3HOEA

Crystal structure of surface lipoprotein
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
242
structure length
242
Chain Sequence
EPALGYVVKVPVSSFENKKVDISDIEVITNGNLDDVPYKANSSKYNYPDIKTKDSSLQYVRSGYVIDGEHSGSNEKGYVYYKGNSPAKELPVNQLLTYTGSWDFTSNANLNNEEGRPNYLNDDYYTKFIGKRVGLVSGDAKPAKHKYTSQFEVDFATKKMTGKLSDKEKTIYTVNADIRGNRFTGAATASDKNKGKGESYNFFSADSQSLEGGFYGPKAEEMAGKFVANDKSLFAVFSAKHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the bacterial transferrin receptor: the structure of transferrin-binding protein B from Actinobacillus pleuropneumoniae.
pubmed doi rcsb
source organism Actinobacillus pleuropneumoniae
molecule tags Transport protein
molecule keywords TbpB
total genus 61
structure length 242
sequence length 242
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 3hoeA01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 3hoeA02
4QQ1A 4O4XA 2KDYA 3UAQA 2LFUA 3PQSA 3HOLA 4O3YA 2W81C 4Z3TA 4O49A 4AYNA 2W80C 4AYDC 3V8UA 2Y7SA 4AYEC 4O4UA 3KVDD 3HOEA 4U9CA 4O3WA 4O3XB 2YPVA 2KC0A 3VE1A 5EE2A 1YS5A 4AYID 4O3ZA 4AYMC 3VE2A 3PQUA 5T5FA
chains in the Genus database with same CATH superfamily
1QABE 2BHVA 1VWAB 1HXLA 1SWLA 3WJFA 2MJIA 3WZOA 2FS7A 1Y53X 3IFBA 4BGFA 1ZNDA 1E54A 1IZNB 2IZFB 4ORSA 2A3FX 2RTGB 1CBRA 3D97A 4YGZA 3UEUA 3ZW2A 5F6BA 1T16A 1SXUA 2X55A 1GT4A 2MM3A 5D4AA 1GFOA 3U9PC 3VG3A 4LKTA 2CAMA 2XTRA 4GU8A 3RWXA 5IO5A 3O22A 2Z4HA 3VE1A 4CDCA 4TLJA 2G7BA 1O1VA 1E02A 1D3SA 3FEPA 4LZUA 1SWBA 1ICMA 3GAQA 2YPVA 2N93A 2NNEA 2F1TA 1YWDA 3FYXA 1SMPI 4GETA 3CKFA 3D96A 3EM0A 1ORMA 1EI5A 2A8GA 1U17A 1OBPA 1U0XA 4ZGFA 2FKJA 3ELZA 5GTIO 3FA6A 1ZNKA 2OF8A 1SWSA 1OEKA 1HXZA 5AQ6A 1FELA 1JJUA 3UEWA 1LCWA 3VHIA 1KGLA 5LKEA 3LK2B 1B4MA 4RLBA 2OVAA 4ZGUA 3FR5A 2A5CA 2JMMA 3PPTA 1VWMB 4NNSA 5K68A 1FEMA 1D2UA 2WJRA 1DZPA 3KVDD 4Z2VA 1SWKA 1KOIA 5CHKA 3P6FA 4QQ1A 1G74A 1RLBE 5IXGA 3PECA 3ZW1A 3KFGA 3RDSA 4C69X 4Z28A 2XKLA 3ZWEA 1GM6A 5PRNA 2OY1O 4CV7A 4GH7A 3UEVA 4WFUA 5HZ6A 2RQ0A 3T1DA 3ZQ3A 1X8OA 2K0LA 3P6GA 2IZEB 3EMNX 1TOWA 1ALBA 3SY7A 2X8FA 2X56A 1NQNA 3DTQA 4XNKA 4I6SA 4BX7B 1FTPA 4KH8A 1BT9A 1BBPA 3VE2A 1MVGA 5EDCA 4M7MA 3JQOA 2A2UA 1U18A 3RZYA 2L9CA 2HYSA 2G78A 2AT0X 2RCQA 1BWYA 3FENA 3BX7A 1P4TA 2RA6A 3NR3A 2QO5A 3RDUA 2O4VA 4CPHA 3Q34A 4K19A 2BS6A 3AAEA 2FKGA 1XCAA 2N2MA 3CKGA 3CQNA 4I9RA 2RCTA 3AAAA 2KZ7B 1SRJA 3T2XA 1KZXA 1E00A 1Q9FA 3FW5A 3RY1A 1SWOA 1W6FA 2ZLDA 1G90A 2M06A 4N75A 2W2AA 2QOSC 3TZSA 4BX6A 2DJFA 1HXXA 1SRIA 4Y5DA 3U0DA 3DA3A 1QY1A 1SRGA 4IB7A 4O3XB 3BS0A 2OY5O 4YKMA 2OL8O 4FBRA 1NC9A 3KFFA 1SWGA 5JR8A 1VPRA 5EEDA 3SY9A 1PEEA 4O9SA 1SRHA 1CBIA 1PM1X 2KDYA 2W2BA 3VG7A 3LK42 4TJZA 1S7DA 4D64A 3S5XA 1PHOA 3MG5A 3EW2A 1BXWA 2OMFA 3OBLA 1LPJA 4YFPA 3HWGA 1LUQA 2MHDA 3POQA 1FJ1E 4ZHFA 1WUBA 4GGZA 1TXLA 1GX8A 1G5WA 4AYID 4PUXA 5DG4A 3WZPA 3RBYA 3VG2A 1IW2A 3WBGA 3AA1B 3CWKA 2RTDB 5FVNA 5HA1A 4ORRA 1HQQA 1MOYA 4GNYA 4Y0RA 4BUMX 1MM5A 5ADXL 2JGSA 1SY1A 1Q9GA 1CBSA 1STSB 4D6AA 1T0VA 2JMBA 5H2FO 3JS1A 4MVKA 1STRB 3FMZA 4XMFA 4ES7A 1VWEB 2R74A 5HCCC 1DZMA 1OSPO 1VWLB 1KQXA 2X32A 3VU1A 5F58A 1H91A 4WFVA 1KZWA 2ALLX 5D8JA 2IWWA 1NP4A 1E06A 1ZNLA 1BEBA 1SXYA 1DV9A 3P6CA 1MPFA 2KZ7A 1B8EA 5DL5A 4O3YA 2XE2A 1I04A 4IB6A 3NX2A 4YMYA 1KFFA 1GX3A 3HOEA 2X46A 3T2WA 4IMNA 4GE1A 4LSHA 2A5BA 1IJ8A 4YDAA 5B11O 3AAEB 2BC3A 2GE4A 3ZUIA 4INNA 2L5PA 4GCQA 1QFTA 5KHPA 3AA1A 3AKNA 4KCAA 3WOVA 4COTA 6PRNA 1ZNHA 2AT8X 2RTQB 1BRQA 3EW1A 1HN2A 4ZR2A 4BCSA 2IZJA 1VYOA 2FT9A 2RTEB 2RTOB 4QGVA 1IZNA 3WJCA 3A0HO 2G79A 4YFRA 2HMBA 2Z4IA 2ERVA 4A1HA 1I78A 2Y0LA 2RTBB 1IFCA 1HMTA 2I5VO 4YGGA 3EYCA 3AUMO 3O0EA 4PJ0O 5JDPA 3P6HA 4AZOA 4ZHGA 4NLIA 1MM4A 2WQ9A 4JO6A 1OBQA 2N2LA 3D9WA 4XMGA 1DC9A 1FDQA 1A2DA 3NADA 3KFHA 3NQ9A 3HWEA 1Y55X 3G7XA 4GGRA 3FIDA 4MIRA 5FENA 5LJKA 1SRFA 1SWEA 2KXPB 1X8QA 2FHNX 1AB0A 5G39A 1W5RA 2R88A 3AA7A 2P8GA 4AYNA 2CM9A 3PDFA 2PORA 3VG6A 3D4RA 4BJ8A 4N7DA 4AW8A 2OFMX 3T6LA 2BSZA 2G5LA 2F09A 2LFUA 2HZRA 1S2PA 4U8UM 3Q6LA 3LTWA 3S60A 1N9YA 4YGHA 3HWBA 4C4VA 1TOUA 3DWOX 4AZRA 1QJPA 2AVIA 4L1NA 2ZSCA 3BU9A 3H3IA 4G76A 2QCBA 2ZFGA 1QQSA 2ZAGA 4MISA 1LKEA 1RXHA 3WI4A 2WJQA 5HTEA 5LJGA 1Z24A 3FEKA 4OELA 4JHQA 3BY0A 2IZAA 5HZQA 4TKJA 4BX6B 1KL5A 1OBUA 4OS0A 4QGWA 3T0SA 4FSPA 4PSQA 5LJHA 1X8PA 1ADLA 3B2HA 5KIDA 3SZVA 4NV7A 5H8TA 1OEEA 3T20A 1NDJA 3UPGA 3BRZA 1A18A 2UYWA 1HBQA 1EIOA 3D95A 2K62A 1BH3A 2I5ZO 5KICA 1ICNA 4ZCBA 3STMX 1T68X 3P02A 1VWGB 4U9CA 3OE3A 3HPEA 2R4OA 4MVLA 1SLEB 2O62A 4RL9A 4K3BA 2KT4B 1EIIA 2LA7A 3C5OA 1G7NA 1SWDA 2HLVA 4GCPA 4HPCA 4AYHA 4ZHCA 3POXA 4AZLA 3VZTX 2X34A 4IBAA 1LDQA 3G7GA 1CBQA 5AFUK 3WJGA 1BM5A 3FA9A 4BX5B 4OMWA 4Z27A 1YIVA 2OFAA 3SZHA 5ADXK 4FZNA 1VWJB 3E3CA 5AFUL 5D45A 2AT5X 3HWDA 4FZLA 2Y32A 3BLGA 1PMPA 3RKGA 3F8AA 3SAOA 4EQAC 1S44A 2CZTA 1KL4A 1EALA 3CR6A 3PH6A 2CM4A 1MDCA 1OEJA 5TISO 5G38A 1NGLA 5IO7A 1ZHYA 3ZUOA 2WEWA 4LSFA 1KT7A 5DPQA 4ORWA 3VHMA 3AA0A 1GGLA 1NBXA 4ORYA 3RY2A 3ELXA 3TZGA 1LIDA 3FLLA 3HWFA 2OVEA 2OYBO 4KC8A 2RTNB 1XKIA 4HPBA 5FQ6E 4YDBA 4TNNA 1A57A 4O4XA 2FLJA 1KT4A 2WVPA 4A8ZA 2AT3X 3BU1A 4QYNA 1HXTA 4ZH9A 3HOLA 1Y52X 4U8UN 2AMMX 4JFBA 1YP6A 3NP1A 3VZUX 4D5UA 3RE5A 4HWMA 3NQ3A 1E5PA 3X00A 5AEOA 2RTFB 4RUNA 4L3RA 