3HOEA

Crystal structure of surface lipoprotein
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
242
structure length
242
Chain Sequence
b'EPALGYVVKVPVSSFENKKVDISDIEVITNGNLDDVPYKANSSKYNYPDIKTKDSSLQYVRSGYVIDGEHSGSNEKGYVYYKGNSPAKELPVNQLLTYTGSWDFTSNANLNNEEGRPNYLNDDYYTKFIGKRVGLVSGDAKPAKHKYTSQFEVDFATKKMTGKLSDKEKTIYTVNADIRGNRFTGAATASDKNKGKGESYNFFSADSQSLEGGFYGPKAEEMAGKFVANDKSLFAVFSAKHN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TbpB
publication title Insights into the bacterial transferrin receptor: the structure of transferrin-binding protein B from Actinobacillus pleuropneumoniae.
pubmed doi rcsb
source organism Actinobacillus pleuropneumoniae
molecule tags Transport protein
total genus 61
structure length 242
sequence length 242
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 3hoeA01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 3hoeA02
2KC0A 3PQUA 4AYMC 4AYDC 3V8UA 3VE1A 3VE2A 4O4UA 4U9CA 2W80C 3PQSA 5EE2A 4QQ1A 3UAQA 4O3XB 4AYEC 2KDYA 4O3ZA 4O4XA 3HOLA 3KVDD 2W81C 4O49A 4AYID 2LFUA 4AYNA 1YS5A 3HOEA 2Y7SA 4O3YA 5T5FA 2YPVA 4O3WA 4Z3TA
chains in the Genus database with same CATH superfamily
2ALLX 1VWCB 4GRJA 3NP1A 4IMOA 1MM5A 1RAVA 1YP7A 3WJGA 5C0NA 1MK5A 3WJBA 4ZGFA 3BSZE 4QQ1A 4I9RA 3DWOX 5PRNA 2R89A 3CQRA 3MX7A 1MUPA 2RTFB 4AZPA 1VWAB 3PGUA 3PPTA 4ORYA 4GJSA 4KH8A 1O8VA 1BXWA 1G7NA 3POQA 1GT5A 1B4MA 5IRUA 3MVFA 1SREA 2AMMX 1W6FA 4FT6A 1SY0A 1SXXA 4OS8A 2R4OA 3B2KA 4PJ0O 4ORUA 1JYJA 1GT1A 3MM0A 3AA7B 1OSPO 2QTKA 5H8TA 4FQEA 4UB6O 2WJQA 3FA7A 1SWDA 4Z2PA 4N59A 4XMCA 3OBLA 2R73A 2OFRX 4O3XB 4YDAA 4JGLA 4OMWA 1HMTA 5B3MO 2F09A 2HZRA 3APUA 4FRTA 2RTCB 1OBQA 1QFVA 2F01A 1OPFA 2XE2A 1EIIA 2RTOB 4IB7A 1LCWA 5D47A 2C1QA 3L4RA 4YDBA 1GX8A 4FZNA 3DZMA 2MHLA 2JW1A 1CBSA 4OEMA 1SWLA 3FLLA 5CHKA 5L8NA 1AB0A 5HWZA 2KC0A 1AVGI 1FDQA 1ZNEA 3VE2A 1NBXA 5F58A 3FIDA 5LJKA 2JMMA 4OELA 7PRNA 1IW2A 4BCSA 2GE4A 1VPRA 5H9AA 4AYNA 4XNKA 1QFTA 1Y55X 3B2JA 2IZHB 4GUZA 1IKJA 4NLIA 1FE3A 4D5UA 4AW8A 2CBRA 4AKRB 3AA6B 3NSGA 3DA3A 1LDOA 3WOVA 2M06A 1MPFA 2GTFX 1T16A 1B56A 5CSEA 4K3CA 4ZHGA 3O19A 3EBWA 3LTWA 3LK2A 2Y2XA 4YH0A 3S26A 3DWNA 2WSJA 1STSB 2MO5A 2R74A 3NQKA 4ODDA 4D64A 2XTRA 1GX3A 2CZTA 3B2HA 3SZVA 4GD9A 3LK41 1A2DA 1I78A 3HWEA 5T5FA 4O3YA 3C76X 2X46A 3HWDA 4UU2A 1SWNA 3TZSA 4ARHA 4YFRA 2BLGA 4BUMX 1PMPA 4BJ8A 5HTDA 1QY1A 2G8CO 2CM4A 3LK3A 2QMIA 1LFOA 1SMPI 2WPUA 3VZUX 3BU1A 2R88A 2Q4NA 1SLFB 3RE5A 3A2SX 2BC3A 2MM3A 3S5XA 1FEMA 2W2BA 2AF5A 8PRNA 3VG6A 3PQUA 2R4PA 5IO6A 4AKMA 1S7DA 5HTEA 1N4JA 2ACOA 2WEXA 3P24A 3WVMA 4CDFA 3ZW0B 1E2TA 4E1TA 1QABE 4GH7A 2HZQA 2W80C 2QOSC 1SWKA 2IZKA 1QJ8A 1Y53X 4TKJA 4FZLA 4RJXA 2I5VO 4BX6B 3D95A 4CPHB 3JSQA 2AL0X 3A0BO 2OY7A 2XE5A 1JMZA 3RY1A 4ES7A 2OVEA 3KFHA 1PHOA 2WWPA 1LUQA 4GGZA 5KAFO 3F6ZB 3LHNA 1SWPA 5B10O 1BM5A 2J4UP 2DM5A 1KT7A 4D65A 3APXA 2MHDA 4M7MA 1X8QA 5AQ6A 4C5PA 5LJCA 4XMEA 2LHFA 2QOMA 3VHHA 1SWEA 3BRNA 4GDZA 5DL6A 4AYEC 4ZHHA 2VDFA 5IO7A 4FBVA 2RTEB 1CBRA 4G75A 2C1SA 3AA7A 5B5GA 4QNIA 1UYNX 4LSFA 3PORA 2Q2MA 5HCEC 1VWEB 1KT4A 3SYSA 3D96A 1BSOA 2VFBA 4BVMA 3EM0A 2R4LA 3SLJA 4UB8O 2AH7X 4ZR2A 4IRWA 4U9CA 3NX1A 3RDOA 4GF4A 2RTIB 4LZVA 3SZDA 1SY2A 1VYFA 3ZUIA 4O49A 2LFUA 2NNQA 4TLJA 2L68A 1H6S1 1CBQA 3T2XA 1KZWA 1THQA 3P6CA 3GE2A 1LKEA 5G26A 1PRNA 1HXUA 3WI5A 4KT5A 1KZXA 3T2WA 1U0XA 1NQMA 4WBKA 3BU9A 4A1YA 1YWDA 3AKMA 1LF7A 3SAOA 1RXJA 4N7DA 4ZHCA 3KZAA 3LV4A 4LKTA 1SXUA 1ML7A 2LBVA 1MVGA 4AKRA 3ZW1B 1B0OA 3SY7A 1QY0A 1SWQA 3SLOA 3AA6A 4CDDA 2KTSA 1ZHYA 1NP4A 1Y9LA 3PEDA 4WFVA 3BLGA 2F1TA 2FS6A 5HBSA 2Y0HA 3TZGA 2YPVA 3GAQA 2A5BA 1BJ7A 4EXZA 2IZIA 5F7GA 4OS3A 4AFKA 2AT8X 2RD7C 3CKGA 2RN4A 4ORWA 3PGRA 3C77X 4I6SA 5TISO 4AYMC 2E4JA 1HXTA 3CWKA 3I17A 1K3BA 1MM9A 4HPAA 4INNA 3LK2B 2XE1A 3U0DA 5H9NA 4OKAA 4TKBA 2JMBA 4A1HA 5DG4A 4RL9A 2WUTA 2P8GA 1QJ9A 3PDFA 4ZHFA 3ZZVA 2FLJA 4A60A 3EC5A 5HZ6A 1LIFA 4HWMA 2CM9A 5L3YA 3O0EA 1KFFA 4PR7A 5GV0A 3PH5A 4O4OA 3NPOA 1LIEA 5L8OA 3VU1A 2FGQX 3P6GA 5AJBA 3ZW0A 1VWJB 4ID2A 4HPCA 2RA6A 4KC8A 4AZLA 1SLGB 2FRSA 3JTYA 1SY1A 4BX6A 4U8UN 4CPHA 4B61A 4ORSA 3CKFA 1E00A 2Y32A 4BGFA 4C4VB 3JCUO 1PTSA 4RLBA 1ORMA 3T20A 1SWSA 4N74A 2R56A 3O2YA 2JU7A 3BS0A 4QRLA 4FGIB 4L3RA 4Y0PA 1T0VA 2PI3O 2M07A 1S44A 1STRB 1RXHA 3K19A 4O3WA 1ICNA 3D4RA 4QGVA 3FMZA 1OBUA 1SXYA 4PSQA 3PQSA 1GFQA 2JN3A 5L8IA 1MX8A 3FR2A 4GHBA 3BY0A 1QJPA 4TNNA 3AAAB 1VWLB 2WQ9A 2X34A 3K3LA 1JJUA 2AT5X 2WVPA 2OY1O 5B11O 1PEEA 5LJDA 3SZHA 3T6LA 3VE1A 2PORA 1CRBA 1VYGA 3VZTX 1GFPA 3KFFA 1EXSA 4C69X 5KHPA 1SY3A 4GNYA 2W2FA 5AJCA 2Y0LA 1S5LO 2A2GA 1SXWA 2HLVA 2IZDB 1VWGB 2JOZA 3CBCA 1VWOB 4M6SA 1GXAA 2LFOA 2KTDA 2C4IA 3DSZA 2F1VA 4AYDC 1XKIA 3HWBA 4NP1A 4GKCA 3HW9A 3Q6LA 2ZSCA 2POAA 5JDPA 1AELA 2OVAA 5FQ6E 1DZPA 1WBIA 3FDCA 4GNWA 1PM1X 1BBPA 5B5FA 1HBQA 3JS1A 1ZHTA 4ZHDA 4XMFA 2K62A 4EEJA 3F8AA 3ZW2A 1QWDA 3APVA 3P6EA 1X89A 5FENA 1ZNKA 3P6HA 4YGGA 5F6ZA 1IKEA 4HPDA 1YUPA 1ZHWA 1A18A 1KL4A 5B66O 4UU3A 4Z27A 2KDYA 5IO5A 4U8UO 3NJTA 4E1SA 2OL7A 3ZW1A 4HFOA 5K68A 4YFQA 1X8UA 3NBXX 3FIQA 3TGCA 5G3AA 4XNLA 4NV7A 1QG5A 3DA4A 5DL5A 5LJGA 1VWDB 1O1VA 1GKAB 1GX9A 4XMDA 4FZMA 1EPAA 4I9SA 4YGZA 3CQNA 2LBAA 2FGRA 3EYCA 1SRGA 1ZHXA 1HQPA 2FS7A 4Y0RA 