3HOEA

Crystal structure of surface lipoprotein
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
242
structure length
242
Chain Sequence
EPALGYVVKVPVSSFENKKVDISDIEVITNGNLDDVPYKANSSKYNYPDIKTKDSSLQYVRSGYVIDGEHSGSNEKGYVYYKGNSPAKELPVNQLLTYTGSWDFTSNANLNNEEGRPNYLNDDYYTKFIGKRVGLVSGDAKPAKHKYTSQFEVDFATKKMTGKLSDKEKTIYTVNADIRGNRFTGAATASDKNKGKGESYNFFSADSQSLEGGFYGPKAEEMAGKFVANDKSLFAVFSAKHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords TbpB
publication title Insights into the bacterial transferrin receptor: the structure of transferrin-binding protein B from Actinobacillus pleuropneumoniae.
pubmed doi rcsb
source organism Actinobacillus pleuropneumoniae
total genus 61
structure length 242
sequence length 242
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 3hoeA01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 3hoeA02
4AYDC 5T5FA 3VE1A 2LFUA 1YS5A 3PQSA 4O4XA 2Y7SA 4AYNA 4O49A 4O3ZA 3PQUA 4AYEC 3UAQA 3V8UA 4AYID 4Z3TA 2W81C 2KDYA 3HOEA 5EE2A 2YPVA 4O3XB 3KVDD 4O3WA 3VE2A 4O3YA 4O4UA 3HOLA 4QQ1A 2KC0A 4AYMC 2W80C 4U9CA
chains in the Genus database with same CATH superfamily
1OPBA 3U9PC 2C4IA 1SRGA 3C78X 5HTDA 3NSGA 1I04A 2A8GA 3FEKA 2AT5X 4QGWA 1JJJA 2IZEB 4Z2PA 5EDCA 5IO7A 4N58A 4AZQA 4HWMA 4ON1A 3D4RA 4ORWA 3TGAA 4GDZA 3VHMA 1K24A 2RTRB 3L4RA 3NADA 3HOEA 1JMZA 2WQAE 3WZNA 3P6CA 2IFBA 3CKGA 4XMGA 1LIFA 2WR6A 5BVQA 4ZJ0A 2WVPA 5LJHA 3PK2A 2GH7A 2JU7A 4KRAA 2W2FA 1S44A 4NLJA 2R74A 1GFOA 2WJQA 1NP4A 2UZ2A 3PORA 4AZRA 1HXTA 4XNKA 3JSQA 3B2JA 4ZHDA 2BS6A 3KVNA 2YNKA 3WZQA 1ICNA 3RSWA 4XMFA 1OEJA 2K62A 4OELA 3AUMO 4QNIA 2A2GA 4MISA 1QJ9A 3PGRA 1VWJB 2JGSA 3LHNA 3QRCA 4JHQA 2QO4A 3DTQA 4HFOA 1SWJA 3FMZA 3LV4A 2LB6A 1HXLA 1RSTB 4IAWA 5AFUL 1MM4A 2CZTA 1P6PA 3FR4A 4FZMA 1T8VA 1LCVA 1NDJA 4MIRA 3VZWX 1W4TA 2K23A 1GXAA 2WEWA 2Q2MA 4OMXA 2ERVA 4FSPA 1LCWA 2MF6A 1FTPA 1THQA 1RLBE 4GD9A 1NQMA 3ZW2A 4YKOA 2AF5A 3VE2A 2FS6A 4U9CA 3VG7A 1EW3A 1SMPI 4OMWA 4U3QA 3V8UA 1YWBA 3ZW1A 2POAA 1BBPA 1JBHA 1PBYA 4C69X 1KT6A 2KDYA 2XKLA 3POQA 2XE1A 2PRNA 1SY2A 4GUZA 5BVSA 1SWKA 5JR8A 4Y0SA 3VU1A 3ZUOA 1GGLA 5IRWA 3BU9A 3OE3A 2OF9A 3PECA 1HN2A 1HY2A 3KQ0A 4EQAC 5HA0A 1E00A 5DL5A 1VWNB 2CM9A 3KZIO 4BX6A 3NR3A 1STRB 3D96A 3VHHA 2A13A 1X8UA 3RE5A 2FR3A 3A0BO 2OL8O 4C4VA 1BXWA 4FQEA 2AT6X 2JN3A 5L3YA 4QQ1A 1YP6A 1QY0A 2LBVA 2Y3EA 3NX1A 2ALLX 1UREA 4O4XA 3AAEA 5D8JA 2R4PA 3BX7A 2L5PA 2RTPB 1YP7A 4FMSA 3LK41 5E79O 1GFQA 4KIIA 2IZIA 4Z2OA 4GE1A 4U46A 2OL6O 3BRZA 2IZJA 1ML7A 2OVSA 1SXYA 1CJ5A 1HMRA 2Y7SA 4ML7B 5IO6A 3DWOX 2A5BA 3VG2A 5FVNA 2FKJA 1MK5A 4JCHA 1OBUA 1GX8A 1NC9A 5F6BA 1HXXA 1SA8A 1UZ2X 3E3CA 4O4UA 3HOLA 3PH6A 5H9LA 2ZFGA 1ZHYA 4ORYA 1AVDA 1CRBA 4IRWA 2C1SA 4OEMA 2A3FX 3P6GA 2JU3A 3RY2A 2G79A 5AJCA 5GTHO 3FW5A 4TQ2A 2PI3O 5HCCC 2AT0X 1BSQA 3MVFA 2F1TA 4AYDC 4CPEA 2UYWA 3OJYC 2FHNX 1T1LA 2LFOA 4GGTA 1G74A 1DFVA 4YFRA 5GTIO 5B5GA 2OVDA 3AAAB 3WJFA 3GE2A 4LSIA 1AVGI 4BX5A 1ZNKA 1LIDA 4N7DA 4BX5B 4RUUA 3LK2A 1YUPA 1JYJA 2QOSC 5HCEC 2ODJA 1SWNA 2HKDA 4KR8A 4DQ3A 1N43A 4D64A 2KT4B 3ZI8A 5D5DA 5HZ9A 5H9KA 1BSYA 3DWNA 1XCAA 3KFFA 4KC7A 3LK42 4M6SA 5G26A 4IB9A 5F58A 2RN4A 2KXPA 7PRNA 3SYSA 2RTDB 2MO5A 3AA7B 1CBSA 4PR7A 8PRNA 1KQXA 4IABA 2XTRA 2OVAA 2L68A 5HBSA 4QGXA 1JJUA 4FBVA 3WJEA 3C5OA 2BT9A 2KZ7B 3NX2A 1AQBA 1YWAA 4IB7A 4FZNA 4GZVA 2RTCB 4Z3TA 5KIDA 3APVA 3HWBA 1G7NA 1T16A 1Y0GA 4PJ2A 3RE6A 3SY9A 2K4TA 2MHLA 1EQDA 4GNYA 4CV7A 2GTLO 3PDFA 2Q39A 4N74A 5B66O 3OBLA 3AA1B 5EDBA 4ORXA 3TGCA 3SLTA 2YG2A 4PJ0O 4BBOA 4MVIA 3WXQA 1B0OA 4YMYA 4O3YA 1N0SA 1HMTA 1SLFB 3T2WA 2OMFA 1QJ8A 2I5VO 2DJFA 2PORA 2XG6A 1FDQA 1N9MA 1H6S1 2X56A 1VWKB 1VWGB 1Y53X 4E1TA 1IZNB 1JV4A 4FBRA 1EPAA 1KQWA 3DZMA 3D95A 1LF7A 3RDQA 1VWMB 3NQ9A 5D47A 5K68A 4QGVA 1SRFA 1PMPA 1SWBA 3QKGA 2IZGB 2L67A 2JMBA 4MVKA 2CM4A 2N2MA 1HQPA 1EIIA 1EIOA 2DJGA 2KTSA 1ZHZA 5DL6A 3EMNX 5HZ8A 1VWDB 3NJTA 5G38A 1DZMA 3NPOA 1LCZA 2NNQA 4C00A 4ID2A 1TXLA 1IW2A 2RTGB 4QRLA 3SZDA 1X8OA 1JYDA 4HPBA 1EXSA 3BRYA 3QQ2A 2GTLM 2F73A 3O0EA 3T2XA 2WWPA 1BRQA 2A2UA 2FGRA 3WI4A 1SWFA 4LSFA 1SXUA 2CBRA 3GAQA 5EEEA 2BC3A 2XE3A 1A2DA 3A2SX 1RXJA 1SWRA 5H9AA 1VWIB 1N7YA 4CDEA 1LDQA 4AYNA 4JO6A 1ZNEA 2R4OA 2HNXA 4GKCA 5D4AA 1H91A 2RTFB 1P4TA 1IKEA 2N93A 5B5EO 4LZUA 3CBCA 1SRIA 3FA9A 1E5PA 4GH7A 3NBXX 4GJVA 4I6SA 3RDOA 1OPAA 3DA4A 3B2IA 1JIWI 1N9YA 4WBKA 4ZGFA 1UYNX 3JQOA 1T0VA 2GC9A 1DV9A 4LSEA 1SXXA 1JMXA 4CPHB 4CDCA 3KFIA 1DZPA 2Q2PA 2HYSA 5LJDA 2Y0KA 5DPQA 2LA7A 4TKHA 4UU2A 2RTOB 5TISO 4NW4A 2NNDA 1GKAA 3X00A 1GKAB 3S5XA 3G7GA 4WFVA 2Y32A 1S7DA 1GT4A 1BSOA 1T68X 3EBWA 1VWBB 4L1NA 1WUBA 3PQSA 4B55A 1MX7A 4NV8A 3T24A 2FGQX 4CSBA 4Z6JA 1O1UA 4Z27A 1A18A 1OSPO 1Q9GA 1SLDB 2RA6A 5CSEA 1R0UA 3WBGA 3UEWA 4AZNA 3BLGA 2JQYA 3VG6A 3UEUA 3QRAA 4D5UA 2QTKA 2I5ZO 3VG3A 1SREA 2RTHB 3SZHA 4YKMA 1HMSA 2X8SA 3WZOA 4HPDA 3BS0A 2OF8A 5K67A 4OS0A 2RTIB 4RJWA 4U8UO 2GTLN 3PH5A 5EEDA 1U17A 2QMIA 5K06A 5D48A 1GFMA 4I9SA 1QFTA 4FRXA 4O4SA 4Y0QA 2OY8A 1OEKA 2FTBA 4Y0PA 5B3MO 5B27A 2JW1A 1HBQA 2FR2A 5IO5A 4GCPA 1U0XA 3FELA 3APWA 4IMOA 4XMEA 4LKPA 5B11O 1E54A 4GHBA 2X8TA 2FS7A 3ZUIA 2LKKA 2IZBA 4O3XB 2AT3X 1BWYA 3POXA 1O1VA 1IJ8A 2OFMX 4G76A 1ZNHA 2OZQA 2QO5A 3CQNA 3K19A 1VPRA 