1VWDB 1X8NA 4DQ3A 2R89A 4Z6JA 1QJ9A 3AA6B 1VYGA 2JW1A 3NQKA 1N43A 2JU7A 5FQ7E 3I0AA 3TGBA 2WUTA 1SWNA 4AZMA 4Z2PA 2IFBA 5H9LA 4IRWA 2RN4A 2MNHA 5EDBA 1T8VA 2AH7X 1QY2A 4FSOA 2PI3O 2IZBA 4DQ4A 2Y0KA 4PR7A 2FTBA 1QWDA 1SWRA 4BX7A 4JCHA 1SWPA 5EPQA 5LJEA 2AL0X 1MM9A 5BVSA 2MF6A 3MX7A 1TVQA 2E4JA 1BLRA 4GD9A 2NP1A 2FWVA 5L8OA 1VWCB 5HTDA 4GK9A 1KT3A 4ON1A 3FA7A 1ML7A 1TW4A 4O3ZA 1GX9A 1LF7A 3WZNA 4XNLA 4FQBB 4KIIA 3QKGA 1VYFA 1MX8A 4EFGA 4FBVA 4A60A 2ASNX 4FT6A 4KC7A 4B55A 1KT5A 1SWQA 2GH7A 2QO4A 2KW1A 3O2YA 1T1LA 2C1SA 1RXKA 3B2KA 4I3CA 2QM9A 4OKAA 3EBWA 1LICA 5BYPA 3APVA 4O3WA 4ALOA 3BDRA 1EPAA 2OVDA 4QZTA 4MEEA 2X9KA 3SLTA 3MVFA 1CRBA 3WI5A 4QNIA 4GJSA 2AT6X 4KT5A 4YKOA 3TF6A 2KTDA 2FHLA 4ML7B 4IAWA 3NJTA 4NV8A 2OFRX 3RDOA 1Y0GA 2K23A 3RBHA 5B2AO 4TQ2A 2JOZA 3PP6A 1IKEA 5LJBA 1MX7A 1OPAA 1KL3A 2WWPA 4BOEA 3VY9X 1EXSA 3PRNA 5CYBA 1S5LO 4AFKA 4HFOA 3B2LA 1MK5A 2R4NA 1GFPA 2OL7A 5D5DA 4FQEA 3APXA 4DCBA 1JMXA 1HY2A 2Q2PA 2ODJA 5K06A 3NBXX 1VWHB 4AUIA 2MHLA 2VDFA 2X4MA 1VWBB 4MVEA 7PRNA 1LCZA 3VG5A 4CPIA 5B3MO 1JQPA 3C78X 2XTQA 4QAEA 5LKFA 4IAXA 3ZI8A 3FW4A 1JYDA 3T6FA 4ZH6A 4UB6O 2RTCB 4OMXA 1I9HA 3AKMA 4ODDA 4IMOA 1N0SA 3PGRA 1JBHA 1LDOA 2XSTA 1K24A 1SXXA 1GFMA 3WYQA 2Q9SA 4CDDA 1AVDA 4CPHB 3RDQA 4WBKA 4AZNA 3TGAA 1X89A 2OL6O 1L6MA 1YUPA 1SWFA 4GJVA 2GC9A 4NW4A 5F7GA 4FMSA 4LSEA 1HMSA 4D65A 1DFVA 3TGCA 1JIWI 1YP7A 4C5PA 4AKRB 3K19A 5B10O 2W2FA 2EU7X 1QY0A 1ZHXA 5T5FA 3PEDA 2XE1A 4TKBA 1YWCA 1ACDA 2OF9A 1UYNX 2Y3EA 1BRPA 2L67A 4I95A 3QRAA 3VY8X 3KVNA 4KRAA 1CJ5A 1W4TA 4ZFXA 4AKRA 2X45A 1O1UA 3JTYA 4U8UO 1JYJA 3EC5A 2F01A 3KZIO 3VPJE 5B66O 1Y9LA 4E1SA 1GFNA 2POAA 4R0BA 3L4RA 5AJBA 1JJJA 2Y2XA 2FGRA 1LIEA 1PBYA 1B0OA 1SREA 4LZVA 3EBKA 2RTAA 2Q4NA 2JN3A 1LNMA 3ZW0B 4ID2A 1I4UA 2OY7A 2FGQX 5HZ5A 1HMRA 5HA0A 4K3CA 5HZ8A 3SYSA 4IL6O 3UAQA 1X8UA 4LSIA 5DL8A 2WR6A 3RDXA 2XG6A 3SZDA 2C1QA 2IZGB 2A0AA 3AEHA 4D6BA 2KTSA 4O4UA 3NX1A 5BVQA 4CDFA 4UU2A 5CE4A 5CSEA 3A2SX 3K3LA 4JGLA 3WZQA 1ERXA 1SA8A 4QRLA 1X71A 2CBSA 4EEJA 4KR8A 1GT1A 1SXWA 2JU3A 3LK3A 1VWPB 3LK41 5D48A 3APWA 4AYEC 1EPBA 4NP1A 3UEXA 4UU3A 1RXJA 2IZKA 5HBSA 1ZHWA 5D47A 4RJWA 3POUA 5IRUA 2AXTO 4NYQA 5C0NA 5IRWA 5KAFO 5G3AA 1LCVA 4ZHHA 4TKHA 4YBUA 3NSGA 4G75A 4ARHA 1ZHTA 3QRCA 4FBOA 4ORXA 3DSZA 1H6S1 4RUUA 4GKCA 3N91A 5BVTA 1SLDB 1PTSA 2LFOA 1ZNGA 5F1EA 1FENA 3HTYA 5FQ8E 4NYRA 1SWTA 2NNDA 1KT6A 1JJXA 1ERBA 3PF1A 1SWCA 3B2JA 2XE3A 1VWFB 2CBRA 4HPDA 2RTIB 4HPAA 5JD2A 1K3BA 4AYDC 3AA6A 4LQZA 4PJ2A 2QTKA 3FR2A 1ZNEA 4ALBA 2AF5A 1YS5A 1SLFB 1AELA 1GT3A 2R56A 1SLGB 3CQRA 1RAVA 3DA4A 1GXAA 4QGXA 4N7CA 3PQSA 1IIUA 2L68A 2HKDA 2RTHB 1VWNB 2IZDB 2W81C 4GZVA 1SY0A 5AJCA 2YMSA 5LJCA 2WPUA 4Y0SA 4NLJA 5FAZA 2A13A 2FRSA 1JZUA 2FGSA 2WEXA 4QYPA 4GUZA 2MWHA 3FIQA 2R4PA 3LK3B 2X8TA 3KFIA 1STPA 3RDMA 1EW3A 3PK2A 4YFQA 2HNXA 1AVGI 2NNQA 1NP1A 2RTRB 2J1NA 3NPOA 1HBPA 3VG4A 1DZJA 3VZWX 2IZLB 3SOTA 4CPFA 1KQWA 5GTHO 1HXUA 1Y9TA 2WSJA 3STNA 1VWKB 4GCSA 5EZ2A 2LHFA 4O49A 4I3BA 4MVIA 5L3YA 3PGUA 2OVSA 3LV4A 5F6ZA 2GJ5A 5DL7A 4LKPA 3LHNA 1PRNA 3F6ZB 5HCDC 2PY1A 2BT9A 4E1TA 1BSQA 2RTPB 2IZHB 1IKJA 1QG5A 4IB9A 2KXPA 1EQDA 1AVEA 2LBAA 2ACPX 3T24A 2RD7C 1DF3A 1SY2A 1YWBA 4EDEA 3LK2A 4Y59A 3SZIA 3JSQA 3DWNA 5LJDA 4Z2OA 3AAAB 2BLGA 3PORA 2KD2A 2YG2A 1RSTB 3WJDA 5HAEA 3PH5A 3V8UA 3VHHA 3BSZE 3MBTA 2XE5A 1OSMA 3WXQA 1DZKA 3BX8A 3PQUA 1THQA 3AA0B 3P6DA 4JNJA 1LIBA 3ZZVA 5EEEA 3U03A 2M07A 1RSUB 4GRJA 1SWHA 3OJYC 2FR3A 3HK1A 3KQ0A 5FFHA 3I17A 4O4OA 2F73A 2R73A 5E79O 3WYPA 2FS6A 3S5VA 2R4LA 3BRNA 5IYUA 1A3YA 2DJGA 4ORUA 2GTLM 2Y0HA 1QFVA 4ZHDA 3P24A 3FA8A 3OD9A 3CBSA 4N59A 1G85A 3ZW0A 2RTMA 4YH0A 4FUVA 2C4IA 4UB8O 5K67A 3DZMA 1DF8A 1N4JA 2IZIA 3WJEA 2VFBA 2GTLN 4YVBA 3SLOA 1BJ7A 4FRTA 3VGWA 4CPEA 1BSOA 1SWJA 2ACOA 4BX5A 1SWAA 2UZ2A 3RSWA 5DL6A 1LELA 4QZUA 1KXOA 1NQMA 2GTLO 3IA8A 2RTKA 3PGSA 4N58A 2PRNA 4RJXA 1GT5A 2G8CO 1HQPA 1O8VA 1QJ8A 2ZAIA 2JQYA 3AA7B 4I3DA 1SWUA 4CK4A 2HZQA 3APUA 2AKQA 4FESA 1ZHZA 2KC0A 1E2TA 2M4LA 1PBOA 3UU2A 4IB8A 1N7YA 1EUOA 3GP6A 4EXZA 4XMDA 5B27A 2ANSA 4GF4A 2XMXA 4AZPA 2K4TA 3MM0A 4OEMA 2IZCB 3SYBA 2LBVA 5B29A 2LKKA 3O19A 2QMIA 1I05A 5H9NA 4DNEA 1GKAA 1N9MA 2JU8A 2A2GA 3C76X 4GGTA 4BVMA 4B61A 2OFBA 3CBCA 3EMMA 5HCEC 1B56A 4M6SA 4OS3A 3CMPA 1JMZA 2OZQA 4FZMA 8PRNA 2R8AA 3ZW1B 4GHBA 4FRXA 3B2IA 2F1CX 2X8SA 3F9DA 5L8IA 3RE6A 1VWIB 4F4BA 3FDCA 3HW9A 4N74A 2QO6A 1LFOA 4YBPA 5B5FA 3FYFA 2W80C 3JCUO 3STKA 4U46A 4YCEA 4I9SA 4NNTA 2FR2A 5B5EO 4XMHA 3WJBA 4OS8A 4U3QA 3FELA 2Q2MA 4C00A 4BBOA 3WU2O 4RLCA 2MO5A 1I06A 1WBIA 2DM5A 2X27X 1RBPA 3FR4A 1UZ2X 5HZ9A 1UREA 4IABA 4O4SA 4XMCA 1R0UA 1OPFA 3SZJA 3A0BO 3GE2A 2Q39A 4I60A 5IO6A 5KAIO 4XMEA 5H9KA 1AQBA 4FOZA 2RTJA 4ZJ0A 4A1YA 3C77X 4Y0QA 4C4VB 3KZAA 1VWQB 1ZRYA 4AKMA 5L8NA 3QQ2A 2WQAE 3BRYA 4KR4A 5EE2A 1GKAB 2J4UP 5F2BA 2Y3FA 1MUPA 4GNWA 1SY3A 2BS5A 5G26A 1FE3A 3P6EA 5GV0A 2QOMA 2YNKA 4GDAA 2VFCA 5HWZA 2LB6A 5IRAA 2GTFX 4Y0PA 2F1VA 1MEPA 1BSYA 1YWAA 1LIFA 4WHIA 1GFQA 2IWVA 4CTDA 1OPBA 4GDZA 4AZQA 1P6PA 2CZUA 1VWRB 3SLJA 5H9AA 4Z3TA 1JV4A 3BS2A 3S26A 5B5GA 4YCHA 4CDEA 2RTLA 3WVMA 2Y7SA 2OY8A 4EKVA 4FGIB 4CSBA 1IFBA 4BQUA 4AYMC 1UYOX 1VWOB
chains in the Genus database with same CATH topology