1FELA 5FVNA 5GTIO 3U03A 4LSHA 3T0SA 3WJFA 3UEUA 3TF6A 4YBPA 3EW2A 4ON1A 2RTLA 4KC7A 4TQ2A 1UREA 4XMGA 2IWVA 2KXPB 2PY1A 3WXQA 5IXGA 3AA0B 3POUA 1W4TA 4FSOA 4GCQA 2Q39A 2KZ7A 1E5PA 4QYNA 3PRNA 3BDRA 1N0SA 4HPBA 4BBOA 4EQAC 1JYDA 1TOWA 2BSZA 2RTHB 3KZIO 5KAIO 4WFUA 4N75A 3BS2A 5ADXK 2X27X 4IL6O 3VHIA 2FWVA 3STNA 2Z4HA 4FMSA 2K0LA 5DPQA 2A8GA 3H3IA 2X9KA 3EW1A 4C4VA 1ALBA 2OFAA 1MOYA 5KICA 1N43A 2IZGB 4IB9A 5D8JA 4O4SA 2GTLN 2FTBA 1KT5A 2X8TA 5BVTA 1QY2A 2BT9A 2RCTA 4CSBA 3PECA 3SOTA 3STKA 1YWCA 3WZNA 3FYXA 4O9SA 3UEXA 1BWYA 1KQXA 1JQPA 3I0AA 4ZH6A 4MVLA 4AZNA 2WJRA 5BYPA 1SRHA 3N91A 5JD2A 3FW4A 2WR6A 4MISA 4U8UM 1ZNLA 4FESA 5B2AO 5G38A 2HYSA 4I3BA 1KOIA 1VWBB 2GJ5A 3PP6A 2RTBB 1LICA 3NX2A 4KCAA 4CPIA 3AAAA 3EMMA 2Y7SA 1DF8A 1N9YA 1GFOA 1ZNGA 4NW4A 1EW3A 1FENA 4Y5DA 2NNDA 5EE2A 1U17A 4DCBA 3E3CA 3POXA 4K19A 1T68X 1VWNB 1X8OA 2IZLB 2OL6O 1BT9A 4NLJA 5ADXL 1ZRYA 3ZQ3A 3BRYA 1D2UA 2KW1A 1JJJA 1KT3A 4IAXA 1KL3A 1HMRA 2M4LA 3WZQA 3AA1B 3T1DA 3ELXA 5HA1A 2YNKA 4GGRA 3RBYA 3RDUA 1SWJA 2FHLA 3RSWA 5CYBA 4QYPA 1DZJA 4YVBA 3IA8A 4I60A 4GGTA 1LELA 2RCQA 3UPGA 3C78X 3HK1A 4QZUA 4CTDA 1JIWI 2W2AA 3V8UA 4U3QA 1TXLA 4FQBB 1Q9GA 4Y0SA 5HA0A 1DF3A 6PRNA 4ALOA 2EU7X 2KT4B 5EPQA 4GE1A 1A3YA 1GKAA 3UEVA 3P6DA 2XKLA 1ADLA 4BX5B 1IIUA 1G74A 1IZNA 3MBTA 4Z6JA 3SY9A 1R0UA 1YP6A 2IWWA 1QQSA 4O3ZA 2J1NA 1E54A 3QRAA 2FHNX 3P02A 4JCHA 3PH6A 4GK9A 2XSTA 3AUMO 3KVNA 2NP1A 2ERVA 1S2PA 3BX7A 2FT9A 3ZI8A 2OY8A 1SRIA 4R0BA 4NYQA 1BH3A 2KXPA 3FENA 2HNXA 2ANSA 2IZBA 3AA0A 2W81C 4MVEA 1IFBA 5FFHA 1YS5A 2IZEB 4CDCA 5AEOA 3OD9A 1E02A 2A0AA 1GT3A 1JJXA 2OFBA 4ZCBA 4Z2OA 2LA7A 2FGSA 5BVSA 1TW4A 2OYBO 4MVKA 2G79A 1Y52X 2OF8A 2RTPB 2CZUA 2RTKA 1OPAA 3C5OA 3VY9X 4D6AA 4AZOA 2WQAE 4ALBA 5F1EA 2KZ7B 4FSPA 2XTQA 4YKMA 1UZ2X 1OPBA 4C00A 3QRCA 1OBPA 1SWHA 4EDEA 1L6MA 3TGBA 1CBIA 2RTDB 4I3DA 4IBAA 1JV4A 4FBOA 1B8EA 1N7YA 2LB6A 1X71A 5LJBA 4IAWA 1RSTB 3D97A 3KQ0A 2BS6A 1DZKA 1KGLA 2F73A 2RTJA 4IMNA 3WZPA 3VG4A 2IZCB 2RTRB 1ICMA 2G78A 4FRXA 2X45A 4AUIA 5H2FO 1SWFA 2GTLM 3FEKA 3ZWEA 4GDAA 3RBHA 3T24A 5B29A 4DQ4A 3VG5A 3AAEA 2OMFA 1NC9A 3A0HO 2X56A 3SYBA 1TVQA 2ZAIA 3AEHA 2MWHA 4O4XA 3WZOA 2HKDA 4N7CA 4IABA 4ZJ0A 1EI5A 3HWFA 2Q9SA 4PUXA 2VFCA 5JR8A 3PK2A 4AYHA 2RTGB 1JZUA 1STPA 5LKFA 1GM6A 3JQOA 4KR8A 4YBUA 1BRPA 3UAQA 2A5CA 3AA1A 3DTQA 3S60A 4I3CA 2QM9A 4Z2VA 3PF1A 1LDQA 1RSUB 1WUBA 3VPJE 5HAEA 3HOLA 5EDCA 2XMXA 1IFCA 4RUNA 4Z3TA 1RBPA 4N58A 1HMSA 1YWAA 5EEEA 1O1UA 1JMXA 4CPEA 4L1NA 4IB6A 4LQZA 5F2BA 1VWIB 1SWBA 5H9KA 1CJ5A 4QZTA 1YIVA 4IB8A 2YMSA 2RQ0A 1G90A 5D4AA 4Y59A 4ML7B 3FR4A 2BHVA 1N9MA 4DQ3A 3HPEA 4BX5A 4YCEA 4BOEA 1SA8A 3O22A 1ZHZA 3QQ2A 3NQ9A 1VWQB 4ZGUA 5LJEA 2N2LA 1LIBA 2QO6A 1TOUA 3VG7A 2N2MA 2RTAA 3FR5A 4NYRA 4NNSA 1IZNB 3CBSA 1I06A 3WYPA 1I05A 3WU2O 3OE3A 4NNTA 1JBHA 2IZAA 2YG2A 4QGXA 1P6PA 3S5VA 5HZ8A 3FA9A 4CPFA 3VG3A 2XG6A 2MJIA 1OSMA 1VWRB 1AQBA 5D5DA 4CK4A 4EKVA 1A57A 2A3FX 4JHQA 5IRAA 1SRFA 1OEJA 3KFGA 2FR3A 2A13A 3U9PC 4I95A 1VYOA 3HTYA 4DNEA 4KR4A 1NDJA 5FAZA 4JO6A 1BEBA 2Y3FA 2KD2A 4CV7A 1MDCA 1KQWA 1EIOA 1LNMA 2UZ2A 1AVDA 3RZYA 2N93A 3APWA 1GFMA 3HOEA 3BRZA 2OZQA 3RKGA 5GTHO 4EFGA 2ZLDA 4G76A 3STMX 5CE4A 4QAEA 2FR2A 3QKGA 5DL8A 2X55A 3VY8X 2JU3A 2A2UA 3WYQA 3NADA 1EUOA 2AVIA 1NGLA 1HXZA 3FA8A 1MX7A 4Y0QA 2R8AA 1YWBA 1BSQA 4COTA 3B2LA 2AXTO 4FUVA 1RLBE 3RDQA 1RXKA 5BVQA 1DC9A 1BRQA 4YMYA 1VWMB 3IFBA 4FBRA 1Y0GA 3F9DA 5AFUK 2Y0KA 3T6FA 3OJYC 4BX7A 3UU2A 4YFPA 4AZQA 1EQDA 1KL5A 1W5RA 4XMHA 3EMNX 2AT3X 1SWAA 4ORRA 2L67A 3BX8A 3GP6A 2WEWA 2OVSA 3FEPA 3AAEB 4YCHA 2X4MA 4NV8A 1Z24A 2F1CX 3VG2A 4OS0A 2CBSA 4O4UA 3ELZA 1SWOA 4ORXA 1SWUA 1HQQA 4RUUA 2O62A 1D3SA 2OVDA 4TJZA 1UYOX 1ACDA 5B5EO 1MEPA 2UYWA 1PBYA 5D48A 5HZQA 3VGWA 5G39A 5K67A 1HXXA 2XE3A 1ZNDA 1G85A 3FYFA 1NP1A 1HY2A 5IRWA 3NR3A 1VWHB 2K23A 3FELA 1DFVA 1SWCA 2I5ZO 3RY2A 4JNJA 1OEEA 5H9LA 1PBOA 4JFBA 2JQYA 1BLRA 1P4TA 4Z28A 4PJ2A 3UEWA 2IZFB 3HWGA 1HN2A 4MEEA 5DL7A 1K24A 3RWXA 5AFUL 1T8VA 2ZAGA 4AYID 2OY5O 4LSIA 3LK42 1KXOA 2Z4IA 1IJ8A 3MG5A 5HZ5A 4KIIA 2ACPX 1VWPB 1AVEA 3SLTA 2G7BA 1DZMA 1GT4A 1GFNA 2GTLO 4LSEA 3Q34A 1LCZA 3FW5A 1EALA 5D45A 2ODJA 3G7XA 3TGAA 3CMPA 5EDBA 4TKHA 2FKGA 2L5PA 3P6FA 2PRNA 2ASNX 2G5LA 3KFIA 1Y9TA 2X8SA 4ZH9A 5K06A 5F6BA 3RDSA 2RTNB 1SLEB 5LKEA 3WI4A 1SLDB 3G7GA 2AKQA 2Q2PA 4YGHA 5EEDA 1T1LA 2R4NA 1SWRA 3X00A 1ZNHA 1G5WA 1HXLA 2K4TA 2NNEA 1MM4A 4GZVA 1ERBA 4U46A 2Y3EA 3FA6A 1GGLA 2GH7A 2JU8A 5FQ8E 1X8NA 1ERXA 2JGSA 3WJDA 4ZFXA 3WBGA 3VZWX 3D9WA 5FQ7E 2IFBA 1I04A 2AT6X 2MF6A 2QCBA 1FTPA 3EBKA 2GC9A 4MVIA 4GU8A 1H91A 3KVDD 4GJVA 1DV9A 1U18A 5HCDC 3WJCA 4RLCA 3AKNA 3SZJA 4WHIA 2ZFGA 2DJGA 1I4UA 1KT6A 2HMBA 2QO4A 4GCSA 5IYUA 1NQNA 3RDMA 2DJFA 1X8PA 1SWGA 2IZJA 1VWFB 4GCPA 2FKJA 5HCCC 3WJEA 4LZUA 4KRAA 2OF9A 2QO5A 3ZUOA 1E06A 3B2IA 2AT0X 3NQ3A 1XCAA 3PGSA 4YKOA 4AZRA 1BSYA 5KIDA 5B27A 2L9CA 4FOZA 1HBPA 2LKKA 5HZ9A 4OMXA 4LKPA 3LK3B 5LJHA 1Q9FA 2RTQB 1VWKB 3RDXA 4F4BA 4QGWA 4MIRA 5E79O 3VHMA 4CDEA 1LCVA 1I9HA 4GETA 2RTMA 3SZIA 1SWTA 1LIDA 4RJWA 4D6BA 2O4VA 2MNHA 3CR6A 4K3BA 2CAMA 1EPBA 4AZMA 4BX7B 5EZ2A 2OL8O 4BQUA 1OEKA 4B55A 2BS5A 1FJ1E 1LPJA 2X8FA 1SRJA 2X32A 2OFMX 3RE6A 4A8ZA
chains in the Genus database with same CATH topology
