3HOEA

Crystal structure of surface lipoprotein
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
242
structure length
242
Chain Sequence
EPALGYVVKVPVSSFENKKVDISDIEVITNGNLDDVPYKANSSKYNYPDIKTKDSSLQYVRSGYVIDGEHSGSNEKGYVYYKGNSPAKELPVNQLLTYTGSWDFTSNANLNNEEGRPNYLNDDYYTKFIGKRVGLVSGDAKPAKHKYTSQFEVDFATKKMTGKLSDKEKTIYTVNADIRGNRFTGAATASDKNKGKGESYNFFSADSQSLEGGFYGPKAEEMAGKFVANDKSLFAVFSAKHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TbpB
publication title Insights into the bacterial transferrin receptor: the structure of transferrin-binding protein B from Actinobacillus pleuropneumoniae.
pubmed doi rcsb
source organism Actinobacillus pleuropneumoniae
molecule tags Transport protein
total genus 61
structure length 242
sequence length 242
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 3hoeA01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 3hoeA02
3PQUA 5T5FA 2W81C 3HOLA 4O3ZA 4O4UA 4AYNA 3VE2A 4O4XA 4O3XB 4AYID 3PQSA 2W80C 4O49A 2Y7SA 4QQ1A 1YS5A 4AYEC 3UAQA 4Z3TA 4AYDC 4O3WA 2LFUA 4AYMC 3HOEA 2KDYA 4U9CA 5EE2A 4O3YA 2YPVA 3KVDD 3VE1A 3V8UA 2KC0A
chains in the Genus database with same CATH superfamily
4WHIA 1LCWA 2G8CO 5L8NA 3RE5A 4JNJA 1ZHYA 1EIIA 1G5WA 1S44A 4GGZA 1L6MA 1WBIA 1A2DA 3AA6B 4U8UO 3DTQA 4JFBA 3T6LA 2FKJA 2QOMA 1E54A 4I3BA 3POUA 3SZVA 5DL5A 1LUQA 1TVQA 1JYDA 2IZEB 1EUOA 4E1TA 2XSTA 1VPRA 1QABE 3RDSA 3DWNA 1CBRA 2FWVA 2RTIB 1H6S1 4N75A 4FSOA 4FOZA 2W81C 2RTAA 1IZNA 1N7YA 2UZ2A 3OJYC 1HXLA 5DG4A 4AYHA 5KICA 4YBPA 3P6DA 2FGRA 1JYJA 4AZRA 3LK42 4WFVA 5K06A 2Y0LA 2OF9A 2G78A 3PQUA 1HMSA 3QQ2A 4D64A 4KC8A 2XE1A 2Q4NA 2GJ5A 2DM5A 3TZSA 1BWYA 1VWHB 1LNMA 6PRNA 4FBRA 5LKEA 1HXZA 1EW3A 2I5VO 2A2UA 3N91A 4RJXA 4IB7A 1SWTA 3FELA 1YWCA 4FQEA 2MHLA 1SWHA 2KZ7B 3SY9A 2JU7A 3T2XA 3FR2A 5B29A 3PP6A 3TGBA 3O2YA 3HWFA 2IZFB 2KXPA 5KAIO 1FJ1E 2WEWA 3VE2A 2Q9SA 1VYOA 1E2TA 1X8NA 4AKMA 3O19A 1RLBE 3F9DA 3FMZA 2AVIA 4N74A 4YFQA 3AAEA 1CRBA 2RTDB 4D6BA 4DQ4A 5D48A 3VE1A 4GHBA 4OS0A 1KT4A 4KIIA 3BDRA 4YGHA 4GDAA 5FFHA 2FKGA 4EFGA 4NNTA 1MM9A 5B66O 4OMWA 1HXXA 4C4VA 4TKJA 1BH3A 5B2AO 2N93A 2ASNX 2L5PA 2RTKA 2OVDA 1LCZA 4ORYA 1HXUA 4Y0QA 3SLJA 2A13A 3VG5A 3HTYA 1VYFA 1Y55X 1YWBA 1KFFA 4XMCA 1LELA 1VWKB 1K3BA 4YGGA 4AYDC 3UPGA 1EQDA 1QJPA 4GH7A 3APVA 3SAOA 2JN3A 2LB6A 3EC5A 5H2FO 5F58A 4CV7A 2IZIA 2MF6A 2KD2A 1SY1A 5CYBA 5LJCA 1MEPA 5IO6A 1JMXA 5EEDA 4BX5B 1ZRYA 4U3QA 4BUMX 3GAQA 2X45A 4LKPA 4YGZA 2WR6A 2XKLA 2W2BA 1SRJA 2M4LA 3FR5A 2BT9A 2RQ0A 4CPFA 2OFBA 1RSTB 3PGUA 1MUPA 1QJ8A 4O49A 3ZZVA 3FR4A 1JJJA 1BBPA 1DZPA 2RD7C 2A0AA 4CDCA 4OEMA 1MOYA 1FEMA 2R74A 1MVGA 1STPA 1QFVA 1AVDA 1ZNEA 1OBPA 3X00A 4TKHA 1QG5A 2X8TA 3QRAA 4QQ1A 4ORXA 1RXKA 1K24A 1B56A 4GUZA 3WJGA 4ZH9A 1PHOA 4L3RA 4ORWA 4OKAA 2R56A 4CSBA 2GTLM 1FDQA 1GT4A 4C5PA 1VWAB 3LTWA 3MG5A 5FQ7E 2GTLN 3C77X 1DF3A 2FT9A 4WFUA 5H8TA 4BOEA 2IWVA 2FHNX 1N0SA 3VY8X 2R8AA 1IW2A 3RDQA 3WI4A 4LSFA 4O3XB 3IFBA 