1QABE 2BHVA 2QO4A 2KW1A 3O2YA 1KQWA 3WJFA 1HXUA 2FT9A 3B2KA 1Y9TA 2WSJA 3STNA 2MJIA 4I3CA 2FS7A 2QM9A 4QGVA 1IZNA 3WJCA 4GCSA 5EZ2A 2LHFA 3IFBA 4O49A 2G79A 3EBWA 1LICA 4I3BA 5BYPA 4YFRA 2HMBA 3APVA 4MVIA 4O3WA 2Z4IA 1ZNDA 4ALOA 1E54A 1IZNB 2ERVA 4A1HA 3BDRA 4ORSA 2Y0LA 1EPAA 2A3FX 2OVDA 4QZTA 1IFCA 2OVSA 3LV4A 5F6ZA 1CBRA 3D97A 2GJ5A 4YGZA 3UEUA 1HMTA 3ZW2A 5F6BA 5DL7A 4YGGA 3MVFA 4LKPA 3EYCA 3O0EA 3LHNA 1CRBA 1SXUA 3WI5A 3P6HA 4QNIA 5JDPA 4AZOA 2AT6X 4ZHGA 1GT4A 2MM3A 5D4AA 3F6ZB 1GFOA 1PRNA 4NLIA 1MM4A 2WQ9A 3U9PC 4KT5A 4YKOA 1OBQA 3VG3A 3TF6A 2N2LA 4LKTA 2XTRA 4GU8A 4XMGA 2KTDA 3RWXA 1DC9A 5IO5A 1FDQA 4ML7B 3O22A 1A2DA 4IAWA 5HCDC 3NADA 2OFRX 2Z4HA 2PY1A 3KFHA 3NQ9A 3VE1A 3HWEA 2BT9A 2K23A 4E1TA 1BSQA 3RBHA 4TLJA 3G7XA 1IKJA 4MIRA 2G7BA 1QG5A 5FENA 5LJKA 1O1VA 1E02A 2KXPB 1D3SA 4IB9A 4TQ2A 2KXPA 1EQDA 1X8QA 2JOZA 3PP6A 1AB0A 1IKEA 5LJBA 2LBAA 1MX7A 1OPAA 3AA7A 2P8GA 2ACPX 3FEPA 4LZUA 3T24A 2RD7C 2WWPA 4BOEA 4AYNA 3VY9X 1DF3A 2CM9A 2PORA 3VG6A 1SY2A 1YWBA 3D4RA 4EDEA 1ICMA 3LK2A 3GAQA 2YPVA 2N93A 4N7DA 4AW8A 2OFMX 2NNEA 1EXSA 3PRNA 5CYBA 2F1TA 3JSQA 5LJDA 1YWDA 3FYXA 1SMPI 4GETA 2BLGA 4HFOA 3AAAB 4AFKA 3B2LA 3D96A 3PORA 3EM0A 2KD2A 1ORMA 1GFPA 2F09A 2LFUA 1EI5A 5D5DA 2HZRA 1S2PA 4U8UM 1U17A 3Q6LA 3S60A 2YG2A 3APXA 1OBPA 1U0XA 4ZGFA 4YGHA 3HWBA 3ELZA 2Q2PA 3WJDA 5HAEA 3PH5A 5K06A 2ODJA 3FA6A 1ZNKA 3V8UA 3BSZE 3NBXX 3MBTA 1OEKA 2XE5A 1OSMA 5AQ6A 3WXQA 4AUIA 1DZKA 1TOUA 3BX8A 1FELA 2MHLA 3UEWA 4AZRA 3PQUA 1THQA 4MVEA 1QJPA 1KGLA 3AA0B 4L1NA 3P6DA 3BU9A 5LKEA 3LK2B 3H3IA 1B4MA 4RLBA 2OVAA 4ZGUA 3FR5A 7PRNA 2JMMA 3PPTA 1LIBA 4G76A 3VG5A 4NNSA 3ZZVA 5EEEA 3U03A 2ZFGA 2M07A 1FEMA 1D2UA 1QQSA 2ZAGA 4MISA 1DZPA 4GRJA 3KVDD 3C78X 3OJYC 1LKEA 2FR3A 3HK1A 2XTQA 3KQ0A 5FFHA 3I17A 4O4OA 4QAEA 2F73A 5LKFA 4IAXA 3WI4A 3ZI8A 2R73A 5HTEA 5LJGA 3FW4A 1JYDA 1Z24A 1KOIA 3FEKA 3P6FA 4ZH6A 2FS6A 3BY0A 4QQ1A 1G74A 3S5VA 3BRNA 5HZQA 1RLBE 4TKJA 5IYUA 1A3YA 3PECA 3ZW1A 1OBUA 4OMXA 3KFGA 4OS0A 4QGWA 4ODDA 3AKMA 3T0SA 4C69X 4FSPA 4ORUA 4IMOA 4PSQA 5LJHA 2XKLA 1X8PA 1ADLA 3ZWEA 3B2HA 2GTLM 1GM6A 1N0SA 5KIDA 1JBHA 1QFVA 4ZHDA 2Y0HA 5PRNA 3SZVA 4CV7A 3P24A 5H8TA 1OEEA 2XSTA 3FA8A 4GH7A 3OD9A 3UEVA 1GFMA 1SXXA 3CBSA 3T20A 2Q9SA 4N59A 4WFUA 1G85A 3ZW0A 5HZ6A 4YH0A 4FUVA 3UPGA 2RQ0A 3T1DA 3ZQ3A 1A18A 1X8OA 2K0LA 3P6GA 4WBKA 4AZNA 3EMNX 1TOWA 3TGAA 1ALBA 1X89A 3WJEA 1HBQA 1EIOA 1L6MA 3SY7A 1YUPA 2X8FA 2GTLN 3D95A 1BJ7A 4FRTA 2K62A 2GC9A 1BH3A 1BSOA 5KICA 2ACOA 1ICNA 4NW4A 5F7GA 4ZCBA 3STMX 4FMSA 1T68X 3RSWA 4LSEA 5DL6A 3DTQA 1HMSA 3P02A 4XNKA 4I6SA 4U9CA 4D65A 1DFVA 3OE3A 1JIWI 3TGCA 4MVLA 1FTPA 1KXOA 1YP7A 4QZUA 2GTLO 4AKRB 2O62A 3K19A 4KH8A 1BT9A 4RL9A 2KT4B 3IA8A 2W2FA 2EU7X 4N58A 1BBPA 1QY0A 3VE2A 1EIIA 1ZHXA 2LA7A 1MVGA 5T5FA 3PEDA 3C5OA 5EDCA 4M7MA 2PRNA 3JQOA 2A2UA 1GT5A 1G7NA 4RJXA 2XE1A 1U18A 2HLVA 4TKBA 4GCPA 1HQPA 4HPCA 3RZYA 4AYHA 4ZHCA 1O8VA 3POXA 2L9CA 1YWCA 1QJ8A 2HYSA 4AZLA 1ACDA 3VZTX 2ZAIA 2G78A 2AT0X 4IBAA 3AA7B 1BRPA 4I3DA 2L67A 4I95A 4CK4A 2HZQA 3G7GA 2RCQA 1BWYA 3APUA 1CBQA 2AKQA 3QRAA 5AFUK 3VY8X 4FESA 3FENA 4KRAA 3BX7A 1CJ5A 1ZHZA 1P4TA 2KC0A 2M4LA 2RA6A 3NR3A 2QO5A 4ZFXA 1PBOA 4AKRA 2X45A 1O1UA 3JTYA 3UU2A 4U8UO 4IB8A 2O4VA 3WJGA 1JYJA 1EUOA 1BM5A 3FA9A 4EXZA 3GP6A 4OMWA 4XMDA 4K19A 1YIVA 3VPJE 5B27A 1Y9LA 2ANSA 4GF4A 4E1SA 1GFNA 2XMXA 2POAA 4R0BA 3L4RA 5AJBA 4AZPA 1JJJA 2K4TA 2Y2XA 2BS6A 2LBVA 3AAEA 3SYBA 1XCAA 1LIEA 2FGRA 2N2MA 1B0OA 5ADXK 3CQNA 4I9RA 5B29A 4FZNA 2RCTA 4LZVA 2LKKA 3E3CA 3EBKA 2Q4NA 2JN3A 3AAAA 2KZ7B 5AFUL 3O19A 5D45A 1LNMA 2AT5X 3HWDA 3ZW0B 2QMIA 4ID2A 4FZLA 1I05A 1I4UA 3BLGA 2FGQX 1PMPA 5HZ5A 1HMRA 5H9NA 1KZXA 3RKGA 5HA0A 1GKAA 1E00A 5HZ8A 2JU8A 2A2GA 3C76X 3FW5A 4BVMA 3F8AA 1Q9FA 3SYSA 4B61A 3SAOA 4EQAC 2ZLDA 1S44A 1G90A 2CZTA 3CBCA 1X8UA 3EMMA 3UAQA 2M06A 5HCEC 4LSIA 1B56A 2WR6A 1EALA 5DL8A 4M6SA 4OS3A 3CR6A 3PH6A 3CMPA 2W2AA 2CM4A 4FZMA 2OZQA 2XG6A 1MDCA 2QOSC 3SZDA 4D6BA 8PRNA 2A0AA 3ZW1B 3TZSA 1HXXA 1OEJA 2KTSA 4GHBA 4O4UA 4FRXA 3U0DA 3B2IA 3DA3A 1QY1A 4IB7A 4AYMC 4O3XB 1NGLA 3NX1A 5BVQA 4YKMA 5IO7A 4UU2A 2X8SA 3F9DA 5CE4A 3A2SX 1ZHYA 3K3LA 4FBRA 3ZUOA 2WEWA 3KFFA 4JGLA 4LSFA 1KT7A 5L8IA 5DPQA 5JR8A 1ERXA 1SA8A 4ORWA 1VPRA 4F4BA 5EEDA 3SY9A 4QRLA 3AA0A 1X71A 1PEEA 1GGLA 4O9SA 1CBIA 2CBSA 1PM1X 2KDYA 4EEJA 2W2BA 3HW9A 4KR8A 1GT1A 1SXWA 4ORYA 2JU3A 2QO6A 3VG7A 3LK42 4TJZA 3ELXA 3TZGA 1LFOA 1LIDA 3LK3A 3LK41 3FLLA 4YBPA 3FYFA 2W80C 3HWFA 3APWA 5D48A 4AYEC 2OVEA 1EPBA 4NP1A 4KC8A 1S7DA 3STKA 3UEXA 4UU3A 3QRCA 4D64A 1XKIA 4YCEA 4I9SA 4HPBA 4NNTA 5HBSA 1ZHWA 3S5XA 2FR2A 5D47A 5FQ6E 4YDBA 1PHOA 4TNNA 1A57A 3POUA 4RJWA 4XMHA 3WJBA 4OS8A 4U3QA 1BXWA 2OMFA 4O4XA 2FLJA 1KT4A 3FELA 3OBLA 4NYQA 2Q2MA 4A8ZA 2AT3X 1LPJA 3BU1A 4QYNA 1HXTA 4ZH9A 3HOLA 4RLCA 2MO5A 4YFPA 1I06A 5C0NA 3HWGA 4U8UN 2AMMX 4JFBA 1YP6A 4ZHHA 3NP1A 2MHDA 3POQA 3VZUX 4TKHA 4ZHFA 2DM5A 4YBUA 2X27X 3NSGA 1RBPA 4G75A 3FR4A 4ARHA 1ZHTA 4D5UA 1TXLA 1GX8A 3NQ3A 1E5PA 1UZ2X 4FBOA 4HWMA 5HZ9A 5AEOA 4ORXA 1UREA 1G5WA 3DSZA 4AYID 4IABA 1H6S1 4PUXA 4O4SA 5DG4A 4RUUA 4GKCA 3N91A 4L3RA 4RUNA 5BVTA 3RBYA 1X8NA 3VG2A 4DQ3A 4XMCA 1QJ9A 1IW2A 2LFOA 3WBGA 3AA1B 3CWKA 3AA6B 1R0UA 1VYGA 1ZNGA 5F1EA 2JW1A 3NQKA 