A;  1MA7 A;  3QUT A;  2E3T A;  1XSN A;  1BPZ A;  1ZYQ A;  5IIM A;  1QSL A;  5KT6 A;  4Q44 A;  1MC8 A;  1D9D A;  5KT5 A;  9ICR A;  4P0Q A;  2F1V A;  4DL2 A;  2W80 C;  9ICM A;  3WK5 A;  4D64 A;  8ICK A;  4RT3 A;  3AQF A;  5JRT A;  2W9C A;  3LK9 A;  1BNP A;  2CPR A;  3CYM A;  3JPO A;  4N74 A;  2XGP A;  4OCZ A;  2EH9 A;  5KFE A;  1KFT A;  1NK4 A;  3PZP A;  4KLM A;  4PJ0 U;  3VY8 X;  4UAZ A;  2XC9 A;  2FPM A;  3UM9 A;  5IYU A;  7ICE A;  4DOC A;  3LK4 1;  3F5E A;  2BR0 A;  3LK3 B;  1UHU A;  2FMQ A;  1QLN A;  2NRV A;  3PML A;  1ZHX A;  4QZE A;  2BHN A;  3C2M A;  1NK7 A;  2QKQ A;  2B0C A;  3JPT A;  3DV9 A;  3H7I A;  2D3D A;  3OTQ A;  4DQR A;  2YPV A;  2XVT A;  4OJO A;  3CW2 C;  2G08 A;  2BZF A;  3L5K A;  2KMD A;  1ZQD A;  1N61 A;  2ASJ A;  9ICT A;  3JPS A;  1KSP A;  3MR5 A;  3Q8L A;  1KL9 A;  7ICN A;  3CRX A;  2ZIX A;  1UA1 A;  4F5Q A;  3LK4 2;  4TUQ A;  4QWD A;  4ECT A;  3RJH A;  5ALV A;  2Y2X A;  2K8A A;  5ALW A;  2F44 A;  2ZIV A;  3PF1 A;  4B9S A;  4DSI A;  3AUO A;  2HHT A;  1OPF A;  5AKH A;  4ZH4 A;  1JXE A;  3NVV A;  1A77 A;  2K8B B;  4NY8 A;  2J6S A;  1Z1V A;  3IG8 A;  5KL8 B;  2WF8 A;  3SV3 A;  2FI1 A;  1N2X A;  4IRC A;  2QTK A;  1Z19 A;  4NXZ A;  4UB4 A;  1C7Y A;  3AA7 A;  2BPF A;  3HW8 A;  1Z1B A;  4ECY A;  2DFL A;  2XMX A;  2W3R A;  1L3U A;  5J2J A;  3HKZ C;  2GOL A;  2KTQ A;  4OO1 J;  3IDW A;  2ZIW B;  2BQ3 A;  3WK4 A;  1PZN A;  4CNQ A;  1L7O A;  1COO A;  1PVQ A;  1PK3 A;  4RQ3 A;  1OUQ A;  2KIC A;  6PRN A;  5EE0 A;  4FSO A;  2NO4 A;  3K1Z A;  8ICU A;  3QU4 A;  5ALX A;  4C00 A;  3RJK A;  4UB3 A;  4QZA A;  2MUT B;  2VA8 A;  5AM4 A;  4OJL A;  1O03 A;  4YFK A;  8ICJ A;  5KFD A;  5ALL A;  3PRN A;  2KJ5 A;  3B0Y A;  4MFF A;  1ZQR A;  2V9W A;  2LBO A;  4P4M A;  3H0R B;  8ICL A;  4K4G A;  1BPY A;  5KFN A;  1SWV A;  9ICX A;  4UB1 A;  5FVN A;  5AI4 A;  2W7P A;  4KRA A;  2JEF A;  4Y2Q A;  1TK8 A;  5CP2 A;  4NM2 A;  4C8M A;  2Y9U A;  2IA6 A;  4KLG A;  5ALN A;  3RB6 A;  1COK A;  5DLG A;  4DEZ A;  3SMV A;  3TAQ A;  3I76 A;  4PGQ A;  4J9K A;  4Y2X A;  3MDC A;  3NVY A;  