3DA3A 1B0OA 4ORSA 4ALOA 3VHIA 1DV9A 4GRJA 4G75A 1KQWA 3VHHA 3T6FA 3SZIA 4LZVA 2Y3FA 1X8OA 3NQ9A 2OVAA 1ZNGA 4LZUA 5HZQA 4K3CA 4INNA 5T5FA 3NX1A 5EZ2A 2FR2A 1PRNA 2W2AA 1NQNA 4YKOA 4GK9A 2QOSC 1GGLA 1EXSA 3FW4A 5K68A 1D3SA 2WQ9A 5F6ZA 3NQKA 2PORA 2OFRX 4GNYA 2N2MA 2AL0X 4QGWA 5DPQA 1ZNDA 3EMMA 4BGFA 3UEVA 1PBOA 1YS5A 4Y0PA 4XMDA 3ZQ3A 3PORA 1FELA 2WWPA 1BSOA 4AUIA 4BVMA 1N4JA 2K0LA 5AFUL 2L9CA 2CBRA 2OY1O 3HOLA 5D8JA 1TOWA 3ZWEA 1KL4A 1LDOA 2X4MA 5BVQA 3BRZA 3IA8A 1LFOA 2OVEA 1YIVA 1CBQA 4G76A 4OMXA 3T1DA 4I6SA 5H9AA 4PUXA 2ZLDA 4IRWA 3WZOA 2WPUA 5HA0A 1OBQA 3SY7A 3P6EA 2RTBB 5HWZA 5JD2A 1NQMA 2ZFGA 4MVEA 4XMGA 1RSUB 4QNIA 2FS6A 3KFHA 1RBPA 3U0DA 5HZ9A 1KT3A 4I9SA 1YP7A 3ZW0A 3BU1A 5EE2A 4GETA 3D97A 1IZNB 1HN2A 2X46A 5H9KA 2NNDA 1YWDA 1Y9LA 5FENA 1I04A 4AYNA 2ZSCA 3LK3B 5L3YA 4MVKA 3F8AA 4YH0A 2L67A 3FA6A 3HOEA 1KT6A 1GFNA 3PGRA 4ZHDA 3FLLA 1EI5A 4C00A 4A1HA 3F6ZB 4OELA 3P6HA 2HZQA 3AA7B 2X32A 1X71A 2AMMX 3WYPA 1SWEA 2BSZA 1MM5A 1HY2A 1IFBA 4K19A 3CQNA 3MX7A 1JJXA 1SY0A 4QAEA 4ZCBA 5F1EA 4ZFXA 1CBSA 5LJGA 2ACOA 5G38A 2LBVA 3ZW1A 4O4XA 5BVSA 5LJEA 1SWLA 4GD9A 4FESA 5LJHA 4Z3TA 1QWDA 3RDXA 1ORMA 4ZH6A 1SWDA 4QYPA 4D65A 2W2FA 3AEHA 2JOZA 3SZHA 2KXPB 5LJDA 3L4RA 2YPVA 1U17A 2ZAIA 3WJDA 5D4AA 3CKFA 4LSIA 3NADA 2R4OA 4KRAA 4IAXA 4ORRA 1LICA 3RDOA 4I60A 1XCAA 2RTQB 3AAEB 3STNA 3G7GA 1ICMA 4K3BA 2XE3A 4AKRB 4IB9A 3FIDA 1OBUA 3A2SX 5B3MO 4GJSA 1LIBA 3HWDA 1GFOA 4AZQA 2RTGB 2JMBA 4CDEA 3MVFA 4GJVA 4RUUA 4U8UN 4C4VB 2FGSA 1T16A 4MIRA 4IL6O 1X89A 5F6BA 1OPAA 2CZUA 4BBOA 2FTBA 1E5PA 1HQQA 3FA8A 1LPJA 2RCQA 4JO6A 5DL6A 2IZCB 3PQSA 4PSQA 1VWNB 2IZHB 1SWRA 3WXQA 1SWUA 1W6FA 3GE2A 3PK2A 1VWFB 1KT7A 3VZTX 4O4SA 4GCQA 1KQXA 2L68A 3FDCA 4GF4A 2YMSA 2RTEB 2XMXA 2PY1A 3VZUX 4RLBA 1AQBA 3WZNA 4NV8A 4HPAA 5HCDC 2KTSA 3BY0A 3FA9A 3H3IA 1YP6A 4TKBA 4U46A 2C1SA 5IYUA 2EU7X 3TGAA 4D5UA 4MVLA 2ERVA 2RTJA 3EBKA 4GGTA 1BM5A 1PMPA 3G7XA 2IZDB 4YVBA 1W5RA 2HNXA 2K23A 1MX7A 4NW4A 5AJCA 4AZPA 3LK41 4MVIA 1ML7A 2X34A 2A5CA 1W4TA 3I0AA 4D6AA 2P8GA 4ZHCA 2LA7A 3D95A 2LFOA 1SREA 4KCAA 2AT5X 4I95A 3CQRA 5CHKA 3WBGA 3U03A 5E79O 2X55A 3WZPA 4JCHA 4GCSA 1LF7A 2IZKA 3VPJE 1SWFA 4N59A 2WUTA 4CPHA 3DSZA 4EQAC 1EIOA 1SLEB 3BU9A 3JS1A 4YMYA 1KGLA 1Y9TA 3K3LA 3VU1A 4YFPA 1VWMB 1Y53X 3RZYA 3AA0A 4ZGUA 3RKGA 1LCVA 1QFTA 1AB0A 2FS7A 1DZKA 4LQZA 1QY0A 2BC3A 4RUNA 2JU8A 4BX7A 2Y0HA 4HPCA 5AJBA 3PPTA 2RTFB 1SLGB 1UYNX 4UB6O 2MO5A 1GKAB 2WSJA 2MJIA 2O4VA 1OSPO 4IMNA 4BX6B 2AT0X 2MNHA 3EW1A 2M06A 1VWRB 1GFMA 1HMRA 1A57A 1N43A 4FBOA 5JR8A 3NP1A 4MISA 1U0XA 2X27X 1UZ2X 2OMFA 1PTSA 1VWBB 3HW9A 2VFBA 2Y32A 5LJBA 3TZGA 5BVTA 2OL8O 4I3CA 3APXA 1BRPA 3FA7A 5IO7A 1Z24A 4XMEA 4WBKA 3CBSA 1VWEB 2RTCB 4EDEA 4AZLA 1OEKA 4UU2A 3PH5A 2XE2A 1KOIA 4BQUA 3NBXX 2YG2A 2X8SA 3TF6A 4ZHHA 2X9KA 4ARHA 1EALA 4FQBB 3P6GA 3AKNA 1THQA 3VG6A 2A3FX 3KFFA 5F7GA 2QMIA 4NLJA 4ON1A 4ODDA 1KT5A 1DF8A 1P6PA 5IO5A 2O62A 5HCEC 5GV0A 2LKKA 3VG7A 4YCEA 