3VY9X 1KL5A 3CQRA 5FQ8E 1KT7A 5IRAA 5DG4A 4O3ZA 4KH8A 3AA0B 1A3YA 1PEEA 2A0AA 5FAZA 1ZNDA 1MM9A 2IZHB 1PTSA 3AKMA 1GT3A 1ICMA 1KT5A 5H2FO 2BLGA 5FFHA 1YWCA 1YS5A 2W2BA 4QYNA 2FGSA 3WZPA 1ZHWA 4GRJA 2OY5O 1LKEA 1SLEB 1JJXA 5HAEA 2FWVA 1QY1A 2IZFB 4KR4A 1Y9LA 4NP1A 4AUIA 3WVMA 3T6FA 4U8UM 1QY2A 3LK3A 3LK3B 5JD2A 4D6AA 3C76X 4WFUA 4MVEA 1D2UA 2IZAA 3ZQ3A 3FENA 1KT3A 4GGZA 4COTA 5EPQA 4AYID 3JS1A 2E4JA 2F1VA 5FQ7E 5KAIO 1EI5A 1SWTA 4BVMA 3A0HO 3WYQA 2OL7A 3P6HA 4QZUA 5FENA 3UAQA 1QFVA 2Y0LA 5DL7A 5ADXK 3LTWA 2RTEB 2WUTA 5HA1A 4Y0RA 3RDUA 3WJDA 4N75A 3VG4A 3VZUX 1OBPA 4IMNA 4QAEA 2XE2A 4JFBA 4AZOA 4ALOA 5LJBA 2O4VA 4I3DA 2OVEA 5BVTA 5F6ZA 1S5LO 2L9CA 4LQZA 3FYFA 2N2LA 3D9WA 2AT8X 1QABE 2YPVA 3ZZVA 2LBAA 4QYPA 3AAAA 4LSHA 1TW4A 2Z4HA 4BUMX 5HZQA 1NP1A 4MVLA 1I05A 4EFGA 5F1EA 5GV0A 5D45A 1L6MA 2ZSCA 4DNEA 4KCAA 3POUA 2RTAA 4RL9A 3RY1A 2PY1A 4IB6A 3S5VA 1GX3A 4D6BA 2R73A 3BRNA 4F4BA 4IB8A 1Y55X 5CHKA 3HTYA 4JGLA 4ZCBA 3AA7A 3SZJA 3O22A 1GX9A 1HQQA 2M06A 4O3WA 5EZ2A 1MEPA 1PM1X 1SWPA 3NP1A 4AYMC 4ORRA 2KZ7A 1LELA 4EKVA 4U8UN 3JTYA 1ZHTA 1VYFA 3JCUO 2P8GA 5HCDC 1KZXA 3WU2O 4BGFA 3HWGA 3EYCA 4C5PA 5B10O 1K3BA 2AKQA 3MG5A 3CWKA 3WJGA 2X27X 1TOWA 3WYPA 4XMHA 4ODDA 1QQSA 1TOUA 1KL3A 3I0AA 1VWOB 3AA1A 5B5FA 2ZAGA 4ZR2A 3P24A 2X45A 5AJBA 1DF3A 2J4UP 3EW1A 4LZVA 2R56A 1HXUA 3S26A 4A8ZA 3O2YA 1CBRA 1BRPA 4FRTA 3RDMA 1FEMA 1Z24A 1LIEA 1VWQB 4NYRA 2AVIA 2R88A 2QM9A 4XNLA 5LKFA 3ELXA 5KHPA 2XSTA 2X34A 2DM5A 3TZGA 1SRHA 1OEEA 3HK1A 1N4JA 4YFQA 5C0NA 1IZNA 1VWCB 1B8EA 3T6LA 2Y2XA 3FYXA 4NNSA 4YGZA 2R8AA 4RJXA 3FLLA 4BQUA 4YGHA 2BS5A 3RDSA 4G75A 3UEXA 1SY0A 1ERBA 3FR2A 4OKAA 3DA3A 2RQ0A 1QJPA 3P6EA 4GJSA 3UU2A 2R4NA 4BX7B 1ERXA 2KW1A 1SWDA 2HZQA 4NLIA 3PEDA 4EXZA 1KXOA 5ADXL 3S60A 4HPCA 5H9NA 4GU8A 4LKTA 3STKA 1X8NA 1OPFA 4CTDA 5T5FA 1UYOX 2QOMA 1E02A 2X4MA 3BS2A 2G5LA 2CZUA 3PQUA 4I3BA 4GCSA 2X46A 2HZRA 2YMSA 4L3RA 3SY7A 4OS3A 4ZHFA 3RBHA 3HWEA 4TLJA 1LIBA 2ZLDA 4B61A 1SRJA 2GE4A 2CBSA 4EEJA 2RTLA 5HWZA 1OBQA 2G78A 2AL0X 2Q9SA 1ZHXA 4AYHA 2W81C 4DQ4A 1GFNA 4NYQA 5KICA 1BH3A 3TF6A 2G7BA 1BT9A 2OY7A 2X9KA 3P02A 3VY8X 1IKJA 1YWDA 1MUPA 3HPEA 3PRNA 4CDFA 1LFOA 3F6ZB 1HBPA 3FA6A 3SLOA 2HLVA 3KVDD 3UEVA 1LUQA 5LJEA 3FA8A 4O4OA 4Y5DA 4YCEA 4K3CA 3U0DA 1XKIA 2OY1O 1I9HA 4CPHA 3FIQA 2ANSA 5AEOA 4ES7A 3AEHA 1ACDA 3HWDA 1CBQA 3Q6LA 1QG5A 4FESA 1KL4A 5LJKA 3FW4A 3CBSA 1GM6A 3Q34A 3H3IA 1B56A 3FDCA 4BCSA 4I60A 4YH0A 3SOTA 3CMPA 3BX8A 1MVGA 2OFRX 4GNWA 4EDEA 3WJCA 3D97A 2Z4IA 1Q9FA 4Y59A 2ASNX 5CYBA 2OFBA 3N91A 1SWSA 3FIDA 4I3CA 1FJ1E 4I9RA 5G39A 4YBUA 1MM5A 3WJBA 4Z28A 2BHVA 3FA7A 4D65A 1FE3A 3RWXA 1VWPB 2JOZA 2IWWA 2ACPX 1EUOA 4AKMA 2GJ5A 3GP6A 2RTQB 2RTKA 4RLCA 1BLRA 3T0SA 2VFCA 1GT1A 2EU7X 3VE1A 2RTJA 2IZDB 1E06A 1DC9A 2IZLB 3SYBA 2OYBO 4UB8O 4NNTA 5L8OA 2X32A 1SWQA 2WPUA 5IYUA 4YDAA 2AH7X 2C1QA 3U03A 1SWHA 2HMBA 1W5RA 4N7CA 4YGGA 1D3SA 1KOIA 4UB6O 2R4LA 2X8FA 2W80C 3CKFA 3WI5A 1BM5A 2R89A 1Y9TA 4M7MA 3STNA 2LFUA 1X71A 5BYPA 1JZUA 1SLGB 3CR6A 3TZSA 2WJRA 4ZHHA 3MBTA 3MM0A 4TKJA 1RAVA 4GDAA 3NQ3A 3AA0A 5LJGA 3ZW1B 3TGBA 5FQ6E 4O9SA 4WHIA 1X89A 4ZH6A 3MX7A 3BDRA 3ZWEA 1NGLA 2FKGA 4IL6O 4OS8A 1LDOA 4YDBA 3VG5A 2WSJA 1I4UA 4I95A 5IXGA 2VDFA 3VPJE 2M07A 3KFHA 5EE2A 4ZHCA 1SWLA 1IIUA 1RXKA 5PRNA 4GF4A 3OD9A 3B2HA 4FQBB 3SAOA 1G90A 3B2LA 3RZYA 1A57A 1HXZA 4BX6B 3BY0A 1DF8A 4RLBA 4AYEC 4K19A 4A1HA 4QZTA 1SY1A 4A60A 3NQKA 4AZMA 4C4VB 4NV7A 1GFPA 4GK9A 2RD7C 4XMDA 1B4MA 4N59A 2XMXA 5CE4A 1STPA 3AAEB 1PBOA 4O49A 4ZHGA 1KFFA 3WOVA 1VYGA 5JDPA 3UPGA 3B2KA 3PF1A 1O8VA 3IA8A 1OSMA 1ADLA 2MWHA 2VFBA 1W6FA 4GCQA 1G5WA 2QO6A 2W2AA 6PRNA 2F09A 5IRUA 4BOEA 3STMX 2IZKA 4R0BA 2JU8A 1RXHA 4UU3A 4Z2VA 1BEBA 4AFKA 4CDDA 2RTNB 1I78A 2M4LA 4CK4A 4TKBA 1EALA 2Y0HA 3VZTX 4YBPA 3P6FA 1SXWA 4AZPA 3KZAA 1BJ7A 4DCBA 1SWOA 1ALBA 4XMCA 1EPBA 4CPIA 2IWVA 1WBIA 1LICA 1KGLA 2K0LA 1X8QA 5B2AO 1AELA 1G85A 2IZCB 1JQPA 4FBOA 3FEPA 2RTBB 1KT4A 3VHIA 1Y52X 1KZWA 1GT5A 1SY3A 2KTDA 1VWEB 3EW2A 2AXTO 4YFPA 3VGWA 2G8CO 3AKNA 5LKEA 1QWDA 2MJIA 3C77X 2Q4NA 3F8AA 3LK2B 4RUNA 2OFAA 3PP6A 2MM3A 3APXA 1SWCA 4E1SA 2RCTA 5AQ6A 1FENA 3EM0A 3PGSA 1VWHB 1SWEA 1IFBA 3APUA 2WQ9A 3K3LA 2F1CX 4KT5A 2X55A 2XTQA 1SWGA 3BSZE 2FT9A 3RKGA 2KXPB 3P6DA 4GETA 1ZNLA 4PSQA 2FLJA 1TVQA 3RBYA 5F2BA 1VWLB 1ZNGA 4ALBA 3BU1A 1DZJA 2NP1A 2J1NA 1CBIA 4ORUA 1LPJA 4FUVA 4ARHA 1PRNA 5L8NA 3SZVA 1MX8A 3DSZA 5G3AA 2MHDA 3G7XA 2Y3FA 1E2TA 4IAXA 1PHOA 1SWAA 1VYOA 3PGUA 2A5CA 2WEXA 3AA6A 3AA6B 1S2PA 1FELA 2O62A 5HTEA 4FT6A 4KC8A 1I06A 3O19A 4YVBA 2CAMA 3RDXA 3EMMA 3KFGA 1STSB 5LJCA 1IFCA 3FR5A 4FZLA 5F7GA 4FSOA 2ZAIA 4ZFXA 5L8IA 1AVEA 1DZKA 5AFUK 5H8TA 4AKRA 4AKRB 2LHFA 1YIVA 3SLJA 1MDCA 1ZRYA 5DL8A 3T20A 4TJZA 3F9DA 2JMMA 2QCBA 1MOYA 1ORMA 4MEEA 2XE5A 5HZ6A 4BX7A 4HPAA 4YCHA 3PPTA 4A1YA 1U18A 1VWAB 2FHLA 4CPFA 4ORSA 3I17A 2NNEA 4INNA 2RCQA 1SWUA 1AB0A 3T1DA 1MPFA 1X8PA 4ZGUA 2KD2A 4ZH9A 4JNJA 2F01A 4AZLA 1NBXA 1LNMA 2MNHA 4FGIB 1VWFB 3SZIA 1RSUB 3ZW0A 4PUXA 1NQNA 5KAFO 3ZW0B 2ACOA 2FRSA 3EBKA 2AMMX 3HWFA 3HW9A 4GGRA 3ELZA 3IFBA 1VWRB 5HZ5A 2BSZA 4AW8A 5B29A 1RBPA 2RTMA 4BJ8A 2GTFX 4TNNA 4FOZA 3EC5A 4IBAA 2KC0A 4K3BA
chains in the Genus database with same CATH topology