1OPFA 5HA1A 5FVNA 2JU7A 4ORRA 5FQ7E 4GNYA 1FENA 4Y0RA 3HTYA 5FQ8E 3GE2A 3I0AA 3TGBA 4NYRA 2NNDA 1KT6A 1MM5A 4BUMX 2WUTA 5ADXL 4AZMA 1JJXA 2IFBA 1ERBA 1SY1A 3B2JA 1Q9GA 1CBSA 2XE3A 4D6AA 1T0VA 2Q39A 2JMBA 5H9LA 3JS1A 5IO6A 4MVKA 2RN4A 2CBRA 4XMEA 2MNHA 5EDBA 3FMZA 4XMFA 1T8VA 4HPDA 1AQBA 5H9KA 4ES7A 4FOZA 2R74A 5HCCC 4HPAA 1DZMA 4ZJ0A 2AH7X 1KQXA 4A1YA 3C77X 1QY2A 4Y0QA 4FSOA 3VU1A 3KZAA 4DQ4A 5F58A 2Y0KA 4AYDC 1ZRYA 2FTBA 4AKMA 5L8NA 1H91A 1QWDA 3AA6A 2WQAE 4WFVA 4LQZA 4PJ2A 2QTKA 1KZWA 3FR2A 4JCHA 2ALLX 5D8JA 5EPQA 5LJEA 4KR4A 1ZNEA 5EE2A 1NP4A 1GKAB 2AL0X 4ALBA 1YS5A 2J4UP 1E06A 1ZNLA 1AELA 1MUPA 1BEBA 5BVSA 1GT3A 2R56A 1SXYA 3MX7A 3CQRA 1TVQA 1SY3A 2BS5A 4GNWA 1DV9A 3DA4A 3P6CA 2E4JA 1MPFA 1GXAA 4QGXA 1BLRA 2KZ7A 1FE3A 3P6EA 5G26A 2NP1A 3PQSA 1B8EA 2FWVA 1IIUA 2L68A 4N7CA 2YNKA 5HWZA 5GV0A 2LB6A 5DL5A 5L8OA 4O3YA 5HTDA 2GTFX 4GZVA 1I04A 1SY0A 4IB6A 5AJCA 2W81C 2XE2A 3NX2A 2YMSA 4Y0PA 4YMYA 5LJCA 2F1VA 4GK9A 1KT3A 4ON1A 3HOEA 2X46A 4Y0SA 3FA7A 1BSYA 1YWAA 1LIFA 4NLJA 4IMNA 4WHIA 1ML7A 4GE1A 4LSHA 1GFQA 1TW4A 1OPBA 4GDZA 5FAZA 4AZQA 4O3ZA 1GX9A 2A13A 4YDAA 3AAEB 1P6PA 2FRSA 2CZUA 1LF7A 1JZUA 2GE4A 2WEXA 3ZUIA 4QYPA 4XNLA 5H9AA 4FQBB 4KIIA 2MWHA 4INNA 2L5PA 3FIQA 4GCQA 3QKGA 1VYFA 1MX8A 3LK3B 2X8TA 3KFIA 1QFTA 4EFGA 4FBVA 1JV4A 5KHPA 4Z3TA 3AA1A 3AKNA 3BS2A 4KCAA 1EW3A 4YFQA 3S26A 4A60A 4YCHA 2HNXA 1AVGI 3WOVA 3WVMA 2NNQA 4COTA 2Y7SA 2ASNX 1NP1A 4FT6A 6PRNA 1ZNHA 4KC7A 1KT5A 2J1NA 2AT8X 1HBPA 3NPOA 1BRQA 4FGIB 4CSBA 3VG4A 1IFBA 1DZJA 4BQUA 3VZWX 1HN2A 3SOTA 4ZR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QQ1 A;  4O4X A;  2KDY A;  3UAQ A;  2LFU A;  3PQS A;  3HOL A;  4O3Y A;  2W81 C;  4Z3T A;  4O49 A;  4AYN A;  2W80 C;  4AYD C;  3V8U A;  2Y7S A;  4AYE C;  4O4U A;  3KVD D;  3HOE A;  4U9C A;  4O3W A;  4O3X B;  2YPV A;  2KC0 A;  3VE1 A;  5EE2 A;  1YS5 A;  4AYI D;  4O3Z A;  4AYM C;  3VE2 A;  3PQU A;  5T5F A; 
#chains in the Genus database with same CATH topology
 1QAB E;  2BHV A;  1VWA B;  1HXL A;  1SWL A;  3WJF A;  2MJI A;  3WZO A;  2FS7 A;  1Y53 X;  3IFB A;  4BGF A;  1ZND A;  1E54 A;  1IZN B;  2IZF B;  4ORS A;  2A3F X;  2RTG B;  1CBR A;  3D97 A;  4YGZ A;  3UEU A;  3ZW2 A;  5F6B A;  1T16 A;  1SXU A;  2X55 A;  1GT4 A;  2MM3 A;  5D4A A;  1GFO A;  3U9P C;  3VG3 A;  4LKT A;  2CAM A;  2XTR A;  4GU8 A;  3RWX A;  5IO5 A;  3O22 A;  2Z4H A;  3VE1 A;  4CDC A;  4TLJ A;  2G7B A;  1O1V A;  1E02 A;  1D3S A;  3FEP A;  4LZU A;  1SWB A;  1ICM A;  3GAQ A;  2YPV A;  2N93 A;  2NNE A;  2F1T A;  1YWD A;  3FYX A;  1SMP I;  4GET A;  3CKF A;  3D96 A;  3EM0 A;  1ORM A;  1EI5 A;  2A8G A;  1U17 A;  1OBP A;  1U0X A;  4ZGF A;  2FKJ A;  3ELZ A;  5GTI O;  3FA6 A;  1ZNK A;  2OF8 A;  1SWS A;  1OEK A;  1HXZ A;  5AQ6 A;  1FEL A;  1JJU A;  3UEW A;  1LCW A;  3VHI A;  1KGL A;  5LKE A;  3LK2 B;  1B4M A;  4RLB A;  2OVA A;  4ZGU A;  3FR5 A;  2A5C A;  2JMM A;  3PPT A;  1VWM B;  4NNS A;  5K68 A;  1FEM A;  1D2U A;  2WJR A;  1DZP A;  3KVD D;  4Z2V A;  1SWK A;  1KOI A;  5CHK A;  3P6F A;  4QQ1 A;  1G74 A;  1RLB E;  5IXG A;  3PEC A;  3ZW1 A;  3KFG A;  3RDS A;  4C69 X;  4Z28 A;  2XKL A;  3ZWE A;  1GM6 A;  5PRN A;  2OY1 O;  4CV7 A;  4GH7 A;  3UEV A;  4WFU A;  5HZ6 A;  2RQ0 A;  3T1D A;  3ZQ3 A;  1X8O A;  2K0L A;  3P6G A;  2IZE B;  3EMN X;  1TOW A;  1ALB A;  3SY7 A;  2X8F A;  2X56 A;  1NQN A;  3DTQ A;  4XNK A;  4I6S A;  4BX7 B;  1FTP A;  4KH8 A;  1BT9 A;  1BBP A;  3VE2 A;  1MVG A;  5EDC A;  4M7M A;  3JQO A;  2A2U A;  1U18 A;  3RZY A;  2L9C A;  2HYS A;  2G78 A;  2AT0 X;  2RCQ A;  1BWY A;  3FEN A;  3BX7 A;  1P4T A;  2RA6 A;  3NR3 A;  2QO5 A;  3RDU A;  2O4V A;  4CPH A;  3Q34 A;  4K19 A;  2BS6 A;  3AAE A;  2FKG A;  1XCA A;  2N2M A;  3CKG A;  3CQN A;  4I9R A;  2RCT A;  3AAA A;  2KZ7 B;  1SRJ A;  3T2X A;  1KZX A;  1E00 A;  1Q9F A;  3FW5 A;  3RY1 A;  1SWO A;  1W6F A;  2ZLD A;  1G90 A;  2M06 A;  4N75 A;  2W2A A;  2QOS C;  3TZS A;  4BX6 A;  2DJF A;  1HXX A;  1SRI A;  4Y5D A;  3U0D A;  3DA3 A;  1QY1 A;  1SRG A;  4IB7 A;  4O3X B;  3BS0 A;  2OY5 O;  4YKM A;  2OL8 O;  4FBR A;  1NC9 A;  3KFF A;  1SWG A;  5JR8 A;  1VPR A;  5EED A;  3SY9 A;  1PEE A;  4O9S A;  1SRH A;  1CBI A;  1PM1 X;  2KDY A;  2W2B A;  3VG7 A;  3LK4 2;  4TJZ A;  1S7D A;  4D64 A;  3S5X A;  1PHO A;  3MG5 A;  3EW2 A;  1BXW A;  2OMF A;  3OBL A;  1LPJ A;  4YFP A;  3HWG A;  1LUQ A;  2MHD A;  3POQ A;  1FJ1 E;  4ZHF A;  1WUB A;  4GGZ A;  1TXL A;  1GX8 A;  1G5W A;  4AYI D;  4PUX A;  5DG4 A;  3WZP A;  3RBY A;  3VG2 A;  1IW2 A;  3WBG A;  3AA1 B;  3CWK A;  2RTD B;  5FVN A;  5HA1 A;  4ORR A;  1HQQ A;  1MOY A;  4GNY A;  4Y0R A;  4BUM X;  1MM5 A;  5ADX L;  2JGS A;  1SY1 A;  1Q9G A;  1CBS A;  1STS B;  4D6A A;  1T0V A;  2JMB A;  5H2F O;  3JS1 A;  4MVK A;  1STR B;  3FMZ A;  4XMF A;  4ES7 A;  1VWE B;  2R74 A;  5HCC C;  1DZM A;  1OSP O;  1VWL B;  1KQX A;  2X32 A;  3VU1 A;  5F58 A;  1H91 A;  4WFV A;  1KZW A;  2ALL X;  5D8J A;  2IWW A;  1NP4 A;  1E06 A;  1ZNL A;  1BEB A;  1SXY A;  1DV9 A;  3P6C A;  1MPF A;  2KZ7 A;  1B8E A;  5DL5 A;  4O3Y A;  2XE2 A;  1I04 A;  4IB6 A;  3NX2 A;  4YMY A;  1KFF A;  1GX3 A;  3HOE A;  2X46 A;  3T2W A;  4IMN A;  4GE1 A;  4LSH A;  2A5B A;  1IJ8 A;  4YDA A;  