4IB6A 2BHVA 3ELZA 2UYWA 3ZW0B 1BSYA 1B8EA 1G7NA 3RDMA 2Y0KA 4EXZA 5HZ5A 1T0VA 3PGSA 3SOTA 1SXWA 5AQ6A 5FQ8E 1GT5A 2WEXA 3AKMA 1JZUA 5CSEA 5D5DA 3AAAA 1KZXA 4FBVA 3WJFA 2LFUA 3P6CA 1YUPA 2KDYA 3WVMA 4ES7A 3STKA 1IIUA 3SZDA 1ZNLA 3APUA 4I9RA 4BCSA 1GX3A 3T20A 2X8FA 2MWHA 2Y7SA 4GNWA 1HQPA 5H9NA 5PRNA 5ADXK 3S60A 2RTPB 1TW4A 1GT1A 3AUMO 1I4UA 2HYSA 3D4RA 3C76X 3ZW1B 1NP1A 3VG3A 3NQ3A 2F1CX 2F09A 5BYPA 5LJKA 4KT5A 1JV4A 1NDJA 2RTRB 1LIEA 1D2UA 4ID2A 3RBHA 1H91A 4FSPA 4A60A 2WJQA 2XTRA 2BS6A 1MM4A 1HBQA 5CE4A 2K62A 5EDBA 1S5LO 4YFRA 1OPBA 3KZAA 4Z2PA 1G74A 4ZJ0A 1GX8A 1ZNKA 4COTA 4DCBA 4NP1A 1IFCA 4AYMC 3Q6LA 2Z4IA 5GTHO 3OE3A 5G39A 3HWGA 1X8QA 2OZQA 1O1UA 3VZWX 3C78X 1BJ7A 3FEPA 1FE3A 1GFQA 1ADLA 1JIWI 4N7DA 2KT4B 1VWPB 4TLJA 4PJ2A 4AZOA 4CTDA 1I9HA 4YDAA 5TISO 3TGCA 1JMZA 4JHQA 1FTPA 5AEOA 1SRHA 2IFBA 3EBWA 3AA1A 3ZW2A 1DFVA 2AT6X 5B10O 3U9PC 2LHFA 3POQA 1KL3A 3WU2O 1DC9A 4F4BA 1U18A 5F2BA 2GH7A 2FLJA 5FQ6E 3MM0A 3UU2A 2J4UP 2A2GA 4FZMA 3VG2A 2E4JA 7PRNA 1VYGA 1SY2A 4GE1A 1SRIA 1STSB 4HFOA 1SWPA 4FGIB 3T2WA 3FYFA 3PECA 3SLTA 3UEWA 3CR6A 2JMMA 3BSZE 1ALBA 1JQPA 4RJWA 2CAMA 5HA1A 3BRNA 3SYBA 3CMPA 3FIQA 1DZJA 4B55A 3HWBA 2OVSA 1OPFA 1VWIB 4IAWA 3B2JA 1KL5A 1E02A 3RY2A 5D47A 1I06A 4Z28A 1OEEA 1T8VA 1SWGA 2DJGA 1IKJA 2IZJA 4IBAA 2A5BA 4CPHB 5LKFA 2AXTO 4B61A 4L1NA 2G7BA 3PEDA 2OFMX 1SWCA 2JU3A 5G3AA 2POAA 2ACPX 3BS0A 1XKIA 4Z2OA 4CDFA 1MK5A 5KAFO 4I3DA 3EYCA 1A18A 2F73A 2X56A 3PDFA 3CWKA 3CBCA 4JGLA 1RXHA 3B2KA 3VY9X 5FAZA 2G5LA 4XNKA 3HPEA 3WOVA 3DA4A 3NSGA 3D96A 4KR8A 2Y2XA 4ORUA 1YWAA 1R0UA 4PJ0O 1IKEA 1ZHXA 2KC0A 2XE5A 1GM6A 5B5GA 1BSQA 4AW8A 1VWJB 1HBPA 4FRXA 2JW1A 4NNSA 1QY2A 4QGVA 4FUVA 2ALLX 4M7MA 2LBAA 1T1LA 2OF8A 1G85A 1VWGB 2OFAA 2KTDA 2HZRA 4GZVA 3D9WA 3KZIO 4A1YA 3CKGA 2XG6A 1BLRA 1SRFA 4KC7A 4HPBA 4IABA 3V8UA 1G90A 5EEEA 4O4OA 2AF5A 1SWSA 3RY1A 4ALBA 3LK3A 4TQ2A 3T0SA 5HTDA 1BEBA 5HZ6A 2C1QA 1X8UA 2BLGA 1OSMA 3Q34A 4KR4A 4IMOA 3FENA 2JQYA 1Y52X 1STRB 2RN4A 5B5EO 2CM9A 3WJCA 3ZUOA 1VWCB 4Z2VA 2A8GA 3KVNA 2WVPA 1ZHWA 3AA7A 3OD9A 1ZHTA 4ZHFA 4ZGFA 3ZI8A 5B11O 1E00A 3LK2A 4Y0RA 3AAAB 4HWMA 2OYBO 2GE4A 2FR3A 2J1NA 3A0HO 1QY1A 3WJBA 3GP6A 5C0NA 2I5ZO 1LKEA 3FW5A 1AVGI 3DZMA 2IZGB 4OS8A 4FZNA 5B5FA 4Z27A 2RTNB 4O9SA 4FZLA 4NYQA 1SWQA 1ZHZA 4UB8O 4AYEC 2OY5O 1QQSA 3B2LA 3BS2A 5KHPA 3UEUA 2AH7X 4AKRA 1DZMA 5H9LA 2F01A 3NPOA 2GTFX 1UREA 3JTYA 1FENA 1SRGA 3VHMA 4AFKA 1P4TA 3BX8A 1O1VA 5K67A 2CM4A 2ODJA 3E3CA 3LV4A 4PR7A 1SWOA 2Z4HA 1N9YA 4DQ3A 2G79A 5EDCA 3P6FA 5HBSA 4ZHGA 4DNEA 3AA6A 5GTIO 1PEEA 2QO4A 3S5XA 5FVNA 1BRQA 3A0BO 4YBUA 3VG4A 5HCCC 3LHNA 2R4PA 3NX2A 5B27A 1X8PA 2KW1A 2CBSA 4NLIA 2QO5A 1ERBA 2YNKA 1SXXA 4YCHA 1NBXA 1I78A 3B2IA 2AKQA 4C69X 4EKVA 2Y3EA 3NR3A 2WQAE 1SMPI 1SLFB 2RTOB 3P02A 2QO6A 1JBHA 3WI5A 3KQ0A 4IB8A 3BLGA 2DJFA 2MM3A 1VWQB 4XMFA 1SWBA 3AA1B 2HLVA 1A3YA 5HTEA 3NJTA 3UEXA 2IZLB 3BX7A 4XNLA 3FEKA 1RXJA 1GX9A 3DWOX 4CDDA 3EMNX 4YKMA 