2ALLX 1GFOA 3VG3A 4GRJA 1ZNGA 3NP1A 4IMOA 4NW4A 2XG6A 3GAQA 2MJIA 1EW3A 1OSMA 1FENA 1MM5A 1BJ7A 1YP7A 3WJGA 5C0NA 2NNDA 4EXZA 3WJBA 4ZGFA 1AQBA 5D5DA 4CK4A 3BSZE 5F7GA 4QQ1A 1U17A 3POXA 3E3CA 4I9RA 5EE2A 4K19A 1A57A 4OS3A 5PRNA 2A3FX 1T68X 4AFKA 2AT8X 3CQRA 3MX7A 1X8OA 2RD7C 1OEJA 1BT9A 1MUPA 3KFGA 4NLJA 2FR3A 2RN4A 4AZPA 2A13A 4ORWA 5ADXL 1ZRYA 3ZQ3A 1D2UA 2KW1A 3U9PC 3C77X 4I6SA 4I95A 1JJJA 3PPTA 4AYMC 1KT3A 4IAXA 4ORYA 3HTYA 2E4JA 1HXTA 3CWKA 4KH8A 4KR4A 3I17A 1O8VA 1BXWA 5FAZA 4HPAA 1G7NA 4INNA 3LK2B 3POQA 1BEBA 1HMRA 1GT5A 2XE1A 3U0DA 5H9NA 2KD2A 4CV7A 1B4MA 2M4LA 1MDCA 4TKBA 1KQWA 3MVFA 2AMMX 1EIOA 3AA1B 4FT6A 1LNMA 1SY0A 1SXXA 2JMBA 3T1DA 4A1HA 4OS8A 3ELXA 3B2KA 5DG4A 4RL9A 4ORUA 2WUTA 2N93A 3APWA 3RZYA 1GFMA 3HOEA 5HA1A 2YNKA 1JYJA 2OZQA 3RKGA 1GT1A 3RBYA 2P8GA 3AA7B 1QJ9A 4ZHFA 3ZZVA 2QTKA 5H8TA 4EFGA 2ZLDA 2FLJA 4A60A 3RSWA 3FA7A 4G76A 3STMX 5HZ6A 1LIFA 5CE4A 5CYBA 4N59A 4QAEA 4QYPA 1DZJA 2FR2A 3OBLA 2R73A 3QKGA 4XMCA 4HWMA 2OFRX 3IA8A 2CM9A 4O3XB 5DL8A 3O0EA 3VY8X 5GV0A 2JU3A 3PH5A 4YDAA 2A2UA 4JGLA 4O4OA 3NADA 4OMWA 1HMTA 2F09A 1EUOA 1NGLA 2HZRA 3FA8A 3APUA 4FRTA 3NPOA 1MX7A 1OBQA 2RCQA 4Y0QA 3UPGA 3C78X 1LIEA 5L8OA 1YWBA 1BSQA 3VU1A 3HK1A 4COTA 3B2LA 4QZUA 1QFVA 2FGQX 3P6GA 1JIWI 2W2AA 5AJBA 3V8UA 4FUVA 3ZW0A 4ID2A 1OPFA 1RLBE 2RA6A 4HPCA 1TXLA 4U3QA 5BVQA 4KC8A 1EIIA 2XE2A 4FQBB 1Q9GA 4AZLA 4Y0SA 5HA0A 2FRSA 1DC9A 4IB7A 1DF3A 3JTYA 1SY1A 5D47A 3L4RA 6PRNA 4YDBA 1GX8A 4ALOA 4FZNA 1BRQA 4YMYA 2EU7X 2KT4B 4U8UN 4B61A 3IFBA 2JW1A 1E00A 4ORSA 3F9DA 4FBRA 2MHLA 5EPQA 5AFUK 4GE1A 2Y0KA 4RLBA 1A3YA 1CBSA 3FLLA 1ORMA 1GKAA 5L8NA 1AB0A 3UEVA 3P6DA 2XKLA 3T20A 5HWZA 1ADLA 2KC0A 1AVGI 1FDQA 2R56A 3OJYC 3O2YA 1IIUA 1G74A 1ZNEA 2JU7A 1IZNA 4YFPA 3VE2A 3UU2A 4AZQA 3MBTA 3SY9A 1EQDA 1R0UA 4QRLA 4FGIB 5F58A 4L3RA 5LJKA 4XMHA 4Y0PA 2JMMA 1YP6A 1T0VA 2AT3X 3EMNX 7PRNA 1QQSA 4O3ZA 4ORRA 2J1NA 2L67A 1E54A 2M07A 3QRAA 1IW2A 1S44A 2GE4A 1VPRA 5H9AA 3BX8A 4AYNA 3P02A 4JCHA 3GP6A 3PH6A 4XNKA 1QFTA 2WEWA 4GK9A 2OVSA 3FEPA 2XSTA 3B2JA 3AAEB 4YCHA 3K19A 4O3WA 1ICNA 3D4RA 1IKJA 4NLIA 2NP1A 2ERVA 1S2PA 1FE3A 3BX7A 4QGVA 3FMZA 1Z24A 2FT9A 3ZI8A 4D5UA 1OBUA 4AW8A 1SXYA 3VG2A 4OS0A 2CBSA 2CBRA 3ELZA 4O4UA 4PSQA 4AKRB 3PQSA 1GFQA 3AA6B 4R0BA 4ORXA 2JN3A 4NYQA 5L8IA 3NSGA 1BH3A 4LSHA 2KXPA 3DA3A 3FENA 1MX8A 2HNXA 2ANSA 3AA0A 3FR2A 4GHBA 3BY0A 4RUUA 1QJPA 2W81C 4MVEA 1IFBA 3WOVA 2O62A 4TNNA 1D3SA 5FFHA 1YS5A 2M06A 3AAAB 2OVDA 2WQ9A 1MPFA 2GTFX 5AEOA 1B56A 3OD9A 1E02A 4TJZA 2A0AA 1ACDA 4ZHGA 3K3LA 1GT3A 2AT5X 3O19A 1PEEA 5LJDA 5D48A 1JJXA 3EBWA 3VE1A 5HZQA 3LK2A 4ZCBA 2Y2XA 2LA7A 1CRBA 1VYGA 2PORA 4YH0A 1HXXA 5BVSA 3S26A 2XE3A 1TW4A 1ZNDA 2WSJA 3VZTX 2MO5A 1G85A 3FYFA 1GFPA 2R74A 3KFFA 4MVKA 3NQKA 4ODDA 4D64A 1NP1A 1EXSA 2G79A 5KHPA 4C69X 2XTRA 1SY3A 4GNYA 2CZTA 2W2FA 5AJCA 2Y0LA 2A2GA 1SXWA 3B2HA 3SZVA 2CZUA 3LK41 1A2DA 1OPAA 2HLVA 3NR3A 3C5OA 2JOZA 3HWEA 5T5FA 4O3YA 2K23A 3CBCA 3C76X 1DFVA 2X46A 3FELA 4M6SA 4D6AA 3HWDA 4AZOA 2WQAE 3VY9X 1GXAA 4ALBA 4UU2A 2LFOA 5F1EA 2KZ7B 1OEEA 2KTDA 5H9LA 4FSPA 3TZSA 1PBOA 3DSZA 2F1VA 4AYDC 4JFBA 1XKIA 4ARHA 2BLGA 4YFRA 2XTQA 4YKMA 3HWBA 4BUMX 1BLRA 1UZ2X 4GKCA 1PMPA 4NP1A 1P4TA 3HW9A 3Q6LA 1OPBA 2POAA 4PJ2A 3UEWA 5HTDA 3QRCA 1QY1A 5JDPA 3HWGA 1AELA 1HN2A 2OVAA 1OBPA 5FQ6E 5DL7A 3RWXA 1DZPA 5AFUL 4EDEA 1L6MA 1T8VA 2ZAGA 3TGBA 2CM4A 3LK3A 4GNWA 4AYID 1CBIA 1BBPA 1PM1X 2QMIA 1LFOA 4LSIA 1HBQA 3JS1A 1ZHTA 4ZHDA 1SMPI 4I3DA 4IBAA 1JV4A 3LK42 1KXOA 2Z4IA 4XMFA 2K62A 4EEJA 3F8AA 4FBOA 1B8EA 5HZ5A 3VZUX 3ZW2A 4KIIA 2LB6A 1X71A 2ACPX 1QWDA 3APVA 5LJBA 4IAWA 3P6EA 3BU1A 2G7BA 1X89A 5FENA 3D97A 1DZMA 1GT4A 3KQ0A 1ZNKA 2Q4NA 3P6HA 1GFNA 2GTLO 2BS6A 4YGGA 5F6ZA 1DZKA 4LSEA 1IKEA 1KGLA 3A2SX 2F73A 4HPDA 2MM3A 1YUPA 3S5XA 1FEMA 1ZHWA 1A18A 4IMNA 3FW5A 1EALA 5D45A 2W2BA 3VG4A 2ODJA 3G7XA 8PRNA 4UU3A 3TGAA 3VG6A 3CMPA 3PQUA 5EDBA 5IO5A 2KDYA 5IO6A 4U8UO 4AKMA 1S7DA 4TKHA 2L5PA 3P6FA 5HTEA 2ACOA 2WEXA 3P24A 3WVMA 4E1SA 2PRNA 3ZW0B 2ASNX 1ICMA 2G78A 4FRXA 3ZW1A 3KFIA 1QABE 1Y9TA 2X45A 2HZQA 2X8SA 4GH7A 4HFOA 4ZH9A 4YFQA 2W80C 4AUIA 2QOSC 5K06A 5F6BA 1X8UA 3NBXX 3FIQA 1QJ8A 3TGCA 2GTLM 3FEKA 4TKJA 3ZWEA 5LKEA 4XNLA 3RBHA 4FZLA 3WI4A 4RJXA 3D95A 1QG5A 3T24A 3JSQA 3DA4A 3G7GA 5DL5A 2AL0X 2AKQA 2Q2PA 4YGHA 5B29A 5EEDA 2XE5A 5LJGA 4DQ4A 3VG5A 3AAEA 1O1VA 1GKAB 4ES7A 2OVEA 1GX9A 4XMDA 3KFHA 1PHOA 2WWPA 1ZNHA 2OMFA 4FZMA 1EPAA 1G5WA 4I9SA 3SYBA 1TVQA 4YGZA 2K4TA 2NNEA 1MM4A 3F6ZB 4GZVA 3CQNA 1ERBA 2LBAA 2FGRA 3FA6A 1GGLA 2JU8A 3EYCA 3LHNA 2ZAIA 5FQ8E 2MWHA 4O4XA 1HQPA 1ZHXA 1BM5A 2J4UP 1X8NA 2FS7A 4N7CA 1ERXA 4IABA 4Y0RA 2DM5A 1FELA 1KT7A 5FVNA 4D65A 4ZJ0A 3U03A 3WJDA 1EI5A 3HWFA 2Q9SA 2MHDA 3APXA 4M7MA 1X8QA 3WBGA 3WJFA 4ZFXA 5AQ6A 3T0SA 4AKRA 3VZWX 4PUXA 5FQ7E 2IFBA 3UEUA 5LJCA 5JR8A 3TF6A 1I04A 2AT6X 4AYHA 4YBPA 4XMEA 2LHFA 1JZUA 1GM6A 3JQOA 5LKFA 1FTPA 3EBKA 4ON1A 4KC7A 4KR8A 4YBUA 1BRPA 3UAQA 2GC9A 4TQ2A 1UREA 5DL6A 3BRNA 4GDZA 3AA1A 4AYEC 4MVIA 4XMGA 3DTQA 4GU8A 2KXPB 2PY1A 3WXQA 3AA0B 3S60A 1H91A 4I3CA 3KVDD 4ZHHA 1DV9A 3POUA 1U18A 5HCDC 5IO7A 4FBVA 1CBRA 2QM9A 4FSOA 2Q39A 4GCQA 3WJCA 4G75A 2KZ7A 3AA7A 4RLCA 1E5PA 4QYNA 4QNIA 3PRNA 3AKNA 4WHIA 3BDRA 2ZFGA 1I4UA 