5B11 O;  3AAE B;  2BC3 A;  2GE4 A;  3ZUI A;  4INN A;  2L5P A;  4GCQ A;  1QFT A;  5KHP A;  3AA1 A;  3AKN A;  4KCA A;  3WOV A;  4COT A;  6PRN A;  1ZNH A;  2AT8 X;  2RTQ B;  1BRQ A;  3EW1 A;  1HN2 A;  4ZR2 A;  4BCS A;  2IZJ A;  1VYO A;  2FT9 A;  2RTE B;  2RTO B;  4QGV A;  1IZN A;  3WJC A;  3A0H O;  2G79 A;  4YFR A;  2HMB A;  2Z4I A;  2ERV A;  4A1H A;  1I78 A;  2Y0L A;  2RTB B;  1IFC A;  1HMT A;  2I5V O;  4YGG A;  3EYC A;  3AUM O;  3O0E A;  4PJ0 O;  5JDP A;  3P6H A;  4AZO A;  4ZHG A;  4NLI A;  1MM4 A;  2WQ9 A;  4JO6 A;  1OBQ A;  2N2L A;  3D9W A;  4XMG A;  1DC9 A;  1FDQ A;  1A2D A;  3NAD A;  3KFH A;  3NQ9 A;  3HWE A;  1Y55 X;  3G7X A;  4GGR A;  3FID A;  4MIR A;  5FEN A;  5LJK A;  1SRF A;  1SWE A;  2KXP B;  1X8Q A;  2FHN X;  1AB0 A;  5G39 A;  1W5R A;  2R88 A;  3AA7 A;  2P8G A;  4AYN A;  2CM9 A;  3PDF A;  2POR A;  3VG6 A;  3D4R A;  4BJ8 A;  4N7D A;  4AW8 A;  2OFM X;  3T6L A;  2BSZ A;  2G5L A;  2F09 A;  2LFU A;  2HZR A;  1S2P A;  4U8U M;  3Q6L A;  3LTW A;  3S60 A;  1N9Y A;  4YGH A;  3HWB A;  4C4V A;  1TOU A;  3DWO X;  4AZR A;  1QJP A;  2AVI A;  4L1N A;  2ZSC A;  3BU9 A;  3H3I A;  4G76 A;  2QCB A;  2ZFG A;  1QQS A;  2ZAG A;  4MIS A;  1LKE A;  1RXH A;  3WI4 A;  2WJQ A;  5HTE A;  5LJG A;  1Z24 A;  3FEK A;  4OEL A;  4JHQ A;  3BY0 A;  2IZA A;  5HZQ A;  4TKJ A;  4BX6 B;  1KL5 A;  1OBU A;  4OS0 A;  4QGW A;  3T0S A;  4FSP A;  4PSQ A;  5LJH A;  1X8P A;  1ADL A;  3B2H A;  5KID A;  3SZV A;  4NV7 A;  5H8T A;  1OEE A;  3T20 A;  1NDJ A;  3UPG A;  3BRZ A;  1A18 A;  2UYW A;  1HBQ A;  1EIO A;  3D95 A;  2K62 A;  1BH3 A;  2I5Z O;  5KIC A;  1ICN A;  4ZCB A;  3STM X;  1T68 X;  3P02 A;  1VWG B;  4U9C A;  3OE3 A;  3HPE A;  2R4O A;  4MVL A;  1SLE B;  2O62 A;  4RL9 A;  4K3B A;  2KT4 B;  1EII A;  2LA7 A;  3C5O A;  1G7N A;  1SWD A;  2HLV A;  4GCP A;  4HPC A;  4AYH A;  4ZHC A;  3POX A;  4AZL A;  3VZT X;  2X34 A;  4IBA A;  1LDQ A;  3G7G A;  1CBQ A;  5AFU K;  3WJG A;  1BM5 A;  3FA9 A;  4BX5 B;  4OMW A;  4Z27 A;  1YIV A;  2OFA A;  3SZH A;  5ADX K;  4FZN A;  1VWJ B;  3E3C A;  5AFU L;  5D45 A;  2AT5 X;  3HWD A;  4FZL A;  2Y32 A;  3BLG A;  1PMP A;  3RKG A;  3F8A A;  3SAO A;  4EQA C;  1S44 A;  2CZT A;  1KL4 A;  1EAL A;  3CR6 A;  3PH6 A;  2CM4 A;  1MDC A;  1OEJ A;  5TIS O;  5G38 A;  1NGL A;  5IO7 A;  1ZHY A;  3ZUO A;  2WEW A;  4LSF A;  1KT7 A;  5DPQ A;  4ORW A;  3VHM A;  3AA0 A;  1GGL A;  1NBX A;  4ORY A;  3RY2 A;  3ELX A;  3TZG A;  1LID A;  3FLL A;  3HWF A;  2OVE A;  2OYB O;  4KC8 A;  2RTN B;  1XKI A;  4HPB A;  5FQ6 E;  4YDB A;  4TNN A;  1A57 A;  4O4X A;  2FLJ A;  1KT4 A;  2WVP A;  4A8Z A;  2AT3 X;  3BU1 A;  4QYN A;  1HXT A;  4ZH9 A;  3HOL A;  1Y52 X;  4U8U N;  2AMM X;  4JFB A;  1YP6 A;  3NP1 A;  3VZU X;  4D5U A;  3RE5 A;  4HWM A;  3NQ3 A;  1E5P A;  3X00 A;  5AEO A;  2RTF B;  4RUN A;  4L3R A;  1VWD B;  1X8N A;  4DQ3 A;  2R89 A;  4Z6J A;  1QJ9 A;  3AA6 B;  1VYG A;  2JW1 A;  3NQK A;  1N43 A;  2JU7 A;  5FQ7 E;  3I0A A;  3TGB A;  2WUT A;  1SWN A;  4AZM A;  4Z2P A;  2IFB A;  5H9L A;  4IRW A;  2RN4 A;  2MNH A;  5EDB A;  1T8V A;  2AH7 X;  1QY2 A;  4FSO A;  2PI3 O;  2IZB A;  4DQ4 A;  2Y0K A;  4PR7 A;  2FTB A;  1QWD A;  1SWR A;  4BX7 A;  4JCH A;  1SWP A;  5EPQ A;  5LJE A;  2AL0 X;  1MM9 A;  5BVS A;  2MF6 A;  3MX7 A;  1TVQ A;  2E4J A;  1BLR A;  4GD9 A;  2NP1 A;  2FWV A;  5L8O A;  1VWC B;  5HTD A;  4GK9 A;  1KT3 A;  4ON1 A;  3FA7 A;  1ML7 A;  1TW4 A;  4O3Z A;  1GX9 A;  1LF7 A;  3WZN A;  4XNL A;  4FQB B;  4KII A;  3QKG A;  1VYF A;  1MX8 A;  4EFG A;  4FBV A;  4A60 A;  2ASN X;  4FT6 A;  4KC7 A;  4B55 A;  1KT5 A;  1SWQ A;  2GH7 A;  2QO4 A;  2KW1 A;  3O2Y A;  1T1L A;  2C1S A;  1RXK A;  3B2K A;  4I3C A;  2QM9 A;  4OKA A;  3EBW A;  1LIC A;  5BYP A;  3APV A;  4O3W A;  4ALO A;  3BDR A;  1EPA A;  2OVD A;  4QZT A;  4MEE A;  2X9K A;  3SLT A;  3MVF A;  1CRB A;  3WI5 A;  4QNI A;  4GJS A;  2AT6 X;  4KT5 A;  4YKO A;  3TF6 A;  2KTD A;  2FHL A;  4ML7 B;  4IAW A;  3NJT A;  4NV8 A;  2OFR X;  3RDO A;  1Y0G A;  2K23 A;  3RBH A;  5B2A O;  4TQ2 A;  2JOZ A;  3PP6 A;  1IKE A;  5LJB A;  1MX7 A;  1OPA A;  1KL3 A;  2WWP A;  4BOE A;  3VY9 X;  1EXS A;  3PRN A;  5CYB A;  1S5L O;  4AFK A;  4HFO A;  3B2L A;  1MK5 A;  2R4N A;  1GFP A;  2OL7 A;  5D5D A;  4FQE A;  3APX A;  4DCB A;  1JMX A;  1HY2 A;  2Q2P A;  2ODJ A;  5K06 A;  3NBX X;  1VWH B;  4AUI A;  2MHL A;  2VDF A;  2X4M A;  1VWB B;  4MVE A;  7PRN A;  1LCZ A;  3VG5 A;  4CPI A;  5B3M O;  1JQP A;  3C78 X;  2XTQ A;  4QAE A;  5LKF A;  4IAX A;  3ZI8 A;  3FW4 A;  1JYD A;  3T6F A;  4ZH6 A;  4UB6 O;  2RTC B;  4OMX A;  1I9H A;  3AKM A;  4ODD A;  4IMO A;  1N0S A;  3PGR A;  1JBH A;  1LDO A;  2XST A;  1K24 A;  1SXX A;  1GFM A;  3WYQ A;  2Q9S A;  4CDD A;  1AVD A;  4CPH B;  3RDQ A;  4WBK A;  4AZN A;  3TGA A;  1X89 A;  2OL6 O;  1L6M A;  1YUP A;  1SWF A;  4GJV A;  2GC9 A;  4NW4 A;  5F7G A;  4FMS A;  4LSE A;  1HMS A;  4D65 A;  1DFV A;  3TGC A;  1JIW I;  1YP7 A;  4C5P A;  4AKR B;  3K19 A;  5B10 O;  2W2F A;  2EU7 X;  1QY0 A;  1ZHX A;  5T5F A;  3PED A;  2XE1 A;  4TKB A;  1YWC A;  1ACD A;  2OF9 A;  1UYN X;  2Y3E A;  1BRP A;  2L67 A;  4I95 A;  3QRA A;  3VY8 X;  3KVN A;  4KRA A;  1CJ5 A;  1W4T A;  4ZFX A;  4AKR A;  2X45 