2EZZ A;  2XE1 A;  3B0X A;  3DWN A;  5AI9 A;  1UCV A;  3GIM A;  1ZHZ A;  1FFU A;  4TUP A;  1HUO A;  4J9R A;  3PGS A;  4IC9 A;  5AKX A;  5C5J A;  2R8J A;  4YQW A;  3MR3 A;  3T0S A;  4XQ8 A;  4O3O A;  1O08 A;  3ZDB A;  3RR8 A;  2J6U A;  5EE3 A;  1F0M A;  2H3Q A;  1MN8 A;  3OSP A;  1KFD A;  4P4O A;  3D2N A;  1SWW A;  3TAR A;  2NRW A;  2AQ4 A;  3BS5 A;  1DK3 A;  5AM5 A;  4EX7 A;  1KDH A;  3PGR A;  4UAU A;  5DG9 A;  4Q45 A;  4AYI D;  5KFS A;  4PGY A;  1RDF A;  1V9P A;  4LZG A;  2B6G A;  3PGU A;  5C0Y A;  1X6I A;  2QLT A;  2BCS A;  3AAA B;  2JRZ A;  3PR5 B;  1ZQP A;  3MR6 A;  2MAX A;  4RLC A;  4TUR A;  5ALE A;  4TQR A;  1ZQL A;  4NLK A;  4C8K A;  3M6K A;  4B6J A;  5DBC A;  4Z6D A;  4Q43 A;  4CTD A;  5EE2 A;  4FUV A;  2KHQ A;  3QU2 A;  2XY6 A;  1T4G A;  4Y2U A;  3UAQ A;  2LPE A;  4C7Z A;  4EYH B;  5AI8 A;  1KLN A;  3V6K A;  5BOM A;  1XO1 A;  4RPY A;  3THV A;  3SY7 A;  3HOE A;  4M9N A;  4Q8E A;  5ALI A;  3V7J A;  2EZY A;  3JPN A;  7ICV A;  3LK3 A;  8ICB A;  2JMG A;  5G5G A;  4R8U B;  5KFH A;  5KG7 A;  2E1F A;  5KAF O;  1UPH A;  2KV2 A;  3CNH A;  1ZQE A;  1QJ9 A;  2OYY A;  2QB1 A;  3T5K A;  1JMS A;  1JRO A;  5HHH A;  5AKK A;  3GIL A;  1KW4 A;  4M9G A;  1RQN A;  2G0A A;  4IQT A;  3DWO X;  3V7K A;  2Q4T A;  4BJQ A;  4BX9 C;  3SQI A;  2JEJ A;  1D8L A;  2KZ7 B;  3IP4 B;  4RPZ A;  1SXD A;  2DKZ A;  1DOQ A;  4F5N A;  3T5H A;  2WJR A;  2EDU A;  4Y2R A;  3TAC B;  2DKX A;  2H5X A;  5DQG A;  3GDX A;  4PJ0 O;  7ICU A;  3ETL A;  3RRH A;  2I9G A;  5DBB A;  5GTI U;  4C8L A;  4PR7 A;  2JHD A;  2YB1 A;  3MC1 A;  4FS2 A;  5KL1 B;  5T5F A;  3L4P A;  5KFR A;  4DFK A;  5KFM A;  2KJ9 A;  1L3V A;  3QYP A;  2ZJ8 A;  1RQL A;  2F1I A;  3LDA A;  5KFL A;  3G6V A;  1OSM A;  4US8 A;  3BDP A;  2ZTC A;  2HBM A;  3QE9 Y;  5AI5 A;  3H8W A;  1V85 A;  5F9L A;  1P4T A;  5KFY A;  3LK2 A;  4EBD A;  4AYM C;  4I28 A;  1SKS A;  3QUC A;  3ZDC A;  2NO5 A;  1Y88 A;  2HOQ A;  2W55 A;  2F8L A;  1VJ5 A;  7ICL A;  7ICO A;  4IR9 A;  3GV5 B;  2R4P A;  4BUM X;  4EEL A;  2QB0 B;  3C29 A;  3EUB 2;  7ICR A;  3NUQ A;  5DB7 