2Q39A 1OPBA 1BM5A 3P6HA 3U9PC 1Y9TA 4M7MA 3STNA 2LFUA 1X71A 3OBLA 3AA1B 5EDBA 4ORXA 4QZUA 5BYPA 5FENA 3UAQA 1QFVA 1JZUA 2Y0LA 5DL7A 5ADXK 3TGCA 2YG2A 3CR6A 3C78X 2WUTA 5HTDA 3NSGA 1I04A 5HA1A 3FEKA 4Y0RA 4MVIA 3WJDA 2AT5X 4QGWA 3WXQA 1B0OA 1JJJA 3VG4A 4YMYA 3VZUX 4O3YA 3TZSA 5EDCA 1N0SA 1OBPA 5IO7A 1HMTA 4N58A 4IMNA 4AZQA 4HWMA 4ZHHA 3MBTA 4TKJA 2OMFA 4QAEA 2XE2A 4ON1A 4JFBA 4AZOA 1QJ8A 4ALOA 3D4RA 4ORWA 3TGAA 5LJBA 4I3DA 4GDZA 3NQ3A 2OVEA 5BVTA 2O4VA 5F6ZA 3L4RA 2PORA 5LJGA 2L9CA 3NADA 4LQZA 5FQ6E 3ZW1B 3FYFA 3TGBA 2N2LA 4O9SA 2XG6A 4WHIA 1FDQA 1X89A 2AT8X 1QABE 3HOEA 4ZH6A 3ZZVA 2WQAE 2YPVA 3MX7A 3BDRA 3ZWEA 2LBAA 4QYPA 1H6S1 3AAAA 3P6CA 4LSHA 1TW4A 2Z4HA 1NGLA 4BUMX 5HZQA 2IFBA 4XMGA 1NP1A 1LIFA 4MVLA 2WR6A 5BVQA 4ZJ0A 1I05A 4EFGA 4E1TA 1IZNB 5F1EA 5GV0A 1JV4A 5D45A 1L6MA 4FBRA 4OS8A 4YDBA 5LJHA 3VG5A 2WSJA 1I4UA 1EPAA 2JU7A 4KCAA 1KQWA 4I95A 3POUA 4KRAA 2W2FA 1S44A 3D95A 4NLJA 2R74A 1GFOA 4RL9A 1LF7A 1NP4A 3VPJE 3PORA 2M07A 3KFHA 3NQ9A 5D47A 4AZRA 4ZHCA 1HXTA 5EE2A 4XNKA 3JSQA 1IIUA 4QGVA 5PRNA 3B2JA 4FUVA 2PY1A 4IB6A 3S5VA 4ZHDA 4GF4A 3OD9A 1PMPA 3B2HA 4FQBB 2BS6A 3SAOA 1G90A 4D6BA 2R73A 3QKGA 2YNKA 3B2LA 2L67A 3RZYA 2JMBA 3BRNA 4F4BA 4IB8A 4MVKA 1ICNA 1A57A 2CM4A 2N2MA 1HQPA 3RSWA 1EIIA 3BY0A 2KTSA 1EIOA 4XMFA 1OEJA 1ZHZA 3EMNX 5DL6A 2K62A 5HZ8A 3HTYA 4RLBA 4QNIA 4AYEC 2A2GA 4K19A 4JGLA 4ZCBA 4A1HA 4QZTA 1SY1A 4A60A 4MISA 1QJ9A 3NQKA 3AA7A 1DZMA 3NPOA 3O22A 4AZMA 1GX9A 2NNQA 4O3WA 2M06A 3LHNA 5EZ2A 4ID2A 1GFPA 4GK9A 2RD7C 1TXLA 1PM1X 3NP1A 3QRCA 4XMDA 1B4MA 1IW2A 4N59A 4QRLA 3SZDA 4AYMC 1X8OA 2XMXA 4ORRA 2KZ7A 1JYDA 4HPBA 2QO4A 3DTQA 5CE4A 4HFOA 4U8UN 3JTYA 1EXSA 1ZHTA 1VYFA 3AA0A 3AAEB 1PBOA 4O49A 2P8GA 5HCDC 3FMZA 2GTLM 2F73A 3O0EA 4ZHGA 1KZXA 3WOVA 3LV4A 1VYGA 3HWGA 3EYCA 2LB6A 2WWPA 1BRQA 2A2UA 2FGRA 2AKQA 5JDPA 4IAWA 3UPGA 3CWKA 5AFUL 3WI4A 1MM4A 3WJGA 3B2KA 4LSFA 1SXUA 2CBRA 2CZTA 1O8VA 1P6PA 3FR4A 3GAQA 3IA8A 5EEEA 1ADLA 1OSMA 2X27X 1TOWA 2XE3A 1T8VA 2MWHA 4FZMA 1A2DA 4XMHA 4ODDA 4MIRA 1QQSA 3VZWX 1TOUA 3A2SX 2K23A 1GXAA 4GCQA 2WEWA 5H9AA 1G5WA 2Q2MA 3I0AA 2QO6A 2W2AA 4OMXA 6PRNA 3AA1A 2F09A 4AYNA 1ZNEA 2ZAGA 4ZR2A 3P24A 2ERVA 2HNXA 2X45A 5AJBA 1DF3A 4FSPA 2J4UP 4GKCA 5D4AA 1FTPA 4LZVA 4BOEA 1H91A 1RLBE 1THQA 2R56A 3STMX 4R0BA 1HXUA 1P4TA 2JU8A 1IKEA 4UU3A 2N93A 4YKOA 3S26A 3ZW2A 1BEBA 4AFKA 4A8ZA 3O2YA 1CBRA 2M4LA 4LZUA 3VE2A 1BRPA 3CBCA 4CK4A 4TKBA 1EALA 4FRTA 2FS6A 3FA9A 4U9CA 3VG7A 1EW3A 1FEMA 2Y0HA 1E5PA 1SMPI 4GH7A 3VZTX 4YBPA 1Z24A 3NBXX 4I6SA 1LIEA 3P6FA 1SXWA 4OMWA 4AZPA 4NYRA 4U3QA 3KZAA 3V8UA 1YWBA 3ZW1A 2POAA 1BBPA 1BJ7A 1JBHA 2QM9A 1ALBA 4XMCA 1EPBA 4XNLA 1OPAA 3ELXA 5LKFA 5KHPA 2XSTA 1KT6A 2KDYA 2XKLA 2DM5A 3B2IA 3DA4A 4C69X 1JIWI 3TZGA 4WBKA 3POQA 1LICA 4ZGFA 1KGLA 2XE1A 1OEEA 3HK1A 2K0LA 3JQOA 1X8QA 2PRNA 1SY2A 1T0VA 2GC9A 4YFQA 5BVSA 5C0NA 1IZNA 1DV9A 4LSEA 1B8EA 1SXXA 5JR8A 4Y0SA 1AELA 3VU1A 2Y2XA 1G85A 3ZUOA 3FYXA 3KFIA 1GGLA 1DZPA 4NNSA 2Q2PA 3BU9A 2HYSA 5LJDA 4YGZA 3OE3A 2Y0KA 4FBOA 3PECA 5DPQA 2LA7A 4RJXA 3FEPA 4TKHA 1KT4A 4UU2A 3FLLA 4BQUA 1HN2A 4NW4A 4YGHA 2BS5A 1KZWA 4G75A 2NNDA 3KQ0A 3UEXA 1GKAA 4EQAC 1GT5A 1SY3A 1GKAB 5HA0A 1SY0A 2KTDA 3S5XA 1E00A 3G7GA 1ERBA 3FR2A 4WFVA 5DL5A 4YFPA 1S7DA 3DA3A 2CM9A 3AKNA 2RQ0A 1GT4A 1BSOA 1T68X 1QWDA 3EBWA 4L1NA 5LKEA 2MJIA 3C77X 2Q4NA 3PQSA 3P6EA 3F8AA 3NR3A 3LK2B 1MX7A 4RUNA 3UU2A 3T24A 3PP6A 3D96A 2MM3A 3APXA 2A13A 4E1SA 1ERXA 2KW1A 2FGQX 1X8UA 2HZQA 4CSBA 2RCTA 2FR3A 4NLIA 5AQ6A 1O1UA 3PEDA 1FENA 4EXZA 1KXOA 3EM0A 1BXWA 5ADXL 1A18A 3S60A 1Q9GA 2AT6X 2JN3A 4HPCA 5H9NA 4GU8A 4QQ1A 1YP6A 1IFBA 1QY0A 2RA6A 4LKTA 1X8NA 3APUA 2LBVA 3STKA 1OPFA 2WQ9A 3NX1A 3K3LA 5T5FA 4KT5A 2ALLX 2XTQA 1R0UA 1UREA 1E02A 3WBGA 3UEWA 4AZNA 4O4XA 3BLGA 3BSZE 3BS2A 2FT9A 3AAEA 3VG6A 2CZUA 3PQUA 3RKGA 3UEUA 2KXPB 5D8JA 3QRAA 4I3BA 3P6DA 2QTKA 4GETA 4D5UA 3VG3A 3BX7A 1ZNLA 4GCSA 4PSQA 2X46A 2FLJA 2HZRA 2YMSA 4L3RA 2L5PA 3SY7A 1TVQA 4OS3A 4ZHFA 1YP7A 4YKMA 3RBYA 3RBHA 1HMSA 2X8SA 3HWEA 4FMSA 3LK41 1ZNGA 4HPDA 4TLJA 1LIBA 1GFQA 4KIIA 1QJPA 4GE1A 4ALBA 2ZLDA 4B61A 3BU1A 1DZJA 4OS0A 2GE4A 4RJWA 1ML7A 2OVSA 4U8UO 2NP1A 2GTLN 3PH5A 1CBIA 2CBSA 5EEDA 2J1NA 1SXYA 1U17A 4ORUA 1LPJA 2QMIA 4EEJA 1HMRA 5K06A 5D48A 1CJ5A 4ML7B 4ARHA 4I9SA 5IO6A 1GFMA 2Y7SA 5HWZA 1OBQA 3VG2A 1PRNA 5FVNA 2G78A 1QFTA 2AL0X 2Q9SA 5L8NA 1ZHXA 4FRXA 3SZVA 4O4SA 4AYHA 4JCHA 1OBUA 2W81C 4Y0QA 1MX8A 1GX8A 3DSZA 4DQ4A 5F6BA 2MHDA 1GFNA 4NYQA 5KICA 1BH3A 3TF6A 2G7BA 1HXXA 1BT9A 1SA8A 3G7XA 1UZ2X 1OEKA 2FTBA 4IAXA 4Y0PA 1PHOA 3E3CA 4O4UA 3HOLA 5B27A 3PH6A 2JW1A 2WEXA 1HBQA 2FR2A 5IO5A 3AA6A 4GCPA 5H9LA 1U0XA 3FELA 2ZFGA 1ZHYA 3AA6B 1S2PA 3APWA 4ORYA 4IMOA 4XMEA 3P02A 3VY8X 1FELA 1CRBA 2O62A 4LKPA 1IKJA 5HTEA 4FT6A 4KC8A 1YWDA 1I06A 3O19A 1MUPA 3PRNA 2A3FX 3P6GA 1E54A 3EMMA 2JU3A 4GHBA 2G79A 2X8TA 1LFOA 2FS7A 3FW5A 3KFGA 5AJCA 3F6ZB 1HBPA 2LKKA 3FA6A 3ZUIA 4O3XB 2HLVA 5LJCA 3KVDD 1IFCA 4TQ2A 2AT3X 5HCCC 3UEVA 1BWYA 3POXA 2AT0X 3FR5A 1BSQA 1O1VA 3FA8A 3MVFA 4O4OA 5LJEA 2F1TA 2OFMX 4G76A 1ZNHA 2OZQA 4YCEA 2QO5A 3CQNA 3K19A 1VPRA 3U0DA 4FZLA 3VY9X 1XKIA 4AYDC 5F7GA 3FIQA 4FSOA 2ZAIA 3CQRA 2ANSA 5FQ8E 4ZFXA 3OJYC 1KT7A 5AEOA 5DG4A 4ES7A 5L8IA 1DZKA 2LFOA 4O3ZA 5AFUK 4KH8A 