4FZLA

High resolution structure of truncated bacteriocin syringacin m from pseudomonas syringae pv. tomato dc3000
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
239
structure length
239
Chain Sequence
GMQNPVATVLLLQGDLYCSPNCLATFQDQARRDSFGIQSKVALKTFAAADQREAEGRDLRTAYNEIATDIGRSQQINENIIKYPPGNHVLSGGLMTPFHALAHGMFGLGAPLTFPIQNVGLNVDIRGIPDVMNVIQSARPVGTSSLDVNFAYDVGKDSNASWLTLGNITLRLVGTIDKNASGAWTFSGEIRAFNDVYDANPSNHRGWLGENLTSLLSAVPFTSYSIEIPGSLPVTVSGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Lipid II-degrading Bacteriocin Syringacin M Suggests Unexpected Evolutionary Relationships between Colicin M-like Bacteriocins.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Antimicrobial protein
molecule keywords Bacteriocin
total genus 73
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.790 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4fzlA01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4fzlA02
3DA3A 2XTRA 2XTQA 4FZMA 4N58A 2XMXA 4G75A 4N59A 4FZNA 4G76A 3DA4A 4FZLA
chains in the Genus database with same CATH superfamily
4O3MA 3NSGA 1BPDA 3OJUA 3PQSA 3HPOA 4BWJA 1ZRNA 3ZDEA 5KAIU 5AKIA 4QWDA 4ECXA 2RDIA 4UAZA 4XNLA 3QEAZ 1S0OA 5B5EO 2IWWA 4Z6FA 4QIWC 4DQQA 4USAA 3M6KA 2KV2A 1S0NA 2AXTO 1SZPA 2AGOA 5KFIA 3PQUA 2FGRA 5AKEA 1PZNA 5CRXA 4YQWA 4C7ZA 5HHHA 4F50A 1B22A 1N63A 4UB2A 8ICSA 3PSTA 1ZQQA 2K4TA 4FZNA 4M9JA 2K4PA 3BS5B 2E8NA 4QZAA 2KTQA 2YPVA 1SV0A 3Q8KA 5KFWA 4C8OA 2FDRA 4RQ0A 3SV3A 2JR5A 4FBUA 1F44A 4KLHA 4MEXA 1DGSA 1QQ6A 3SI8A 5KT7A 1XSLA 5IIOA 4Q8EA 4NLGA 1NZBA 4FUVA 4JUZA 1ZQGA 3DV9A 2VA2A 3PR4A 7ICQA 3AM9A 3L5KA 5AI5A 4UB5A 2K60A 4LVSA 2JEFA 4ZOHC 1TAQA 3ETLA 1ZHZA 3O0FA 5D5DA 3UMCA 4KN4A 4F4BA 4EBCA 1D8LA 2GE4A 3SMVA 3RJFA 5D4BA 4Q43A 3JPSA 7ICEA 2K89A 1OSMA 1NI3A 4C8MA 3QU9A 3EZ5A 2AQ4A 4G9BA 4B9MA 1SV4A 3AQFA 2XO7A 1U49A 2A1JA 1U47A 2VKQA 3K75D 4JMUA 5F9NA 1TAUA 5KT2A 2XY7A 4QW8A 4RQ5A 4B9UA 2W7PA 2XE5A 1JXEA 1X66A 4QWBA 1NK0A 4UB6U 3HOEA 2JH1A 5KG6A 2KFNA 5DDMA 2R4OA 8ICQA 5K4LA 2IWVA 4YN4A 5KFFA 5G5HA 9ICRA 5DB6A 9ICJA 2VA8A 3ICXA 2BGWA 3AUOA 2BPGA 4DSFA 1LKYB 5AKJA 5CR0A 4K4GA 3BQ0A 1MQ2A 2F77X 2LFUA 4F5RA 2AXTU 3UU2A 3ZDAA 2YMQA 5KFGA 5EWFA 4KX5A 5IINA 5KFXA 2I5HA 3VY9X 4O3YA 1XSPA 4I2FA 4QWCA 4M9HA 2ZXHA 2W11A 4AYDC 3ISCA 2FMQA 4RNOA 4P0QB 4RQ1A 4R65A 1SGGA 3G6YA 9ICTA 2WTFA 4Y2JA 2KZ7B 3H4BA 5F3XB 5PRNA 2W54A 3F5EA 1N56A 1IZNB 4C7YA 4I2AA 5KFYA 2J6TA 3GQCA 1F0MA 1L7OA 1M6YA 2M9NA 4EELA 9ICEA 5DL5A 2RLTA 5ALHA 2XIDA 3KHLA 3RH6A 4GF4A 2DQNB 3IHQB 2PFOA 1KKXA 2HBKA 4C4SA 4YD1A 5KFPA 3F2DA 2XVTA 1BPXA 1G90A 2G09A 2QB0B 1JIHA 1ZQKA 3GV8B 3RAXA 4I2HA 4D64A 5DL6A 8ICAA 2KHVA 5HNKA 4FOZA 5KFHA 1IG6A 1UPHA 3ORYA 3LK9A 2WHEA 3AL0B 1SL0A 2C2DA 5IIJA 1RYSA 3A0BU 2LYBA 1SL1A 1KN5A 3NVZA 1JRPA 3CW2C 3D2SA 3HJEA 1QSLA 4M9NA 1LV5A 1ZQNA 2BCQA 3UMBA 2NYVA 2Y0LA 3LK42 1OPFA 4Y2UA 5TISU 4J9PA 1T94A 3PGUA 2YMPA 4UATA 5L1MA 3H0MB 4DQIA 1ZQRA 2KICA 8ICBA 6PRNA 1WG8A 4QIWF 3M9OB 3F5AA 2XICA 2F76X 2W9CA 2PFQA 2ERVA 1HJPA 4DSLA 4GFJA 3E2EA 3PSIA 1V85A 3RB4A 2W3SA 5KAIO 3LK2A 3ZD9A 4UW9A 5AI6A 1ZJMA 5J8YA 3C2KA 5JRTA 2ZG6A 3V6JA 8ICKA 2ZJ5A 3GIIA 5KG7A 4FQEA 3MFHA 5E79U 4Z6EA 1D9DA 1O03A 9ICFA 1A0PA 2RDJA 3SAGA 2ZTDA 4DL2A 2A3VA 1CRXA 8ICPA 4A8EA 1XU4A 4DSJA 1BT9A 2HBJA 1XSNA 3NJTA 3RH5A 4K4IA 3C21A 1UT5A 1WWVA 2BCUA 2D8CA 3K19A 3UM9A 3N4MB 2OMFA 3JPNA 3DDHA 3NUQA 2W81C 3H0RB 4XUSA 4B9TA 4OO1J 7ICHA 5AKXA 4LJXA 2E1FA 3T5JA 2M0NA 1A76A 2Y1JA 2G0AA 3QUTA 1J97A 4ECWA 4ED6A 8ICWA 1KFSA 3LK2B 4PHDA 4RT3A 2HBMA 4F71A 2HOFA 4Q45A 2O4VA 4O3ZA 4RL9A 2KIWA 3M9MB 2XC9A 1ZQLA 1LVHA 4PGQA 5D46A 1ZQFA 5DQGA 2MA1A 7PRNA 2BCRA 5J0SA 1E54A 4P4MA 4IS7A 4GXIA 3K1ZA 2A1AA 3CP8A 1T8EA 1ZD2P 4P0PB 2QARB 9ICBA 4N58A 3LVVA 4NWIA 1BNOA 3VZTX 4O3PA 4NLKA 2KVSA 5AM1A 4F4KA 1L7PA 2XI9A 3UMGA 1UA1A 5J2BA 3AA1B 4R63A 3PRNA 4QZFA 3AU6A 4DS5A 1T7PA 2JMGA 2DPIA 5J2IA 3O0EA 2KZMA 4Y2PA 4M9GA 4KLUA 4EBDA 8ICTA 5BOLA 1ZJNA 2NRVA 3H8JA 2HOIA 2NRTA 1H38A 4O4XA 3H0LB 4PGYA 4YXMA 2IOFA 2Q4TA 2KFZA 3G6XA 2WF8A 3QZ8A 4F8RA 3RBHA 3UPGA 2R8IA 2YMLA 4YMOA 1Z4NA 3PR5B 4B9VA 4IRKA 7ICNA 4M47A 1KEJA 4Y2RA 3KHRA 4MEYA 4F2SA 3IM1A 2HSZA 4FS1A 3MR5A 2BQRA 2YQEA 7ICJA 5J0PA 2YB1A 2OWOA 4Z3TA 2KXPB 5CB1A 4NJ8A 3KKAA 4IR1A 4FESA 1TVAA 5KL1B 5KG2A 2KSOA 3BZCA 1PUZA 2MUTA 4RQ4A 4C4VB 3N7RC 3JTYA 4K4HA 1F5SA 3GV7B 4NLCA 5KT6A 8ICVA 4F4ZA 3NASA 3V6HA 7ICPA 4FRTA 3ZDBA 2IA6A 4YFKA 4K3BA 3F53A 2YMMA 3BQ1A 1OXJA 3SV4A 2ASJA 4CGZA 4FFDA 3ISBA 1L3VA 4ED3A 2GO7A 2DPJA 4U9CA 3QXGA 3WK7A 1S77D 3GIMA 2LYAA 3GV5B 2F3NA 1Q9FA 3VC8A 4GXKA 5ALTA 4CDGA 2DUYA 1TAMA 3QUCA 3KHGA 3DA3A 3AA0B 3NVVA 4J9OA 2BDUA 2LM1A 1N62A 5DLFA 1CI4A 5G39A 2ZUCA 7ICVA 2IHNA 4QZHA 1U4BA 3PGSA 3RF9A 1T16A 3L3FX 2AH5A 1KSPA 5J0UA 4DOAA 4R64A 4ECVA 5KG3A 5J2FA 3FM9A 3QEBZ 1PHOA 4JB3A 2YTUA 3RJEA 8ICNA 2FLPA 5AKZA 3KZIU 4NLZA 2KIVA 3M8SA 4F5NA 2KJ5A 3POQA 1TKDA 2W3RA 3E0FA 1X40A 2NRZA 1ZQZA 4BX9C 2HHSA 2E5SA 2QTKA 4UBBA 4DOBA 1ZQXA 2QB0A 4O3SA 1ZQPA 3PMNA 4BUMX 9ICVA 5CEHA 8ICMA 4FT6A 3RBDA 1L8OA 4NM1A 4ZH4A 1X9WA 1TK8A 2XY6A 2KE7A 4GHBA 3DA4A 1V38A 2ZIWA 3C5FA 1EXNA 2WB1C 3E58A 2KD1A 3QU2A 3VE2A 4J03A 8ICCA 4KLTA 2JH7A 8ICHA 4PH5A 3QUBA 1OUQA 3TADA 1T4GA 2ASLA 3ZI4A 4AYMC 1ZQJA 1UHUA 3LWMA 1BPEA 4US9A 3BQTA 5KT4A 5ALXA 3A0BO 3QRAA 4GLXA 1ZD5A 1QSYA 9ICNA 1DGJA 1RXWA 