A;  2F8K A;  4BWJ A;  4O3Q A;  4C80 A;  5AKL A;  4LSH A;  1J2M A;  5DL5 A;  3RB0 A;  5J2E A;  1N60 A;  1QTM A;  4RUC A;  4O5C A;  1Q9F A;  2KXP B;  4N58 A;  2W54 A;  4G9B A;  3KKA C;  2Q0Z X;  4UAT A;  4Q8F A;  1LVH A;  3HPO A;  2LI6 A;  2PMZ C;  1ARO P;  5AKI A;  3SAG A;  5D5D A;  4KLO A;  2VA2 A;  3N28 A;  3LVV A;  2IBK A;  4DCC A;  1DXS A;  4ECW A;  1QCK A;  3T3F A;  1PVP A;  1ZQG A;  1D8B A;  4RQ2 A;  1ZD4 A;  3J81 j;  2JEI A;  4Z6C A;  4O9M A;  4DSF A;  3GII A;  4NLN A;  3SR6 A;  3BZK A;  3SD7 A;  3UQ2 A;  3AMZ A;  1WCL A;  4NWI A;  1N5W A;  4JK1 A;  1K1Q A;  4YG2 A;  4UB8 O;  2BGW A;  5KT3 A;  2C28 A;  2YMP A;  4DFD A;  5DB6 A;  3Q8S B;  2DQN B;  4ED6 A;  1IV8 A;  2YMQ A;  3PNC A;  5DQH A;  3SZD A;  1NI3 A;  2A19 A;  3ISC A;  1CRX A;  3LWM A;  2KN7 A;  1Z00 B;  2WAQ C;  4GC6 A;  4J9L A;  4EYI B;  4F4Z A;  3KVD D;  3HJE A;  5K4L A;  2OWO A;  3QNM A;  1L8O A;  2KZM A;  3ZD8 A;  4BDP A;  1XNS A;  2K4H A;  1VDV A;  1H6S 1;  2FPL A;  2HBK A;  2VIX A;  3HWT A;  2Y1J A;  1JAL A;  1HEK A;  5AFU L;  5KFV A;  1GFQ A;  3AAA A;  2OCE A;  1ZQC A;  1PK1 B;  5AIB A;  3SYB A;  2WF6 A;  4O3Z A;  3NAS A;  5KFG A;  2BPC A;  2ISP A;  5KFT A;  2UVU A;  2I1Q A;  3LVW A;  9ICP A;  3ETR A;  3EPG A;  5EWE A;  2XY5 A;  4IRD A;  2ALZ A;  3SV4 A;  4FMS A;  5AM3 A;  3PQU A;  5AKJ A;  4QZ9 A;  2ERV A;  5J0S A;  2PFN A;  3ONN A;  3I1Y A;  1X66 A;  2Y9T A;  2HHQ A;  4RNN A;  3E2E A;  9ICJ A;  8ICR A;  1MQ2 A;  1Q46 A;  3C21 A;  5DDY A;  4FE3 A;  4PGX A;  4J9S A;  5CA7 A;  3ISB A;  3VZW X;  4RZR A;  1KQQ A;  4R8U A;  1J97 A;  3UMG A;  2R8G A;  9ICK A;  1L7N A;  2W03 A;  5KG0 A;  4RQ1 A;  4UB5 A;  1ZQF A;  2R18 A;  1KEJ A;  5IIJ A;  4HYK A;  2HCF A;  1GFN A;  3PSI A;  4F4B A;  5DKW A;  7ICG A;  3WKE A;  5CB1 A;  2OMF A;  2XO7 A;  4DOB A;  1MPF A;  2KVS A;  4GF4 A;  4I27 A;  2KZ7 A;  2WB1 F;  3RBE A;  2G06 A;  5L1L A;  4OD0 A;  2KK0 A;  2A3V A;  2POR A;  5B66 O;  2AU0 A;  4Y2J A;  4QWB A;  2XCP A;  4GC7 A;  2XE5 A;  2BCR A;  5KAF U;  1KN5 A;  4YR2 A;  3NRZ A;  4PH5 A;  4AKR B;  2K8C