A;  1O1U A;  3JTY A;  4U8U O;  1JYJ A;  3EC5 A;  2F01 A;  3KZI O;  3VPJ E;  5B66 O;  1Y9L A;  4E1S A;  1GFN A;  2POA A;  4R0B A;  3L4R A;  5AJB A;  1JJJ A;  2Y2X A;  2FGR A;  1LIE A;  1PBY A;  1B0O A;  1SRE A;  4LZV A;  3EBK A;  2RTA A;  2Q4N A;  2JN3 A;  1LNM A;  3ZW0 B;  4ID2 A;  1I4U A;  2OY7 A;  2FGQ X;  5HZ5 A;  1HMR A;  5HA0 A;  4K3C A;  5HZ8 A;  3SYS A;  4IL6 O;  3UAQ A;  1X8U A;  4LSI A;  5DL8 A;  2WR6 A;  3RDX A;  2XG6 A;  3SZD A;  2C1Q A;  2IZG B;  2A0A A;  3AEH A;  4D6B A;  2KTS A;  4O4U A;  3NX1 A;  5BVQ A;  4CDF A;  4UU2 A;  5CE4 A;  5CSE A;  3A2S X;  3K3L A;  4JGL A;  3WZQ A;  1ERX A;  1SA8 A;  4QRL A;  1X71 A;  2CBS A;  4EEJ A;  4KR8 A;  1GT1 A;  1SXW A;  2JU3 A;  3LK3 A;  1VWP B;  3LK4 1;  5D48 A;  3APW A;  4AYE C;  1EPB A;  4NP1 A;  3UEX A;  4UU3 A;  1RXJ A;  2IZK A;  5HBS A;  1ZHW A;  5D47 A;  4RJW A;  3POU A;  5IRU A;  2AXT O;  4NYQ A;  5C0N A;  5IRW A;  5KAF O;  5G3A A;  1LCV A;  4ZHH A;  4TKH A;  4YBU A;  3NSG A;  4G75 A;  4ARH A;  1ZHT A;  3QRC A;  4FBO A;  4ORX A;  3DSZ A;  1H6S 1;  4RUU A;  4GKC A;  3N91 A;  5BVT A;  1SLD B;  1PTS A;  2LFO A;  1ZNG A;  5F1E A;  1FEN A;  3HTY A;  5FQ8 E;  4NYR A;  1SWT A;  2NND A;  1KT6 A;  1JJX A;  1ERB A;  3PF1 A;  1SWC A;  3B2J A;  2XE3 A;  1VWF B;  2CBR A;  4HPD A;  2RTI B;  4HPA A;  5JD2 A;  1K3B A;  4AYD C;  3AA6 A;  4LQZ A;  4PJ2 A;  2QTK A;  3FR2 A;  1ZNE A;  4ALB A;  2AF5 A;  1YS5 A;  1SLF B;  1AEL A;  1GT3 A;  2R56 A;  1SLG B;  3CQR A;  1RAV A;  3DA4 A;  1GXA A;  4QGX A;  4N7C A;  3PQS A;  1IIU A;  2L68 A;  2HKD A;  2RTH B;  1VWN B;  2IZD B;  2W81 C;  4GZV A;  1SY0 A;  5AJC A;  2YMS A;  5LJC A;  2WPU A;  4Y0S A;  4NLJ A;  5FAZ A;  2A13 A;  2FRS A;  1JZU A;  2FGS A;  2WEX A;  4QYP A;  4GUZ A;  2MWH A;  3FIQ A;  2R4P A;  3LK3 B;  2X8T A;  3KFI A;  1STP A;  3RDM A;  1EW3 A;  3PK2 A;  4YFQ A;  2HNX A;  1AVG I;  2NNQ A;  1NP1 A;  2RTR B;  2J1N A;  3NPO A;  1HBP A;  3VG4 A;  1DZJ A;  3VZW X;  2IZL B;  3SOT A;  4CPF A;  1KQW A;  5GTH O;  1HXU A;  1Y9T A;  2WSJ A;  3STN A;  1VWK B;  4GCS A;  5EZ2 A;  2LHF A;  4O49 A;  4I3B A;  4MVI A;  5L3Y A;  3PGU A;  2OVS A;  3LV4 A;  5F6Z A;  2GJ5 A;  5DL7 A;  4LKP A;  3LHN A;  1PRN A;  3F6Z B;  5HCD C;  2PY1 A;  2BT9 A;  4E1T A;  1BSQ A;  2RTP B;  2IZH B;  1IKJ A;  1QG5 A;  4IB9 A;  2KXP A;  1EQD A;  1AVE A;  2LBA A;  2ACP X;  3T24 A;  2RD7 C;  1DF3 A;  1SY2 A;  1YWB A;  4EDE A;  3LK2 A;  4Y59 A;  3SZI A;  3JSQ A;  3DWN A;  5LJD A;  4Z2O A;  3AAA B;  2BLG A;  3POR A;  2KD2 A;  2YG2 A;  1RST B;  3WJD A;  5HAE A;  3PH5 A;  3V8U A;  3VHH A;  3BSZ E;  3MBT A;  2XE5 A;  1OSM A;  3WXQ A;  1DZK A;  3BX8 A;  3PQU A;  1THQ A;  3AA0 B;  3P6D A;  4JNJ A;  1LIB A;  3ZZV A;  5EEE A;  3U03 A;  2M07 A;  1RSU B;  4GRJ A;  1SWH A;  3OJY C;  2FR3 A;  3HK1 A;  3KQ0 A;  5FFH A;  3I17 A;  4O4O A;  2F73 A;  2R73 A;  5E79 O;  3WYP A;  2FS6 A;  3S5V A;  2R4L A;  3BRN A;  5IYU A;  1A3Y A;  2DJG A;  4ORU A;  2GTL M;  2Y0H A;  1QFV A;  4ZHD A;  3P24 A;  3FA8 A;  3OD9 A;  3CBS A;  4N59 A;  1G85 A;  3ZW0 A;  2RTM A;  4YH0 A;  4FUV A;  2C4I A;  4UB8 O;  5K67 A;  3DZM A;  1DF8 A;  1N4J A;  2IZI A;  3WJE A;  2VFB A;  2GTL N;  4YVB A;  3SLO A;  1BJ7 A;  4FRT A;  3VGW A;  4CPE A;  1BSO A;  1SWJ A;  2ACO A;  4BX5 A;  1SWA A;  2UZ2 A;  3RSW A;  5DL6 A;  1LEL A;  4QZU A;  1KXO A;  1NQM A;  2GTL O;  3IA8 A;  2RTK A;  3PGS A;  4N58 A;  2PRN A;  4RJX A;  1GT5 A;  2G8C O;  1HQP A;  1O8V A;  1QJ8 A;  2ZAI A;  2JQY A;  3AA7 B;  4I3D A;  1SWU A;  4CK4 A;  2HZQ A;  3APU A;  2AKQ A;  4FES A;  1ZHZ A;  2KC0 A;  1E2T A;  2M4L A;  1PBO A;  3UU2 A;  4IB8 A;  1N7Y A;  1EUO A;  3GP6 A;  4EXZ A;  4XMD A;  5B27 A;  2ANS A;  4GF4 A;  2XMX A;  4AZP A;  2K4T A;  3MM0 A;  4OEM A;  2IZC B;  3SYB A;  2LBV A;  5B29 A;  2LKK A;  3O19 A;  2QMI A;  1I05 A;  5H9N A;  4DNE A;  1GKA A;  1N9M A;  2JU8 A;  2A2G A;  3C76 X;  4GGT A;  4BVM A;  4B61 A;  2OFB A;  3CBC A;  3EMM A;  5HCE C;  1B56 A;  4M6S A;  4OS3 A;  3CMP A;  1JMZ A;  2OZQ A;  4FZM A;  8PRN A;  2R8A A;  3ZW1 B;  4GHB A;  4FRX A;  3B2I A;  2F1C X;  2X8S A;  3F9D A;  5L8I A;  3RE6 A;  1VWI B;  4F4B A;  3FDC A;  3HW9 A;  4N74 A;  2QO6 A;  1LFO A;  4YBP A;  5B5F A;  3FYF A;  2W80 C;  3JCU O;  3STK A;  4U46 A;  4YCE A;  4I9S A;  4NNT A;  2FR2 A;  5B5E O;  4XMH A;  3WJB A;  4OS8 A;  4U3Q A;  3FEL A;  2Q2M A;  4C00 A;  4BBO A;  3WU2 O;  4RLC A;  2MO5 A;  1I06 A;  1WBI A;  2DM5 A;  2X27 X;  1RBP A;  3FR4 A;  1UZ2 X;  5HZ9 A;  1URE A;  4IAB A;  4O4S A;  4XMC A;  1R0U A;  1OPF A;  3SZJ A;  3A0B O;  3GE2 A;  2Q39 A;  4I60 A;  5IO6 A;  5KAI O;  4XME A;  5H9K A;  1AQB A;  4FOZ A;  2RTJ A;  4ZJ0 A;  4A1Y A;  3C77 X;  4Y0Q A;  4C4V B;  3KZA A;  1VWQ B;  1ZRY A;  4AKM A;  5L8N A;  3QQ2 A;  2WQA E;  3BRY A;  4KR4 A;  5EE2 A;  1GKA B;  2J4U P;  5F2B A;  2Y3F A;  1MUP A;  4GNW A;  1SY3 A;  2BS5 A;  5G26 A;  1FE3 A;  3P6E A;  5GV0 A;  2QOM A;  2YNK A;  4GDA A;  2VFC A;  5HWZ A;  2LB6 A;  5IRA A;  2GTF X;  4Y0P A;  2F1V A;  1MEP A;  1BSY A;  1YWA A;  1LIF A;  4WHI A;  1GFQ A;  2IWV A;  4CTD A;  1OPB A;  4GDZ A;  4AZQ A;  1P6P A;  2CZU A;  1VWR B;  3SLJ A;  5H9A A;  4Z3T A;  1JV4 A;  3BS2 A;  3S26 A;  5B5G A;  4YCH A;  4CDE A;  2RTL A;  3WVM A;  2Y7S A;  2OY8 A;  4EKV A;  4FGI B;  4CSB A;  1IFB A;  4BQU A;  4AYM C;  1UYO X;  1VWO B; 