4LSFA 3PORA 1KT6A 2Q2MA 2HMBA 3VPJE 1N0SA 2QO4A 4GCSA 5IYUA 4HPBA 5HCEC 4EQAC 1JYDA 1X8PA 1KT4A 5HAEA 1TOWA 3SYSA 4GCPA 3HOLA 4E1TA 5HCCC 3WJEA 4LZUA 3D96A 4KRAA 1BSOA 5EDCA 2XMXA 2QO5A 4WFUA 3ZUOA 4BVMA 3BS2A 5ADXK 1IFCA 3EM0A 4RUNA 1E06A 4Z3TA 3B2IA 2X27X 2AT0X 3NQ3A 1XCAA 2FWVA 1RBPA 4N58A 1HMSA 4YKOA 3STNA 2AH7X 1BSYA 4AZRA 1YWAA 5EEEA 1O1UA 2Z4HA 4U9CA 4ZR2A 4L1NA 4FMSA 4IB6A 4LQZA 5KIDA 3NX1A 2K0LA 4GF4A 5DPQA 4LZVA 5H9KA 5B27A 2L9CA 1CJ5A 3H3IA 4FOZA 3SZDA 1SY2A 1VYFA 4QZTA 3ZUIA 1HBPA 1ALBA 2LKKA 1YIVA 5HZ9A 4OMXA 4IB8A 2YMSA 2RQ0A 4O49A 4LKPA 5KICA 2LFUA 4IB9A 3LK3B 5D4AA 2NNQA 1G90A 4TLJA 2L68A 1H6S1 5D8JA 5LJHA 1CBQA 1Q9FA 1KZWA 4ML7B 1IZNB 3FR4A 4O4SA 1THQA 2GTLN 2BHVA 3GE2A 2FTBA 3P6CA 1KT5A 4DQ3A 2X8TA 5BVTA 1QY2A 4F4BA 2BT9A 2RCTA 4CSBA 1LKEA 4YCEA 4BOEA 3PECA 4QGWA 5G26A 1SA8A 3SOTA 4MIRA 3STKA 1YWCA 1HXUA 1PRNA 3WI5A 4KT5A 1KZXA 3O22A 3FYXA 4O9SA 1U0XA 3UEXA 1BWYA 1KQXA 1ZHZA 4WBKA 3I0AA 4ZH6A 3BU9A 3NQ9A 4ZGUA 4MVLA 4GETA 4A1YA 5LJEA 2N2LA 4AZNA 1LIBA 1YWDA 3AKMA 2QO6A 1LF7A 3SAOA 5BYPA 3N91A 4N7DA 4ZHCA 1LIDA 3KZAA 1TOUA 3LV4A 4LKTA 3FW4A 3VG7A 2N2MA 4RJWA 4D6BA 2O4VA 2MNHA 2WR6A 4MISA 4U8UM 1ZNLA 4FESA 1SXUA 1ML7A 3CR6A 2LBVA 3FR5A 2HYSA 1EPBA 4I3BA 1KOIA 1MVGA 2GJ5A 3PP6A 4NNSA 4NYRA 3CBSA 3ZW1B 4AZMA 1B0OA 1I06A 1LICA 1QY0A 3NX2A 5EZ2A 3AA6A 3SY7A 1I05A 4BQUA 2KTSA 1ZHYA 1OEKA 4KCAA 3OE3A 1NP4A 2BS5A 4NNTA 1Y9LA 3PEDA 4WFVA 1JBHA 1LPJA 2YG2A 3BLGA 1P6PA 2FS6A 2X8FA 4QGXA 3S5VA 2F1TA 3AAAA 5HZ8A 2OFMX 3EMMA 5HBSA 2Y0HA 4A8ZA 2Y7SA 3TZGA 2YPVA 3FA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KC0 A;  3PQU A;  4AYM C;  4AYD C;  3V8U A;  3VE1 A;  3VE2 A;  4O4U A;  4U9C A;  2W80 C;  3PQS A;  5EE2 A;  4QQ1 A;  3UAQ A;  4O3X B;  4AYE C;  2KDY A;  4O3Z A;  4O4X A;  3HOL A;  3KVD D;  2W81 C;  4O49 A;  4AYI D;  2LFU A;  4AYN A;  1YS5 A;  3HOE A;  2Y7S A;  4O3Y A;  5T5F A;  2YPV A;  4O3W A;  4Z3T A; 
#chains in the Genus database with same CATH topology
 2ALL X;  1VWC B;  4GRJ A;  3NP1 A;  4IMO A;  1MM5 A;  1RAV A;  1YP7 A;  3WJG A;  5C0N A;  1MK5 A;  3WJB A;  4ZGF A;  3BSZ E;  4QQ1 A;  4I9R A;  3DWO X;  5PRN A;  2R89 A;  3CQR A;  3MX7 A;  1MUP A;  2RTF B;  4AZP A;  1VWA B;  3PGU A;  3PPT A;  4ORY A;  4GJS A;  4KH8 A;  1O8V A;  1BXW A;  1G7N A;  3POQ A;  1GT5 A;  1B4M A;  5IRU A;  3MVF A;  1SRE A;  2AMM X;  1W6F A;  4FT6 A;  1SY0 A;  1SXX A;  4OS8 A;  2R4O A;  3B2K A;  4PJ0 O;  4ORU A;  1JYJ A;  1GT1 A;  3MM0 A;  3AA7 B;  1OSP O;  2QTK A;  5H8T A;  4FQE A;  4UB6 O;  2WJQ A;  3FA7 A;  1SWD A;  4Z2P A;  4N59 A;  4XMC A;  3OBL A;  2R73 A;  2OFR X;  4O3X B;  4YDA A;  4JGL A;  4OMW A;  1HMT A;  5B3M O;  2F09 A;  2HZR A;  3APU A;  4FRT A;  2RTC B;  1OBQ A;  1QFV A;  2F01 A;  1OPF A;  2XE2 A;  1EII A;  2RTO B;  4IB7 A;  1LCW A;  5D47 A;  2C1Q A;  3L4R A;  4YDB A;  1GX8 A;  4FZN A;  3DZM A;  2MHL A;  2JW1 A;  1CBS A;  4OEM A;  1SWL A;  3FLL A;  5CHK A;  5L8N A;  1AB0 A;  5HWZ A;  2KC0 A;  1AVG I;  1FDQ A;  1ZNE A;  3VE2 A;  1NBX A;  5F58 A;  3FID A;  5LJK A;  2JMM A;  4OEL A;  7PRN A;  1IW2 A;  4BCS A;  2GE4 A;  1VPR A;  5H9A A;  4AYN A;  4XNK A;  1QFT A;  1Y55 X;  3B2J A;  2IZH B;  4GUZ A;  1IKJ A;  4NLI A;  1FE3 A;  4D5U A;  4AW8 A;  2CBR A;  4AKR B;  3AA6 B;  3NSG A;  3DA3 A;  1LDO A;  3WOV A;  2M06 A;  1MPF A;  2GTF X;  1T16 A;  1B56 A;  5CSE A;  4K3C A;  4ZHG A;  3O19 A;  3EBW A;  3LTW A;  3LK2 A;  2Y2X A;  4YH0 A;  3S26 A;  3DWN A;  2WSJ A;  1STS B;  2MO5 A;  2R74 A;  3NQK A;  4ODD A;  4D64 A;  2XTR A;  1GX3 A;  2CZT A;  3B2H A;  3SZV A;  4GD9 A;  3LK4 1;  1A2D A;  1I78 A;  3HWE A;  5T5F A;  4O3Y A;  3C76 X;  2X46 A;  3HWD A;  4UU2 A;  1SWN A;  3TZS A;  4ARH A;  4YFR A;  2BLG A;  4BUM X;  1PMP A;  4BJ8 A;  5HTD A;  1QY1 A;  2G8C O;  2CM4 A;  3LK3 A;  2QMI A;  1LFO A;  1SMP I;  2WPU A;  3VZU X;  3BU1 A;  2R88 A;  2Q4N A;  1SLF B;  3RE5 A;  3A2S X;  2BC3 A;  2MM3 A;  3S5X A;  1FEM A;  2W2B A;  2AF5 A;  8PRN A;  3VG6 A;  3PQU A;  2R4P A;  5IO6 A;  4AKM A;  1S7D A;  5HTE A;  1N4J A;  2ACO A;  2WEX A;  3P24 A;  3WVM A;  4CDF A;  3ZW0 B;  1E2T A;  4E1T A;  1QAB E;  4GH7 A;  2HZQ A;  2W80 C;  2QOS C;  1SWK A;  2IZK A;  1QJ8 A;  1Y53 X;  4TKJ A;  4FZL A;  4RJX A;  2I5V O;  4BX6 B;  3D95 A;  4CPH B;  3JSQ A;  2AL0 X;  3A0B O;  2OY7 A;  2XE5 A;  1JMZ A;  3RY1 A;  4ES7 A;  2OVE A;  3KFH A;  1PHO A;  2WWP A;  1LUQ A;  4GGZ A;  5KAF O;  3F6Z B;  3LHN A;  1SWP A;  5B10 O;  1BM5 A;  2J4U P;  2DM5 A;  1KT7 A;  4D65 A;  3APX A;  2MHD A;  4M7M A;  1X8Q A;  5AQ6 A;  4C5P A;  5LJC A;  4XME A;  2LHF A;  2QOM A;  3VHH A;  1SWE A;  3BRN A;  4GDZ A;  5DL6 A;  4AYE C;  4ZHH A;  2VDF A;  5IO7 A;  4FBV A;  2RTE B;  1CBR A;  4G75 A;  2C1S A;  3AA7 A;  5B5G A;  4QNI A;  1UYN X;  4LSF A;  3POR A;  2Q2M A;  5HCE C;  1VWE B;  1KT4 A;  3SYS A;  3D96 A;  1BSO A;  2VFB A;  4BVM A;  3EM0 A;  2R4L A;  3SLJ A;  4UB8 O;  2AH7 X;  4ZR2 A;  4IRW A;  4U9C A;  3NX1 A;  3RDO A;  4GF4 A;  2RTI B;  4LZV A;  3SZD A;  1SY2 A;  1VYF A;  3ZUI A;  4O49 A;  2LFU A;  2NNQ A;  4TLJ A;  2L68 A;  1H6S 1;  1CBQ A;  3T2X A;  1KZW A;  1THQ A;  3P6C A;  3GE2 A;  1LKE A;  5G26 A;  1PRN A;  1HXU A;  3WI5 A;  