B;  4O49 A;  3BS0 A;  2W81 C;  2AH5 A;  4I2J A;  4UAV A;  1ZJM A;  5J0Q A;  2FE9 A;  5J0O A;  3BQ1 A;  2Y0S C;  2EAM A;  3QU7 A;  1AQ6 A;  1FEZ A;  2PI4 A;  3QUB A;  1SZH A;  4CCH A;  1KBU A;  4RQM A;  3NRW A;  5CR0 A;  2XIC A;  4F5P A;  1TFR A;  5AKZ A;  3SAH A;  3TI0 A;  4B9T A;  3F5A A;  3E58 A;  9ICC A;  1BPB A;  1ZQY A;  1ZQH A;  4QZH A;  5J0T A;  4C4V A;  3SAF A;  3Q8Q B;  5IIO A;  3KHR A;  1T16 A;  5KFW A;  3G6X A;  2DF4 B;  4RQ5 A;  3H8S A;  4DSJ A;  2JH1 A;  4RNM A;  3N7R C;  3CP8 A;  5DGB A;  2O6K A;  8ICX A;  2HBJ A;  3PV8 A;  1X9M A;  1KFS A;  1HXT A;  3KZI U;  5ALO A;  5KT4 A;  2Y1I A;  3H4B A;  2QB0 A;  5KG3 A;  2ODJ A;  2P66 A;  2IWW A;  4FS1 A;  5DLF A;  4KLS A;  8PRN A;  1X9S A;  3UXN A;  4ECU A;  5GTI O;  2R89 A;  1A76 A;  3LWL A;  4M9L A;  3AA1 A;  2I6X A;  4M6W B;  3H0L B;  5KG5 A;  4F5R A;  1D9F A;  1TKD A;  5HR7 A;  7ICS A;  5J2G A;  3F2D A;  1NKB A;  8ICV A;  2KXP A;  1U47 A;  5F9N A;  1N5X A;  1JI7 A;  1YZ6 A;  1Z4N A;  2OM6 A;  2BPG A;  1ZRM A;  5ALQ A;  2FMS A;  4EX6 A;  1QSS A;  9ICA A;  3H40 A;  3T24 A;  5T14 A;  3QEB Z;  1NZP A;  5KFK A;  3C1Y A;  5AK5 A;  3UMB A;  4DQS A;  4FQE A;  3MFI A;  3KD3 A;  5ALK A;  2YN4 A;  3AQE A;  3RB4 A;  4QIW C;  2NV3 A;  2ZFG A;  1SGG A;  7ICM A;  4F72 A;  3KHL A;  1GFO A;  4FBT A;  3GIJ A;  2UVV A;  1ZRN A;  5KTQ A;  2OEH A;  1Q9G A;  3KOO A;  1DRG A;  1JN3 A;  3VZT X;  3M8R A;  3AA6 B;  5J2K A;  4B61 A;  4UAW A;  1U9L A;  2E8O A;  5CEH A;  1NOM A;  4ED7 A;  5AK4 A;  2KD1 A;  1S77 D;  3PR4 A;  5DQI A;  4R64 A;  3POX A;  4CGZ A;  2E5S A;  1ZQV A;  3M6Z A;  3MFH A;  3VZU X;  3FDS A;  1TV9 A;  3IV6 A;  4OJ6 A;  3NVZ A;  1IZN A;  2HVH A;  2W9M A;  1T3Q A;  3UXP A;  1E54 A;  9ICG A;  2HDO A;  4GHB A;  1IIP A;  2LHF A;  3TKA A;  2NYV A;  1BPD A;  1NJY A;  3VE1 A;  3KKA A;  5ALU A;  3C28 A;  2P35 A;  2IOF A;  1T94 A;  3D2S A;  5J0R A;  3NVW A;  2JR5 A;  1LKY B;  4UB8 U;  2XE2 A;  3M9N B;  2K60 A;  4I2F A;  2KIW A;  1T3N A;  2IWV A;  4EEK A;  3TZG A;  1ZQ1 C;  4KTQ A;  2HHW A;  1PK1 A;  3HW9 A;  3AEV A;  