#chains in the Genus database with same CATH homology
 1QAB E;  2BHV A;  2QO4 A;  2KW1 A;  3O2Y A;  1KQW A;  3WJF A;  1HXU A;  2FT9 A;  3B2K A;  1Y9T A;  2WSJ A;  3STN A;  2MJI A;  4I3C A;  2FS7 A;  2QM9 A;  4QGV A;  1IZN A;  3WJC A;  4GCS A;  5EZ2 A;  2LHF A;  3IFB A;  4O49 A;  2G79 A;  3EBW A;  1LIC A;  4I3B A;  5BYP A;  4YFR A;  2HMB A;  3APV A;  4MVI A;  4O3W A;  2Z4I A;  1ZND A;  4ALO A;  1E54 A;  1IZN B;  2ERV A;  4A1H A;  3BDR A;  4ORS A;  2Y0L A;  1EPA A;  2A3F X;  2OVD A;  4QZT A;  1IFC A;  2OVS A;  3LV4 A;  5F6Z A;  1CBR A;  3D97 A;  2GJ5 A;  4YGZ A;  3UEU A;  1HMT A;  3ZW2 A;  5F6B A;  5DL7 A;  4YGG A;  3MVF A;  4LKP A;  3EYC A;  3O0E A;  3LHN A;  1CRB A;  1SXU A;  3WI5 A;  3P6H A;  4QNI A;  5JDP A;  4AZO A;  2AT6 X;  4ZHG A;  1GT4 A;  2MM3 A;  5D4A A;  3F6Z B;  1GFO A;  1PRN A;  4NLI A;  1MM4 A;  2WQ9 A;  3U9P C;  4KT5 A;  4YKO A;  1OBQ A;  3VG3 A;  3TF6 A;  2N2L A;  4LKT A;  2XTR A;  4GU8 A;  4XMG A;  2KTD A;  3RWX A;  1DC9 A;  5IO5 A;  1FDQ A;  4ML7 B;  3O22 A;  1A2D A;  4IAW A;  5HCD C;  3NAD A;  2OFR X;  2Z4H A;  2PY1 A;  3KFH A;  3NQ9 A;  3VE1 A;  3HWE A;  2BT9 A;  2K23 A;  4E1T A;  1BSQ A;  3RBH A;  4TLJ A;  3G7X A;  1IKJ A;  4MIR A;  2G7B A;  1QG5 A;  5FEN A;  5LJK A;  1O1V A;  1E02 A;  2KXP B;  1D3S A;  4IB9 A;  4TQ2 A;  2KXP A;  1EQD A;  1X8Q A;  2JOZ A;  3PP6 A;  1AB0 A;  1IKE A;  5LJB A;  2LBA A;  1MX7 A;  1OPA A;  3AA7 A;  2P8G A;  2ACP X;  3FEP A;  4LZU A;  3T24 A;  2RD7 C;  2WWP A;  4BOE A;  4AYN A;  3VY9 X;  1DF3 A;  2CM9 A;  2POR A;  3VG6 A;  1SY2 A;  1YWB A;  3D4R A;  4EDE A;  1ICM A;  3LK2 A;  3GAQ A;  2YPV A;  2N93 A;  4N7D A;  4AW8 A;  2OFM X;  2NNE A;  1EXS A;  3PRN A;  5CYB A;  2F1T A;  3JSQ A;  5LJD A;  1YWD A;  3FYX A;  1SMP I;  4GET A;  2BLG A;  4HFO A;  3AAA B;  4AFK A;  3B2L A;  3D96 A;  3POR A;  3EM0 A;  2KD2 A;  1ORM A;  1GFP A;  2F09 A;  2LFU A;  1EI5 A;  5D5D A;  2HZR A;  1S2P A;  4U8U M;  1U17 A;  3Q6L A;  3S60 A;  2YG2 A;  3APX A;  1OBP A;  1U0X A;  4ZGF A;  4YGH A;  3HWB A;  3ELZ A;  2Q2P A;  3WJD A;  5HAE A;  3PH5 A;  5K06 A;  2ODJ A;  3FA6 A;  1ZNK A;  3V8U A;  3BSZ E;  3NBX X;  3MBT A;  1OEK A;  2XE5 A;  1OSM A;  5AQ6 A;  3WXQ A;  4AUI A;  1DZK A;  1TOU A;  3BX8 A;  1FEL A;  2MHL A;  3UEW A;  4AZR A;  3PQU A;  1THQ A;  4MVE A;  1QJP A;  1KGL A;  3AA0 B;  4L1N A;  3P6D A;  3BU9 A;  5LKE A;  3LK2 B;  3H3I A;  1B4M A;  4RLB A;  2OVA A;  4ZGU A;  3FR5 A;  7PRN A;  2JMM A;  3PPT A;  1LIB A;  4G76 A;  3VG5 A;  4NNS A;  3ZZV A;  5EEE A;  3U03 A;  2ZFG A;  2M07 A;  1FEM A;  1D2U A;  1QQS A;  2ZAG A;  4MIS A;  1DZP A;  4GRJ A;  3KVD D;  3C78 X;  3OJY C;  1LKE A;  2FR3 A;  3HK1 A;  2XTQ A;  3KQ0 A;  5FFH A;  3I17 A;  4O4O A;  4QAE A;  2F73 A;  5LKF A;  4IAX A;  3WI4 A;  3ZI8 A;  2R73 A;  5HTE A;  5LJG A;  3FW4 A;  1JYD A;  1Z24 A;  1KOI A;  3FEK A;  3P6F A;  4ZH6 A;  2FS6 A;  3BY0 A;  4QQ1 A;  1G74 A;  3S5V A;  3BRN A;  5HZQ A;  1RLB E;  4TKJ A;  5IYU A;  1A3Y A;  3PEC A;  3ZW1 A;  1OBU A;  4OMX A;  3KFG A;  4OS0 A;  4QGW A;  4ODD A;  3AKM A;  3T0S A;  4C69 X;  4FSP A;  4ORU A;  4IMO A;  4PSQ A;  5LJH A;  2XKL A;  1X8P A;  1ADL A;  3ZWE A;  3B2H A;  2GTL M;  1GM6 A;  1N0S A;  5KID A;  1JBH A;  1QFV A;  4ZHD A;  2Y0H A;  5PRN A;  3SZV A;  4CV7 A;  3P24 A;  5H8T A;  1OEE A;  2XST A;  3FA8 A;  4GH7 A;  3OD9 A;  3UEV A;  1GFM A;  1SXX A;  3CBS A;  3T20 A;  2Q9S A;  4N59 A;  4WFU A;  1G85 A;  3ZW0 A;  5HZ6 A;  4YH0 A;  4FUV A;  3UPG A;  2RQ0 A;  3T1D A;  3ZQ3 A;  1A18 A;  1X8O A;  2K0L A;  3P6G A;  4WBK A;  4AZN A;  3EMN X;  1TOW A;  3TGA A;  1ALB A;  1X89 A;  3WJE A;  1HBQ A;  1EIO A;  1L6M A;  3SY7 A;  1YUP A;  2X8F A;  2GTL N;  3D95 A;  1BJ7 A;  4FRT A;  2K62 A;  2GC9 A;  1BH3 A;  1BSO A;  5KIC A;  2ACO A;  1ICN A;  4NW4 A;  5F7G A;  4ZCB A;  3STM X;  4FMS A;  1T68 X;  3RSW A;  4LSE A;  5DL6 A;  3DTQ A;  1HMS A;  3P02 A;  4XNK A;  4I6S A;  4U9C A;  4D65 A;  1DFV A;  3OE3 A;  1JIW I;  3TGC A;  4MVL A;  1FTP A;  1KXO A;  1YP7 A;  4QZU A;  2GTL O;  4AKR B;  2O62 A;  3K19 A;  4KH8 A;  1BT9 A;  4RL9 A;  2KT4 B;  3IA8 A;  2W2F A;  2EU7 X;  4N58 A;  1BBP A;  1QY0 A;  3VE2 A;  1EII A;  1ZHX A;  2LA7 A;  1MVG A;  5T5F A;  3PED A;  3C5O A;  5EDC A;  4M7M A;  2PRN A;  3JQO A;  2A2U A;  1GT5 A;  1G7N A;  4RJX A;  2XE1 A;  1U18 A;  2HLV A;  4TKB A;  4GCP A;  1HQP A;  4HPC A;  3RZY A;  4AYH A;  4ZHC A;  1O8V A;  3POX A;  2L9C A;  1YWC A;  1QJ8 A;  2HYS A;  4AZL A;  1ACD A;  3VZT X;  2ZAI A;  2G78 A;  2AT0 X;  4IBA A;  3AA7 B;  1BRP A;  4I3D A;  2L67 A;  4I95 A;  4CK4 A;  2HZQ A;  3G7G A;  2RCQ A;  1BWY A;  3APU A;  1CBQ A;  2AKQ A;  3QRA A;  5AFU K;  3VY8 X;  4FES A;  3FEN A;  4KRA A;  3BX7 A;  1CJ5 A;  1ZHZ A;  1P4T A;  2KC0 A;  2M4L A;  2RA6 A;  3NR3 A;  2QO5 A;  4ZFX A;  1PBO A;  4AKR A;  2X45 A;  1O1U A;  3JTY A;  3UU2 A;  4U8U O;  4IB8 A;  2O4V A;  3WJG A;  1JYJ A;  1EUO A;  1BM5 A;  3FA9 A;  4EXZ A;  3GP6 A;  4OMW A;  4XMD A;  4K19 A;  1YIV A;  3VPJ E;  5B27 A;  1Y9L A;  2ANS A;  4GF4 A;  4E1S A;  