4KT5 A;  1KZX A;  3T2W A;  1U0X A;  1NQM A;  4WBK A;  3BU9 A;  4A1Y A;  1YWD A;  3AKM A;  1LF7 A;  3SAO A;  1RXJ A;  4N7D A;  4ZHC A;  3KZA A;  3LV4 A;  4LKT A;  1SXU A;  1ML7 A;  2LBV A;  1MVG A;  4AKR A;  3ZW1 B;  1B0O A;  3SY7 A;  1QY0 A;  1SWQ A;  3SLO A;  3AA6 A;  4CDD A;  2KTS A;  1ZHY A;  1NP4 A;  1Y9L A;  3PED A;  4WFV A;  3BLG A;  2F1T A;  2FS6 A;  5HBS A;  2Y0H A;  3TZG A;  2YPV A;  3GAQ A;  2A5B A;  1BJ7 A;  4EXZ A;  2IZI A;  5F7G A;  4OS3 A;  4AFK A;  2AT8 X;  2RD7 C;  3CKG A;  2RN4 A;  4ORW A;  3PGR A;  3C77 X;  4I6S A;  5TIS O;  4AYM C;  2E4J A;  1HXT A;  3CWK A;  3I17 A;  1K3B A;  1MM9 A;  4HPA A;  4INN A;  3LK2 B;  2XE1 A;  3U0D A;  5H9N A;  4OKA A;  4TKB A;  2JMB A;  4A1H A;  5DG4 A;  4RL9 A;  2WUT A;  2P8G A;  1QJ9 A;  3PDF A;  4ZHF A;  3ZZV A;  2FLJ A;  4A60 A;  3EC5 A;  5HZ6 A;  1LIF A;  4HWM A;  2CM9 A;  5L3Y A;  3O0E A;  1KFF A;  4PR7 A;  5GV0 A;  3PH5 A;  4O4O A;  3NPO A;  1LIE A;  5L8O A;  3VU1 A;  2FGQ X;  3P6G A;  5AJB A;  3ZW0 A;  1VWJ B;  4ID2 A;  4HPC A;  2RA6 A;  4KC8 A;  4AZL A;  1SLG B;  2FRS A;  3JTY A;  1SY1 A;  4BX6 A;  4U8U N;  4CPH A;  4B61 A;  4ORS A;  3CKF A;  1E00 A;  2Y32 A;  4BGF A;  4C4V B;  3JCU O;  1PTS A;  4RLB A;  1ORM A;  3T20 A;  1SWS A;  4N74 A;  2R56 A;  3O2Y A;  2JU7 A;  3BS0 A;  4QRL A;  4FGI B;  4L3R A;  4Y0P A;  1T0V A;  2PI3 O;  2M07 A;  1S44 A;  1STR B;  1RXH A;  3K19 A;  4O3W A;  1ICN A;  3D4R A;  4QGV A;  3FMZ A;  1OBU A;  1SXY A;  4PSQ A;  3PQS A;  1GFQ A;  2JN3 A;  5L8I A;  1MX8 A;  3FR2 A;  4GHB A;  3BY0 A;  1QJP A;  4TNN A;  3AAA B;  1VWL B;  2WQ9 A;  2X34 A;  3K3L A;  1JJU A;  2AT5 X;  2WVP A;  2OY1 O;  5B11 O;  1PEE A;  5LJD A;  3SZH A;  3T6L A;  3VE1 A;  2POR A;  1CRB A;  1VYG A;  3VZT X;  1GFP A;  3KFF A;  1EXS A;  4C69 X;  5KHP A;  1SY3 A;  4GNY A;  2W2F A;  5AJC A;  2Y0L A;  1S5L O;  2A2G A;  1SXW A;  2HLV A;  2IZD B;  1VWG B;  2JOZ A;  3CBC A;  1VWO B;  4M6S A;  1GXA A;  2LFO A;  2KTD A;  2C4I A;  3DSZ A;  2F1V A;  4AYD C;  1XKI A;  3HWB A;  4NP1 A;  4GKC A;  3HW9 A;  3Q6L A;  2ZSC A;  2POA A;  5JDP A;  1AEL A;  2OVA A;  5FQ6 E;  1DZP A;  1WBI A;  3FDC A;  4GNW A;  1PM1 X;  1BBP A;  5B5F A;  1HBQ A;  3JS1 A;  1ZHT A;  4ZHD A;  4XMF A;  2K62 A;  4EEJ A;  3F8A A;  3ZW2 A;  1QWD A;  3APV A;  3P6E A;  1X89 A;  5FEN A;  1ZNK A;  3P6H A;  4YGG A;  5F6Z A;  1IKE A;  4HPD A;  1YUP A;  1ZHW A;  1A18 A;  1KL4 A;  5B66 O;  4UU3 A;  4Z27 A;  2KDY A;  5IO5 A;  4U8U O;  3NJT A;  4E1S A;  2OL7 A;  3ZW1 A;  4HFO A;  5K68 A;  4YFQ A;  1X8U A;  3NBX X;  3FIQ A;  3TGC A;  5G3A A;  4XNL A;  4NV7 A;  1QG5 A;  3DA4 A;  5DL5 A;  5LJG A;  1VWD B;  1O1V A;  1GKA B;  1GX9 A;  4XMD A;  4FZM A;  1EPA A;  4I9S A;  4YGZ A;  3CQN A;  2LBA A;  2FGR A;  3EYC A;  1SRG A;  1ZHX A;  1HQP A;  2FS7 A;  4Y0R A;  1FEL A;  5FVN A;  5GTI O;  3U03 A;  4LSH A;  3T0S A;  3WJF A;  3UEU A;  3TF6 A;  4YBP A;  3EW2 A;  4ON1 A;  2RTL A;  4KC7 A;  4TQ2 A;  1URE A;  4XMG A;  2IWV A;  2KXP B;  2PY1 A;  3WXQ A;  5IXG A;  3AA0 B;  3POU A;  1W4T A;  4FSO A;  4GCQ A;  2Q39 A;  2KZ7 A;  1E5P A;  4QYN A;  3PRN A;  3BDR A;  1N0S A;  4HPB A;  4BBO A;  4EQA C;  1JYD A;  1TOW A;  2BSZ A;  2RTH B;  3KZI O;  5KAI O;  4WFU A;  4N75 A;  3BS2 A;  5ADX K;  2X27 X;  4IL6 O;  3VHI A;  2FWV A;  3STN A;  2Z4H A;  4FMS A;  2K0L A;  5DPQ A;  2A8G A;  3H3I A;  2X9K A;  3EW1 A;  4C4V A;  1ALB A;  2OFA A;  1MOY A;  5KIC A;  1N43 A;  2IZG B;  4IB9 A;  5D8J A;  4O4S A;  2GTL N;  2FTB A;  1KT5 A;  2X8T A;  5BVT A;  1QY2 A;  2BT9 A;  2RCT A;  4CSB A;  3PEC A;  3SOT A;  3STK A;  1YWC A;  3WZN A;  3FYX A;  4O9S A;  3UEX A;  1BWY A;  1KQX A;  1JQP A;  3I0A A;  4ZH6 A;  4MVL A;  4AZN A;  2WJR A;  5BYP A;  1SRH A;  3N91 A;  5JD2 A;  3FW4 A;  2WR6 A;  4MIS A;  4U8U M;  1ZNL A;  4FES A;  5B2A O;  5G38 A;  2HYS A;  4I3B A;  1KOI A;  1VWB B;  2GJ5 A;  3PP6 A;  2RTB B;  1LIC A;  3NX2 A;  4KCA A;  4CPI A;  3AAA A;  3EMM A;  2Y7S A;  1DF8 A;  1N9Y A;  1GFO A;  1ZNG A;  4NW4 A;  1EW3 A;  1FEN A;  4Y5D A;  2NND A;  5EE2 A;  1U17 A;  4DCB A;  3E3C A;  3POX A;  4K19 A;  1T68 X;  1VWN B;  1X8O A;  2IZL B;  2OL6 O;  1BT9 A;  4NLJ A;  5ADX L;  1ZRY A;  3ZQ3 A;  3BRY A;  1D2U A;  2KW1 A;  1JJJ A;  1KT3 A;  4IAX A;  1KL3 A;  1HMR A;  2M4L A;  3WZQ A;  3AA1 B;  3T1D A;  3ELX A;  5HA1 A;  2YNK A;  4GGR A;  3RBY A;  3RDU A;  1SWJ A;  2FHL A;  3RSW A;  5CYB A;  4QYP A;  1DZJ A;  4YVB A;  3IA8 A;  4I60 A;  4GGT A;  1LEL A;  2RCQ A;  3UPG A;  3C78 X;  3HK1 A;  4QZU A;  4CTD A;  1JIW I;  2W2A A;  3V8U A;  4U3Q A;  1TXL A;  4FQB B;  1Q9G A;  4Y0S A;  5HA0 A;  1DF3 A;  6PRN A;  4ALO A;  2EU7 X;  2KT4 B;  5EPQ A;  4GE1 A;  1A3Y A;  1GKA A;  3UEV A;  3P6D A;  2XKL A;  1ADL A;  4BX5 B;  1IIU A;  1G74 A;  1IZN A;  3MBT A;  4Z6J A;  3SY9 A;  1R0U A;  1YP6 A;  2IWW A;  1QQS A;  4O3Z A;  2J1N A;  1E54 A;  3QRA A;  2FHN X;  3P02 A;  4JCH A;  3PH6 A;  4GK9 A;  2XST A;  3AUM O;  3KVN A;  2NP1 A;  2ERV A;  1S2P A;  3BX7 A;  2FT9 A;  3ZI8 A;  2OY8 A;  1SRI A;  4R0B A;  4NYQ A;  1BH3 A;  2KXP A;  3FEN A;  2HNX A;  2ANS A;  2IZB A;  3AA0 A;  2W81 C;  4MVE A;  1IFB A;  5FFH A;  1YS5 A;  2IZE B;  4CDC A;  5AEO A;  3OD9 A;  