4DQP A;  3RJJ A;  2KSO B;  1S0M A;  2DL0 A;  4EEY A;  2ZIU B;  1BNO A;  3FC4 A;  4DFP A;  3RTV A;  1T8E A;  4GFJ A;  2KKV A;  5JTI A;  2IHM A;  1TVA A;  1URJ A;  4J9O A;  4YXJ A;  4G3I A;  4AYB F;  4KX3 A;  2XTR A;  3SZV A;  3F2C A;  4ECV A;  1H38 A;  3PW0 A;  9ICI A;  3RRG A;  5AK6 A;  1YS5 A;  2B21 A;  1RYS A;  2WHE A;  2H3Z A;  2W11 A;  1QJP A;  4DWI A;  5B5E O;  2QAR B;  2F3N A;  2K4T A;  1ZQS A;  5DGA A;  1TAM A;  3G7G A;  5GTH U;  1RG6 A;  2G09 A;  2VA3 A;  1BXW A;  4YMO A;  4DLE A;  3DZM A;  4NL9 C;  3V8U A;  2ZUC A;  1NKC A;  3Q8K A;  4DO9 A;  2PKE A;  4E1T A;  4RQ7 A;  2OXO A;  3G6Y A;  4B9U A;  2KFN A;  4YCX A;  1N62 A;  2YB4 A;  5DDM A;  4F50 A;  4NJ8 A;  4FOZ A;  1BGX T;  2R8H A;  1ORM A;  4XUS A;  3MBY A;  4XRH A;  4DF4 A;  2IHN A;  4AYN A;  1ZD2 P;  3GV7 B;  4BXO A;  3POQ A;  4GIB A;  1GFM A;  3AU6 A;  4QW9 A;  2XG6 A;  4AKR A;  4US9 A;  2J6T A;  1ED1 A;  1WCN A;  3FYX A;  3VE2 A;  1TK5 A;  3SI8 A;  3PVX A;  5G3A A;  2ZXI A;  2ZXH A;  4O0I A;  7ICJ A;  4UB6 O;  3M7D A;  1KKX A;  4IR1 A;  1ZHW A;  4Z6E A;  1UT8 A;  4UW9 A;  5B66 U;  1XS9 D;  3QZ8 A;  2BQU A;  5DL7 A;  3M1Y A;  1TAU A;  4DQQ A;  2EQY A;  4ICA A;  4BGD A;  2W7O A;  2W43 A;  4N75 A;  3NS1 A;  5KFU A;  1A0P A;  3IHQ B;  5ALJ A;  3C1Z A;  4EBC A;  4M9J A;  3PST A;  3FM9 A;  4NLB A;  4F3O A;  2YML A;  3SY9 A;  4LSE A;  3O0E A;  3C5G A;  4QWA A;  3AA0 B;  4ED3 A;  4CF5 A;  1LV5 A;  1L7P A;  1YT3 A;  1EXN A;  1SXE A;  2XI9 A;  5ADX L;  4DLG A;  1NK5 A;  4FBU A;  3QRC A;  4XNL A;  4FSP A;  3HX0 A;  2CXY A;  2MA1 A;  3RR7 A;  2W9A A;  5AIC A;  4DQI A;  1OW5 A;  5AKG A;  4M0A A;  4O3W A;  3WKA A;  4DFM A;  4IQV A;  1V38 A;  3QRA A;  5KG2 A;  4I2C A;  4FES A;  3EMN X;  2C2D A;  3WU2 O;  4BWM A;  5KFQ A;  1ZET A;  2M06 A;  8ICP A;  3HRD D;  1NJX A;  1FFV A;  5KFX A;  3IG5 A;  4NLC A;  3TAN A;  4O3Y A;  4TUS A;  2DGZ A;  3FAH A;  2WF7 A;  4ZOH C;  1GFP A;  2Y0K A;  2YQE A;  5PRN A;  3QU9 A;  4J9M A;  1L7M A;  4UBB A;  3OHA A;  1RPL A;  9ICW A;  3L3F X;  2GO7 A;  5TZV A;  4F2S A;  4IQU A;  1K5O