4CPEA 2R88A 4YDBA 1TOUA 2IWWA 3MBTA 3HK1A 1OEJA 2Q2MA 5IXGA 1UYOX 2M07A 1SLDB 2KZ7A 3RWXA 2R4LA 3S26A 1SY3A 4BJ8A 4AZNA 1T68X 3ZUIA 3HWEA 1BT9A 4QZTA 4KH8A 3RSWA 5IRUA 8PRNA 3FYXA 2RCTA 3POXA 3OBLA 3PH6A 2VFCA 3B2HA 5ADXL 1SA8A 2JGSA 1ACDA 1HXTA 4ZR2A 1LIFA 3C5OA 2GTLO 4M6SA 4FMSA 1SXUA 1AELA 1E06A 1RAVA 4AYID 4FT6A 2R89A 2QTKA 4HPDA 2VDFA 4GGRA 4OS3A 4AZMA 4NYRA 1GXAA 2CZTA 1KZWA 2FHLA 4O3ZA 2IZAA 3EW2A 1LDQA 2OY7A 2IZBA 1SWKA 1GKAA 1Q9FA 1I05A 4XMHA 3WZQA 2FGQX 3BRYA 5IRWA 5DL7A 1SWNA 4FRTA 4BX6A 1AVEA 1ZNHA 4TJZA 1JJUA 5G26A 5DL8A 4EEJA 3I17A 4A8ZA 3APWA 4UU3A 3RBYA 4Y59A 5AFUK 1BXWA 3WJEA 3JCUO 2OL7A 4BX5A 3RE6A 2ZAGA 2F1TA 4O4UA 4TNNA 4QYNA 1CBIA 1LIDA 4CPIA 4ML7B 1PM1X 2R73A 5EPQA 5IRAA 1VWLB 1EPBA 4QZUA 2QCBA 3P24A 5KIDA 4QRLA 3QKGA 5HAEA 5L8OA 4GU8A 3SZJA 4RLCA 3RDUA 1IJ8A 3SYSA 3VGWA 4LKTA 1SWJA 4GKCA 4QGXA 3PRNA 2OL6O 2BS5A 2NP1A 1PBYA 3UAQA 2GC9A 3JSQA 2MHDA 2HKDA 1O8VA 4U9CA 2K4TA 2AT8X 4O3YA 1SXYA 4CK4A 3SLOA 4NV7A 4RL9A 4GCPA 3ELXA 3PF1A 2Q2PA 2R4NA 2HMBA 3JQOA 1WUBA 2PI3O 2AT3X 1VWOB 1SWAA 2NNQA 5D45A 1KXOA 4Z6JA 3O0EA 2W80C 4MEEA 1Q9GA 2Q39A 2FRSA 1NGLA 1HMTA 3LK2B 4E1SA 2PRNA 1MPFA 1N9MA 1GFPA 1VWDB 1MDCA 3WYQA 4LSEA 2WJRA 3K19A 2QM9A 1MX8A 1TXLA 3AA0B 1GT3A 2RTMA 4GDZA 2RTHB 2RA6A 3KFGA 3T24A 1S7DA 4O3WA 4N58A 1NC9A 4Y5DA 3S5VA 3STMX 4R0BA 1CJ5A 4N7CA 1ERXA 1NP4A 4Y0SA 2C4IA 1Y0GA 5JDPA 4BX7B 3EM0A 3O22A 1S2PA 1B4MA 2N2LA 1QJ9A 2ANSA 2RTLA 2F1VA 5HZ8A 5L8IA 2NNEA 2XTQA 3QRCA 4U8UM 4LSHA 3KFIA 1EPAA 1ICNA 2OY8A 3KVDD
chains in the Genus database with same CATH topology
3SY7A 4O9SA 3SOTA 4WHIA 1SXWA 5AQ6A 4FZLA 4NYQA 3P6EA 5FQ8E 1GT5A 5HWZA 5L8NA 1ZHZA 2ZFGA 2WEXA 3AKMA 4MVEA 4QNIA 4XMGA 1JZUA 1ZHYA 5D5DA 2FS6A 3AAAA 3KFHA 1RBPA 1KZXA 4AYEC 1EIIA 3U0DA 4FBVA 5HZ9A 1G5WA 1S44A 3WJFA 1KT3A 4I9SA 3P6CA 2LFUA 1QQSA 1YP7A 1L6MA 1YUPA 2KDYA 3WVMA 3ZW0A 3B2LA 3BS2A 3BU1A 5EE2A 1A2DA 3D97A 4GETA 4U8UO 5KHPA 3AA6B 1IZNB 1HN2A 3DTQA 4JFBA 4ES7A 3UEUA 2AH7X 2X46A 5H9KA 2NNDA 1YWDA 1E54A 3STKA 1IIUA 4AKRA 4I3BA 3POUA 1DZMA 5H9LA 3SZVA 3SZDA 3NPOA 5DL5A 2GTFX 1TVQA 1Y9LA 1UREA 5FENA 1ZNLA 1I04A 3APUA 3JTYA 4AYNA 4I9RA 1FENA 1JYDA 3LK3B 3T20A 2X8FA 2MWHA 2Y7SA 4GNWA 4AFKA 1HQPA 5H9NA 1P4TA 5PRNA 5ADXK 3S60A 4MVKA 1TW4A 3BX8A 3F8AA 4YH0A 1GT1A 1EUOA 1O1VA 2L67A 3FA6A 4E1TA 2XSTA 1VPRA 1QABE 1I4UA 3HOEA 2CM4A 2HYSA 1KT6A 1GFNA 2ODJA 4ZHDA 3FLLA 3D4RA 1EI5A 3E3CA 3LV4A 3C76X 1CBRA 3ZW1B 1NP1A 3VG3A 3NQ3A 2FWVA 1H6S1 2Z4HA 4A1HA 3F6ZB 4DQ3A 2G79A 5EDCA 3P6HA 3P6FA 2HZQA 5HBSA 4FOZA 4ZHGA 2W81C 2F09A 4FSOA 5BYPA 3AA6A 5LJKA 1IZNA 4KT5A 1JV4A 1PEEA 2QO4A 3OJYC 3AA7B 3S5XA 1LIEA 1D2UA 4ID2A 5FVNA 3RBHA 1H91A 1BRQA 4FSPA 4A60A 5DG4A 4AYHA 4YBUA 1X71A 2AMMX 5KICA 4YBPA 2XTRA 3VG4A 2BS6A 3P6DA 1MM4A 1MM5A 2FGRA 1HBQA 1JYJA 4AZRA 1IFBA 3LHNA 5HCCC 3LK42 4K19A 4WFVA 3NX2A 5B27A 1X8PA 2K62A 2KW1A 3CQNA 1SY0A 3MX7A 4QAEA 5EDBA 5K06A 1JJXA 4ZCBA 2Y0LA 5F1EA 4ZFXA 