1GFN A;  2XMX A;  2POA A;  4R0B A;  3L4R A;  5AJB A;  4AZP A;  1JJJ A;  2K4T A;  2Y2X A;  2BS6 A;  2LBV A;  3AAE A;  3SYB A;  1XCA A;  1LIE A;  2FGR A;  2N2M A;  1B0O A;  5ADX K;  3CQN A;  4I9R A;  5B29 A;  4FZN A;  2RCT A;  4LZV A;  2LKK A;  3E3C A;  3EBK A;  2Q4N A;  2JN3 A;  3AAA A;  2KZ7 B;  5AFU L;  3O19 A;  5D45 A;  1LNM A;  2AT5 X;  3HWD A;  3ZW0 B;  2QMI A;  4ID2 A;  4FZL A;  1I05 A;  1I4U A;  3BLG A;  2FGQ X;  1PMP A;  5HZ5 A;  1HMR A;  5H9N A;  1KZX A;  3RKG A;  5HA0 A;  1GKA A;  1E00 A;  5HZ8 A;  2JU8 A;  2A2G A;  3C76 X;  3FW5 A;  4BVM A;  3F8A A;  1Q9F A;  3SYS A;  4B61 A;  3SAO A;  4EQA C;  2ZLD A;  1S44 A;  1G90 A;  2CZT A;  3CBC A;  1X8U A;  3EMM A;  3UAQ A;  2M06 A;  5HCE C;  4LSI A;  1B56 A;  2WR6 A;  1EAL A;  5DL8 A;  4M6S A;  4OS3 A;  3CR6 A;  3PH6 A;  3CMP A;  2W2A A;  2CM4 A;  4FZM A;  2OZQ A;  2XG6 A;  1MDC A;  2QOS C;  3SZD A;  4D6B A;  8PRN A;  2A0A A;  3ZW1 B;  3TZS A;  1HXX A;  1OEJ A;  2KTS A;  4GHB A;  4O4U A;  4FRX A;  3U0D A;  3B2I A;  3DA3 A;  1QY1 A;  4IB7 A;  4AYM C;  4O3X B;  1NGL A;  3NX1 A;  5BVQ A;  4YKM A;  5IO7 A;  4UU2 A;  2X8S A;  3F9D A;  5CE4 A;  3A2S X;  1ZHY A;  3K3L A;  4FBR A;  3ZUO A;  2WEW A;  3KFF A;  4JGL A;  4LSF A;  1KT7 A;  5L8I A;  5DPQ A;  5JR8 A;  1ERX A;  1SA8 A;  4ORW A;  1VPR A;  4F4B A;  5EED A;  3SY9 A;  4QRL A;  3AA0 A;  1X71 A;  1PEE A;  1GGL A;  4O9S A;  1CBI A;  2CBS A;  1PM1 X;  2KDY A;  4EEJ A;  2W2B A;  3HW9 A;  4KR8 A;  1GT1 A;  1SXW A;  4ORY A;  2JU3 A;  2QO6 A;  3VG7 A;  3LK4 2;  4TJZ A;  3ELX A;  3TZG A;  1LFO A;  1LID A;  3LK3 A;  3LK4 1;  3FLL A;  4YBP A;  3FYF A;  2W80 C;  3HWF A;  3APW A;  5D48 A;  4AYE C;  2OVE A;  1EPB A;  4NP1 A;  4KC8 A;  1S7D A;  3STK A;  3UEX A;  4UU3 A;  3QRC A;  4D64 A;  1XKI A;  4YCE A;  4I9S A;  4HPB A;  4NNT A;  5HBS A;  1ZHW A;  3S5X A;  2FR2 A;  5D47 A;  5FQ6 E;  4YDB A;  1PHO A;  4TNN A;  1A57 A;  3POU A;  4RJW A;  4XMH A;  3WJB A;  4OS8 A;  4U3Q A;  1BXW A;  2OMF A;  4O4X A;  2FLJ A;  1KT4 A;  3FEL A;  3OBL A;  4NYQ A;  2Q2M A;  4A8Z A;  2AT3 X;  1LPJ A;  3BU1 A;  4QYN A;  1HXT A;  4ZH9 A;  3HOL A;  4RLC A;  2MO5 A;  4YFP A;  1I06 A;  5C0N A;  3HWG A;  4U8U N;  2AMM X;  4JFB A;  1YP6 A;  4ZHH A;  3NP1 A;  2MHD A;  3POQ A;  3VZU X;  4TKH A;  4ZHF A;  2DM5 A;  4YBU A;  2X27 X;  3NSG A;  1RBP A;  4G75 A;  3FR4 A;  4ARH A;  1ZHT A;  4D5U A;  1TXL A;  1GX8 A;  3NQ3 A;  1E5P A;  1UZ2 X;  4FBO A;  4HWM A;  5HZ9 A;  5AEO A;  4ORX A;  1URE A;  1G5W A;  3DSZ A;  4AYI D;  4IAB A;  1H6S 1;  4PUX A;  4O4S A;  5DG4 A;  4RUU A;  4GKC A;  3N91 A;  4L3R A;  4RUN A;  5BVT A;  3RBY A;  1X8N A;  3VG2 A;  4DQ3 A;  4XMC A;  1QJ9 A;  1IW2 A;  2LFO A;  3WBG A;  3AA1 B;  3CWK A;  3AA6 B;  1R0U A;  1VYG A;  1ZNG A;  5F1E A;  2JW1 A;  3NQK A;  1OPF A;  5HA1 A;  5FVN A;  2JU7 A;  4ORR A;  5FQ7 E;  4GNY A;  1FEN A;  4Y0R A;  3HTY A;  5FQ8 E;  3GE2 A;  3I0A A;  3TGB A;  4NYR A;  2NND A;  1KT6 A;  1MM5 A;  4BUM X;  2WUT A;  5ADX L;  4AZM A;  1JJX A;  2IFB A;  1ERB A;  1SY1 A;  3B2J A;  1Q9G A;  1CBS A;  2XE3 A;  4D6A A;  1T0V A;  2Q39 A;  2JMB A;  5H9L A;  3JS1 A;  5IO6 A;  4MVK A;  2RN4 A;  2CBR A;  4XME A;  2MNH A;  5EDB A;  3FMZ A;  4XMF A;  1T8V A;  4HPD A;  1AQB A;  5H9K A;  4ES7 A;  4FOZ A;  2R74 A;  5HCC C;  4HPA A;  1DZM A;  4ZJ0 A;  2AH7 X;  1KQX A;  4A1Y A;  3C77 X;  1QY2 A;  4Y0Q A;  4FSO A;  3VU1 A;  3KZA A;  4DQ4 A;  5F58 A;  2Y0K A;  4AYD C;  1ZRY A;  2FTB A;  4AKM A;  5L8N A;  1H91 A;  1QWD A;  3AA6 A;  2WQA E;  4WFV A;  4LQZ A;  4PJ2 A;  2QTK A;  1KZW A;  3FR2 A;  4JCH A;  2ALL X;  5D8J A;  5EPQ A;  5LJE A;  4KR4 A;  1ZNE A;  5EE2 A;  1NP4 A;  1GKA B;  2AL0 X;  4ALB A;  1YS5 A;  2J4U P;  1E06 A;  1ZNL A;  1AEL A;  1MUP A;  1BEB A;  5BVS A;  1GT3 A;  2R56 A;  1SXY A;  3MX7 A;  3CQR A;  1TVQ A;  1SY3 A;  2BS5 A;  4GNW A;  1DV9 A;  3DA4 A;  3P6C A;  2E4J A;  1MPF A;  1GXA A;  4QGX A;  1BLR A;  2KZ7 A;  1FE3 A;  3P6E A;  5G26 A;  2NP1 A;  3PQS A;  1B8E A;  2FWV A;  1IIU A;  2L68 A;  4N7C A;  2YNK A;  5HWZ A;  5GV0 A;  2LB6 A;  5DL5 A;  5L8O A;  4O3Y A;  5HTD A;  2GTF X;  4GZV A;  1I04 A;  1SY0 A;  4IB6 A;  5AJC A;  2W81 C;  2XE2 A;  3NX2 A;  2YMS A;  4Y0P A;  4YMY A;  5LJC A;  2F1V A;  4GK9 A;  1KT3 A;  4ON1 A;  3HOE A;  2X46 A;  4Y0S A;  3FA7 A;  1BSY A;  1YWA A;  1LIF A;  4NLJ A;  4IMN A;  4WHI A;  1ML7 A;  4GE1 A;  4LSH A;  1GFQ A;  1TW4 A;  1OPB A;  4GDZ A;  5FAZ A;  4AZQ A;  4O3Z A;  1GX9 A;  2A13 A;  4YDA A;  3AAE B;  1P6P A;  2FRS A;  2CZU A;  1LF7 A;  1JZU A;  2GE4 A;  2WEX A;  3ZUI A;  4QYP A;  4XNL A;  5H9A A;  4FQB B;  4KII A;  2MWH A;  4INN A;  2L5P A;  3FIQ A;  4GCQ A;  3QKG A;  1VYF A;  1MX8 A;  3LK3 B;  2X8T A;  3KFI A;  1QFT A;  4EFG A;  4FBV A;  1JV4 A;  5KHP A;  4Z3T A;  3AA1 A;  3AKN A;  3BS2 A;  4KCA A;  1EW3 A;  4YFQ A;  3S26 A;  4A60 A;  4YCH A;  2HNX A;  1AVG I;  3WOV A;  3WVM A;  2NNQ A;  4COT A;  2Y7S A;  2ASN X;  1NP1 A;  4FT6 A;  6PRN A;  1ZNH A;  4KC7 A;  1KT5 A;  2J1N A;  2AT8 X;  1HBP A;  3NPO A;  1BRQ A;  4FGI B;  4CSB A;  3VG4 A;  1IFB A;  1DZJ A;  4BQU A;  3VZW X;  1HN2 A;  3SOT A;  4ZR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...