3U26A 3OPXA 4G3IA 3T5KA 1U48A 3SQIA 3A0HU 4J9SA 2R8JA 3QYPA 4E1TA 4ED0A 1RQLA 2OYYA 1SKRA 4KMOB 5KFBA 4TURA 2J6UA 2ESEA 3AN1A 2J1NA 5DGAA 2VA3A 2X27X 2EZYA 3KZXA 3V72A 3V7KA 4DL4A 3V7JA 2YNKA 2KP7A 4B6JA 3SYBA 3HWBA 1X2IA 4DSIA 9ICIA 2OH2A 5ALJA 2ZIVB 4C8NA 1IIPA 3HOLA 3OGUA 1LKYA 2KK0A 4B61A 7ICOA 2Z7JA 5EE3A 1L3SA 1OW5A 4Y2VA 2JZBA 5J8YC 4DFKA 1ZHTA 1SKSA 5D49A 3DZMA 2EANA 5ALWA 1NJZA 3LK3A 4R66A 4ECYA 4Y2XA 3C5OA 4ED7A 3SZDA 2WJRA 1J2NA 2BQUA 3IRUA 3PW0A 3WU2U 4EX7A 3QU5A 2MSNA 4NLBA 3RJHA 2Y0SF 3HP6A 3ETRA 4PHEA 3TFSA 1FIQA 2P66A 3A2SX 4GC7A 4RQ7A 2ZUDA 2KDYA 3L4PA 5TISO 3M9NB 5ALYA 3T3FA 4YMMA 4C0ZA 2WF9A 2BCVA 4GIBA 2OXOA 2R8AA 1RM6C 2W55A 1COOA 2Q0ZX 3OTQA 5DB9A 4KLEA 2Y9TA 5AFUK 5AIAA 1ZQIA 3EPIA 4AYBF 4C8KA 2XG6A 4RQ3A 5IIKA 4RQ8A 4O3NA 3FC4A 4YR3A 3PVXA 3SYZA 2IOHA 2DWQA 8PRNA 2B0CA 4KR4A 2KC0A 1A77A 1T3QA 3RB3A 2W43A 3AQEA 3WK9A 4FS2A 2KEYA 1ZQBA 8ICOA 2HVHA 1JX4A 5CP2A 1NKEA 2NV3A 5KFJA 3C2LA 2JHDA 4DL7A 5EE1A 3PX4A 5AI8A 1S97A 4DOCA 2M06A 1RYRA 7ICFA 2Y7SA 2ZUBA 1ZETA 3QE9Y 3BRYA 2XGPA 4DL6A 4F92B 5J2EA 2UVUA 1JALA 4K3CA 1KW4A 1YS5A 3RB0A 2R4LA 1K1SA 2K8CB 7ICUA 5G38A 1FFVA 1N5WA 2Y1IA 4O4UA 3HKZF 3PW5A 4M9LA 3VE1A 5DBBA 5EWGA 4XA5A 3IG8A 3AA7A 4RU9A 5DKWA 5KG1A 2QKQA 1TV9A 4JCHA 2AGPA 5AKHA 3PX6A 5JDPA 3TFRA 5J2DA 2UVVA 4EZ6A 1FEZA 3WK6A 4QWAA 1XC9A 3FYXA 4DF8A 3AAAA 1ZQDA 2EAPA 5C0YA 4O3WA 1BNPA 1N61A 1L5UA 1QLNA 2WB1F 5CA7A 3KBBA 4GCQA 2BCSA 5HR6A 3WK8A 1NK7A 1PK1B 2W8LA 2G06A 1NK9A 3FDSA 3VY8X 2HHTA 5AI9A 3RRGA 3G7GA 4FZLA 2G5HB 5DG7A 4DL5A 8ICEA 1QJ8A 4UB8U 3WKEA 1D8YA 1WYGA 9ICHA 2XTRA 3QU7A 3S6JA 1ZRMA 2LMRA 3H40A 3R9KA 5ALIA 4OJLA 4M0AA 4UAWA 1T1LA 3UPQA 4BXOB 3UQ0A 8ICJA 3BZKA 4UB6O 4O5EA 4RQ2A 4OJ6A 1PK3A 2ZLDA 4PGXA 3AU2A 3PO4A 4QZDA 4QZEA 3HW8A 4KLSA 5B5EU 3RFAA 2RQ5A 2F1VA 3MGVA 1BPZA 5KFTA 4KLOA 1NNLA 3LYSA 1N2XA 2MUTB 3ZD8A 4O0IA 4AYEC 3WKDA 2PFPA 2F1IA 1MC8A 1ZQ1C 3NTUA 1HXTA 5KAFO 2W9BA 5G26A 2H3QA 5BOMA 2F1JA 3SY7A 4TUSA 3ZDCA 2E8PA 1KQQA 3HX0A 1ZXIA 1KFDA 2FPLA 3V7LA 4J9RA 7ICGA 5F9LA 4N75A 5AM4A 4EEKA 5DDYA 5EOZA 2JMMA 5JUMA 3DWNA 3TARA 5KNIA 3HW9A 4YMNA 8ICLA 5J2JA 1QH9A 2BZFA 2AJQA 5ALFA 1Q3UA 5KFVA 4IQVA 4RJWA 3N7PD 1ZHXA 4BUGA 4NXZA 4I27A 4DQRA 4RUCA 2PORA 4R8UA 4DFJA 2KG5A 3PF1A 2YB4A 2PI4A 8ICZA 3BQ7A 4EBEA 1NJYA 2EDUA 3F2CA 2GOLA 4UB3A 5J0RA 2W9MA 3GDXA 9ICUA 5KG0A 5J0XA 2OCEA 3MFIA 3GFKB 4I2EA 5IYUA 2FE9A 5H2FO 3EMNX 4JWNA 2BHNA 3C1YA 2B6GA 4EYHB 2E8MA 3WK4A 4QZCA 2K8AA 3BS7A 2K4IA 1QCKA 1GFNA 5T14A 3BRZA 4NLNA 4RZRA 2CXYA 4I2JA 5DG9A 4DLEA 4PPXA 4QZ8A 1WCLA 4FBTA 5KFRA 3Q8QB 1JN3A 4MF8A 4DSEA 2W03A 4XNKA 4C00A 3IDWA 1ZYQA 1NZPA 4I2DA 1PVPA 4AYNA 2R4NA 2HDOA 3AEVA 2XTQA 4YD2A 4LSIA 2FPMA 5FP0A 1JROA 2F44A 4IR9A 4YVZA 2KJ9A 2F1CX 4RUAA 5IILA 1NOMA 2CN1A 4M6WA 4FSOA 5ALQA 3OHAA 4RNMA 4AKRA 3MR3A 2MRLA 4HYKA 5ALGA 4Y2QA 4PR7A 2C22A 2FPKA 7ICSA 3IN5A 3MR2A 5AK6A 4F3OA 2ES6A 2E3TA 4RQNA 1PVQA 4RJXA 2OM6A 3T5HA 4DFPA 1NJXA 3POXA 1Q8KA 4O5CA 3Q8SB 5ALSA 2PI5A 1S5LU 2XE2A 5DL7A 1URJA 3TQ1A 3WI4A 1KLNA 2WAQC 1ZQMA 4MFFA 2FJ6A 3K1RB 4F72A 5DQHA 4P0QA 2PFNA 4UARA 2MNHA 2M07A 3ZDDA 3WKAA 1DRGA 3D6JA 4DEZA 4KX3A 3WI5A 2P6UA 2C2EA 3JPPA 3UXPA 2KNJA 2WF5A 3GZFA 3Q8MA 5ALUA 2HMXA 4Q8FA 2IMWP 1XO1A 1T3NA 1DXSA 1ZQCA 3V8UA 3N28A 2ASDA 1S10A 1X9XA 1KTQA 1BGXT 5ALPA 2AQ0A 2K8BB 1TK5A 4F93B 4I2GA 5AM5A 3TACB 4KLIA 2MHLA 2W80C 1Z1BA 4M6WB 4DFDA 1YZ7A 5KFAA 3RAQA 2VIXA 3J81j 2DL0A 2CRXA 3ISDA 4FO6A 2KVCA 1N48A 2FLLA 2NO5A 4RPXA 2FMPA 9ICAA 2W7OA 3N7SC 5KFDA 5JU5A 4CF3A 1L7NA 2P35A 5L1LA 3Q8RB 3OSPA 4OCZA 2R8HA 3I28A 3AA0A 4XQ8A 2VJ4A 2H5XA 5J0YA 3HILA 2HHUA 3TADC 2LPEA 4NM2A 5CWRA 2ALZA 3WKCA 2I1QA 3MDAA 8ICXA 4AUIA 3LDAA 3NVWA 2X9KA 1J2MA 4PZOA 2EAMA 3THVA 3JPQA 1XO0A 7ICLA 5ADXK 9ICGA 3QX7A 3I1YA 1ZHYA 9ICQA 4F5PA 1MM4A 2R8GA 3AA6A 4LSFA 5ALZA 8ICUA 4O9MA 2PMZF 2RP5A 3C5GA 3H8MA 2H3VA 2KSOB 3FAHA 4DSKA 5KFMA 1FFUA 3TANA 4F5OA 1SZHA 4P4OA 1COKA 4EENA 3Q8LA 2K4HA 4UBCA 3ONNA 1SIJA 2ODJA 4C69X 1L6NA 4IQUA 4CNQA 3SEIA 1NKCA 3K4GA 3RJGA 4Y2SA 2KKPA 2WVPA 2JV3A 3AMZA 1A6SA 3WK5A 1TFRA 5GV0A 4PZNA 1XNSA 2HHVA 5HMMA 4EZ9A 1SXDA 1PRNA 5CHGA 3EUB2 1Z00B 1CEZA 1L3TA 5J0OA 2WF7A 1XWLA 4UB8O 2H3ZA 1BPBA 1DK2A 1VLBA 1THQA 5AK4A 4ACOA 3PX0A 5TZVA 1ZQUA 2H3IA 3PY8A 9ICSA 2ZIVA 3PNCA 3AAEB 2R18A 2R88A 2W9CB 1HXUA 4I2CA 5EE0A 4BGDA 3IG5A 2WF6A 2K0LA 1MPFA 2DGZA 2LHFA 1JXLA 4RPZA 1NK5A 2F1HA 2VANA 5AKLA 2V4QA 1QJPA 1D9FA 4FMSA 4RLCA 2OHFA 4DCCA 2LKYA 3KHHA 2GWSA 3PGRA 5FVNA 1HUZA 2KOBA 1Q3VA 2LYHA 1TK0A 2HHXA 1X6JA 3SAHA 4U7CA 4DLGA 3MGHA 2CPRA 2JEGA 5ALEA 2ZTCA 2DBYA 5B66O 2HBLA 4QNLA 2E1EA 1S8OA 2VJ5A 2XMXA 4JV1A 4AKMA 3PZPA 3PW4A 4JK1A 2PKEA 2BDPA 1WCNA 5DG8A 3F2BA 1V9PA 1Z4OA 2QLTA 4TUPA 2J6SA 4RQMA 3TKAA 1HXXA 4IRDA 1ZHWA 1GFPA 2MU2A 3GP6A 1X6IA 7ICIA 5IIMA 4PJ0U 4O3RA 2ISPA 1SXEA 4E1SA 2P6RA 4JFBA 2F8KA 1U45A 4OJ5A 5AK5A 3GIKA 5HR7A 1B43A 1SV0C 1SWWA 5J2KA 2W8KA 2D3DA 3UAQA 1NK8A 5KFNA 4KN7A 3LWLA 3IP4B 4CRXA 3Q8PB 7ICTA 4P4PA 5G5GA 3LK3B 2XGQA 2I6XA 4RPYA 1ECWA 3B0XA 1ZQOA 4UAUA 4MF2A 5KAFU 3M6ZA 4BWMA 2H3FA 4ECRA 3T5LA 2EZXA 4AYID 3VCBA 2LHTA 2C2RA 4KR8A 3MC1A 2XCAA 3TZGA 2NO4A 4X5VA 5L1JA 3RRHA 4ELVA 1S0VA 5B66U 1L8LA 3H7IA 3MR6A 2IBKA 2KMDA 4LSEA 1O08A 4KRAA 3N97B 4Y2YA 3PW7A 5KG4A 4Q44A 2GH1A 4DFMA 5GTIU 5KTQA 2L5YA 4ELTA 8ICFA 9ICKA 1S76D 1P7DA 1HIWA 4C8LA 4MFCA 4YG2A 