1ACDA 3AA0B 1A3YA 3HWDA 1CBQA 1PEEA 5H8TA 4AKRA 2A0AA 5FAZA 1ZNDA 4AKRB 2LHFA 1YIVA 1G74A 1DFVA 4YFRA 1MDCA 2OVDA 1ZRYA 3AKMA 3Q6LA 1QG5A 3AAAB 5DL8A 3T20A 4FESA 5LJKA 3FW4A 1GT3A 4TJZA 3F9DA 1ICMA 1KT5A 3WJFA 3CBSA 1GM6A 3H3IA 2BLGA 2JMMA 3GE2A 1B56A 5FFHA 4LSIA 1AVGI 1YWCA 1ZNKA 1LIDA 4N7DA 4RUUA 1YS5A 2W2BA 1ORMA 4YH0A 3LK2A 1YUPA 3SOTA 1JYJA 3CMPA 2XE5A 3BX8A 2QOSC 4QYNA 1MVGA 5HCEC 2OFRX 5HZ6A 1ZHWA 4GRJA 4HPAA 4GNWA 4YCHA 3WJCA 4EDEA 3D97A 3PPTA 2ODJA 4A1YA 4KR8A 4DQ3A 2Z4IA 1U18A 1Q9FA 4D64A 1LKEA 2KT4B 3ZI8A 2ASNX 5CYBA 5D5DA 1JJXA 5HZ9A 5H9KA 5HAEA 1BSYA 3N91A 1XCAA 4I3CA 4ORSA 3KFFA 2FWVA 1QY1A 4KC7A 3I17A 4M6SA 3LK42 4I9RA 2NNEA 4YBUA 4INNA 1MM5A 2RCQA 4IB9A 3WJBA 4KR4A 1AB0A 3T1DA 5F58A 1MPFA 1Y9LA 2BHVA 4NP1A 4AUIA 2RN4A 3FA7A 1X8PA 2KXPA 7PRNA 3WVMA 4D65A 1FE3A 3RWXA 4U8UM 1QY2A 4ZGUA 2KD2A 3SYSA 4ZH9A 2JOZA 2MO5A 3AA7B 1CBSA 2ACPX 3LK3A 3LK3B 8PRNA 4AZLA 4D6AA 1EUOA 4AKMA 1KQXA 2GJ5A 1LNMA 5G26A 4IABA 2XTRA 2MNHA 2OVAA 2L68A 3C76X 3GP6A 5HBSA 4FGIB 4QGXA 4WFUA 4FBVA 3WJEA 4MVEA 4RLCA 1D2UA 1BLRA 3T0SA 3C5OA 2BT9A 3ZW0A 2KZ7B 4PUXA 1GT1A 2EU7X 3NX2A 3ZW0B 2ACOA 1AQBA 1YWAA 4IB7A 3VE1A 3ZQ3A 2FRSA 1E06A 3EBKA 2AMMX 1DC9A 3FENA 4FZNA 4GZVA 1KT3A 3HWFA 3SYBA 4COTA 3HW9A 5EPQA 4AYID 3JS1A 4NNTA 5L8OA 4Z3TA 5KIDA 2E4JA 3APVA 3HWBA 1G7NA 3ELZA 3IFBA 5HZ5A 4AW8A 5IYUA 4YDAA 2F1VA 5FQ7E 4PJ2A 2AH7X 5B29A 3U03A 1RBPA 3SY9A 2HMBA 1EI5A 4BVMA 2GTFX 4TNNA 4N7CA 4YGGA 1D3SA 1KOIA 2K4TA 2MHLA 1EQDA 4IBAA 4FOZA 4GNYA 2KC0A 4CV7A 2X8FA 2W80C 2GTLO 3WI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYD C;  5T5F A;  3VE1 A;  2LFU A;  1YS5 A;  3PQS A;  4O4X A;  2Y7S A;  4AYN A;  4O49 A;  4O3Z A;  3PQU A;  4AYE C;  3UAQ A;  3V8U A;  4AYI D;  4Z3T A;  2W81 C;  2KDY A;  3HOE A;  5EE2 A;  2YPV A;  4O3X B;  3KVD D;  4O3W A;  3VE2 A;  4O3Y A;  4O4U A;  3HOL A;  4QQ1 A;  2KC0 A;  4AYM C;  2W80 C;  4U9C A; 
#chains in the Genus database with same CATH topology
 1OPB A;  3U9P C;  2C4I A;  1SRG A;  3C78 X;  5HTD A;  3NSG A;  1I04 A;  2A8G A;  3FEK A;  2AT5 X;  4QGW A;  1JJJ A;  2IZE B;  4Z2P A;  5EDC A;  5IO7 A;  4N58 A;  4AZQ A;  4HWM A;  4ON1 A;  3D4R A;  4ORW A;  3TGA A;  4GDZ A;  3VHM A;  1K24 A;  2RTR B;  3L4R A;  3NAD A;  3HOE A;  1JMZ A;  2WQA E;  3WZN A;  3P6C A;  2IFB A;  3CKG A;  4XMG A;  1LIF A;  2WR6 A;  5BVQ A;  4ZJ0 A;  2WVP A;  5LJH A;  3PK2 A;  2GH7 A;  2JU7 A;  4KRA A;  2W2F A;  1S44 A;  4NLJ A;  2R74 A;  1GFO A;  2WJQ A;  1NP4 A;  2UZ2 A;  3POR A;  4AZR A;  1HXT A;  4XNK A;  3JSQ A;  3B2J A;  4ZHD A;  2BS6 A;  3KVN A;  2YNK A;  3WZQ A;  1ICN A;  3RSW A;  4XMF A;  1OEJ A;  2K62 A;  4OEL A;  3AUM O;  4QNI A;  2A2G A;  4MIS A;  1QJ9 A;  3PGR A;  1VWJ B;  2JGS A;  3LHN A;  3QRC A;  4JHQ A;  2QO4 A;  3DTQ A;  4HFO A;  1SWJ A;  3FMZ A;  3LV4 A;  2LB6 A;  1HXL A;  1RST B;  4IAW A;  5AFU L;  1MM4 A;  2CZT A;  1P6P A;  3FR4 A;  4FZM A;  1T8V A;  1LCV A;  1NDJ A;  4MIR A;  3VZW X;  1W4T A;  2K23 A;  1GXA A;  2WEW A;  2Q2M A;  4OMX A;  2ERV A;  4FSP A;  1LCW A;  2MF6 A;  1FTP A;  1THQ A;  1RLB E;  4GD9 A;  1NQM A;  3ZW2 A;  4YKO A;  2AF5 A;  3VE2 A;  2FS6 A;  4U9C A;  3VG7 A;  1EW3 A;  1SMP I;  4OMW A;  4U3Q A;  3V8U A;  1YWB A;  3ZW1 A;  2POA A;  1BBP A;  1JBH A;  1PBY A;  4C69 X;  1KT6 A;  2KDY A;  2XKL A;  3POQ A;  2XE1 A;  2PRN A;  1SY2 A;  4GUZ A;  5BVS A;  1SWK A;  5JR8 A;  4Y0S A;  3VU1 A;  3ZUO A;  1GGL A;  5IRW A;  3BU9 A;  3OE3 A;  2OF9 A;  3PEC A;  1HN2 A;  1HY2 A;  3KQ0 A;  4EQA C;  5HA0 A;  1E00 A;  5DL5 A;  1VWN B;  2CM9 A;  3KZI O;  4BX6 A;  3NR3 A;  1STR B;  3D96 A;  3VHH A;  2A13 A;  1X8U A;  3RE5 A;  2FR3 A;  3A0B O;  2OL8 O;  4C4V A;  1BXW A;  4FQE A;  2AT6 X;  2JN3 A;  5L3Y A;  4QQ1 A;  1YP6 A;  1QY0 A;  2LBV A;  2Y3E A;  3NX1 A;  2ALL X;  1URE A;  4O4X A;  3AAE A;  5D8J A;  2R4P A;  3BX7 A;  2L5P A;  2RTP B;  1YP7 A;  4FMS A;  3LK4 1;  5E79 O;  1GFQ A;  4KII A;  2IZI A;  4Z2O A;  4GE1 A;  4U46 A;  2OL6 O;  3BRZ A;  2IZJ A;  1ML7 A;  2OVS A;  1SXY A;  1CJ5 A;  1HMR A;  2Y7S A;  4ML7 B;  5IO6 A;  3DWO X;  2A5B A;  3VG2 A;  5FVN A;  2FKJ A;  1MK5 A;  4JCH A;  1OBU A;  1GX8 A;  1NC9 A;  5F6B A;  1HXX A;  1SA8 A;  1UZ2 X;  3E3C A;  4O4U A;  3HOL A;  3PH6 A;  5H9L A;  2ZFG A;  1ZHY A;  4ORY A;  1AVD A;  1CRB A;  4IRW A;  2C1S A;  4OEM A;  2A3F X;  3P6G A;  2JU3 A;  3RY2 A;  2G79 A;  5AJC A;  5GTH O;  3FW5 A;  4TQ2 A;  2PI3 O;  5HCC C;  2AT0 X;  1BSQ A;  3MVF A;  2F1T A;  4AYD C;  4CPE A;  2UYW A;  3OJY C;  2FHN X;  1T1L A;  2LFO A;  4GGT A;  1G74 A;  1DFV A;  4YFR A;  5GTI O;  5B5G A;  2OVD A;  3AAA B;  3WJF A;  3GE2 A;  4LSI A;  1AVG I;  4BX5 A;  1ZNK A;  1LID A;  4N7D A;  4BX5 B;  4RUU A;  3LK2 A;  1YUP A;  1JYJ A;  2QOS C;  5HCE C;  2ODJ A;  1SWN A;  2HKD A;  4KR8 A;  4DQ3 A;  1N43 A;  4D64 A;  2KT4 B;  3ZI8 A;  5D5D A;  5HZ9 A;  5H9K A;  1BSY A;  3DWN A;  1XCA A;  3KFF A;  4KC7 A;  3LK4 2;  4M6S A;  5G26 A;  4IB9 A;  5F58 A;  2RN4 A;  2KXP A;  7PRN A;  3SYS A;  2RTD B;  2MO5 A;  3AA7 B;  1CBS A;  4PR7 A;  8PRN A;  1KQX A;  4IAB A;  2XTR A;  2OVA A;  2L68 A;  5HBS A;  4QGX A;  1JJU A;  4FBV A;  3WJE A;  3C5O A;  2BT9 A;  2KZ7 B;  3NX2 A;  1AQB