A;  1TE2 A;  1S5L O;  3HOL A;  2DUY A;  3MGH A;  9ICE A;  3KZI O;  5DG8 A;  1WUD A;  3IN5 A;  2RDJ A;  2W8L A;  2R4L A;  4DSE A;  3AA6 A;  5F3X B;  1S0V A;  4FZL A;  4ED2 A;  2JXJ A;  2XID A;  2IOH A;  1IXR A;  2YNK A;  4PZO A;  3BJY A;  4KLJ A;  3C23 A;  1ZQK A;  1SV4 A;  1FIQ A;  5KFP A;  2W8K A;  2HVI A;  2EZX A;  2ZIW A;  4Y2S A;  4I29 A;  4KLT A;  3A0B O;  1M6Y A;  2ESE A;  5EE1 A;  1V97 A;  4RQ6 A;  3HKZ F;  1ZOL A;  4AYE C;  2J4U P;  7ICH A;  3PSP A;  1ZXI A;  2F76 X;  3HIL A;  1SIJ A;  3JPP A;  3M9O B;  4CE6 A;  2MUT A;  2FGR A;  2HOI A;  5ALG A;  7ICF A;  5KG1 A;  3K4G A;  2FPK A;  4M47 A;  9ICF A;  2MU2 A;  2OHF A;  4KLL A;  3M8S A;  2XE3 A;  5KFZ A;  4I2H A;  2H3V A;  4QWE A;  2VAN A;  5J2D A;  2KSO A;  2ZIU A;  1IG6 A;  4MF8 A;  5J2A A;  4CF4 A;  1G90 A;  2LYH A;  3A2S X;  4USA A;  4DS4 A;  5AI6 A;  4GXI A;  2RP5 A;  5KFA A;  2LYA A;  5E79 O;  1X42 A;  1ZQQ A;  3MR2 A;  3GFK B;  1ZQU A;  3RH5 A;  3RAQ A;  3C2L A;  5BOL A;  4OJP A;  3RJI A;  2D8C A;  1QJ8 A;  4RQ4 A;  4Z3T A;  3UU2 A;  1NJZ A;  4AUI A;  8ICN A;  2EAN A;  5HHI A;  1PHO A;  3WKB A;  1L3T A;  1NZB A;  5EOZ A;  3JTY A;  4JUZ A;  4QZ8 A;  4JV1 A;  3VCB A;  1MQ3 A;  2MNH A;  3F2B A;  5DB8 A;  2XGQ A;  3PW4 A;  2K4P A;  7ICK A;  3PW2 A;  4RNO A; 
#chains in the Genus database with same CATH homology
 2LBO A;  2XIC A;  2WB1 C;  4AZL A;  3SAH A;  4ACO A;  3LYS A;  3H0R B;  3F5A A;  1HXX A;  3VC8 A;  3KZX A;  3SAF A;  5FVN A;  3OPX A;  2W7P A;  5DL6 A;  2DF4 B;  3F53 A;  4KRA A;  2KKP A;  2VKQ A;  2JH1 A;  3N7R C;  4O3X B;  3CP8 A;  2F77 X;  2HBJ A;  4RL9 A;  1HXT A;  4QNL A;  2KDY A;  3SMV A;  3O0F A;  2G5H B;  3HWB A;  4D65 A;  2ODJ A;  2XE1 A;  4AKM A;  3AAE A;  1ZHZ A;  8PRN A;  4QIW F;  2VJ4 A;  4P0Q B;  3AA1 A;  4IC9 A;  3H0L B;  3T0S A;  3N7P D;  5HR7 A;  3F2D A;  2YX8 A;  2KXP A;  2H3Q A;  3NSG A;  4G75 A;  4GCP A;  3D2N A;  4RLB A;  2VJ5 A;  2G07 A;  2OM6 A;  1BH3 A;  2KJ8 A;  3E0F A;  4LSF A;  2M0N A;  2Y0H A;  4PUX A;  4AYI D;  3T24 A;  5T14 A;  2KEY A;  3AA0 A;  4FZM A;  3AQE