1RYUA 3G6VA 2IOFK 5DB7A 3SZ2A 3C29A 4NV0A 5EE2A 2EZZA 3H8SA 4AKRB 2DFLA 5KFZA 5KFOA 1KRPA 1SWVA 1V97A 4FE3A 4UB1A 2F1TA 2WJQA 5J0QA 4US8A 2D6FC 1U9LA 5A0LA 3HWTA 2DF4B 3SZVA 4N59A 4ED1A 4IL6U 1ZQEA 3LK41 4D5UA 1RQNA 2PMZC 4C4TA 2BKEA 5DQIA 4M2YA 3RBEA 3DWOX 4RQ6A 4JV0A 3OJSA 1RG6A 3CNHA 4UAVA 4UQGA 3WKBA 4J9KA 2W9AA 3VZUX 4G75A 1GFQA 3WU2O 1ZQAA 8ICIA 4RNNA 5E79O 5EE9A 3SENA 2QB1A 2HI0A 1RXVA 4DS4A 4OJOA 4JV2A 2YY6A 3I76A 1JMSA 4RT2A 4F4XA 2FI1A 5DB8A 4KLFA 1MSWD 4CTDA 5KFUA 1S0MA 5ALOA 5KT3A 3CRXA 2GLEA 3T20A 1IM4A 3LVWA 5ALVA 1ED1A 4DF4A 1QTMA 4PL2A 3KFUF 9ICWA 3RR8A 3T24A 5AM3A 3PMLA 3MGIA 3RJJA 8ICRA 1P4TA 4CF4A 4U6PA 3MABA 3CYMA 2O6KA 7ICKA 3SD7A 4CCHA 4C4RA 3JPTA 2LM4A 4BXOA 1KBUA 4KMUA 2ZIUA 2QARA 2DKXA 2KJ8A 1RDFA 4YR0A 3NS1A 4ECSA 1ZD3A 4IC9A 1L3UA 2JRZA 5AHXA 1Z00A 1WWUA 2AGQA 1PVRA 5AI4A 4HAIA 4F4YA 5HP4A 4RLBA 2KKVA 3HKZC 2RHFA 4UB4A 4QZIA 4KLDA 3AAEA 3ED5A 1ZQWA 4NY8A 1NK6A 1SL2A 2RRDA 1MN8A 4YCXA 4DQPA 4ED8A 3D2NA 4Y2TA 4XRHA 2XCPA 3QNMA 4C80A 4FRXA 3SYSA 4E0DA 4N74A 4QZ9A 3C28A 4KLJA 3TAPA 2W9BB 7ICRA 1JUDA 2R4PA 2A1JB 3KOOA 4MHVA 4KLLA 2G5IB 3AA7B 3BS0A 1Y88A 3JPRA 2A19A 3M8RA 4EX6A 1RZTA 2JGAA 3H8WA 4QW9A 4EYIB 1ZQTA 1Z3EB 4EEYA 2Y0HA 4ECUA 5GTHO 1MM5A 4R8UB 1RPLA 3NVYA 5AK3A 5H2FU 3PO5A 2Y9UA 3KZIO 4J9QA 1NK4A 4OJPA 4LZDA 2IHMA 4YR2A 3JCUO 1ZD4A 5EWEA 5ALDA 9ICOA 3RH4A 4F5QA 2OEHA 5IIIA 2ODGA 3EPGA 4DL3A 4GC6A 4ECQA 1AQ6A 1VJ5A 4LSHA 4F4WA 2LBOA 2E8OA 4KLGA 2W04A 4KTQA 4QWEA 2V9WA 9ICCA 3A0HO 3B9JA 1UA0A 5G3AA 4ICAA 1IXRA 3BQ2A 4J9MA 3GILA 2KZ7A 1B4FA 4I28A 2WFAA 3AA6B 3PSFA 1KFTA 1ZQVA 3DEEA 2Y0KA 4QQ1A 4KLMA 1BH3A 5ALRA 3AAAB 2KZZA 2MAXA 4UAYA 3C2MA 3D2QA 2HCFA 5AM0A 2FGQX 1X42A 1FO4A 3M7DA 4B9LA 1YT3A 8ICGA 4O49A 1SB3C 2BPCA 3NRWA 3UXOA 5JTIA 1HUOA 5GTIO 4I2BA 1IZNA 3B0YA 4YP3A 4NL9C 3MBYA 4I29A 4O5KA 5KFEA 1C20A 4QJFB 2B21A 2F8LA 4ECTA 4ED2A 2XE1A 2ZFGA 3EYZA 2R89A 1QJ9A 4P2HA 2JEIA 8ICYA 5J2CA 2F2AB 5GTHU 5J2AA 4M04A 7ICMA 4I2IA 5KFLA 4IL6O 3POUA 5ALNA 3UXNA 4AFKA 3M1YA 4KLQA 4AZLA 5J29A 3PW2A 1NKBA 1TE2A 2N2MA 4TQSA 3GIJA 1N60A 4DQSA 1ZQSA 2KN7A 3AA1A 4LZGA 2ZIXB 1KDHA 4B9SA 5DBAA 3V6KA 2ZIUB 2AU0A 3QRCA 4D65A 1S5LO 2JZBB 3HT3A 4ECZA 5AFUL 2LI6A 3VZWX 4PHAA 1GFOA 2ISOA 2KZ3A 3RJKA 4Z6CA 5KG5A 4PL1A 5L1IA 1LB2B 3FYHA 3NRZA 1NJWA 2YN4A 5ALKA 4AP9A 2ZIWB 2EAOA 3EW9A 4BDPA 2BPFA 3NGDA 5KT5A 4QZGA 1K5OA 2HOQA 3JPOA 1GO3F 4O3QA 5BPCA 1YZ6A 5J0WA 2KHQA 5DLGA 2XY5A 2XE3A 3EWAA 4PJ0O 4P0PA 1Z19A 1BPYA 4CF5A 1MQ3A 4C4VA 3GU3A 3H4DA 2ATLA 1Q46A 3PV8A 4F91B 5DGBA 5HMLA 3UQ2A 3ALRA 2J4UP 5HHIA 2FLNA 3T0SA 1ZQYA 1X9MA 3BDPA 3IV6A 2NRXA 3RJIA 3OHBA 1QQ7A 1K1QA 5CJ7A 2HHQA 5AICA 5KFKA 3T79A 4IRCA 5L1KA 4UASA 4F2RA 2HW3A 1D8BA 1DK3A 4Z6DA 1DOQA 4GXJA 9ICLA 1BXWA 4GCPA 2Y2XA 5AI0A 1HEKA 4WJ3B 1UT8A 4FZMA 4NL9A 4PUXA 5ALMA 5KFCA 2NRWA 2R8KA 2DKZA 2C28A 1JI7A 4KITB 3MDCA 1IV8A 3TAQA 4TQRA 4FSPA 1PK1A 1Z1VA 1QSSA 2JEJA 1KL9A 3SAFA 4GCSA 2EH9A 5AKKA 3KTQA 4PHPA 3SY9A 2HHWA 3OSNA 2I9GA 2N1RA 4DWIA 3TI0A 1MA7A 2FMSA 5AKYA 2PRNA 5KFSA 5ALLA 4BJQA 2Y0SC 4JWMA 5J2HA 4IQTA 5J0TA 2BQ3A 3PORA 2AHOB 5DL8A 2UVRA 1Q9GA 2ZJAA 5AM2A 5ADXL 1SKWA 3SR6A 4OD0A 1BVSA 4J9NA 1QQ5A 3QU4A 1UCVA 5AIBA 3RR7A 4MFAA 5L9XA 4G76A 2ZJ8A 9ICMA 3RB6A 3KKAC 2G08A 2HVIA 4DO9A 3QZ7A 1GFMA 2BR0A 1H6S1 5T5FA 1ZOLA 1L7MA 4O3OA 3C1ZA 3HRDD 5J2GA 9ICPA 3PSPA 1XS9D 5C5JA 4QZBA 2WAQF 1S9FA 5DBCA 5KFQA 5KL8B 4J9LA 4TUQA 1N5XA 1C7YA 1ZQHA 4O3XB 4YXJA 3BS5A 3KVDD 2G07A 2N2LA 3KD3A 5AKGA 1B0XA 2ZXIA 3C23A 2V4RA 4AYBC 4ELUA 3QUQA 2UVWA 1AROP 3RTVA 4IQWA 2EQYA 1ORMA 2ZIXA 2JQYA 2PXIA 1UQVA 3BJYA 2K4EA 2YX8A 1X9SA 2ZTEA 4B9NA 2JXJA 1WUDA 1VDVA 4CE6A 9ICXA 2KXPA 1CUKA
chains in the Genus database with same CATH topology
4NLCA 3F2CA 3LK41 4O3MA 4D5UA 2PMZC 3NSGA 2GOLA 3PQSA 4FRTA 4XNLA 3F53A 5IYUA 3EMNX 4QIWC 3M6KA 2KV2A 4CGZA 3PQUA 3VZUX 4G75A 2FGRA 1GFQA 2K8AA 4U9CA 2K4IA 5CRXA 1GFNA 2LYAA 5T14A 1Q9FA 3VC8A 4OJOA 4CDGA 1TAMA 3PSTA 2K4TA 4FZNA 3DA3A 3CRXA 3AA0B 3T20A 3LVWA 1ED1A 2YPVA 2BDUA 2W03A 4XNKA 4PL2A 3KFUF 1PVPA 4AYNA 3T24A 1F44A 1P4TA 4U6PA 2XTQA 3RF9A 4LSIA 3CYMA 3L3FX 1NZBA 4FUVA 2KJ9A 1KBUA 2ZIUA 2CN1A 2KJ8A 4FSOA 1PHOA 4AKRA 1ZHZA 3O0FA 4IC9A 5D5DA 4F4BA 2MRLA 2GE4A 3SMVA 1PVRA 3IN5A 2K89A 1OSMA 2KJ5A 3POQA 4RLBA 2KKVA 4RJXA 3E0FA 3HKZC 1PVQA 2RHFA 2OM6A 3AAEA 4BX9C 2QTKA 2E5SA 3AQFA 2RRDA 3POXA 2VKQA 4JMUA 4BUMX 3D2NA 4FT6A 4FRXA 3SYSA 2W7PA 2XE2A 2XE5A 5DL7A 1URJA 3C28A 3WI4A 3HOEA 2WAQC 2JH1A 4GHBA 3DA4A 3AA7B 2G5IB 2ZIWA 4P0QA 2MNHA 2M07A 1DRGA 2WB1C 2KD1A 3VE2A 4KX3A 2JH7A 3ICXA 3WI5A 2JGAA 1OUQA 2KNJA 3GZFA 4AYMC 2Y0HA 2HMXA 1MM5A 2F77X 2LFUA 3UU2A 3V8UA 4KX5A 4OJPA 3VY9X 4O3YA 3QRAA 2K8BB 2ZXHA 4AYDC 4P0QB 2MHLA 2W80C 3OPXA 1Z1BA 2KZ7B 3SQIA 4LSHA 5PRNA 4E1TA 3F5EA 1IZNB 2LBOA 2W04A 2OYYA 4KMOB 2VIXA 4ICAA 2CRXA 5DL5A 2KVCA 2XIDA 2J1NA 2KZ7A 4GF4A 2W7OA 3N7SC 3AA6B 3PSFA 2DQNB 2HBKA 2X27X 3DEEA 2Y0KA 4QQ1A 3KZXA 3F2DA 2XVTA 1BH3A 3AAAB 1G90A 2G09A 3AA0A 3D2QA 2VJ4A 2YNKA 2FGQX 4D64A 3SYBA 5DL6A 3HWBA 2KHVA 3M7DA 4FOZA 1YT3A 1UPHA 2OH2A 4O49A 3NRWA 2ZIVB 3AL0B 1IZNA 4AUIA 1IIPA 3HOLA 4B61A 1XO0A 4QJFB 2LYBA 2F8LA 2Z7JA 2XE1A 2ZFGA 1ZHTA 1ZHYA 1MM4A 3D2SA 1QJ9A 3LK3A 3AA6A 4LSFA 3C5OA 3SZDA 2F2AB 2PMZF 2RP5A 2Y0LA 3LK42 1OPFA 2H3VA 1T94A 3POUA 4AFKA 3H0MB 1SZHA 2KICA 4NLBA 6PRNA 2Y0SF 4AZLA 4QIWF 3F5AA 2N2MA 