1E02 A;  2A0A A;  1GT3 A;  1JJX A;  2OFB A;  4ZCB A;  4Z2O A;  2LA7 A;  2FGS A;  5BVS A;  1TW4 A;  2OYB O;  4MVK A;  2G79 A;  1Y52 X;  2OF8 A;  2RTP B;  2CZU A;  2RTK A;  1OPA A;  3C5O A;  3VY9 X;  4D6A A;  4AZO A;  2WQA E;  4ALB A;  5F1E A;  2KZ7 B;  4FSP A;  2XTQ A;  4YKM A;  1UZ2 X;  1OPB A;  4C00 A;  3QRC A;  1OBP A;  1SWH A;  4EDE A;  1L6M A;  3TGB A;  1CBI A;  2RTD B;  4I3D A;  4IBA A;  1JV4 A;  4FBO A;  1B8E A;  1N7Y A;  2LB6 A;  1X71 A;  5LJB A;  4IAW A;  1RST B;  3D97 A;  3KQ0 A;  2BS6 A;  1DZK A;  1KGL A;  2F73 A;  2RTJ A;  4IMN A;  3WZP A;  3VG4 A;  2IZC B;  2RTR B;  1ICM A;  2G78 A;  4FRX A;  2X45 A;  4AUI A;  5H2F O;  1SWF A;  2GTL M;  3FEK A;  3ZWE A;  4GDA A;  3RBH A;  3T24 A;  5B29 A;  4DQ4 A;  3VG5 A;  3AAE A;  2OMF A;  1NC9 A;  3A0H O;  2X56 A;  3SYB A;  1TVQ A;  2ZAI A;  3AEH A;  2MWH A;  4O4X A;  3WZO A;  2HKD A;  4N7C A;  4IAB A;  4ZJ0 A;  1EI5 A;  3HWF A;  2Q9S A;  4PUX A;  2VFC A;  5JR8 A;  3PK2 A;  4AYH A;  2RTG B;  1JZU A;  1STP A;  5LKF A;  1GM6 A;  3JQO A;  4KR8 A;  4YBU A;  1BRP A;  3UAQ A;  2A5C A;  3AA1 A;  3DTQ A;  3S60 A;  4I3C A;  2QM9 A;  4Z2V A;  3PF1 A;  1LDQ A;  1RSU B;  1WUB A;  3VPJ E;  5HAE A;  3HOL A;  5EDC A;  2XMX A;  1IFC A;  4RUN A;  4Z3T A;  1RBP A;  4N58 A;  1HMS A;  1YWA A;  5EEE A;  1O1U A;  1JMX A;  4CPE A;  4L1N A;  4IB6 A;  4LQZ A;  5F2B A;  1VWI B;  1SWB A;  5H9K A;  1CJ5 A;  4QZT A;  1YIV A;  4IB8 A;  2YMS A;  2RQ0 A;  1G90 A;  5D4A A;  4Y59 A;  4ML7 B;  3FR4 A;  2BHV A;  1N9M A;  4DQ3 A;  3HPE A;  4BX5 A;  4YCE A;  4BOE A;  1SA8 A;  3O22 A;  1ZHZ A;  3QQ2 A;  3NQ9 A;  1VWQ B;  4ZGU A;  5LJE A;  2N2L A;  1LIB A;  2QO6 A;  1TOU A;  3VG7 A;  2N2M A;  2RTA A;  3FR5 A;  4NYR A;  4NNS A;  1IZN B;  3CBS A;  1I06 A;  3WYP A;  1I05 A;  3WU2 O;  3OE3 A;  4NNT A;  1JBH A;  2IZA A;  2YG2 A;  4QGX A;  1P6P A;  3S5V A;  5HZ8 A;  3FA9 A;  4CPF A;  3VG3 A;  2XG6 A;  2MJI A;  1OSM A;  1VWR B;  1AQB A;  5D5D A;  4CK4 A;  4EKV A;  1A57 A;  2A3F X;  4JHQ A;  5IRA A;  1SRF A;  1OEJ A;  3KFG A;  2FR3 A;  2A13 A;  3U9P C;  4I95 A;  1VYO A;  3HTY A;  4DNE A;  4KR4 A;  1NDJ A;  5FAZ A;  4JO6 A;  1BEB A;  2Y3F A;  2KD2 A;  4CV7 A;  1MDC A;  1KQW A;  1EIO A;  1LNM A;  2UZ2 A;  1AVD A;  3RZY A;  2N93 A;  3APW A;  1GFM A;  3HOE A;  3BRZ A;  2OZQ A;  3RKG A;  5GTH O;  4EFG A;  2ZLD A;  4G76 A;  3STM X;  5CE4 A;  4QAE A;  2FR2 A;  3QKG A;  5DL8 A;  2X55 A;  3VY8 X;  2JU3 A;  2A2U A;  3WYQ A;  3NAD A;  1EUO A;  2AVI A;  1NGL A;  1HXZ A;  3FA8 A;  1MX7 A;  4Y0Q A;  2R8A A;  1YWB A;  1BSQ A;  4COT A;  3B2L A;  2AXT O;  4FUV A;  1RLB E;  3RDQ A;  1RXK A;  5BVQ A;  1DC9 A;  1BRQ A;  4YMY A;  1VWM B;  3IFB A;  4FBR A;  1Y0G A;  3F9D A;  5AFU K;  2Y0K A;  3T6F A;  3OJY C;  4BX7 A;  3UU2 A;  4YFP A;  4AZQ A;  1EQD A;  1KL5 A;  1W5R A;  4XMH A;  3EMN X;  2AT3 X;  1SWA A;  4ORR A;  2L67 A;  3BX8 A;  3GP6 A;  2WEW A;  2OVS A;  3FEP A;  3AAE B;  4YCH A;  2X4M A;  4NV8 A;  1Z24 A;  2F1C X;  3VG2 A;  4OS0 A;  2CBS A;  4O4U A;  3ELZ A;  1SWO A;  4ORX A;  1SWU A;  1HQQ A;  4RUU A;  2O62 A;  1D3S A;  2OVD A;  4TJZ A;  1UYO X;  1ACD A;  5B5E O;  1MEP A;  2UYW A;  1PBY A;  5D48 A;  5HZQ A;  3VGW A;  5G39 A;  5K67 A;  1HXX A;  2XE3 A;  1ZND A;  1G85 A;  3FYF A;  1NP1 A;  1HY2 A;  5IRW A;  3NR3 A;  1VWH B;  2K23 A;  3FEL A;  1DFV A;  1SWC A;  2I5Z O;  3RY2 A;  4JNJ A;  1OEE A;  5H9L A;  1PBO A;  4JFB A;  2JQY A;  1BLR A;  1P4T A;  4Z28 A;  4PJ2 A;  3UEW A;  2IZF B;  3HWG A;  1HN2 A;  4MEE A;  5DL7 A;  1K24 A;  3RWX A;  5AFU L;  1T8V A;  2ZAG A;  4AYI D;  2OY5 O;  4LSI A;  3LK4 2;  1KXO A;  2Z4I A;  1IJ8 A;  3MG5 A;  5HZ5 A;  4KII A;  2ACP X;  1VWP B;  1AVE A;  3SLT A;  2G7B A;  1DZM A;  1GT4 A;  1GFN A;  2GTL O;  4LSE A;  3Q34 A;  1LCZ A;  3FW5 A;  1EAL A;  5D45 A;  2ODJ A;  3G7X A;  3TGA A;  3CMP A;  5EDB A;  4TKH A;  2FKG A;  2L5P A;  3P6F A;  2PRN A;  2ASN X;  2G5L A;  3KFI A;  1Y9T A;  2X8S A;  4ZH9 A;  5K06 A;  5F6B A;  3RDS A;  2RTN B;  1SLE B;  5LKE A;  3WI4 A;  1SLD B;  3G7G A;  2AKQ A;  2Q2P A;  4YGH A;  5EED A;  1T1L A;  2R4N A;  1SWR A;  3X00 A;  1ZNH A;  1G5W A;  1HXL A;  2K4T A;  2NNE A;  1MM4 A;  4GZV A;  1ERB A;  4U46 A;  2Y3E A;  3FA6 A;  1GGL A;  2GH7 A;  2JU8 A;  5FQ8 E;  1X8N A;  1ERX A;  2JGS A;  3WJD A;  4ZFX A;  3WBG A;  3VZW X;  3D9W A;  5FQ7 E;  2IFB A;  1I04 A;  2AT6 X;  2MF6 A;  2QCB A;  1FTP A;  3EBK A;  2GC9 A;  4MVI A;  4GU8 A;  1H91 A;  3KVD D;  4GJV A;  1DV9 A;  1U18 A;  5HCD C;  3WJC A;  4RLC A;  3AKN A;  3SZJ A;  4WHI A;  2ZFG A;  2DJG A;  1I4U A;  1KT6 A;  2HMB A;  2QO4 A;  4GCS A;  5IYU A;  1NQN A;  3RDM A;  2DJF A;  1X8P A;  1SWG A;  2IZJ A;  1VWF B;  4GCP A;  2FKJ A;  5HCC C;  3WJE A;  4LZU A;  4KRA A;  2OF9 A;  2QO5 A;  3ZUO A;  1E06 A;  3B2I A;  2AT0 X;  3NQ3 A;  1XCA A;  3PGS A;  4YKO A;  4AZR A;  1BSY A;  5KID A;  5B27 A;  2L9C A;  4FOZ A;  1HBP A;  2LKK A;  5HZ9 A;  4OMX A;  4LKP A;  3LK3 B;  5LJH A;  1Q9F A;  2RTQ B;  1VWK B;  3RDX A;  4F4B A;  4QGW A;  4MIR A;  5E79 O;  3VHM A;  4CDE A;  1LCV A;  1I9H A;  4GET A;  2RTM A;  3SZI A;  1SWT A;  1LID A;  4RJW A;  4D6B A;  2O4V A;  2MNH A;  3CR6 A;  4K3B A;  2CAM A;  1EPB A;  4AZM A;  4BX7 B;  5EZ2 A;  2OL8 O;  4BQU A;  1OEK A;  4B55 A;  2BS5 A;  1FJ1 E;  1LPJ A;  2X8F A;  1SRJ A;  2X32 A;  2OFM X;  3RE6 A;  4A8Z A; 