A;  1YWA A;  4IB7 A;  4FZN A;  4GZV A;  2RTC B;  4Z3T A;  5KID A;  3APV A;  3HWB A;  1G7N A;  1T16 A;  1Y0G A;  4PJ2 A;  3RE6 A;  3SY9 A;  2K4T A;  2MHL A;  1EQD A;  4GNY A;  4CV7 A;  2GTL O;  3PDF A;  2Q39 A;  4N74 A;  5B66 O;  3OBL A;  3AA1 B;  5EDB A;  4ORX A;  3TGC A;  3SLT A;  2YG2 A;  4PJ0 O;  4BBO A;  4MVI A;  3WXQ A;  1B0O A;  4YMY A;  4O3Y A;  1N0S A;  1HMT A;  1SLF B;  3T2W A;  2OMF A;  1QJ8 A;  2I5V O;  2DJF A;  2POR A;  2XG6 A;  1FDQ A;  1N9M A;  1H6S 1;  2X56 A;  1VWK B;  1VWG B;  1Y53 X;  4E1T A;  1IZN B;  1JV4 A;  4FBR A;  1EPA A;  1KQW A;  3DZM A;  3D95 A;  1LF7 A;  3RDQ A;  1VWM B;  3NQ9 A;  5D47 A;  5K68 A;  4QGV A;  1SRF A;  1PMP A;  1SWB A;  3QKG A;  2IZG B;  2L67 A;  2JMB A;  4MVK A;  2CM4 A;  2N2M A;  1HQP A;  1EII A;  1EIO A;  2DJG A;  2KTS A;  1ZHZ A;  5DL6 A;  3EMN X;  5HZ8 A;  1VWD B;  3NJT A;  5G38 A;  1DZM A;  3NPO A;  1LCZ A;  2NNQ A;  4C00 A;  4ID2 A;  1TXL A;  1IW2 A;  2RTG B;  4QRL A;  3SZD A;  1X8O A;  1JYD A;  4HPB A;  1EXS A;  3BRY A;  3QQ2 A;  2GTL M;  2F73 A;  3O0E A;  3T2X A;  2WWP A;  1BRQ A;  2A2U A;  2FGR A;  3WI4 A;  1SWF A;  4LSF A;  1SXU A;  2CBR A;  3GAQ A;  5EEE A;  2BC3 A;  2XE3 A;  1A2D A;  3A2S X;  1RXJ A;  1SWR A;  5H9A A;  1VWI B;  1N7Y A;  4CDE A;  1LDQ A;  4AYN A;  4JO6 A;  1ZNE A;  2R4O A;  2HNX A;  4GKC A;  5D4A A;  1H91 A;  2RTF B;  1P4T A;  1IKE A;  2N93 A;  5B5E O;  4LZU A;  3CBC A;  1SRI A;  3FA9 A;  1E5P A;  4GH7 A;  3NBX X;  4GJV A;  4I6S A;  3RDO A;  1OPA A;  3DA4 A;  3B2I A;  1JIW I;  1N9Y A;  4WBK A;  4ZGF A;  1UYN X;  3JQO A;  1T0V A;  2GC9 A;  1DV9 A;  4LSE A;  1SXX A;  1JMX A;  4CPH B;  4CDC A;  3KFI A;  1DZP A;  2Q2P A;  2HYS A;  5LJD A;  2Y0K A;  5DPQ A;  2LA7 A;  4TKH A;  4UU2 A;  2RTO B;  5TIS O;  4NW4 A;  2NND A;  1GKA A;  3X00 A;  1GKA B;  3S5X A;  3G7G A;  4WFV A;  2Y32 A;  1S7D A;  1GT4 A;  1BSO A;  1T68 X;  3EBW A;  1VWB B;  4L1N A;  1WUB A;  3PQS A;  4B55 A;  1MX7 A;  4NV8 A;  3T24 A;  2FGQ X;  4CSB A;  4Z6J A;  1O1U A;  4Z27 A;  1A18 A;  1OSP O;  1Q9G A;  1SLD B;  2RA6 A;  5CSE A;  1R0U A;  3WBG A;  3UEW A;  4AZN A;  3BLG A;  2JQY A;  3VG6 A;  3UEU A;  3QRA A;  4D5U A;  2QTK A;  2I5Z O;  3VG3 A;  1SRE A;  2RTH B;  3SZH A;  4YKM A;  1HMS A;  2X8S A;  3WZO A;  4HPD A;  3BS0 A;  2OF8 A;  5K67 A;  4OS0 A;  2RTI B;  4RJW A;  4U8U O;  2GTL N;  3PH5 A;  5EED A;  1U17 A;  2QMI A;  5K06 A;  5D48 A;  1GFM A;  4I9S A;  1QFT A;  4FRX A;  4O4S A;  4Y0Q A;  2OY8 A;  1OEK A;  2FTB A;  4Y0P A;  5B3M O;  5B27 A;  2JW1 A;  1HBQ A;  2FR2 A;  5IO5 A;  4GCP A;  1U0X A;  3FEL A;  3APW A;  4IMO A;  4XME A;  4LKP A;  5B11 O;  1E54 A;  4GHB A;  2X8T A;  2FS7 A;  3ZUI A;  2LKK A;  2IZB A;  4O3X B;  2AT3 X;  1BWY A;  3POX A;  1O1V A;  1IJ8 A;  2OFM X;  4G76 A;  1ZNH A;  2OZQ A;  2QO5 A;  3CQN A;  3K19 A;  1VPR A;  3VY9 X;  1KL5 A;  3CQR A;  5FQ8 E;  1KT7 A;  5IRA A;  5DG4 A;  4O3Z A;  4KH8 A;  3AA0 B;  1A3Y A;  1PEE A;  2A0A A;  5FAZ A;  1ZND A;  1MM9 A;  2IZH B;  1PTS A;  3AKM A;  1GT3 A;  1ICM A;  1KT5 A;  5H2F O;  2BLG A;  5FFH A;  1YWC A;  1YS5 A;  2W2B A;  4QYN A;  2FGS A;  3WZP A;  1ZHW A;  4GRJ A;  2OY5 O;  1LKE A;  1SLE B;  1JJX A;  5HAE A;  2FWV A;  1QY1 A;  2IZF B;  4KR4 A;  1Y9L A;  4NP1 A;  4AUI A;  3WVM A;  3T6F A;  4U8U M;  1QY2 A;  3LK3 A;  3LK3 B;  5JD2 A;  4D6A A;  3C76 X;  4WFU A;  4MVE A;  1D2U A;  2IZA A;  3ZQ3 A;  3FEN A;  1KT3 A;  4GGZ A;  4COT A;  5EPQ A;  4AYI D;  3JS1 A;  2E4J A;  2F1V A;  5FQ7 E;  5KAI O;  1EI5 A;  1SWT A;  4BVM A;  3A0H O;  3WYQ A;  2OL7 A;  3P6H A;  4QZU A;  5FEN A;  3UAQ A;  1QFV A;  2Y0L A;  5DL7 A;  5ADX K;  3LTW A;  2RTE B;  2WUT A;  5HA1 A;  4Y0R A;  3RDU A;  3WJD A;  4N75 A;  3VG4 A;  3VZU X;  1OBP A;  4IMN A;  4QAE A;  2XE2 A;  4JFB A;  4AZO A;  4ALO A;  5LJB A;  2O4V A;  4I3D A;  2OVE A;  5BVT A;  5F6Z A;  1S5L O;  2L9C A;  4LQZ A;  3FYF A;  2N2L A;  3D9W A;  2AT8 X;  1QAB E;  2YPV A;  3ZZV A;  2LBA A;  4QYP A;  3AAA A;  4LSH A;  1TW4 A;  2Z4H A;  4BUM X;  5HZQ A;  1NP1 A;  4MVL A;  1I05 A;  4EFG A;  5F1E A;  5GV0 A;  5D45 A;  1L6M A;  2ZSC A;  4DNE A;  4KCA A;  3POU A;  2RTA A;  4RL9 A;  3RY1 A;  2PY1 A;  4IB6 A;  3S5V A;  1GX3 A;  4D6B A;  2R73 A;  3BRN A;  4F4B A;  4IB8 A;  1Y55 X;  5CHK A;  3HTY A;  4JGL A;  4ZCB A;  3AA7 A;  3SZJ A;  3O22 A;  1GX9 A;  1HQQ A;  2M06 A;  4O3W A;  5EZ2 A;  1MEP A;  1PM1 X;  1SWP A;  3NP1 A;  4AYM C;  4ORR A;  2KZ7 A;  1LEL A;  4EKV A;  4U8U N;  3JTY A;  1ZHT A;  1VYF A;  3JCU O;  2P8G A;  5HCD C;  1KZX A;  3WU2 O;  4BGF A;  3HWG A;  3EYC A;  4C5P A;  5B10 O;  1K3B A;  2AKQ A;  3MG5 A;  3CWK A;  3WJG A;  2X27 X;  1TOW A;  3WYP A;  4XMH A;  4ODD A;  1QQS A;  1TOU A;  1KL3 A;  3I0A A;  1VWO B;  3AA1 A;  5B5F A;  2ZAG A;  4ZR2 A;  3P24 A;  2X45 A;  5AJB A;  1DF3 A;  2J4U P;  3EW1 A;  4LZV A;  2R56 A;  1HXU A;  3S26 A;  4A8Z A;  3O2Y A;  1CBR A;  1BRP A;  4FRT A;  3RDM A;  1FEM A;  1Z24 A;  1LIE A;  1VWQ B;  4NYR A;  2AVI A;  2R88 A;  2QM9 A;  4XNL A;  5LKF A;  3ELX A;  5KHP A;  2XST A;  2X34 A;  2DM5 A;  3TZG A;  1SRH A;  1OEE A;  3HK1 A;  1N4J A;  4YFQ A;  5C0N A;  1IZN A;  1VWC B;  1B8E A;  3T6L A;  2Y2X A;  3FYX A;  4NNS A;  