2XICA 2F76X 3A2SX 2KDYA 2K4HA 2ERVA 3AA1A 3ONNA 4GFJA 4C0ZA 2ODJA 4C69X 3PSIA 1L6NA 2ZIXB 2ZIUB 2KKPA 2OXOA 3LK2A 3QRCA 4D65A 1A6SA 5AFUL 5GV0A 3VZWX 1XNSA 1GFOA 2ZG6A 4PL1A 1PRNA 5AFUK 4AYBF 2ZIWB 2XG6A 2H3ZA 1A0PA 3SAGA 1THQA 4ACOA 2A3VA 1CRXA 8PRNA 2HOQA 2H3IA 2ZIVA 3AAEB 4KR4A 1GO3F 2R18A 4A8EA 2KC0A 1HXUA 3AQEA 2KHQA 2XE3A 3IG5A 1BT9A 2KEYA 2K0LA 4P0PA 1Z19A 1MPFA 2HBJA 2DGZA 2LHFA 2NV3A 3GU3A 2JHDA 1QJPA 3K19A 4FMSA 2M06A 4RLCA 2LKYA 3ALRA 2OMFA 5FVNA 2Y7SA 2KOBA 2J4UP 3NUQA 1Q3VA 2W81C 3T0SA 3H0RB 3SAHA 4U7CA 2CPRA 4OO1J 1YS5A 2E1FA 2K8CB 2HBLA 4QNLA 2E1EA 3T79A 4O4UA 1D8BA 3HKZF 2VJ5A 2XMXA 2M0NA 2G0AA 1BXWA 4GCPA 3PZPA 4AKMA 2Y2XA 3VE1A 1HEKA 4WJ3B 4FZMA 4PUXA 3AA7A 3IG8A 3LK2B 3F2BA 4JCHA 2HBMA 2O4VA 2HOFA 4O3ZA 5JDPA 4FSPA 4RL9A 2KIWA 3SAFA 1HXXA 3FYXA 4GCSA 3AAAA 1ZHWA 1GFPA 3SY9A 2N1RA 3GP6A 2MA1A 4O3WA 5C0YA 7PRNA 2WB1F 1MA7A 1E54A 4E1SA 4GCQA 5HR6A 4JFBA 3K1ZA 4OJ5A 2PRNA 5HR7A 2G06A 3CP8A 3VY8X 3UAQA 4BJQA 2Y0SC 4P0PB 3G7GA 4FZLA 2G5HB 1QJ8A 4N58A 3PORA 3LVVA 4NWIA 5DL8A 3VZTX 1Q9GA 4CRXA 3IP4B 5ADXL 2XTRA 3LK3B 2XI9A 1ECWA 3AA1B 3M6ZA 2H3FA 3PRNA 4AYID 4OJLA 2JMGA 3VCBA 2LHTA 3O0EA 4G76A 4KR8A 2G08A 4OJ6A 2ZLDA 3TZGA 1GFMA 3RFAA 2F1VA 1H6S1 3MGVA 2HOIA 4LSEA 4O4XA 3H0LB 5T5FA 4KRAA 3LYSA 2Q4TA 4AYEC 3PSPA 2GH1A 3RBHA 2WAQF 3UPGA 1ZQ1C 1HXTA 5KL8B 5G26A 2H3QA 4O3XB 3SY7A 3KVDD 1P7DA 1HIWA 2G07A 2N2LA 2ZXIA 3C29A 4NV0A 5EE2A 2YB1A 4AYBC 2JMMA 4AKRB 4Z3TA 3HW9A 2KXPB 4FESA 4FE3A 5KL1B 1Q3UA 2ZIXA 1ORMA 2F1TA 4RJWA 3N7PD 1ZHXA 4BUGA 2D6FC 2K4EA 2YX8A 5A0LA 2DF4B 2PORA 3N7RC 3SZVA 3JTYA 1WUDA 2YB4A 4N59A 5ADXK 2KXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DA3 A;  2XTR A;  2XTQ A;  4FZM A;  4N58 A;  2XMX A;  4G75 A;  4N59 A;  4FZN A;  4G76 A;  3DA4 A;  4FZL A; 
#chains in the Genus database with same CATH topology
 4O3M A;  3NSG A;  1BPD A;  3OJU A;  3PQS A;  3HPO A;  4BWJ A;  1ZRN A;  3ZDE A;  5KAI U;  5AKI A;  4QWD A;  4ECX A;  2RDI A;  4UAZ A;  4XNL A;  3QEA Z;  1S0O A;  5B5E O;  2IWW A;  4Z6F A;  4QIW C;  4DQQ A;  4USA A;  3M6K A;  2KV2 A;  1S0N A;  2AXT O;  1SZP A;  2AGO A;  5KFI A;  3PQU A;  2FGR A;  5AKE A;  1PZN A;  5CRX A;  4YQW A;  4C7Z A;  5HHH A;  4F50 A;  1B22 A;  1N63 A;  4UB2 A;  8ICS A;  3PST A;  1ZQQ A;  2K4T A;  4FZN A;  4M9J A;  2K4P A;  3BS5 B;  2E8N A;  4QZA A;  2KTQ A;  2YPV A;  1SV0 A;  3Q8K A;  5KFW A;  4C8O A;  2FDR A;  4RQ0 A;  3SV3 A;  2JR5 A;  4FBU A;  1F44 A;  4KLH A;  4MEX A;  1DGS A;  1QQ6 A;  3SI8 A;  5KT7 A;  1XSL A;  5IIO A;  4Q8E A;  4NLG A;  1NZB A;  4FUV A;  4JUZ A;  1ZQG A;  3DV9 A;  2VA2 A;  3PR4 A;  7ICQ A;  3AM9 A;  3L5K A;  5AI5 A;  4UB5 A;  2K60 A;  4LVS A;  2JEF A;  4ZOH C;  1TAQ A;  3ETL A;  1ZHZ A;  3O0F A;  5D5D A;  3UMC A;  4KN4 A;  4F4B A;  4EBC A;  1D8L A;  2GE4 A;  3SMV A;  3RJF A;  5D4B A;  4Q43 A;  3JPS A;  7ICE A;  2K89 A;  1OSM A;  1NI3 A;  4C8M A;  3QU9 A;  3EZ5 A;  2AQ4 A;  4G9B A;  4B9M A;  1SV4 A;  3AQF A;  2XO7 A;  1U49 A;  2A1J A;  1U47 A;  2VKQ A;  3K75 D;  4JMU A;  5F9N A;  1TAU A;  5KT2 A;  2XY7 A;  4QW8 A;  4RQ5 A;  4B9U A;  2W7P A;  2XE5 A;  1JXE A;  1X66 A;  4QWB A;  1NK0 A;  4UB6 U;  3HOE A;  2JH1 A;  5KG6 A;  2KFN A;  5DDM A;  2R4O A;  8ICQ A;  5K4L A;  2IWV A;  4YN4 A;  5KFF A;  5G5H A;  9ICR A;  5DB6 A;  9ICJ A;  2VA8 A;  3ICX A;  2BGW A;  3AUO A;  2BPG A;  4DSF A;  1LKY B;  5AKJ A;  5CR0 A;  4K4G A;  3BQ0 A;  1MQ2 A;  2F77 X;  2LFU A;  4F5R A;  2AXT U;  3UU2 A;  3ZDA A;  2YMQ A;  5KFG A;  5EWF A;  4KX5 A;  5IIN A;  5KFX A;  2I5H A;  3VY9 X;  4O3Y A;  1XSP A;  4I2F A;  4QWC A;  4M9H A;  2ZXH A;  2W11 A;  4AYD C;  3ISC A;  2FMQ A;  4RNO A;  4P0Q B;  4RQ1 A;  4R65 A;  1SGG A;  3G6Y A;  9ICT A;  2WTF A;  4Y2J A;  2KZ7 B;  3H4B A;  5F3X B;  5PRN A;  2W54 A;  3F5E A;  1N56 A;  1IZN B;  4C7Y A;  4I2A A;  5KFY A;  2J6T A;  3GQC A;  1F0M A;  1L7O A;  1M6Y A;  2M9N A;  4EEL A;  9ICE A;  5DL5 A;  2RLT A;  5ALH A;  2XID A;  3KHL A;  3RH6 A;  4GF4 A;  2DQN B;  3IHQ B;  2PFO A;  1KKX A;  2HBK A;  4C4S A;  4YD1 A;  5KFP A;  3F2D A;  2XVT A;  1BPX A;  1G90 A;  2G09 A;  2QB0 B;  1JIH A;  1ZQK A;  3GV8 B;  3RAX A;  4I2H A;  4D64 A;  5DL6 A;  8ICA A;  2KHV A;  5HNK A;  4FOZ A;  5KFH A;  1IG6 A;  1UPH A;  3ORY A;  3LK9 A;  2WHE A;  3AL0 B;  1SL0 A;  2C2D A;  5IIJ A;  1RYS A;  3A0B U;  2LYB A;  1SL1 A;  1KN5 A;  3NVZ A;  1JRP A;  3CW2 C;  3D2S A;  3HJE A;  1QSL A;  4M9N A;  1LV5 A;  1ZQN A;  2BCQ A;  3UMB A;  2NYV A;  2Y0L A;  3LK4 2;  1OPF A;  4Y2U A;  5TIS U;  4J9P A;  1T94 A;  3PGU A;  2YMP A;  4UAT A;  5L1M A;  3H0M B;  4DQI A;  1ZQR A;  2KIC A;  8ICB A;  6PRN A;  1WG8 A;  4QIW F;  3M9O B;  3F5A A;  2XIC A;  2F76 X;  2W9C A;  2PFQ A;  2ERV A;  1HJP A;  4DSL A;  4GFJ A;  3E2E A;  3PSI A;  1V85 A;  3RB4 A;  2W3S A;  5KAI O;  3LK2 A;  3ZD9 A;  4UW9 A;  5AI6 A;  1ZJM A;  5J8Y A;  3C2K A;  5JRT A;  2ZG6 A;  3V6J A;  8ICK A;  2ZJ5 A;  3GII A;  5KG7 A;  4FQE A;  3MFH A;  5E79 U;  4Z6E A;  1D9D A;  1O03 A;  9ICF A;  1A0P A;  2RDJ A;  3SAG A;  2ZTD A;  4DL2 A;  2A3V A;  1CRX A;  8ICP A;  4A8E A;  1XU4 A;  4DSJ A;  1BT9 A;  2HBJ A;  1XSN A;  3NJT A;  3RH5 A;  4K4I A;  3C21 A;  1UT5 A;  1WWV A;  2BCU A;  2D8C A;  3K19 A;  3UM9 A;  3N4M B;  2OMF A;  3JPN A;  3DDH A;  3NUQ A;  2W81 C;  3H0R B;  4XUS A;  4B9T A;  4OO1 J;  