2G78A 1CBSA 4YFRA 1OPBA 3PQUA 2ACOA 5LJGA 2CBSA 3KZAA 1HMSA 4NLIA 2LBVA 2QO5A 1ERBA 2YNKA 1SXXA 3ZW1A 4O4XA 4YCHA 5BVSA 5LJEA 4D64A 4KC8A 1G74A 2XE1A 2Q4NA 4ZJ0A 1GX8A 2GJ5A 2DM5A 3B2IA 2AKQA 4FESA 5LJHA 4C69X 4Z3TA 1QWDA 1ZNKA 4COTA 1ORMA 4NP1A 3TZSA 3NR3A 2WQAE 1IFCA 4ZH6A 1BWYA 4AYMC 4QYPA 4D65A 2W2FA 1LNMA 2JOZA 4FBRA 3Q6LA 1SMPI 5LKEA 2Z4IA 2KXPB 6PRNA 5LJDA 1EW3A 3L4RA 3OE3A 2YPVA 2A2UA 3N91A 4RJXA 1U17A 2ZAIA 3WJDA 3P02A 5D4AA 4IB7A 2QO6A 3FELA 4LSIA 3NADA 1JBHA 3WI5A 3KQ0A 4IB8A 1YWCA 3BLGA 4KRAA 4IAXA 5HCDC 3HWGA 2MM3A 4ORRA 1X8QA 4XMFA 1LICA 2MHLA 2OZQA 3AA1B 2KZ7B 3SY9A 1O1UA 2HLVA 3VZWX 1XCAA 3C78X 3AAEB 2JU7A 1BJ7A 3FR2A 3FEPA 3STNA 1FE3A 3G7GA 1A3YA 5HTEA 1ICMA 2XE3A 4AKRB 1GFQA 4IB9A 3UEXA 1ADLA 3BX7A 5B29A 4XNLA 3FEKA 3PP6A 3TGBA 1GX9A 1OBUA 1JIWI 3O2YA 3HWFA 3A2SX 3EMNX 4YKMA 4N7DA 1LIBA 3HWDA 1GFOA 4AZQA 2KXPA 2KT4B 4FMSA 2JMBA 2WEWA 4TLJA 4PJ2A 1TOUA 4YDBA 3VE2A 4AZOA 2Q9SA 3MBTA 3MVFA 3HK1A 4RUUA 4U8UN 1OEJA 1X8NA 4AKMA 3O19A 4YDAA 1RLBE 2Q2MA 4MIRA 3TGCA 1X89A 1FTPA 3F9DA 5AEOA 5F6BA 2IFBA 3FMZA 2M07A 3EBWA 1OPAA 2CZUA 3AA1A 2KZ7A 3RWXA 3ZW2A 4YFQA 3AAEA 1DFVA 2AT6X 1CRBA 2FTBA 1E5PA 4D6BA 4DQ4A 3S26A 5D48A 3VE1A 3U9PC 4GHBA 1SY3A 3FA8A 2LHFA 4OS0A 1KT4A 4KIIA 3POQA 4AZNA 1LPJA 1T68X 1DC9A 3ZUIA 3BDRA 1U18A 3HWEA 4YGHA 4F4BA 2RCQA 1BT9A 5FQ6E 2FLJA 3UU2A 2J4UP 5FFHA 5DL6A 3PQSA 2A2GA 4PSQA 4QZTA 4FZMA 4EFGA 4KH8A 4NNTA 3WXQA 3RSWA 8PRNA 3GE2A 2E4JA 3VG2A 3FYXA 1KT7A 3VZTX 4OMWA 1HXXA 2RCTA 4O4SA 4GCQA 7PRNA 1KQXA 2L68A 1VYGA 3OBLA 4TKJA 1BH3A 3PH6A 3POXA 1SY2A 2YMSA 4GF4A 2N93A 2XMXA 3B2HA 5ADXL 1SA8A 2ASNX 2L5PA 2PY1A 4GE1A 3VZUX 4RLBA 2OVDA 1AQBA 4ORYA 1HXUA 4Y0QA 1ACDA 1HXTA 4HFOA 4ZR2A 1LIFA 2A13A 4FGIB 4HPAA 2GTLO 3FYFA 3HTYA 4M6SA 1SXUA 1VYFA 2KTSA 3PECA 3VG5A 3BY0A 3FA9A 3H3IA 1AELA 1E06A 1YP6A 4TKBA 1YWBA 4AYID 3UEWA 5IYUA 4FT6A 2EU7X 3TGAA 2QTKA 3CR6A 4D5UA 4HPDA 4MVLA 4XMCA 2ERVA 2JMMA 4YGGA 4AYDC 3BSZE 1ALBA 3EBKA 3UPGA 1EQDA 1QJPA 4GH7A 3APVA 3SAOA 1BM5A 4RJWA 1PMPA 5HA1A 4OS3A 4AZMA 2JN3A 3G7XA 3BRNA 3SYBA 3CMPA 4NYRA 1GXAA 3FIQA 1DZJA 3HWBA 2LB6A 2OVSA 1OPFA 2CZTA 3B2JA 4IAWA 1KZWA 4O3ZA 1E02A 5D47A 5F58A 4CV7A 1I06A 2HNXA 5HA0A 1GKAA 2K23A 2KD2A 1MX7A 1OEEA 4NW4A 5AJCA 1SY1A 1T8VA 5CYBA 4AZPA 1Q9FA 3LK41 1I05A 5LJCA 5IO6A 1IKJA 4XMHA 2FGQX 4IBAA 4MVIA 5DL7A 1ML7A 4FRTA 5EEDA 5LKFA 1ZRYA 4B61A 4D6AA 3I0AA 2G7BA 4L1NA 4U3QA 4BUMX 3GAQA 2P8GA 1ZNHA 3PEDA 4ZHCA 2X45A 2OFMX 4LKPA 4TJZA 4YGZA 2JU3A 2WR6A 5G26A 2POAA 2ACPX 2XKLA 2LA7A 2W2BA 2M4LA 3D95A 2LFOA 3FR5A 5CE4A 5DL8A 2BT9A 4KCAA 2RQ0A 2AT5X 4I95A 1XKIA 1MUPA 3CQRA 1QJ8A 4EEJA 3I17A 4A8ZA 4O49A 3WBGA 3ZZVA 3APWA 3FR4A 3U03A 4UU3A 1JJJA 3RBYA 1BBPA 1DZPA 2RD7C 3EYCA 4I3DA 1BXWA 1A18A 4GCSA 4JCHA 1LF7A 5AFUK 2A0AA 3WJEA 3VPJE 2F73A 4N59A 3CWKA 2WUTA 3CBCA 4JGLA 1FEMA 2R74A 3B2KA 3DSZA 5FAZA 4EQAC 3VY9X 1EIOA 1MVGA 2ZAGA 2F1TA 4O4UA 1QFVA 4XNKA 1ZNEA 4TNNA 3WOVA 3BU9A 4YMYA 