4YGZ A;  2R8A A;  4RJX A;  3FLL A;  4BQU A;  4YGH A;  2BS5 A;  3RDS A;  4G75 A;  3UEX A;  1SY0 A;  1ERB A;  3FR2 A;  4OKA A;  3DA3 A;  2RQ0 A;  1QJP A;  3P6E A;  4GJS A;  3UU2 A;  2R4N A;  4BX7 B;  1ERX A;  2KW1 A;  1SWD A;  2HZQ A;  4NLI A;  3PED A;  4EXZ A;  1KXO A;  5ADX L;  3S60 A;  4HPC A;  5H9N A;  4GU8 A;  4LKT A;  3STK A;  1X8N A;  1OPF A;  4CTD A;  5T5F A;  1UYO X;  2QOM A;  1E02 A;  2X4M A;  3BS2 A;  2G5L A;  2CZU A;  3PQU A;  4I3B A;  4GCS A;  2X46 A;  2HZR A;  2YMS A;  4L3R A;  3SY7 A;  4OS3 A;  4ZHF A;  3RBH A;  3HWE A;  4TLJ A;  1LIB A;  2ZLD A;  4B61 A;  1SRJ A;  2GE4 A;  2CBS A;  4EEJ A;  2RTL A;  5HWZ A;  1OBQ A;  2G78 A;  2AL0 X;  2Q9S A;  1ZHX A;  4AYH A;  2W81 C;  4DQ4 A;  1GFN A;  4NYQ A;  5KIC A;  1BH3 A;  3TF6 A;  2G7B A;  1BT9 A;  2OY7 A;  2X9K A;  3P02 A;  3VY8 X;  1IKJ A;  1YWD A;  1MUP A;  3HPE A;  3PRN A;  4CDF A;  1LFO A;  3F6Z B;  1HBP A;  3FA6 A;  3SLO A;  2HLV A;  3KVD D;  3UEV A;  1LUQ A;  5LJE A;  3FA8 A;  4O4O A;  4Y5D A;  4YCE A;  4K3C A;  3U0D A;  1XKI A;  2OY1 O;  1I9H A;  4CPH A;  3FIQ A;  2ANS A;  5AEO A;  4ES7 A;  3AEH A;  1ACD A;  3HWD A;  1CBQ A;  3Q6L A;  1QG5 A;  4FES A;  1KL4 A;  5LJK A;  3FW4 A;  3CBS A;  1GM6 A;  3Q34 A;  3H3I A;  1B56 A;  3FDC A;  4BCS A;  4I60 A;  4YH0 A;  3SOT A;  3CMP A;  3BX8 A;  1MVG A;  2OFR X;  4GNW A;  4EDE A;  3WJC A;  3D97 A;  2Z4I A;  1Q9F A;  4Y59 A;  2ASN X;  5CYB A;  2OFB A;  3N91 A;  1SWS A;  3FID A;  4I3C A;  1FJ1 E;  4I9R A;  5G39 A;  4YBU A;  1MM5 A;  3WJB A;  4Z28 A;  2BHV A;  3FA7 A;  4D65 A;  1FE3 A;  3RWX A;  1VWP B;  2JOZ A;  2IWW A;  2ACP X;  1EUO A;  4AKM A;  2GJ5 A;  3GP6 A;  2RTQ B;  2RTK A;  4RLC A;  1BLR A;  3T0S A;  2VFC A;  1GT1 A;  2EU7 X;  3VE1 A;  2RTJ A;  2IZD B;  1E06 A;  1DC9 A;  2IZL B;  3SYB A;  2OYB O;  4UB8 O;  4NNT A;  5L8O A;  2X32 A;  1SWQ A;  2WPU A;  5IYU A;  4YDA A;  2AH7 X;  2C1Q A;  3U03 A;  1SWH A;  2HMB A;  1W5R A;  4N7C A;  4YGG A;  1D3S A;  1KOI A;  4UB6 O;  2R4L A;  2X8F A;  2W80 C;  3CKF A;  3WI5 A;  1BM5 A;  2R89 A;  1Y9T A;  4M7M A;  3STN A;  2LFU A;  1X71 A;  5BYP A;  1JZU A;  1SLG B;  3CR6 A;  3TZS A;  2WJR A;  4ZHH A;  3MBT A;  3MM0 A;  4TKJ A;  1RAV A;  4GDA A;  3NQ3 A;  3AA0 A;  5LJG A;  3ZW1 B;  3TGB A;  5FQ6 E;  4O9S A;  4WHI A;  1X89 A;  4ZH6 A;  3MX7 A;  3BDR A;  3ZWE A;  1NGL A;  2FKG A;  4IL6 O;  4OS8 A;  1LDO A;  4YDB A;  3VG5 A;  2WSJ A;  1I4U A;  4I95 A;  5IXG A;  2VDF A;  3VPJ E;  2M07 A;  3KFH A;  5EE2 A;  4ZHC A;  1SWL A;  1IIU A;  1RXK A;  5PRN A;  4GF4 A;  3OD9 A;  3B2H A;  4FQB B;  3SAO A;  1G90 A;  3B2L A;  3RZY A;  1A57 A;  1HXZ A;  4BX6 B;  3BY0 A;  1DF8 A;  4RLB A;  4AYE C;  4K19 A;  4A1H A;  4QZT A;  1SY1 A;  4A60 A;  3NQK A;  4AZM A;  4C4V B;  4NV7 A;  1GFP A;  4GK9 A;  2RD7 C;  4XMD A;  1B4M A;  4N59 A;  2XMX A;  5CE4 A;  1STP A;  3AAE B;  1PBO A;  4O49 A;  4ZHG A;  1KFF A;  3WOV A;  1VYG A;  5JDP A;  3UPG A;  3B2K A;  3PF1 A;  1O8V A;  3IA8 A;  1OSM A;  1ADL A;  2MWH A;  2VFB A;  1W6F A;  4GCQ A;  1G5W A;  2QO6 A;  2W2A A;  6PRN A;  2F09 A;  5IRU A;  4BOE A;  3STM X;  2IZK A;  4R0B A;  2JU8 A;  1RXH A;  4UU3 A;  4Z2V A;  1BEB A;  4AFK A;  4CDD A;  2RTN B;  1I78 A;  2M4L A;  4CK4 A;  4TKB A;  1EAL A;  2Y0H A;  3VZT X;  4YBP A;  3P6F A;  1SXW A;  4AZP A;  3KZA A;  1BJ7 A;  4DCB A;  1SWO A;  1ALB A;  4XMC A;  1EPB A;  4CPI A;  2IWV A;  1WBI A;  1LIC A;  1KGL A;  2K0L A;  1X8Q A;  5B2A O;  1AEL A;  1G85 A;  2IZC B;  1JQP A;  4FBO A;  3FEP A;  2RTB B;  1KT4 A;  3VHI A;  1Y52 X;  1KZW A;  1GT5 A;  1SY3 A;  2KTD A;  1VWE B;  3EW2 A;  2AXT O;  4YFP A;  3VGW A;  2G8C O;  3AKN A;  5LKE A;  1QWD A;  2MJI A;  3C77 X;  2Q4N A;  3F8A A;  3LK2 B;  4RUN A;  2OFA A;  3PP6 A;  2MM3 A;  3APX A;  1SWC A;  4E1S A;  2RCT A;  5AQ6 A;  1FEN A;  3EM0 A;  3PGS A;  1VWH B;  1SWE A;  1IFB A;  3APU A;  2WQ9 A;  3K3L A;  2F1C X;  4KT5 A;  2X55 A;  2XTQ A;  1SWG A;  3BSZ E;  2FT9 A;  3RKG A;  2KXP B;  3P6D A;  4GET A;  1ZNL A;  4PSQ A;  2FLJ A;  1TVQ A;  3RBY A;  5F2B A;  1VWL B;  1ZNG A;  4ALB A;  3BU1 A;  1DZJ A;  2NP1 A;  2J1N A;  1CBI A;  4ORU A;  1LPJ A;  4FUV A;  4ARH A;  1PRN A;  5L8N A;  3SZV A;  1MX8 A;  3DSZ A;  5G3A A;  2MHD A;  3G7X A;  2Y3F A;  1E2T A;  4IAX A;  1PHO A;  1SWA A;  1VYO A;  3PGU A;  2A5C A;  2WEX A;  3AA6 A;  3AA6 B;  1S2P A;  1FEL A;  2O62 A;  5HTE A;  4FT6 A;  4KC8 A;  1I06 A;  3O19 A;  4YVB A;  2CAM A;  3RDX A;  3EMM A;  3KFG A;  1STS B;  5LJC A;  1IFC A;  3FR5 A;  4FZL A;  5F7G A;  4FSO A;  2ZAI A;  4ZFX A;  5L8I A;  1AVE A;  1DZK A;  5AFU K;  5H8T A;  4AKR A;  4AKR B;  2LHF A;  1YIV A;  3SLJ A;  1MDC A;  1ZRY A;  5DL8 A;  3T20 A;  4TJZ A;  3F9D A;  2JMM A;  2QCB A;  1MOY A;  1ORM A;  4MEE A;  2XE5 A;  5HZ6 A;  4BX7 A;  4HPA A;  4YCH A;  3PPT A;  4A1Y A;  1U18 A;  1VWA B;  2FHL A;  4CPF A;  4ORS A;  3I17 A;  2NNE A;  4INN A;  2RCQ A;  1SWU A;  1AB0 A;  3T1D A;  1MPF A;  1X8P A;  4ZGU A;  2KD2 A;  4ZH9 A;  4JNJ A;  2F01 A;  4AZL A;  1NBX A;  1LNM A;  2MNH A;  4FGI B;  1VWF B;  3SZI A;  1RSU B;  3ZW0 A;  4PUX A;  1NQN A;  5KAF O;  3ZW0 B;  2ACO A;  2FRS A;  3EBK A;  2AMM X;  3HWF A;  3HW9 A;  4GGR A;  3ELZ A;  3IFB A;  1VWR B;  5HZ5 A;  2BSZ A;  4AW8 A;  5B29 A;  1RBP A;  2RTM A;  4BJ8 A;  2GTF X;  4TNN A;  4FOZ A;  3EC5 A;  4IBA A;  2KC0 A;  4K3B A; 