7ICH A;  5AKX A;  4LJX A;  2E1F A;  3T5J A;  2M0N A;  1A76 A;  2Y1J A;  2G0A A;  3QUT A;  1J97 A;  4ECW A;  4ED6 A;  8ICW A;  1KFS A;  3LK2 B;  4PHD A;  4RT3 A;  2HBM A;  4F71 A;  2HOF A;  4Q45 A;  2O4V A;  4O3Z A;  4RL9 A;  2KIW A;  3M9M B;  2XC9 A;  1ZQL A;  1LVH A;  4PGQ A;  5D46 A;  1ZQF A;  5DQG A;  2MA1 A;  7PRN A;  2BCR A;  5J0S A;  1E54 A;  4P4M A;  4IS7 A;  4GXI A;  3K1Z A;  2A1A A;  3CP8 A;  1T8E A;  1ZD2 P;  4P0P B;  2QAR B;  9ICB A;  4N58 A;  3LVV A;  4NWI A;  1BNO A;  3VZT X;  4O3P A;  4NLK A;  2KVS A;  5AM1 A;  4F4K A;  1L7P A;  2XI9 A;  3UMG A;  1UA1 A;  5J2B A;  3AA1 B;  4R63 A;  3PRN A;  4QZF A;  3AU6 A;  4DS5 A;  1T7P A;  2JMG A;  2DPI A;  5J2I A;  3O0E A;  2KZM A;  4Y2P A;  4M9G A;  4KLU A;  4EBD A;  8ICT A;  5BOL A;  1ZJN A;  2NRV A;  3H8J A;  2HOI A;  2NRT A;  1H38 A;  4O4X A;  3H0L B;  4PGY A;  4YXM A;  2IOF A;  2Q4T A;  2KFZ A;  3G6X A;  2WF8 A;  3QZ8 A;  4F8R A;  3RBH A;  3UPG A;  2R8I A;  2YML A;  4YMO A;  1Z4N A;  3PR5 B;  4B9V A;  4IRK A;  7ICN A;  4M47 A;  1KEJ A;  4Y2R A;  3KHR A;  4MEY A;  4F2S A;  3IM1 A;  2HSZ A;  4FS1 A;  3MR5 A;  2BQR A;  2YQE A;  7ICJ A;  5J0P A;  2YB1 A;  2OWO A;  4Z3T A;  2KXP B;  5CB1 A;  4NJ8 A;  3KKA A;  4IR1 A;  4FES A;  1TVA A;  5KL1 B;  5KG2 A;  2KSO A;  3BZC A;  1PUZ A;  2MUT A;  4RQ4 A;  4C4V B;  3N7R C;  3JTY A;  4K4H A;  1F5S A;  3GV7 B;  4NLC A;  5KT6 A;  8ICV A;  4F4Z A;  3NAS A;  3V6H A;  7ICP A;  4FRT A;  3ZDB A;  2IA6 A;  4YFK A;  4K3B A;  3F53 A;  2YMM A;  3BQ1 A;  1OXJ A;  3SV4 A;  2ASJ A;  4CGZ A;  4FFD A;  3ISB A;  1L3V A;  4ED3 A;  2GO7 A;  2DPJ A;  4U9C A;  3QXG A;  3WK7 A;  1S77 D;  3GIM A;  2LYA A;  3GV5 B;  2F3N A;  1Q9F A;  3VC8 A;  4GXK A;  5ALT A;  4CDG A;  2DUY A;  1TAM A;  3QUC A;  3KHG A;  3DA3 A;  3AA0 B;  3NVV A;  4J9O A;  2BDU A;  2LM1 A;  1N62 A;  5DLF A;  1CI4 A;  5G39 A;  2ZUC A;  7ICV A;  2IHN A;  4QZH A;  1U4B A;  3PGS A;  3RF9 A;  1T16 A;  3L3F X;  2AH5 A;  1KSP A;  5J0U A;  4DOA A;  4R64 A;  4ECV A;  5KG3 A;  5J2F A;  3FM9 A;  3QEB Z;  1PHO A;  4JB3 A;  2YTU A;  3RJE A;  8ICN A;  2FLP A;  5AKZ A;  3KZI U;  4NLZ A;  2KIV A;  3M8S A;  4F5N A;  2KJ5 A;  3POQ A;  1TKD A;  2W3R A;  3E0F A;  1X40 A;  2NRZ A;  1ZQZ A;  4BX9 C;  2HHS A;  2E5S A;  2QTK A;  4UBB A;  4DOB A;  1ZQX A;  2QB0 A;  4O3S A;  1ZQP A;  3PMN A;  4BUM X;  9ICV A;  5CEH A;  8ICM A;  4FT6 A;  3RBD A;  1L8O A;  4NM1 A;  4ZH4 A;  1X9W A;  1TK8 A;  2XY6 A;  2KE7 A;  4GHB A;  3DA4 A;  1V38 A;  2ZIW A;  3C5F A;  1EXN A;  2WB1 C;  3E58 A;  2KD1 A;  3QU2 A;  3VE2 A;  4J03 A;  8ICC A;  4KLT A;  2JH7 A;  8ICH A;  4PH5 A;  3QUB A;  1OUQ A;  3TAD A;  1T4G A;  2ASL A;  3ZI4 A;  4AYM C;  1ZQJ A;  1UHU A;  3LWM A;  1BPE A;  4US9 A;  3BQT A;  5KT4 A;  5ALX A;  3A0B O;  3QRA A;  4GLX A;  1ZD5 A;  1QSY A;  9ICN A;  1DGJ A;  1RXW A;  3U26 A;  3OPX A;  4G3I A;  3T5K A;  1U48 A;  3SQI A;  3A0H U;  4J9S A;  2R8J A;  3QYP A;  4E1T A;  4ED0 A;  1RQL A;  2OYY A;  1SKR A;  4KMO B;  5KFB A;  4TUR A;  2J6U A;  2ESE A;  3AN1 A;  2J1N A;  5DGA A;  2VA3 A;  2X27 X;  2EZY A;  3KZX A;  3V72 A;  3V7K A;  4DL4 A;  3V7J A;  2YNK A;  2KP7 A;  4B6J A;  3SYB A;  3HWB A;  1X2I A;  4DSI A;  9ICI A;  2OH2 A;  5ALJ A;  2ZIV B;  4C8N A;  1IIP A;  3HOL A;  3OGU A;  1LKY A;  2KK0 A;  4B61 A;  7ICO A;  2Z7J A;  5EE3 A;  1L3S A;  1OW5 A;  4Y2V A;  2JZB A;  5J8Y C;  4DFK A;  1ZHT A;  1SKS A;  5D49 A;  3DZM A;  2EAN A;  5ALW A;  1NJZ A;  3LK3 A;  4R66 A;  4ECY A;  4Y2X A;  3C5O A;  4ED7 A;  3SZD A;  2WJR A;  1J2N A;  2BQU A;  3IRU A;  3PW0 A;  3WU2 U;  4EX7 A;  3QU5 A;  2MSN A;  4NLB A;  3RJH A;  2Y0S F;  3HP6 A;  3ETR A;  4PHE A;  3TFS A;  1FIQ A;  2P66 A;  3A2S X;  4GC7 A;  4RQ7 A;  2ZUD A;  2KDY A;  3L4P A;  5TIS O;  3M9N B;  5ALY A;  3T3F A;  4YMM A;  4C0Z A;  2WF9 A;  2BCV A;  4GIB A;  2OXO A;  2R8A A;  1RM6 C;  2W55 A;  1COO A;  2Q0Z X;  3OTQ A;  5DB9 A;  4KLE A;  2Y9T A;  5AFU K;  5AIA A;  1ZQI A;  3EPI A;  4AYB F;  4C8K A;  2XG6 A;  4RQ3 A;  5IIK A;  4RQ8 A;  4O3N A;  3FC4 A;  4YR3 A;  3PVX A;  3SYZ A;  2IOH A;  2DWQ A;  8PRN A;  2B0C A;  4KR4 A;  2KC0 A;  1A77 A;  1T3Q A;  3RB3 A;  2W43 A;  3AQE A;  3WK9 A;  4FS2 A;  2KEY A;  1ZQB A;  8ICO A;  2HVH A;  1JX4 A;  5CP2 A;  1NKE A;  2NV3 A;  5KFJ A;  3C2L A;  2JHD A;  4DL7 A;  5EE1 A;  3PX4 A;  5AI8 A;  1S97 A;  4DOC A;  2M06 A;  1RYR A;  7ICF A;  2Y7S A;  2ZUB A;  1ZET A;  3QE9 Y;  3BRY A;  2XGP A;  4DL6 A;  4F92 B;  5J2E A;  2UVU A;  1JAL A;  4K3C A;  1KW4 A;  1YS5 A;  3RB0 A;  2R4L A;  1K1S A;  2K8C B;  7ICU A;  5G38 A;  1FFV A;  1N5W A;  2Y1I A;  4O4U A;  3HKZ F;  3PW5 A;  4M9L A;  3VE1 A;  5DBB A;  5EWG A;  4XA5 A;  3IG8 A;  3AA7 A;  4RU9 A;  5DKW A;  5KG1 A;  2QKQ A;  1TV9 A;  4JCH A;  2AGP A;  5AKH A;  3PX6 A;  5JDP A;  3TFR A;  5J2D A;  2UVV A;  4EZ6 A;  1FEZ A;  3WK6 A;  4QWA A;  1XC9 A;  3FYX A;  4DF8 A;  3AAA A;  1ZQD A;  2EAP A;  5C0Y A;  4O3W A;  1BNP A;  1N61 A;  1L5U A;  1QLN A;  2WB1 F;  5CA7 A;  3KBB A;  4GCQ A;  2BCS A;  5HR6 A;  3WK8 A;  1NK7 A;  1PK1 B;  2W8L A;  2G06 A;  1NK9 A;  3FDS A;  3VY8 X;  2HHT A;  5AI9 A;  3RRG A;  3G7G A;  4FZL A;  2G5H B;  5DG7 A;  4DL5 A;  8ICE A;  1QJ8 A;  4UB8 U;  3WKE A;  1D8Y A;  1WYG A;  9ICH A;  2XTR A;  3QU7 A;  3S6J A;  1ZRM A;  2LMR A;  3H40 A;  3R9K A;  5ALI A;  