#chains in the Genus database with same CATH homology
 2ALL X;  1GFO A;  3VG3 A;  4GRJ A;  1ZNG A;  3NP1 A;  4IMO A;  4NW4 A;  2XG6 A;  3GAQ A;  2MJI A;  1EW3 A;  1OSM A;  1FEN A;  1MM5 A;  1BJ7 A;  1YP7 A;  3WJG A;  5C0N A;  2NND A;  4EXZ A;  3WJB A;  4ZGF A;  1AQB A;  5D5D A;  4CK4 A;  3BSZ E;  5F7G A;  4QQ1 A;  1U17 A;  3POX A;  3E3C A;  4I9R A;  5EE2 A;  4K19 A;  1A57 A;  4OS3 A;  5PRN A;  2A3F X;  1T68 X;  4AFK A;  2AT8 X;  3CQR A;  3MX7 A;  1X8O A;  2RD7 C;  1OEJ A;  1BT9 A;  1MUP A;  3KFG A;  4NLJ A;  2FR3 A;  2RN4 A;  4AZP A;  2A13 A;  4ORW A;  5ADX L;  1ZRY A;  3ZQ3 A;  1D2U A;  2KW1 A;  3U9P C;  3C77 X;  4I6S A;  4I95 A;  1JJJ A;  3PPT A;  4AYM C;  1KT3 A;  4IAX A;  4ORY A;  3HTY A;  2E4J A;  1HXT A;  3CWK A;  4KH8 A;  4KR4 A;  3I17 A;  1O8V A;  1BXW A;  5FAZ A;  4HPA A;  1G7N A;  4INN A;  3LK2 B;  3POQ A;  1BEB A;  1HMR A;  1GT5 A;  2XE1 A;  3U0D A;  5H9N A;  2KD2 A;  4CV7 A;  1B4M A;  2M4L A;  1MDC A;  4TKB A;  1KQW A;  3MVF A;  2AMM X;  1EIO A;  3AA1 B;  4FT6 A;  1LNM A;  1SY0 A;  1SXX A;  2JMB A;  3T1D A;  4A1H A;  4OS8 A;  3ELX A;  3B2K A;  5DG4 A;  4RL9 A;  4ORU A;  2WUT A;  2N93 A;  3APW A;  3RZY A;  1GFM A;  3HOE A;  5HA1 A;  2YNK A;  1JYJ A;  2OZQ A;  3RKG A;  1GT1 A;  3RBY A;  2P8G A;  3AA7 B;  1QJ9 A;  4ZHF A;  3ZZV A;  2QTK A;  5H8T A;  4EFG A;  2ZLD A;  2FLJ A;  4A60 A;  3RSW A;  3FA7 A;  4G76 A;  3STM X;  5HZ6 A;  1LIF A;  5CE4 A;  5CYB A;  4N59 A;  4QAE A;  4QYP A;  1DZJ A;  2FR2 A;  3OBL A;  2R73 A;  3QKG A;  4XMC A;  4HWM A;  2OFR X;  3IA8 A;  2CM9 A;  4O3X B;  5DL8 A;  3O0E A;  3VY8 X;  5GV0 A;  2JU3 A;  3PH5 A;  4YDA A;  2A2U A;  4JGL A;  4O4O A;  3NAD A;  4OMW A;  1HMT A;  2F09 A;  1EUO A;  1NGL A;  2HZR A;  3FA8 A;  3APU A;  4FRT A;  3NPO A;  1MX7 A;  1OBQ A;  2RCQ A;  4Y0Q A;  3UPG A;  3C78 X;  1LIE A;  5L8O A;  1YWB A;  1BSQ A;  3VU1 A;  3HK1 A;  4COT A;  3B2L A;  4QZU A;  1QFV A;  2FGQ X;  3P6G A;  1JIW I;  2W2A A;  5AJB A;  3V8U A;  4FUV A;  3ZW0 A;  4ID2 A;  1OPF A;  1RLB E;  2RA6 A;  4HPC A;  1TXL A;  4U3Q A;  5BVQ A;  4KC8 A;  1EII A;  2XE2 A;  4FQB B;  1Q9G A;  4AZL A;  4Y0S A;  5HA0 A;  2FRS A;  1DC9 A;  4IB7 A;  1DF3 A;  3JTY A;  1SY1 A;  5D47 A;  3L4R A;  6PRN A;  4YDB A;  1GX8 A;  4ALO A;  4FZN A;  1BRQ A;  4YMY A;  2EU7 X;  2KT4 B;  4U8U N;  4B61 A;  3IFB A;  2JW1 A;  1E00 A;  4ORS A;  3F9D A;  4FBR A;  2MHL A;  5EPQ A;  5AFU K;  4GE1 A;  2Y0K A;  4RLB A;  1A3Y A;  1CBS A;  3FLL A;  1ORM A;  1GKA A;  5L8N A;  1AB0 A;  3UEV A;  3P6D A;  2XKL A;  3T20 A;  5HWZ A;  1ADL A;  2KC0 A;  1AVG I;  1FDQ A;  2R56 A;  3OJY C;  3O2Y A;  1IIU A;  1G74 A;  1ZNE A;  2JU7 A;  1IZN A;  4YFP A;  3VE2 A;  3UU2 A;  4AZQ A;  3MBT A;  3SY9 A;  1EQD A;  1R0U A;  4QRL A;  4FGI B;  5F58 A;  4L3R A;  5LJK A;  4XMH A;  4Y0P A;  2JMM A;  1YP6 A;  1T0V A;  2AT3 X;  3EMN X;  7PRN A;  1QQS A;  4O3Z A;  4ORR A;  2J1N A;  2L67 A;  1E54 A;  2M07 A;  3QRA A;  1IW2 A;  1S44 A;  2GE4 A;  1VPR A;  5H9A A;  3BX8 A;  4AYN A;  3P02 A;  4JCH A;  3GP6 A;  3PH6 A;  4XNK A;  1QFT A;  2WEW A;  4GK9 A;  2OVS A;  3FEP A;  2XST A;  3B2J A;  3AAE B;  4YCH A;  3K19 A;  4O3W A;  1ICN A;  3D4R A;  1IKJ A;  4NLI A;  2NP1 A;  2ERV A;  1S2P A;  1FE3 A;  3BX7 A;  4QGV A;  3FMZ A;  1Z24 A;  2FT9 A;  3ZI8 A;  4D5U A;  1OBU A;  4AW8 A;  1SXY A;  3VG2 A;  4OS0 A;  2CBS A;  2CBR A;  3ELZ A;  4O4U A;  4PSQ A;  4AKR B;  3PQS A;  1GFQ A;  3AA6 B;  4R0B A;  4ORX A;  2JN3 A;  4NYQ A;  5L8I A;  3NSG A;  1BH3 A;  4LSH A;  2KXP A;  3DA3 A;  3FEN A;  1MX8 A;  2HNX A;  2ANS A;  3AA0 A;  3FR2 A;  4GHB A;  3BY0 A;  4RUU A;  1QJP A;  2W81 C;  4MVE A;  1IFB A;  3WOV A;  2O62 A;  4TNN A;  1D3S A;  5FFH A;  1YS5 A;  2M06 A;  3AAA B;  2OVD A;  2WQ9 A;  1MPF A;  2GTF X;  5AEO A;  1B56 A;  3OD9 A;  1E02 A;  4TJZ A;  2A0A A;  1ACD A;  4ZHG A;  3K3L A;  1GT3 A;  2AT5 X;  3O19 A;  1PEE A;  5LJD A;  5D48 A;  1JJX A;  3EBW A;  3VE1 A;  5HZQ A;  3LK2 A;  4ZCB A;  2Y2X A;  2LA7 A;  1CRB A;  1VYG A;  2POR A;  4YH0 A;  1HXX A;  5BVS A;  3S26 A;  2XE3 A;  1TW4 A;  1ZND A;  2WSJ A;  3VZT X;  2MO5 A;  1G85 A;  3FYF A;  1GFP A;  2R74 A;  3KFF A;  4MVK A;  3NQK A;  4ODD A;  4D64 A;  1NP1 A;  1EXS A;  2G79 A;  5KHP A;  4C69 X;  2XTR A;  1SY3 A;  4GNY A;  2CZT A;  2W2F A;  5AJC A;  2Y0L A;  2A2G A;  1SXW A;  3B2H A;  3SZV A;  2CZU A;  3LK4 1;  1A2D A;  1OPA A;  2HLV A;  3NR3 A;  3C5O A;  2JOZ A;  3HWE A;  5T5F A;  4O3Y A;  2K23 A;  3CBC A;  3C76 X;  1DFV A;  2X46 A;  3FEL A;  4M6S A;  4D6A A;  3HWD A;  4AZO A;  2WQA E;  3VY9 X;  1GXA A;  4ALB A;  4UU2 A;  2LFO A;  5F1E A;  2KZ7 B;  1OEE A;  2KTD A;  5H9L A;  4FSP A;  3TZS A;  1PBO A;  3DSZ A;  2F1V A;  4AYD C;  4JFB A;  1XKI A;  4ARH A;  2BLG A;  4YFR A;  2XTQ A;  4YKM A;  3HWB A;  4BUM X;  1BLR A;  1UZ2 X;  4GKC A;  1PMP A;  4NP1 A;  1P4T A;  3HW9 A;  3Q6L A;  1OPB A;  2POA A;  4PJ2 A;  3UEW A;  5HTD A;  3QRC A;  1QY1 A;  5JDP A;  3HWG A;  1AEL A;  1HN2 A;  2OVA A;  1OBP A;  5FQ6 E;  5DL7 A;  3RWX A;  1DZP A;  5AFU L;  4EDE