#chains in the Genus database with same CATH homology
 2Q39 A;  1OPB A;  1BM5 A;  3P6H A;  3U9P C;  1Y9T A;  4M7M A;  3STN A;  2LFU A;  1X71 A;  3OBL A;  3AA1 B;  5EDB A;  4ORX A;  4QZU A;  5BYP A;  5FEN A;  3UAQ A;  1QFV A;  1JZU A;  2Y0L A;  5DL7 A;  5ADX K;  3TGC A;  2YG2 A;  3CR6 A;  3C78 X;  2WUT A;  5HTD A;  3NSG A;  1I04 A;  5HA1 A;  3FEK A;  4Y0R A;  4MVI A;  3WJD A;  2AT5 X;  4QGW A;  3WXQ A;  1B0O A;  1JJJ A;  3VG4 A;  4YMY A;  3VZU X;  4O3Y A;  3TZS A;  5EDC A;  1N0S A;  1OBP A;  5IO7 A;  1HMT A;  4N58 A;  4IMN A;  4AZQ A;  4HWM A;  4ZHH A;  3MBT A;  4TKJ A;  2OMF A;  4QAE A;  2XE2 A;  4ON1 A;  4JFB A;  4AZO A;  1QJ8 A;  4ALO A;  3D4R A;  4ORW A;  3TGA A;  5LJB A;  4I3D A;  4GDZ A;  3NQ3 A;  2OVE A;  5BVT A;  2O4V A;  5F6Z A;  3L4R A;  2POR A;  5LJG A;  2L9C A;  3NAD A;  4LQZ A;  5FQ6 E;  3ZW1 B;  3FYF A;  3TGB A;  2N2L A;  4O9S A;  2XG6 A;  4WHI A;  1FDQ A;  1X89 A;  2AT8 X;  1QAB E;  3HOE A;  4ZH6 A;  3ZZV A;  2WQA E;  2YPV A;  3MX7 A;  3BDR A;  3ZWE A;  2LBA A;  4QYP A;  1H6S 1;  3AAA A;  3P6C A;  4LSH A;  1TW4 A;  2Z4H A;  1NGL A;  4BUM X;  5HZQ A;  2IFB A;  4XMG A;  1NP1 A;  1LIF A;  4MVL A;  2WR6 A;  5BVQ A;  4ZJ0 A;  1I05 A;  4EFG A;  4E1T A;  1IZN B;  5F1E A;  5GV0 A;  1JV4 A;  5D45 A;  1L6M A;  4FBR A;  4OS8 A;  4YDB A;  5LJH A;  3VG5 A;  2WSJ A;  1I4U A;  1EPA A;  2JU7 A;  4KCA A;  1KQW A;  4I95 A;  3POU A;  4KRA A;  2W2F A;  1S44 A;  3D95 A;  4NLJ A;  2R74 A;  1GFO A;  4RL9 A;  1LF7 A;  1NP4 A;  3VPJ E;  3POR A;  2M07 A;  3KFH A;  3NQ9 A;  5D47 A;  4AZR A;  4ZHC A;  1HXT A;  5EE2 A;  4XNK A;  3JSQ A;  1IIU A;  4QGV A;  5PRN A;  3B2J A;  4FUV A;  2PY1 A;  4IB6 A;  3S5V A;  4ZHD A;  4GF4 A;  3OD9 A;  1PMP A;  3B2H A;  4FQB B;  2BS6 A;  3SAO A;  1G90 A;  4D6B A;  2R73 A;  3QKG A;  2YNK A;  3B2L A;  2L67 A;  3RZY A;  2JMB A;  3BRN A;  4F4B A;  4IB8 A;  4MVK A;  1ICN A;  1A57 A;  2CM4 A;  2N2M A;  1HQP A;  3RSW A;  1EII A;  3BY0 A;  2KTS A;  1EIO A;  4XMF A;  1OEJ A;  1ZHZ A;  3EMN X;  5DL6 A;  2K62 A;  5HZ8 A;  3HTY A;  4RLB A;  4QNI A;  4AYE C;  2A2G A;  4K19 A;  4JGL A;  4ZCB A;  4A1H A;  4QZT A;  1SY1 A;  4A60 A;  4MIS A;  1QJ9 A;  3NQK A;  3AA7 A;  1DZM A;  3NPO A;  3O22 A;  4AZM A;  1GX9 A;  2NNQ A;  4O3W A;  2M06 A;  3LHN A;  5EZ2 A;  4ID2 A;  1GFP A;  4GK9 A;  2RD7 C;  1TXL A;  1PM1 X;  3NP1 A;  3QRC A;  4XMD A;  1B4M A;  1IW2 A;  4N59 A;  4QRL A;  3SZD A;  4AYM C;  1X8O A;  2XMX A;  4ORR A;  2KZ7 A;  1JYD A;  4HPB A;  2QO4 A;  3DTQ A;  5CE4 A;  4HFO A;  4U8U N;  3JTY A;  1EXS A;  1ZHT A;  1VYF A;  3AA0 A;  3AAE B;  1PBO A;  4O49 A;  2P8G A;  5HCD C;  3FMZ A;  2GTL M;  2F73 A;  3O0E A;  4ZHG A;  1KZX A;  3WOV A;  3LV4 A;  1VYG A;  3HWG A;  3EYC A;  2LB6 A;  2WWP A;  1BRQ A;  2A2U A;  2FGR A;  2AKQ A;  5JDP A;  4IAW A;  3UPG A;  3CWK A;  5AFU L;  3WI4 A;  1MM4 A;  3WJG A;  3B2K A;  4LSF A;  1SXU A;  2CBR A;  2CZT A;  1O8V A;  1P6P A;  3FR4 A;  3GAQ A;  3IA8 A;  5EEE A;  1ADL A;  1OSM A;  2X27 X;  1TOW A;  2XE3 A;  1T8V A;  2MWH A;  4FZM A;  1A2D A;  4XMH A;  4ODD A;  4MIR A;  1QQS A;  3VZW X;  1TOU A;  3A2S X;  2K23 A;  1GXA A;  4GCQ A;  2WEW A;  5H9A A;  1G5W A;  2Q2M A;  3I0A A;  2QO6 A;  2W2A A;  4OMX A;  6PRN A;  3AA1 A;  2F09 A;  4AYN A;  1ZNE A;  2ZAG A;  4ZR2 A;  3P24 A;  2ERV A;  2HNX A;  2X45 A;  5AJB A;  1DF3 A;  4FSP A;  2J4U P;  4GKC A;  5D4A A;  1FTP A;  4LZV A;  4BOE A;  1H91 A;  1RLB E;  1THQ A;  2R56 A;  3STM X;  4R0B A;  1HXU A;  1P4T A;  2JU8 A;  1IKE A;  4UU3 A;  2N93 A;  4YKO A;  3S26 A;  3ZW2 A;  1BEB A;  4AFK A;  4A8Z A;  3O2Y A;  1CBR A;  2M4L A;  4LZU A;  3VE2 A;  1BRP A;  3CBC A;  4CK4 A;  4TKB A;  1EAL A;  4FRT A;  2FS6 A;  3FA9 A;  4U9C A;  3VG7 A;  1EW3 A;  1FEM A;  2Y0H A;  1E5P A;  1SMP I;  4GH7 A;  3VZT X;  4YBP A;  1Z24 A;  3NBX X;  4I6S A;  1LIE A;  3P6F A;  1SXW A;  4OMW A;  4AZP A;  4NYR A;  4U3Q A;  3KZA A;  3V8U A;  1YWB A;  3ZW1 A;  2POA A;  1BBP A;  1BJ7 A;  1JBH A;  2QM9 A;  1ALB A;  4XMC A;  1EPB A;  4XNL A;  1OPA A;  3ELX A;  5LKF A;  5KHP A;  2XST A;  1KT6 A;  2KDY A;  2XKL A;  2DM5 A;  3B2I A;  3DA4 A;  4C69 X;  1JIW I;  3TZG A;  4WBK A;  3POQ A;  1LIC A;  4ZGF A;  1KGL A;  2XE1 A;  1OEE A;  3HK1 A;  2K0L A;  3JQO A;  1X8Q A;  2PRN A;  1SY2 A;  1T0V A;  2GC9 A;  4YFQ A;  5BVS A;  5C0N A;  1IZN A;  1DV9 A;  4LSE A;  1B8E A;  1SXX A;  5JR8 A;  4Y0S A;  1AEL A;  3VU1 A;  2Y2X A;  1G85 A;  3ZUO A;  3FYX A;  3KFI A;  1GGL A;  1DZP A;  4NNS A;  2Q2P A;  3BU9 A;  2HYS A;  5LJD A;  4YGZ A;  3OE3 A;  2Y0K A;  4FBO A;  3PEC A;  5DPQ A;  2LA7 A;  4RJX A;  3FEP A;  4TKH A;  1KT4 A;  4UU2 A;  3FLL A;  4BQU A;  1HN2 A;  4NW4 A;  4YGH A;  2BS5 A;  1KZW A;  4G75 A;  2NND A;  3KQ0 A;  3UEX A;  1GKA A;  4EQA C;  1GT5 A;  1SY3 A;  1GKA B;  5HA0 A;  1SY0 A;  2KTD A;  3S5X A;  1E00 A;  3G7G A;  1ERB A;  3FR2 A;  4WFV A;  5DL5 A;  4YFP A;  1S7D A;  3DA3 A;  2CM9 A;  3AKN A;  2RQ0 A;  1GT4 A;  1BSO A;  1T68 X;  1QWD A;  3EBW A;  4L1N A;  5LKE A;  2MJI A;  3C77 X;  2Q4N A;  3PQS A;  