A;  3RFA A;  3DA3 A;  4QIW C;  2NV3 A;  2ZFG A;  5C0Y A;  1MM4 A;  1GFO A;  2D6F C;  3AAA B;  4O3M A;  2CRX A;  4RLC A;  4AYD C;  1Q9G A;  3VZT X;  1DRG A;  4C0Z A;  3M6K A;  3AA6 B;  4B61 A;  2ZG6 A;  3RBH A;  5EE2 A;  2F2A B;  3AA1 B;  4FUV A;  2KHQ A;  2H3F A;  2M07 A;  1ZHT A;  4A8E A;  3UAQ A;  2KD1 A;  5HR6 A;  3ICX A;  2ZIX B;  3POX A;  3GU3 A;  4CGZ A;  2E5S A;  3M6Z A;  4JMU A;  4FT6 A;  3VZU X;  4D5U A;  4OJ6 A;  3SY7 A;  4KMO B;  1IZN A;  4GCQ A;  3HOE A;  4P0P A;  4QJF B;  1L6N A;  1E54 A;  1THQ A;  4KR8 A;  2ZIV B;  4GHB A;  3WI4 A;  1IIP A;  2LHF A;  2J1N A;  2JMM A;  3VE1 A;  3C28 A;  1T94 A;  3LK3 A;  2LYB A;  2JMG A;  3D2S A;  4CDG A;  2E1F A;  1UPH A;  2KV2 A;  2LHT A;  2XE2 A;  1QJ9 A;  2OYY A;  2KVC A;  2E1E A;  2KIW A;  3PQS A;  3TZG A;  1ZQ1 C;  2W04 A;  2F1T A;  1Q3U A;  2JGA A;  3AA7 B;  3HW9 A;  2G0A A;  3AL0 B;  2Q4T A;  4BJQ A;  2ZIU B;  4BX9 C;  2HOF A;  3SQI A;  2KNJ A;  2KZ7 B;  4GFJ A;  2KKV A;  3H0M B;  3IP4 B;  1URJ A;  2X27 X;  2K4I A;  1PRN A;  4AYB F;  3WI5 A;  4KX3 A;  1MM5 A;  2XTR A;  3SZV A;  3F2C A;  4XNK A;  4FRT A;  1IZN B;  3VY9 X;  4N59 A;  2PRN A;  4CRX A;  1YS5 A;  2HBL A;  4JFB A;  3SYS A;  5CRX A;  4LSI A;  2H3Z A;  2JHD A;  2YB1 A;  1QJP A;  3KFU F;  1ECW A;  5KL1 B;  2K4T A;  5T5F A;  3POU A;  1TAM A;  3G7G A;  2G09 A;  2KJ9 A;  2N2M A;  1BXW A;  4C69 X;  4U6P A;  1OSM A;  3V8U A;  2HBM A;  4E1T A;  2K4E A;  4AYB C;  2OXO A;  1F44 A;  2BDU A;  1P4T A;  4RJW A;  3LK2 A;  4KX5 A;  4AYM C;  2YB4 A;  2FGQ X;  2HOQ A;  4FOZ A;  5ADX K;  5DL8 A;  1ORM A;  2F8L A;  4AYN A;  4GCS A;  4BUM X;  4WJ3 B;  4NV0 A;  2PMZ F;  3POQ A;  1GFM A;  2XG6 A;  4AKR A;  3C29 A;  1ED1 A;  3AAE B;  3FYX A;  3NUQ A;  3VE2 A;  4U7C A;  4LSH A;  1HIW A;  2ZXI A;  2ZXH A;  2LKY A;  5DL5 A;  3N7S C;  3M7D A;  1Q3V A;  1ZHW A;  4U9C A;  5GV0 A;  1Q9F A;  2KXP B;  4KR4 A;  4N58 A;  5DL7 A;  1P7D A;  3DEE A;  4ICA A;  2W7O A;  3MGV A;  4PL1 A;  2XTQ A;  4RJX A;  5JDP A;  2GH1 A;  1A0P A;  2K0L A;  3LK2 B;  2PMZ C;  3PST A;  4NLB A;  1PVR A;  