A;  1L6M A;  1T8V A;  2ZAG A;  3TGB A;  2CM4 A;  3LK3 A;  4GNW A;  4AYI D;  1CBI A;  1BBP A;  1PM1 X;  2QMI A;  1LFO A;  4LSI A;  1HBQ A;  3JS1 A;  1ZHT A;  4ZHD A;  1SMP I;  4I3D A;  4IBA A;  1JV4 A;  3LK4 2;  1KXO A;  2Z4I A;  4XMF A;  2K62 A;  4EEJ A;  3F8A A;  4FBO A;  1B8E A;  5HZ5 A;  3VZU X;  3ZW2 A;  4KII A;  2LB6 A;  1X71 A;  2ACP X;  1QWD A;  3APV A;  5LJB A;  4IAW A;  3P6E A;  3BU1 A;  2G7B A;  1X89 A;  5FEN A;  3D97 A;  1DZM A;  1GT4 A;  3KQ0 A;  1ZNK A;  2Q4N A;  3P6H A;  1GFN A;  2GTL O;  2BS6 A;  4YGG A;  5F6Z A;  1DZK A;  4LSE A;  1IKE A;  1KGL A;  3A2S X;  2F73 A;  4HPD A;  2MM3 A;  1YUP A;  3S5X A;  1FEM A;  1ZHW A;  1A18 A;  4IMN A;  3FW5 A;  1EAL A;  5D45 A;  2W2B A;  3VG4 A;  2ODJ A;  3G7X A;  8PRN A;  4UU3 A;  3TGA A;  3VG6 A;  3CMP A;  3PQU A;  5EDB A;  5IO5 A;  2KDY A;  5IO6 A;  4U8U O;  4AKM A;  1S7D A;  4TKH A;  2L5P A;  3P6F A;  5HTE A;  2ACO A;  2WEX A;  3P24 A;  3WVM A;  4E1S A;  2PRN A;  3ZW0 B;  2ASN X;  1ICM A;  2G78 A;  4FRX A;  3ZW1 A;  3KFI A;  1QAB E;  1Y9T A;  2X45 A;  2HZQ A;  2X8S A;  4GH7 A;  4HFO A;  4ZH9 A;  4YFQ A;  2W80 C;  4AUI A;  2QOS C;  5K06 A;  5F6B A;  1X8U A;  3NBX X;  3FIQ A;  1QJ8 A;  3TGC A;  2GTL M;  3FEK A;  4TKJ A;  3ZWE A;  5LKE A;  4XNL A;  3RBH A;  4FZL A;  3WI4 A;  4RJX A;  3D95 A;  1QG5 A;  3T24 A;  3JSQ A;  3DA4 A;  3G7G A;  5DL5 A;  2AL0 X;  2AKQ A;  2Q2P A;  4YGH A;  5B29 A;  5EED A;  2XE5 A;  5LJG A;  4DQ4 A;  3VG5 A;  3AAE A;  1O1V A;  1GKA B;  4ES7 A;  2OVE A;  1GX9 A;  4XMD A;  3KFH A;  1PHO A;  2WWP A;  1ZNH A;  2OMF A;  4FZM A;  1EPA A;  1G5W A;  4I9S A;  3SYB A;  1TVQ A;  4YGZ A;  2K4T A;  2NNE A;  1MM4 A;  3F6Z B;  4GZV A;  3CQN A;  1ERB A;  2LBA A;  2FGR A;  3FA6 A;  1GGL A;  2JU8 A;  3EYC A;  3LHN A;  2ZAI A;  5FQ8 E;  2MWH A;  4O4X A;  1HQP A;  1ZHX A;  1BM5 A;  2J4U P;  1X8N A;  2FS7 A;  4N7C A;  1ERX A;  4IAB A;  4Y0R A;  2DM5 A;  1FEL A;  1KT7 A;  5FVN A;  4D65 A;  4ZJ0 A;  3U03 A;  3WJD A;  1EI5 A;  3HWF A;  2Q9S A;  2MHD A;  3APX A;  4M7M A;  1X8Q A;  3WBG A;  3WJF A;  4ZFX A;  5AQ6 A;  3T0S A;  4AKR A;  3VZW X;  4PUX A;  5FQ7 E;  2IFB A;  3UEU A;  5LJC A;  5JR8 A;  3TF6 A;  1I04 A;  2AT6 X;  4AYH A;  4YBP A;  4XME A;  2LHF A;  1JZU A;  1GM6 A;  3JQO A;  5LKF A;  1FTP A;  3EBK A;  4ON1 A;  4KC7 A;  4KR8 A;  4YBU A;  1BRP A;  3UAQ A;  2GC9 A;  4TQ2 A;  1URE A;  5DL6 A;  3BRN A;  4GDZ A;  3AA1 A;  4AYE C;  4MVI A;  4XMG A;  3DTQ A;  4GU8 A;  2KXP B;  2PY1 A;  3WXQ A;  3AA0 B;  3S60 A;  1H91 A;  4I3C A;  3KVD D;  4ZHH A;  1DV9 A;  3POU A;  1U18 A;  5HCD C;  5IO7 A;  4FBV A;  1CBR A;  2QM9 A;  4FSO A;  2Q39 A;  4GCQ A;  3WJC A;  4G75 A;  2KZ7 A;  3AA7 A;  4RLC A;  1E5P A;  4QYN A;  4QNI A;  3PRN A;  3AKN A;  4WHI A;  3BDR A;  2ZFG A;  1I4U A;  4LSF A;  3POR A;  1KT6 A;  2Q2M A;  2HMB A;  3VPJ E;  1N0S A;  2QO4 A;  4GCS A;  5IYU A;  4HPB A;  5HCE C;  4EQA C;  1JYD A;  1X8P A;  1KT4 A;  5HAE A;  1TOW A;  3SYS A;  4GCP A;  3HOL A;  4E1T A;  5HCC C;  3WJE A;  4LZU A;  3D96 A;  4KRA A;  1BSO A;  5EDC A;  2XMX A;  2QO5 A;  4WFU A;  3ZUO A;  4BVM A;  3BS2 A;  5ADX K;  1IFC A;  3EM0 A;  4RUN A;  1E06 A;  4Z3T A;  3B2I A;  2X27 X;  2AT0 X;  3NQ3 A;  1XCA A;  2FWV A;  1RBP A;  4N58 A;  1HMS A;  4YKO A;  3STN A;  2AH7 X;  1BSY A;  4AZR A;  1YWA A;  5EEE A;  1O1U A;  2Z4H A;  4U9C A;  4ZR2 A;  4L1N A;  4FMS A;  4IB6 A;  4LQZ A;  5KID A;  3NX1 A;  2K0L A;  4GF4 A;  5DPQ A;  4LZV A;  5H9K A;  5B27 A;  2L9C A;  1CJ5 A;  3H3I A;  4FOZ A;  3SZD A;  1SY2 A;  1VYF A;  4QZT A;  3ZUI A;  1HBP A;  1ALB A;  2LKK A;  1YIV A;  5HZ9 A;  4OMX A;  4IB8 A;  2YMS A;  2RQ0 A;  4O49 A;  4LKP A;  5KIC A;  2LFU A;  4IB9 A;  3LK3 B;  5D4A A;  2NNQ A;  1G90 A;  4TLJ A;  2L68 A;  1H6S 1;  5D8J A;  5LJH A;  1CBQ A;  1Q9F A;  1KZW A;  4ML7 B;  1IZN B;  3FR4 A;  4O4S A;  1THQ A;  2GTL N;  2BHV A;  3GE2 A;  2FTB A;  3P6C A;  1KT5 A;  4DQ3 A;  2X8T A;  5BVT A;  1QY2 A;  4F4B A;  2BT9 A;  2RCT A;  4CSB A;  1LKE A;  4YCE A;  4BOE A;  3PEC A;  4QGW A;  5G26 A;  1SA8 A;  3SOT A;  4MIR A;  3STK A;  1YWC A;  1HXU A;  1PRN A;  3WI5 A;  4KT5 A;  1KZX A;  3O22 A;  3FYX A;  4O9S A;  1U0X A;  3UEX A;  1BWY A;  1KQX A;  1ZHZ A;  4WBK A;  3I0A A;  4ZH6 A;  3BU9 A;  3NQ9 A;  4ZGU A;  4MVL A;  4GET A;  4A1Y A;  5LJE A;  2N2L A;  4AZN A;  1LIB A;  1YWD A;  3AKM A;  2QO6 A;  1LF7 A;  3SAO A;  5BYP A;  3N91 A;  4N7D A;  4ZHC A;  1LID A;  3KZA A;  1TOU A;  3LV4 A;  4LKT A;  3FW4 A;  3VG7 A;  2N2M A;  4RJW A;  4D6B A;  2O4V A;  2MNH A;  2WR6 A;  4MIS A;  4U8U M;  1ZNL A;  4FES A;  1SXU A;  1ML7 A;  3CR6 A;  2LBV A;  3FR5 A;  2HYS A;  1EPB A;  4I3B A;  1KOI A;  1MVG A;  2GJ5 A;  3PP6 A;  4NNS A;  4NYR A;  3CBS A;  3ZW1 B;  4AZM A;  1B0O A;  1I06 A;  1LIC A;  1QY0 A;  3NX2 A;  5EZ2 A;  3AA6 A;  3SY7 A;  1I05 A;  4BQU A;  2KTS A;  1ZHY A;  1OEK A;  4KCA A;  3OE3 A;  1NP4 A;  2BS5 A;  4NNT A;  1Y9L A;  3PED A;  4WFV A;  1JBH A;  1LPJ A;  2YG2 A;  3BLG A;  1P6P A;  2FS6 A;  2X8F A;  4QGX A;  3S5V A;  2F1T A;  3AAA A;  5HZ8 A;  2OFM X;  3EMM A;  5HBS A;  2Y0H A;  4A8Z A;  2Y7S A;  3TZG A;  2YPV A;  3FA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...