4OJL A;  4M0A A;  4UAW A;  1T1L A;  3UPQ A;  4BXO B;  3UQ0 A;  8ICJ A;  3BZK A;  4UB6 O;  4O5E A;  4RQ2 A;  4OJ6 A;  1PK3 A;  2ZLD A;  4PGX A;  3AU2 A;  3PO4 A;  4QZD A;  4QZE A;  3HW8 A;  4KLS A;  5B5E U;  3RFA A;  2RQ5 A;  2F1V A;  3MGV A;  1BPZ A;  5KFT A;  4KLO A;  1NNL A;  3LYS A;  1N2X A;  2MUT B;  3ZD8 A;  4O0I A;  4AYE C;  3WKD A;  2PFP A;  2F1I A;  1MC8 A;  1ZQ1 C;  3NTU A;  1HXT A;  5KAF O;  2W9B A;  5G26 A;  2H3Q A;  5BOM A;  2F1J A;  3SY7 A;  4TUS A;  3ZDC A;  2E8P A;  1KQQ A;  3HX0 A;  1ZXI A;  1KFD A;  2FPL A;  3V7L A;  4J9R A;  7ICG A;  5F9L A;  4N75 A;  5AM4 A;  4EEK A;  5DDY A;  5EOZ A;  2JMM A;  5JUM A;  3DWN A;  3TAR A;  5KNI A;  3HW9 A;  4YMN A;  8ICL A;  5J2J A;  1QH9 A;  2BZF A;  2AJQ A;  5ALF A;  1Q3U A;  5KFV A;  4IQV A;  4RJW A;  3N7P D;  1ZHX A;  4BUG A;  4NXZ A;  4I27 A;  4DQR A;  4RUC A;  2POR A;  4R8U A;  4DFJ A;  2KG5 A;  3PF1 A;  2YB4 A;  2PI4 A;  8ICZ A;  3BQ7 A;  4EBE A;  1NJY A;  2EDU A;  3F2C A;  2GOL A;  4UB3 A;  5J0R A;  2W9M A;  3GDX A;  9ICU A;  5KG0 A;  5J0X A;  2OCE A;  3MFI A;  3GFK B;  4I2E A;  5IYU A;  2FE9 A;  5H2F O;  3EMN X;  4JWN A;  2BHN A;  3C1Y A;  2B6G A;  4EYH B;  2E8M A;  3WK4 A;  4QZC A;  2K8A A;  3BS7 A;  2K4I A;  1QCK A;  1GFN A;  5T14 A;  3BRZ A;  4NLN A;  4RZR A;  2CXY A;  4I2J A;  5DG9 A;  4DLE A;  4PPX A;  4QZ8 A;  1WCL A;  4FBT A;  5KFR A;  3Q8Q B;  1JN3 A;  4MF8 A;  4DSE A;  2W03 A;  4XNK A;  4C00 A;  3IDW A;  1ZYQ A;  1NZP A;  4I2D A;  1PVP A;  4AYN A;  2R4N A;  2HDO A;  3AEV A;  2XTQ A;  4YD2 A;  4LSI A;  2FPM A;  5FP0 A;  1JRO A;  2F44 A;  4IR9 A;  4YVZ A;  2KJ9 A;  2F1C X;  4RUA A;  5IIL A;  1NOM A;  2CN1 A;  4M6W A;  4FSO A;  5ALQ A;  3OHA A;  4RNM A;  4AKR A;  3MR3 A;  2MRL A;  4HYK A;  5ALG A;  4Y2Q A;  4PR7 A;  2C22 A;  2FPK A;  7ICS A;  3IN5 A;  3MR2 A;  5AK6 A;  4F3O A;  2ES6 A;  2E3T A;  4RQN A;  1PVQ A;  4RJX A;  2OM6 A;  3T5H A;  4DFP A;  1NJX A;  3POX A;  1Q8K A;  4O5C A;  3Q8S B;  5ALS A;  2PI5 A;  1S5L U;  2XE2 A;  5DL7 A;  1URJ A;  3TQ1 A;  3WI4 A;  1KLN A;  2WAQ C;  1ZQM A;  4MFF A;  2FJ6 A;  3K1R B;  4F72 A;  5DQH A;  4P0Q A;  2PFN A;  4UAR A;  2MNH A;  2M07 A;  3ZDD A;  3WKA A;  1DRG A;  3D6J A;  4DEZ A;  4KX3 A;  3WI5 A;  2P6U A;  2C2E A;  3JPP A;  3UXP A;  2KNJ A;  2WF5 A;  3GZF A;  3Q8M A;  5ALU A;  2HMX A;  4Q8F A;  2IMW P;  1XO1 A;  1T3N A;  1DXS A;  1ZQC A;  3V8U A;  3N28 A;  2ASD A;  1S10 A;  1X9X A;  1KTQ A;  1BGX T;  5ALP A;  2AQ0 A;  2K8B B;  1TK5 A;  4F93 B;  4I2G A;  5AM5 A;  3TAC B;  4KLI A;  2MHL A;  2W80 C;  1Z1B A;  4M6W B;  4DFD A;  1YZ7 A;  5KFA A;  3RAQ A;  2VIX A;  3J81 j;  2DL0 A;  2CRX A;  3ISD A;  4FO6 A;  2KVC A;  1N48 A;  2FLL A;  2NO5 A;  4RPX A;  2FMP A;  9ICA A;  2W7O A;  3N7S C;  5KFD A;  5JU5 A;  4CF3 A;  1L7N A;  2P35 A;  5L1L A;  3Q8R B;  3OSP A;  4OCZ A;  2R8H A;  3I28 A;  3AA0 A;  4XQ8 A;  2VJ4 A;  2H5X A;  5J0Y A;  3HIL A;  2HHU A;  3TAD C;  2LPE A;  4NM2 A;  5CWR A;  2ALZ A;  3WKC A;  2I1Q A;  3MDA A;  8ICX A;  4AUI A;  3LDA A;  3NVW A;  2X9K A;  1J2M A;  4PZO A;  2EAM A;  3THV A;  3JPQ A;  1XO0 A;  7ICL A;  5ADX K;  9ICG A;  3QX7 A;  3I1Y A;  1ZHY A;  9ICQ A;  4F5P A;  1MM4 A;  2R8G A;  3AA6 A;  4LSF A;  5ALZ A;  8ICU A;  4O9M A;  2PMZ F;  2RP5 A;  3C5G A;  3H8M A;  2H3V A;  2KSO B;  3FAH A;  4DSK A;  5KFM A;  1FFU A;  3TAN A;  4F5O A;  1SZH A;  4P4O A;  1COK A;  4EEN A;  3Q8L A;  2K4H A;  4UBC A;  3ONN A;  1SIJ A;  2ODJ A;  4C69 X;  1L6N A;  4IQU A;  4CNQ A;  3SEI A;  1NKC A;  3K4G A;  3RJG A;  4Y2S A;  2KKP A;  2WVP A;  2JV3 A;  3AMZ A;  1A6S A;  3WK5 A;  1TFR A;  5GV0 A;  4PZN A;  1XNS A;  2HHV A;  5HMM A;  4EZ9 A;  1SXD A;  1PRN A;  5CHG A;  3EUB 2;  1Z00 B;  1CEZ A;  1L3T A;  5J0O A;  2WF7 A;  1XWL A;  4UB8 O;  2H3Z A;  1BPB A;  1DK2 A;  1VLB A;  1THQ A;  5AK4 A;  4ACO A;  3PX0 A;  5TZV A;  1ZQU A;  2H3I A;  3PY8 A;  9ICS A;  2ZIV A;  3PNC A;  3AAE B;  2R18 A;  2R88 A;  2W9C B;  1HXU A;  4I2C A;  5EE0 A;  4BGD A;  3IG5 A;  2WF6 A;  2K0L A;  1MPF A;  2DGZ A;  2LHF A;  1JXL A;  4RPZ A;  1NK5 A;  2F1H A;  2VAN A;  5AKL A;  2V4Q A;  1QJP A;  1D9F A;  4FMS A;  4RLC A;  2OHF A;  4DCC A;  2LKY A;  3KHH A;  2GWS A;  3PGR A;  5FVN A;  1HUZ A;  2KOB A;  1Q3V A;  2LYH A;  1TK0 A;  2HHX A;  1X6J A;  3SAH A;  4U7C A;  4DLG A;  3MGH A;  2CPR A;  2JEG A;  5ALE A;  2ZTC A;  2DBY A;  5B66 O;  2HBL A;  4QNL A;  2E1E A;  1S8O A;  2VJ5 A;  2XMX A;  4JV1 A;  4AKM A;  3PZP A;  3PW4 A;  4JK1 A;  2PKE A;  2BDP A;  1WCN A;  5DG8 A;  3F2B A;  1V9P A;  1Z4O A;  2QLT A;  4TUP A;  2J6S A;  4RQM A;  3TKA A;  1HXX A;  4IRD A;  1ZHW A;  1GFP A;  2MU2 A;  3GP6 A;  1X6I A;  7ICI A;  5IIM A;  4PJ0 U;  4O3R A;  2ISP A;  1SXE A;  4E1S A;  2P6R A;  4JFB A;  2F8K A;  1U45 A;  4OJ5 A;  5AK5 A;  3GIK A;  5HR7 A;  1B43 A;  1SV0 C;  1SWW A;  5J2K A;  2W8K A;  2D3D A;  3UAQ A;  1NK8 A;  5KFN A;  4KN7 A;  3LWL A;  3IP4 B;  4CRX A;  3Q8P B;  7ICT A;  4P4P A;  5G5G A;  3LK3 B;  2XGQ A;  2I6X A;  4RPY A;  1ECW A;  3B0X A;  1ZQO A;  4UAU A;  4MF2 A;  5KAF U;  3M6Z A;  4BWM A;  2H3F A;  4ECR A;  3T5L A;  2EZX A;  4AYI D;  3VCB A;  2LHT A;  2C2R A;  4KR8 A;  3MC1 A;  2XCA A;  3TZG A;  2NO4 A;  4X5V A;  5L1J A;  3RRH A;  4ELV A;  1S0V A;  5B66 U;  1L8L A;  3H7I A;  3MR6 A;  2IBK A;  2KMD A;  4LSE A;  1O08 