3P6E A;  3F8A A;  3NR3 A;  3LK2 B;  1MX7 A;  4RUN A;  3UU2 A;  3T24 A;  3PP6 A;  3D96 A;  2MM3 A;  3APX A;  2A13 A;  4E1S A;  1ERX A;  2KW1 A;  2FGQ X;  1X8U A;  2HZQ A;  4CSB A;  2RCT A;  2FR3 A;  4NLI A;  5AQ6 A;  1O1U A;  3PED A;  1FEN A;  4EXZ A;  1KXO A;  3EM0 A;  1BXW A;  5ADX L;  1A18 A;  3S60 A;  1Q9G A;  2AT6 X;  2JN3 A;  4HPC A;  5H9N A;  4GU8 A;  4QQ1 A;  1YP6 A;  1IFB A;  1QY0 A;  2RA6 A;  4LKT A;  1X8N A;  3APU A;  2LBV A;  3STK A;  1OPF A;  2WQ9 A;  3NX1 A;  3K3L A;  5T5F A;  4KT5 A;  2ALL X;  2XTQ A;  1R0U A;  1URE A;  1E02 A;  3WBG A;  3UEW A;  4AZN A;  4O4X A;  3BLG A;  3BSZ E;  3BS2 A;  2FT9 A;  3AAE A;  3VG6 A;  2CZU A;  3PQU A;  3RKG A;  3UEU A;  2KXP B;  5D8J A;  3QRA A;  4I3B A;  3P6D A;  2QTK A;  4GET A;  4D5U A;  3VG3 A;  3BX7 A;  1ZNL A;  4GCS A;  4PSQ A;  2X46 A;  2FLJ A;  2HZR A;  2YMS A;  4L3R A;  2L5P A;  3SY7 A;  1TVQ A;  4OS3 A;  4ZHF A;  1YP7 A;  4YKM A;  3RBY A;  3RBH A;  1HMS A;  2X8S A;  3HWE A;  4FMS A;  3LK4 1;  1ZNG A;  4HPD A;  4TLJ A;  1LIB A;  1GFQ A;  4KII A;  1QJP A;  4GE1 A;  4ALB A;  2ZLD A;  4B61 A;  3BU1 A;  1DZJ A;  4OS0 A;  2GE4 A;  4RJW A;  1ML7 A;  2OVS A;  4U8U O;  2NP1 A;  2GTL N;  3PH5 A;  1CBI A;  2CBS A;  5EED A;  2J1N A;  1SXY A;  1U17 A;  4ORU A;  1LPJ A;  2QMI A;  4EEJ A;  1HMR A;  5K06 A;  5D48 A;  1CJ5 A;  4ML7 B;  4ARH A;  4I9S A;  5IO6 A;  1GFM A;  2Y7S A;  5HWZ A;  1OBQ A;  3VG2 A;  1PRN A;  5FVN A;  2G78 A;  1QFT A;  2AL0 X;  2Q9S A;  5L8N A;  1ZHX A;  4FRX A;  3SZV A;  4O4S A;  4AYH A;  4JCH A;  1OBU A;  2W81 C;  4Y0Q A;  1MX8 A;  1GX8 A;  3DSZ A;  4DQ4 A;  5F6B A;  2MHD A;  1GFN A;  4NYQ A;  5KIC A;  1BH3 A;  3TF6 A;  2G7B A;  1HXX A;  1BT9 A;  1SA8 A;  3G7X A;  1UZ2 X;  1OEK A;  2FTB A;  4IAX A;  4Y0P A;  1PHO A;  3E3C A;  4O4U A;  3HOL A;  5B27 A;  3PH6 A;  2JW1 A;  2WEX A;  1HBQ A;  2FR2 A;  5IO5 A;  3AA6 A;  4GCP A;  5H9L A;  1U0X A;  3FEL A;  2ZFG A;  1ZHY A;  3AA6 B;  1S2P A;  3APW A;  4ORY A;  4IMO A;  4XME A;  3P02 A;  3VY8 X;  1FEL A;  1CRB A;  2O62 A;  4LKP A;  1IKJ A;  5HTE A;  4FT6 A;  4KC8 A;  1YWD A;  1I06 A;  3O19 A;  1MUP A;  3PRN A;  2A3F X;  3P6G A;  1E54 A;  3EMM A;  2JU3 A;  4GHB A;  2G79 A;  2X8T A;  1LFO A;  2FS7 A;  3FW5 A;  3KFG A;  5AJC A;  3F6Z B;  1HBP A;  2LKK A;  3FA6 A;  3ZUI A;  4O3X B;  2HLV A;  5LJC A;  3KVD D;  1IFC A;  4TQ2 A;  2AT3 X;  5HCC C;  3UEV A;  1BWY A;  3POX A;  2AT0 X;  3FR5 A;  1BSQ A;  1O1V A;  3FA8 A;  3MVF A;  4O4O A;  5LJE A;  2F1T A;  2OFM X;  4G76 A;  1ZNH A;  2OZQ A;  4YCE A;  2QO5 A;  3CQN A;  3K19 A;  1VPR A;  3U0D A;  4FZL A;  3VY9 X;  1XKI A;  4AYD C;  5F7G A;  3FIQ A;  4FSO A;  2ZAI A;  3CQR A;  2ANS A;  5FQ8 E;  4ZFX A;  3OJY C;  1KT7 A;  5AEO A;  5DG4 A;  4ES7 A;  5L8I A;  1DZK A;  2LFO A;  4O3Z A;  5AFU K;  4KH8 A;  1ACD A;  3AA0 B;  1A3Y A;  3HWD A;  1CBQ A;  1PEE A;  5H8T A;  4AKR A;  2A0A A;  5FAZ A;  1ZND A;  4AKR B;  2LHF A;  1YIV A;  1G74 A;  1DFV A;  4YFR A;  1MDC A;  2OVD A;  1ZRY A;  3AKM A;  3Q6L A;  1QG5 A;  3AAA B;  5DL8 A;  3T20 A;  4FES A;  5LJK A;  3FW4 A;  1GT3 A;  4TJZ A;  3F9D A;  1ICM A;  1KT5 A;  3WJF A;  3CBS A;  1GM6 A;  3H3I A;  2BLG A;  2JMM A;  3GE2 A;  1B56 A;  5FFH A;  4LSI A;  1AVG I;  1YWC A;  1ZNK A;  1LID A;  4N7D A;  4RUU A;  1YS5 A;  2W2B A;  1ORM A;  4YH0 A;  3LK2 A;  1YUP A;  3SOT A;  1JYJ A;  3CMP A;  2XE5 A;  3BX8 A;  2QOS C;  4QYN A;  1MVG A;  5HCE C;  2OFR X;  5HZ6 A;  1ZHW A;  4GRJ A;  4HPA A;  4GNW A;  4YCH A;  3WJC A;  4EDE A;  3D97 A;  3PPT A;  2ODJ A;  4A1Y A;  4KR8 A;  4DQ3 A;  2Z4I A;  1U18 A;  1Q9F A;  4D64 A;  1LKE A;  2KT4 B;  3ZI8 A;  2ASN X;  5CYB A;  5D5D A;  1JJX A;  5HZ9 A;  5H9K A;  5HAE A;  1BSY A;  3N91 A;  1XCA A;  4I3C A;  4ORS A;  3KFF A;  2FWV A;  1QY1 A;  4KC7 A;  3I17 A;  4M6S A;  3LK4 2;  4I9R A;  2NNE A;  4YBU A;  4INN A;  1MM5 A;  2RCQ A;  4IB9 A;  3WJB A;  4KR4 A;  1AB0 A;  3T1D A;  5F58 A;  1MPF A;  1Y9L A;  2BHV A;  4NP1 A;  4AUI A;  2RN4 A;  3FA7 A;  1X8P A;  2KXP A;  7PRN A;  3WVM A;  4D65 A;  1FE3 A;  3RWX A;  4U8U M;  1QY2 A;  4ZGU A;  2KD2 A;  3SYS A;  4ZH9 A;  2JOZ A;  2MO5 A;  3AA7 B;  1CBS A;  2ACP X;  3LK3 A;  3LK3 B;  8PRN A;  4AZL A;  4D6A A;  1EUO A;  4AKM A;  1KQX A;  2GJ5 A;  1LNM A;  5G26 A;  4IAB A;  2XTR A;  2MNH A;  2OVA A;  2L68 A;  3C76 X;  3GP6 A;  5HBS A;  4FGI B;  4QGX A;  4WFU A;  4FBV A;  3WJE A;  4MVE A;  4RLC A;  1D2U A;  1BLR A;  3T0S A;  3C5O A;  2BT9 A;  3ZW0 A;  2KZ7 B;  4PUX A;  1GT1 A;  2EU7 X;  3NX2 A;  3ZW0 B;  2ACO A;  1AQB A;  1YWA A;  4IB7 A;  3VE1 A;  3ZQ3 A;  2FRS A;  1E06 A;  3EBK A;  2AMM X;  1DC9 A;  3FEN A;  4FZN A;  4GZV A;  1KT3 A;  3HWF A;  3SYB A;  4COT A;  3HW9 A;  5EPQ A;  4AYI D;  3JS1 A;  4NNT A;  5L8O A;  4Z3T A;  5KID A;  2E4J A;  3APV A;  3HWB A;  1G7N A;  3ELZ A;  3IFB A;  5HZ5 A;  4AW8 A;  5IYU A;  4YDA A;  2F1V A;  5FQ7 E;  4PJ2 A;  2AH7 X;  5B29 A;  3U03 A;  1RBP A;  3SY9 A;  2HMB A;  1EI5 A;  4BVM A;  2GTF X;  4TNN A;  4N7C A;  4YGG A;  1D3S A;  1KOI A;  2K4T A;  2MHL A;  1EQD A;  4IBA A;  4FOZ A;  4GNY A;  2KC0 A;  4CV7 A;  2X8F A;  2W80 C;  2GTL O;  3WI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...