3JS1A 1OBPA 4QYNA 1KGLA 1Y9TA 1CBIA 1LIDA 4TKHA 1QG5A 2X8TA 3K3LA 3VU1A 4ML7B 3DA4A 1PM1X 4QQ1A 3D96A 2R73A 4YFPA 3NSGA 4KR8A 3T24A 2Y2XA 4ORUA 5EPQA 1EPBA 3RZYA 4ORXA 1YWAA 3AA0A 4QZUA 4ZGUA 3P24A 3RKGA 5KIDA 1R0UA 1QFTA 1IKEA 4QRLA 1B56A 1ZHXA 3QKGA 5HAEA 5L8OA 3WJGA 4GU8A 4ZH9A 1PHOA 4L3RA 4ORWA 4RLCA 1AB0A 3C5OA 2KC0A 2XE5A 1GM6A 3SYSA 2R56A 4LKTA 4CSBA 2GTLM 1BSQA 4GKCA 2FS7A 1FDQA 1GT4A 4AW8A 1HBPA 4FRXA 2JW1A 1DZKA 4QGXA 4LQZA 3PRNA 2BS5A 1QY0A 4NNSA 2NP1A 3UAQA 2GC9A 4RUNA 2JU8A 1QY2A 3JSQA 2Y0HA 4HPCA 2MHDA 5FQ7E 2GTLN 5AJBA 4QGVA 3PPTA 1O8VA 3C77X 1DF3A 2ALLX 4FUVA 2FT9A 4U9CA 2K4TA 2AT8X 4M7MA 2LBAA 4WFUA 5H8TA 4BOEA 4O3YA 1SXYA 1G85A 1N0SA 2MO5A 4CK4A 3VY8X 1GKAB 1IW2A 3WI4A 2WSJA 2MJIA 2O4VA 2KTDA 2HZRA 4GZVA 4LSFA 4O3XB 4IMNA 3IFBA 3DA3A 1B0OA 4RL9A 4A1YA 2AT0X 4ORSA 4ALOA 1DV9A 2MNHA 4GCPA 3ELXA 4GRJA 4G75A 2M06A 2Q2PA 1KQWA 1GFMA 2XG6A 2HMBA 3JQOA 1BLRA 4LZVA 1X8OA 1HMRA 4KC7A 4HPBA 3NQ9A 2OVAA 4FBOA 1A57A 1ZNGA 5JR8A 4LZUA 3NP1A 2AT3X 4IABA 4MISA 5HZQA 1U0XA 2X27X 3V8UA 1G90A 1UZ2X 2NNQA 5EEEA 4INNA 5T5FA 2OMFA 3NX1A 4O4OA 5EZ2A 2FR2A 5D45A 1PRNA 1KXOA 3O0EA 2W80C 3HW9A 2W2AA 1Q9GA 5LJBA 3TZGA 2Q39A 5BVTA 2FRSA 4I3CA 4ALBA 4YKOA 4GK9A 1NGLA 1HMTA 2QOSC 3APXA 4TQ2A 1GGLA 2PRNA 1BRPA 3LK2B 3LK3A 4E1SA 1EXSA 3FA7A 5IO7A 1MPFA 3T0SA 1Z24A 4XMEA 3FW4A 4WBKA 5HTDA 1BEBA 5HZ6A 3CBSA 1D3SA 2WQ9A 4EDEA 1OEKA 1X8UA 4UU2A 1GFPA 3PH5A 2BLGA 5F6ZA 1OSMA 4AZLA 3NQKA 2PORA 4KR4A 2OFRX 1KOIA 4IMOA 2XE2A 4GNYA 1MDCA 4LSEA 4BQUA 3FENA 2N2MA 3NBXX 2AL0X 2YG2A 2X8SA 4QGWA 3K19A 2QM9A 3TF6A 1MX8A 4ZHHA 5DPQA 1ZNDA 2RN4A 3EMMA 1TXLA 3AA0B 1GT3A 3UEVA 4GDZA 2CM9A 4ARHA 3WJCA 1PBOA 2RA6A 3ZUOA 1YS5A 1EALA 4FQBB 3KFGA 3P6GA 3AKNA 4Y0PA 4XMDA 1S7DA 3VG6A 3ZQ3A 1THQA 2A3FX 3KFFA 4O3WA 3PORA 5F7GA 1ZHWA 4N58A 3AA7A 1FELA 3OD9A 2QMIA 4NLJA 3S5VA 3STMX 1ZHTA 4ZHFA 4ON1A 2WWPA 4ODDA 4ZGFA 4R0BA 1BSOA 1KT5A 3ZI8A 1P6PA 4AUIA 5IO5A 1CJ5A 4N7CA 2O62A 4BVMA 2K0LA 1E00A 5HCEC 3LK2A 5AFUL 2L9CA 4Y0RA 5GV0A 1ERXA 2LKKA 1NP4A 2CBRA 4Y0SA 3AAAB 4G76A 4HWMA 3HOLA 2GE4A 2FR3A 2J1NA 5JDPA 5D8JA 3EM0A 3VG7A 3O22A 1QY1A 1S2PA 4IB6A 1TOWA 2BHVA 3ELZA 4YCEA 3WJBA 3ZWEA 5C0NA 3GP6A 1B4MA 1LKEA 2N2LA 3ZW0B 1BSYA 5BVQA 1QJ9A 3FW5A 3IA8A 1AVGI 2ANSA 1LFOA 2OVEA 1YIVA 2F1VA 1B8EA 1CBQA 5HZ8A 4OS8A 5L8IA 4FZNA 2NNEA 1G7NA 4OMXA 3T1DA 4I6SA 5H9AA 2XTQA 3QRCA 4U8UM 4PUXA 2Y0KA 4LSHA 3KFIA 4EXZA 1EPAA 2ZLDA 1ICNA 5HZ5A 3KVDD 3QRAA 1T0VA 1OBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PQU A;  5T5F A;  2W81 C;  3HOL A;  4O3Z A;  4O4U A;  4AYN A;  3VE2 A;  4O4X A;  4O3X B;  4AYI D;  3PQS A;  2W80 C;  4O49 A;  2Y7S A;  4QQ1 A;  1YS5 A;  4AYE C;  3UAQ A;  4Z3T A;  4AYD C;  4O3W A;  2LFU A;  4AYM C;  3HOE A;  2KDY A;  4U9C A;  5EE2 A;  4O3Y A;  2YPV A;  3KVD D;  3VE1 A;  3V8U A;  2KC0 A; 
#chains in the Genus database with same CATH topology