3SY9 A;  3SAG A;  3K19 A;  4LSE A;  3O0E A;  3ALR A;  2O4V A;  5D5D A;  3AA0 B;  2RRD A;  1YT3 A;  3UPG A;  5AFU K;  2XI9 A;  1BT9 A;  5ADX L;  3LVV A;  3RF9 A;  3QRC A;  4XNL A;  2ZLD A;  1PVP A;  4FSP A;  1D8B A;  1HXU A;  1MA7 A;  2N2L A;  2MA1 A;  2RHF A;  2WAQ F;  4O3W A;  1XO0 A;  3QRA A;  4P0Q A;  4FES A;  2F1V A;  3EMN X;  2MHL A;  2W80 C;  4NWI A;  4D64 A;  2M06 A;  3AQF A;  2JH7 A;  3GP6 A;  1GO3 F;  2CPR A;  3CYM A;  4QQ1 A;  3IG5 A;  2DQN B;  4NLC A;  4O3Y A;  3PZP A;  4AFK A;  2KOB A;  3SZD A;  2DGZ A;  1GFP A;  2Y0K A;  4P0P B;  3VY8 X;  1CRX A;  5IYU A;  5PRN A;  2G5I B;  3L3F X;  2WAQ C;  3LK4 1;  3F5E A;  3LK3 B;  3KVD D;  4G76 A;  1XNS A;  3HOL A;  2K4H A;  4BUG A;  4E1S A;  1H6S 1;  2CN1 A;  2HBK A;  4O4X A;  2VIX A;  2GE4 A;  1ZHX A;  1HEK A;  5AFU L;  1GFQ A;  3AAA A;  4FRX A;  1WUD A;  3IN5 A;  3SYB A;  3AA6 A;  4OJ5 A;  4O3Z A;  2YPV A;  4FZL A;  2XVT A;  2XID A;  4OJO A;  2G08 A;  2YNK A;  3T20 A;  3LVW A;  4FMS A;  2ZIW A;  2LFU A;  2HMX A;  3T79 A;  3PQU A;  3CRX A;  2ZIX A;  3LK4 2;  2Z7J A;  3HKZ F;  2ERV A;  4AYE C;  2J4U P;  3ONN A;  2Y2X A;  3PSF A;  3PSP A;  2K8A A;  5G26 A;  2F76 X;  1A6S A;  2ZIV A;  3D2Q A;  2Y0L A;  4FZN A;  4FE3 A;  1OPF A;  2FGR A;  2HOI A;  3VZW X;  2KHV A;  7PRN A;  2K89 A;  3POR A;  2K8B B;  2KC0 A;  3IG8 A;  5KL8 B;  2W03 A;  2R18 A;  2QTK A;  1Z19 A;  2XE3 A;  2Y0S F;  1GFN A;  3PSI A;  2H3V A;  3AA7 A;  4F4B A;  1Z1B A;  2OMF A;  1MPF A;  2XMX A;  4GF4 A;  2ZIU A;  4PL2 A;  1ZHY A;  2OH2 A;  3HKZ C;  2KZ7 A;  1G90 A;  2WB1 F;  2G06 A;  3A2S X;  2N1R A;  2GOL A;  4OO1 J;  2RP5 A;  2LYA A;  2A3V A;  2ZIW B;  2POR A;  2XE5 A;  1PVQ A;  1OUQ A;  2KIC A;  3GZF A;  6PRN A;  4FSO A;  4OJP A;  4AKR B;  1QJ8 A;  3K1Z A;  4Z3T A;  3UU2 A;  2K8C B;  3DA4 A;  4O49 A;  4AUI A;  2W81 C;  1PHO A;  2H3I A;  2MRL A;  5A0L A;  1NZB A;  3JTY A;  4OJL A;  2Y0S C;  3VCB A;  2MNH A;  1SZH A;  3F2B A;  3C5O A;  2Y7S A;  1KBU A;  3PRN A;  2KJ5 A;  4O4U A;  3NRW A;  4JCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...