A;  4KRA A;  3N97 B;  4Y2Y A;  3PW7 A;  5KG4 A;  4Q44 A;  2GH1 A;  4DFM A;  5GTI U;  5KTQ A;  2L5Y A;  4ELT A;  8ICF A;  9ICK A;  1S76 D;  1P7D A;  1HIW A;  4C8L A;  4MFC A;  4YG2 A;  1RYU A;  3G6V A;  2IOF K;  5DB7 A;  3SZ2 A;  3C29 A;  4NV0 A;  5EE2 A;  2EZZ A;  3H8S A;  4AKR B;  2DFL A;  5KFZ A;  5KFO A;  1KRP A;  1SWV A;  1V97 A;  4FE3 A;  4UB1 A;  2F1T A;  2WJQ A;  5J0Q A;  4US8 A;  2D6F C;  1U9L A;  5A0L A;  3HWT A;  2DF4 B;  3SZV A;  4N59 A;  4ED1 A;  4IL6 U;  1ZQE A;  3LK4 1;  4D5U A;  1RQN A;  2PMZ C;  4C4T A;  2BKE A;  5DQI A;  4M2Y A;  3RBE A;  3DWO X;  4RQ6 A;  4JV0 A;  3OJS A;  1RG6 A;  3CNH A;  4UAV A;  4UQG A;  3WKB A;  4J9K A;  2W9A A;  3VZU X;  4G75 A;  1GFQ A;  3WU2 O;  1ZQA A;  8ICI A;  4RNN A;  5E79 O;  5EE9 A;  3SEN A;  2QB1 A;  2HI0 A;  1RXV A;  4DS4 A;  4OJO A;  4JV2 A;  2YY6 A;  3I76 A;  1JMS A;  4RT2 A;  4F4X A;  2FI1 A;  5DB8 A;  4KLF A;  1MSW D;  4CTD A;  5KFU A;  1S0M A;  5ALO A;  5KT3 A;  3CRX A;  2GLE A;  3T20 A;  1IM4 A;  3LVW A;  5ALV A;  1ED1 A;  4DF4 A;  1QTM A;  4PL2 A;  3KFU F;  9ICW A;  3RR8 A;  3T24 A;  5AM3 A;  3PML A;  3MGI A;  3RJJ A;  8ICR A;  1P4T A;  4CF4 A;  4U6P A;  3MAB A;  3CYM A;  2O6K A;  7ICK A;  3SD7 A;  4CCH A;  4C4R A;  3JPT A;  2LM4 A;  4BXO A;  1KBU A;  4KMU A;  2ZIU A;  2QAR A;  2DKX A;  2KJ8 A;  1RDF A;  4YR0 A;  3NS1 A;  4ECS A;  1ZD3 A;  4IC9 A;  1L3U A;  2JRZ A;  5AHX A;  1Z00 A;  1WWU A;  2AGQ A;  1PVR A;  5AI4 A;  4HAI A;  4F4Y A;  5HP4 A;  4RLB A;  2KKV A;  3HKZ C;  2RHF A;  4UB4 A;  4QZI A;  4KLD A;  3AAE A;  3ED5 A;  1ZQW A;  4NY8 A;  1NK6 A;  1SL2 A;  2RRD A;  1MN8 A;  4YCX A;  4DQP A;  4ED8 A;  3D2N A;  4Y2T A;  4XRH A;  2XCP A;  3QNM A;  4C80 A;  4FRX A;  3SYS A;  4E0D A;  4N74 A;  4QZ9 A;  3C28 A;  4KLJ A;  3TAP A;  2W9B B;  7ICR A;  1JUD A;  2R4P A;  2A1J B;  3KOO A;  4MHV A;  4KLL A;  2G5I B;  3AA7 B;  3BS0 A;  1Y88 A;  3JPR A;  2A19 A;  3M8R A;  4EX6 A;  1RZT A;  2JGA A;  3H8W A;  4QW9 A;  4EYI B;  1ZQT A;  1Z3E B;  4EEY A;  2Y0H A;  4ECU A;  5GTH O;  1MM5 A;  4R8U B;  1RPL A;  3NVY A;  5AK3 A;  5H2F U;  3PO5 A;  2Y9U A;  3KZI O;  4J9Q A;  1NK4 A;  4OJP A;  4LZD A;  2IHM A;  4YR2 A;  3JCU O;  1ZD4 A;  5EWE A;  5ALD A;  9ICO A;  3RH4 A;  4F5Q A;  2OEH A;  5III A;  2ODG A;  3EPG A;  4DL3 A;  4GC6 A;  4ECQ A;  1AQ6 A;  1VJ5 A;  4LSH A;  4F4W A;  2LBO A;  2E8O A;  4KLG A;  2W04 A;  4KTQ A;  4QWE A;  2V9W A;  9ICC A;  3A0H O;  3B9J A;  1UA0 A;  5G3A A;  4ICA A;  1IXR A;  3BQ2 A;  4J9M A;  3GIL A;  2KZ7 A;  1B4F A;  4I28 A;  2WFA A;  3AA6 B;  3PSF A;  1KFT A;  1ZQV A;  3DEE A;  2Y0K A;  4QQ1 A;  4KLM A;  1BH3 A;  5ALR A;  3AAA B;  2KZZ A;  2MAX A;  4UAY A;  3C2M A;  3D2Q A;  2HCF A;  5AM0 A;  2FGQ X;  1X42 A;  1FO4 A;  3M7D A;  4B9L A;  1YT3 A;  8ICG A;  4O49 A;  1SB3 C;  2BPC A;  3NRW A;  3UXO A;  5JTI A;  1HUO A;  5GTI O;  4I2B A;  1IZN A;  3B0Y A;  4YP3 A;  4NL9 C;  3MBY A;  4I29 A;  4O5K A;  5KFE A;  1C20 A;  4QJF B;  2B21 A;  2F8L A;  4ECT A;  4ED2 A;  2XE1 A;  2ZFG A;  3EYZ A;  2R89 A;  1QJ9 A;  4P2H A;  2JEI A;  8ICY A;  5J2C A;  2F2A B;  5GTH U;  5J2A A;  4M04 A;  7ICM A;  4I2I A;  5KFL A;  4IL6 O;  3POU A;  5ALN A;  3UXN A;  4AFK A;  3M1Y A;  4KLQ A;  4AZL A;  5J29 A;  3PW2 A;  1NKB A;  1TE2 A;  2N2M A;  4TQS A;  3GIJ A;  1N60 A;  4DQS A;  1ZQS A;  2KN7 A;  3AA1 A;  4LZG A;  2ZIX B;  1KDH A;  4B9S A;  5DBA A;  3V6K A;  2ZIU B;  2AU0 A;  3QRC A;  4D65 A;  1S5L O;  2JZB B;  3HT3 A;  4ECZ A;  5AFU L;  2LI6 A;  3VZW X;  4PHA A;  1GFO A;  2ISO A;  2KZ3 A;  3RJK A;  4Z6C A;  5KG5 A;  4PL1 A;  5L1I A;  1LB2 B;  3FYH A;  3NRZ A;  1NJW A;  2YN4 A;  5ALK A;  4AP9 A;  2ZIW B;  2EAO A;  3EW9 A;  4BDP A;  2BPF A;  3NGD A;  5KT5 A;  4QZG A;  1K5O A;  2HOQ A;  3JPO A;  1GO3 F;  4O3Q A;  5BPC A;  1YZ6 A;  5J0W A;  2KHQ A;  5DLG A;  2XY5 A;  2XE3 A;  3EWA A;  4PJ0 O;  4P0P A;  1Z19 A;  1BPY A;  4CF5 A;  1MQ3 A;  4C4V A;  3GU3 A;  3H4D A;  2ATL A;  1Q46 A;  3PV8 A;  4F91 B;  5DGB A;  5HML A;  3UQ2 A;  3ALR A;  2J4U P;  5HHI A;  2FLN A;  3T0S A;  1ZQY A;  1X9M A;  3BDP A;  3IV6 A;  2NRX A;  3RJI A;  3OHB A;  1QQ7 A;  1K1Q A;  5CJ7 A;  2HHQ A;  5AIC A;  5KFK A;  3T79 A;  4IRC A;  5L1K A;  4UAS A;  4F2R A;  2HW3 A;  1D8B A;  1DK3 A;  4Z6D A;  1DOQ A;  4GXJ A;  9ICL A;  1BXW A;  4GCP A;  2Y2X A;  5AI0 A;  1HEK A;  4WJ3 B;  1UT8 A;  4FZM A;  4NL9 A;  4PUX A;  5ALM A;  5KFC A;  2NRW A;  2R8K A;  2DKZ A;  2C28 A;  1JI7 A;  4KIT B;  3MDC A;  1IV8 A;  3TAQ A;  4TQR A;  4FSP A;  1PK1 A;  1Z1V A;  1QSS A;  2JEJ A;  1KL9 A;  3SAF A;  4GCS A;  2EH9 A;  5AKK A;  3KTQ A;  4PHP A;  3SY9 A;  2HHW A;  3OSN A;  2I9G A;  2N1R A;  4DWI A;  3TI0 A;  1MA7 A;  2FMS A;  5AKY A;  2PRN A;  5KFS A;  5ALL A;  4BJQ A;  2Y0S C;  4JWM A;  5J2H A;  4IQT A;  5J0T A;  2BQ3 A;  3POR A;  2AHO B;  5DL8 A;  2UVR A;  1Q9G A;  2ZJA A;  5AM2 A;  5ADX L;  1SKW A;  3SR6 A;  4OD0 A;  1BVS A;  4J9N A;  1QQ5 A;  3QU4 A;  1UCV A;  5AIB A;  3RR7 A;  4MFA A;  5L9X A;  4G76 A;  2ZJ8 A;  9ICM A;  3RB6 A;  3KKA C;  2G08 A;  2HVI A;  4DO9 A;  3QZ7 A;  1GFM A;  2BR0 A;  1H6S 1;  5T5F A;  1ZOL A;  1L7M A;  4O3O A;  3C1Z A;  3HRD D;  5J2G A;  9ICP A;  3PSP A;  1XS9 D;  5C5J A;  4QZB A;  2WAQ F;  1S9F A;  5DBC A;  5KFQ A;  5KL8 B;  4J9L A;  4TUQ A;  1N5X A;  1C7Y A;  1ZQH A;  4O3X B;  4YXJ A;  3BS5 A;  3KVD D;  2G07 A;  2N2L A;  3KD3 A;  5AKG A;  1B0X A;  2ZXI A;  3C23 A;  2V4R A;  4AYB C;  4ELU A;  3QUQ A;  2UVW A;  1ARO P;  3RTV A;  4IQW A;  2EQY A;  1ORM A;  2ZIX A;  2JQY A;  2PXI A;  1UQV A;  3BJY A;  2K4E A;  2YX8 A;  1X9S A;  2ZTE A;  4B9N A;  2JXJ A;  1WUD A;  1VDV A;  4CE6 A;  9ICX A;  2KXP A;  1CUK A; 