 4WHI A;  1LCW A;  2G8C O;  5L8N A;  3RE5 A;  4JNJ A;  1ZHY A;  1EII A;  1G5W A;  1S44 A;  4GGZ A;  1L6M A;  1WBI A;  1A2D A;  3AA6 B;  4U8U O;  3DTQ A;  4JFB A;  3T6L A;  2FKJ A;  2QOM A;  1E54 A;  4I3B A;  3POU A;  3SZV A;  5DL5 A;  1LUQ A;  1TVQ A;  1JYD A;  2IZE B;  1EUO A;  4E1T A;  2XST A;  1VPR A;  1QAB E;  3RDS A;  3DWN A;  1CBR A;  2FWV A;  2RTI B;  1H6S 1;  4N75 A;  4FSO A;  4FOZ A;  2W81 C;  2RTA A;  1IZN A;  1N7Y A;  2UZ2 A;  3OJY C;  1HXL A;  5DG4 A;  4AYH A;  5KIC A;  4YBP A;  3P6D A;  2FGR A;  1JYJ A;  4AZR A;  3LK4 2;  4WFV A;  5K06 A;  2Y0L A;  2OF9 A;  2G78 A;  3PQU A;  1HMS A;  3QQ2 A;  4D64 A;  4KC8 A;  2XE1 A;  2Q4N A;  2GJ5 A;  2DM5 A;  3TZS A;  1BWY A;  1VWH B;  1LNM A;  6PRN A;  4FBR A;  5LKE A;  1HXZ A;  1EW3 A;  2I5V O;  2A2U A;  3N91 A;  4RJX A;  4IB7 A;  1SWT A;  3FEL A;  1YWC A;  4FQE A;  2MHL A;  1SWH A;  2KZ7 B;  3SY9 A;  2JU7 A;  3T2X A;  3FR2 A;  5B29 A;  3PP6 A;  3TGB A;  3O2Y A;  3HWF A;  2IZF B;  2KXP A;  5KAI O;  1FJ1 E;  2WEW A;  3VE2 A;  2Q9S A;  1VYO A;  1E2T A;  1X8N A;  4AKM A;  3O19 A;  1RLB E;  3F9D A;  3FMZ A;  2AVI A;  4N74 A;  4YFQ A;  3AAE A;  1CRB A;  2RTD B;  4D6B A;  4DQ4 A;  5D48 A;  3VE1 A;  4GHB A;  4OS0 A;  1KT4 A;  4KII A;  3BDR A;  4YGH A;  4GDA A;  5FFH A;  2FKG A;  4EFG A;  4NNT A;  1MM9 A;  5B66 O;  4OMW A;  1HXX A;  4C4V A;  4TKJ A;  1BH3 A;  5B2A O;  2N93 A;  2ASN X;  2L5P A;  2RTK A;  2OVD A;  1LCZ A;  4ORY A;  1HXU A;  4Y0Q A;  3SLJ A;  2A13 A;  3VG5 A;  3HTY A;  1VYF A;  1Y55 X;  1YWB A;  1KFF A;  4XMC A;  1LEL A;  1VWK B;  1K3B A;  4YGG A;  4AYD C;  3UPG A;  1EQD A;  1QJP A;  4GH7 A;  3APV A;  3SAO A;  2JN3 A;  2LB6 A;  3EC5 A;  5H2F O;  5F58 A;  4CV7 A;  2IZI A;  2MF6 A;  2KD2 A;  1SY1 A;  5CYB A;  5LJC A;  1MEP A;  5IO6 A;  1JMX A;  5EED A;  4BX5 B;  1ZRY A;  4U3Q A;  4BUM X;  3GAQ A;  2X45 A;  4LKP A;  4YGZ A;  2WR6 A;  2XKL A;  2W2B A;  1SRJ A;  2M4L A;  3FR5 A;  2BT9 A;  2RQ0 A;  4CPF A;  2OFB A;  1RST B;  3PGU A;  1MUP A;  1QJ8 A;  4O49 A;  3ZZV A;  3FR4 A;  1JJJ A;  1BBP A;  1DZP A;  2RD7 C;  2A0A A;  4CDC A;  4OEM A;  1MOY A;  1FEM A;  2R74 A;  1MVG A;  1STP A;  1QFV A;  1AVD A;  1ZNE A;  1OBP A;  3X00 A;  4TKH A;  1QG5 A;  2X8T A;  3QRA A;  4QQ1 A;  4ORX A;  1RXK A;  1K24 A;  1B56 A;  4GUZ A;  3WJG A;  4ZH9 A;  1PHO A;  4L3R A;  4ORW A;  4OKA A;  2R56 A;  4CSB A;  2GTL M;  1FDQ A;  1GT4 A;  4C5P A;  1VWA B;  3LTW A;  3MG5 A;  5FQ7 E;  2GTL N;  3C77 X;  1DF3 A;  2FT9 A;  4WFU A;  5H8T A;  4BOE A;  2IWV A;  2FHN X;  1N0S A;  3VY8 X;  2R8A A;  1IW2 A;  3RDQ A;  3WI4 A;  4LSF A;  4O3X B;  3IFB A;  3DA3 A;  1B0O A;  4ORS A;  4ALO A;  3VHI A;  1DV9 A;  4GRJ A;  4G75 A;  1KQW A;  3VHH A;  3T6F A;  3SZI A;  4LZV A;  2Y3F A;  1X8O A;  3NQ9 A;  2OVA A;  1ZNG A;  4LZU A;  5HZQ A;  4K3C A;  4INN A;  5T5F A;  3NX1 A;  5EZ2 A;  2FR2 A;  1PRN A;  2W2A A;  1NQN A;  4YKO A;  4GK9 A;  2QOS C;  1GGL A;  1EXS A;  3FW4 A;  5K68 A;  1D3S A;  2WQ9 A;  