#chains in the Genus database with same CATH homology
 4NLC A;  3F2C A;  3LK4 1;  4O3M A;  4D5U A;  2PMZ C;  3NSG A;  2GOL A;  3PQS A;  4FRT A;  4XNL A;  3F53 A;  5IYU A;  3EMN X;  4QIW C;  3M6K A;  2KV2 A;  4CGZ A;  3PQU A;  3VZU X;  4G75 A;  2FGR A;  1GFQ A;  2K8A A;  4U9C A;  2K4I A;  5CRX A;  1GFN A;  2LYA A;  5T14 A;  1Q9F A;  3VC8 A;  4OJO A;  4CDG A;  1TAM A;  3PST A;  2K4T A;  4FZN A;  3DA3 A;  3CRX A;  3AA0 B;  3T20 A;  3LVW A;  1ED1 A;  2YPV A;  2BDU A;  2W03 A;  4XNK A;  4PL2 A;  3KFU F;  1PVP A;  4AYN A;  3T24 A;  1F44 A;  1P4T A;  4U6P A;  2XTQ A;  3RF9 A;  4LSI A;  3CYM A;  3L3F X;  1NZB A;  4FUV A;  2KJ9 A;  1KBU A;  2ZIU A;  2CN1 A;  2KJ8 A;  4FSO A;  1PHO A;  4AKR A;  1ZHZ A;  3O0F A;  4IC9 A;  5D5D A;  4F4B A;  2MRL A;  2GE4 A;  3SMV A;  1PVR A;  3IN5 A;  2K89 A;  1OSM A;  2KJ5 A;  3POQ A;  4RLB A;  2KKV A;  4RJX A;  3E0F A;  3HKZ C;  1PVQ A;  2RHF A;  2OM6 A;  3AAE A;  4BX9 C;  2QTK A;  2E5S A;  3AQF A;  2RRD A;  3POX A;  2VKQ A;  4JMU A;  4BUM X;  3D2N A;  4FT6 A;  4FRX A;  3SYS A;  2W7P A;  2XE2 A;  2XE5 A;  5DL7 A;  1URJ A;  3C28 A;  3WI4 A;  3HOE A;  2WAQ C;  2JH1 A;  4GHB A;  3DA4 A;  3AA7 B;  2G5I B;  2ZIW A;  4P0Q A;  2MNH A;  2M07 A;  1DRG A;  2WB1 C;  2KD1 A;  3VE2 A;  4KX3 A;  2JH7 A;  3ICX A;  3WI5 A;  2JGA A;  1OUQ A;  2KNJ A;  3GZF A;  4AYM C;  2Y0H A;  2HMX A;  1MM5 A;  2F77 X;  2LFU A;  3UU2 A;  3V8U A;  4KX5 A;  4OJP A;  3VY9 X;  4O3Y A;  3QRA A;  2K8B B;  2ZXH A;  4AYD C;  4P0Q B;  2MHL A;  2W80 C;  3OPX A;  1Z1B A;  2KZ7 B;  3SQI A;  4LSH A;  5PRN A;  4E1T A;  3F5E A;  1IZN B;  2LBO A;  2W04 A;  2OYY A;  4KMO B;  2VIX A;  4ICA A;  2CRX A;  5DL5 A;  2KVC A;  2XID A;  2J1N A;  2KZ7 A;  4GF4 A;  2W7O A;  3N7S C;  3AA6 B;  3PSF A;  2DQN B;  2HBK A;  2X27 X;  3DEE A;  2Y0K A;  4QQ1 A;  3KZX A;  3F2D A;  2XVT A;  1BH3 A;  3AAA B;  1G90 A;  2G09 A;  3AA0 A;  3D2Q A;  2VJ4 A;  2YNK A;  2FGQ X;  4D64 A;  3SYB A;  5DL6 A;  3HWB A;  2KHV A;  3M7D A;  4FOZ A;  1YT3 A;  1UPH A;  2OH2 A;  4O49 A;  3NRW A;  2ZIV B;  3AL0 B;  1IZN A;  4AUI A;  1IIP A;  3HOL A;  4B61 A;  1XO0 A;  4QJF B;  2LYB A;  2F8L A;  2Z7J A;  2XE1 A;  2ZFG A;  1ZHT A;  1ZHY A;  1MM4 A;  3D2S A;  1QJ9 A;  3LK3 A;  3AA6 A;  4LSF A;  3C5O A;  3SZD A;  2F2A B;  2PMZ F;  2RP5 A;  2Y0L A;  3LK4 2;  1OPF A;  2H3V A;  1T94 A;  3POU A;  4AFK A;  3H0M B;  1SZH A;  2KIC A;  4NLB A;  6PRN A;  2Y0S F;  4AZL A;  4QIW F;  3F5A A;  2N2M A;  2XIC A;  2F76 X;  3A2S X;  2KDY A;  2K4H A;  2ERV A;  3AA1 A;  3ONN A;  4GFJ A;  4C0Z A;  2ODJ A;  4C69 X;  3PSI A;  1L6N A;  2ZIX B;  2ZIU B;  2KKP A;  2OXO A;  3LK2 A;  3QRC A;  4D65 A;  1A6S A;  5AFU L;  5GV0 A;  3VZW X;  1XNS A;  1GFO A;  2ZG6 A;  4PL1 A;  1PRN A;  5AFU K;  4AYB F;  2ZIW B;  2XG6 A;  2H3Z A;  1A0P A;  3SAG A;  1THQ A;  4ACO A;  2A3V A;  1CRX A;  8PRN A;  2HOQ A;  2H3I A;  2ZIV A;  3AAE B;  4KR4 A;  1GO3 F;  2R18 A;  4A8E A;  2KC0 A;  1HXU A;  3AQE A;  2KHQ A;  2XE3 A;  3IG5 A;  1BT9 A;  2KEY A;  2K0L A;  4P0P A;  1Z19 A;  1MPF A;  2HBJ A;  2DGZ A;  2LHF A;  2NV3 A;  3GU3 A;  2JHD A;  1QJP A;  3K19 A;  4FMS A;  2M06 A;  4RLC A;  2LKY A;  3ALR A;  2OMF A;  5FVN A;  2Y7S A;  2KOB A;  2J4U P;  3NUQ A;  1Q3V A;  2W81 C;  3T0S A;  3H0R B;  3SAH A;  4U7C A;  2CPR A;  4OO1 J;  1YS5 A;  2E1F A;  2K8C B;  2HBL A;  4QNL A;  2E1E A;  3T79 A;  4O4U A;  1D8B A;  3HKZ F;  2VJ5 A;  2XMX A;  2M0N A;  2G0A A;  1BXW A;  4GCP A;  3PZP A;  4AKM A;  2Y2X A;  3VE1 A;  1HEK A;  4WJ3 B;  4FZM A;  4PUX A;  3AA7 A;  3IG8 A;  3LK2 B;  3F2B A;  4JCH A;  2HBM A;  2O4V A;  2HOF A;  4O3Z A;  5JDP A;  4FSP A;  4RL9 A;  2KIW A;  3SAF A;  1HXX A;  3FYX A;  4GCS A;  3AAA A;  1ZHW A;  1GFP A;  3SY9 A;  2N1R A;  3GP6 A;  2MA1 A;  4O3W A;  5C0Y A;  7PRN A;  2WB1 F;  1MA7 A;  1E54 A;  4E1S A;  4GCQ A;  5HR6 A;  4JFB A;  3K1Z A;  4OJ5 A;  2PRN A;  5HR7 A;  2G06 A;  3CP8 A;  3VY8 X;  3UAQ A;  4BJQ A;  2Y0S C;  4P0P B;  3G7G A;  4FZL A;  2G5H B;  1QJ8 A;  4N58 A;  3POR A;  3LVV A;  4NWI A;  5DL8 A;  3VZT X;  1Q9G A;  4CRX A;  3IP4 B;  5ADX L;  2XTR A;  3LK3 B;  2XI9 A;  1ECW A;  3AA1 B;  3M6Z A;  2H3F A;  3PRN A;  4AYI D;  4OJL A;  2JMG A;  3VCB A;  2LHT A;  3O0E A;  4G76 A;  4KR8 A;  2G08 A;  4OJ6 A;  2ZLD A;  3TZG A;  1GFM A;  3RFA A;  2F1V A;  1H6S 1;  3MGV A;  2HOI A;  4LSE A;  4O4X A;  3H0L B;  5T5F A;  4KRA A;  3LYS A;  2Q4T A;  4AYE C;  3PSP A;  2GH1 A;  3RBH A;  2WAQ F;  3UPG A;  1ZQ1 C;  1HXT A;  5KL8 B;  5G26 A;  2H3Q A;  4O3X B;  3SY7 A;  3KVD D;  1P7D A;  1HIW A;  2G07 A;  2N2L A;  2ZXI A;  3C29 A;  4NV0 A;  5EE2 A;  2YB1 A;  4AYB C;  2JMM A;  4AKR B;  4Z3T A;  3HW9 A;  2KXP B;  4FES A;  4FE3 A;  5KL1 B;  1Q3U A;  2ZIX A;  1ORM A;  2F1T A;  4RJW A;  3N7P D;  1ZHX A;  4BUG A;  2D6F C;  2K4E A;  2YX8 A;  5A0L A;  2DF4 B;  2POR A;  3N7R C;  3SZV A;  3JTY A;  1WUD A;  2YB4 A;  4N59 A;  5ADX K;  2KXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...