5F6Z A;  3NQK A;  2POR A;  2OFR X;  4GNY A;  2N2M A;  2AL0 X;  4QGW A;  5DPQ A;  1ZND A;  3EMM A;  4BGF A;  3UEV A;  1PBO A;  1YS5 A;  4Y0P A;  4XMD A;  3ZQ3 A;  3POR A;  1FEL A;  2WWP A;  1BSO A;  4AUI A;  4BVM A;  1N4J A;  2K0L A;  5AFU L;  2L9C A;  2CBR A;  2OY1 O;  3HOL A;  5D8J A;  1TOW A;  3ZWE A;  1KL4 A;  1LDO A;  2X4M A;  5BVQ A;  3BRZ A;  3IA8 A;  1LFO A;  2OVE A;  1YIV A;  1CBQ A;  4G76 A;  4OMX A;  3T1D A;  4I6S A;  5H9A A;  4PUX A;  2ZLD A;  4IRW A;  3WZO A;  2WPU A;  5HA0 A;  1OBQ A;  3SY7 A;  3P6E A;  2RTB B;  5HWZ A;  5JD2 A;  1NQM A;  2ZFG A;  4MVE A;  4XMG A;  1RSU B;  4QNI A;  2FS6 A;  3KFH A;  1RBP A;  3U0D A;  5HZ9 A;  1KT3 A;  4I9S A;  1YP7 A;  3ZW0 A;  3BU1 A;  5EE2 A;  4GET A;  3D97 A;  1IZN B;  1HN2 A;  2X46 A;  5H9K A;  2NND A;  1YWD A;  1Y9L A;  5FEN A;  1I04 A;  4AYN A;  2ZSC A;  3LK3 B;  5L3Y A;  4MVK A;  3F8A A;  4YH0 A;  2L67 A;  3FA6 A;  3HOE A;  1KT6 A;  1GFN A;  3PGR A;  4ZHD A;  3FLL A;  1EI5 A;  4C00 A;  4A1H A;  3F6Z B;  4OEL A;  3P6H A;  2HZQ A;  3AA7 B;  2X32 A;  1X71 A;  2AMM X;  3WYP A;  1SWE A;  2BSZ A;  1MM5 A;  1HY2 A;  1IFB A;  4K19 A;  3CQN A;  3MX7 A;  1JJX A;  1SY0 A;  4QAE A;  4ZCB A;  5F1E A;  4ZFX A;  1CBS A;  5LJG A;  2ACO A;  5G38 A;  2LBV A;  3ZW1 A;  4O4X A;  5BVS A;  5LJE A;  1SWL A;  4GD9 A;  4FES A;  5LJH A;  4Z3T A;  1QWD A;  3RDX A;  1ORM A;  4ZH6 A;  1SWD A;  4QYP A;  4D65 A;  2W2F A;  3AEH A;  2JOZ A;  3SZH A;  2KXP B;  5LJD A;  3L4R A;  2YPV A;  1U17 A;  2ZAI A;  3WJD A;  5D4A A;  3CKF A;  4LSI A;  3NAD A;  2R4O A;  4KRA A;  4IAX A;  4ORR A;  1LIC A;  3RDO A;  4I60 A;  1XCA A;  2RTQ B;  3AAE B;  3STN A;  3G7G A;  1ICM A;  4K3B A;  2XE3 A;  4AKR B;  4IB9 A;  3FID A;  1OBU A;  3A2S X;  5B3M O;  4GJS A;  1LIB A;  3HWD A;  1GFO A;  4AZQ A;  2RTG B;  2JMB A;  4CDE A;  3MVF A;  4GJV A;  4RUU A;  4U8U N;  4C4V B;  2FGS A;  1T16 A;  4MIR A;  4IL6 O;  1X89 A;  5F6B A;  1OPA A;  2CZU A;  4BBO A;  2FTB A;  1E5P A;  1HQQ A;  3FA8 A;  1LPJ A;  2RCQ A;  4JO6 A;  5DL6 A;  2IZC B;  3PQS A;  4PSQ A;  1VWN B;  2IZH B;  1SWR A;  3WXQ A;  1SWU A;  1W6F A;  3GE2 A;  3PK2 A;  1VWF B;  1KT7 A;  3VZT X;  4O4S A;  4GCQ A;  1KQX A;  2L68 A;  3FDC A;  4GF4 A;  2YMS A;  2RTE B;  2XMX A;  2PY1 A;  3VZU X;  4RLB A;  1AQB A;  3WZN A;  4NV8 A;  4HPA A;  5HCD C;  2KTS A;  3BY0 A;  3FA9 A;  3H3I A;  1YP6 A;  4TKB A;  4U46 A;  2C1S A;  5IYU A;  2EU7 X;  3TGA A;  4D5U A;  4MVL A;  2ERV A;  2RTJ A;  3EBK A;  4GGT A;  1BM5 A;  1PMP A;  3G7X A;  2IZD B;  4YVB A;  1W5R A;  2HNX A;  2K23 A;  1MX7 A;  4NW4 A;  5AJC A;  4AZP A;  3LK4 1;  4MVI A;  1ML7 A;  2X34 A;  2A5C A;  1W4T A;  3I0A A;  4D6A A;  2P8G A;  4ZHC A;  2LA7 A;  3D95 A;  2LFO A;  1SRE A;  4KCA A;  2AT5 X;  4I95 A;  3CQR A;  5CHK A;  3WBG A;  3U03 A;  5E79 O;  2X55 A;  3WZP A;  4JCH A;  4GCS A;  1LF7 A;  2IZK A;  3VPJ E;  1SWF A;  4N59 A;  2WUT A;  4CPH A;  3DSZ A;  4EQA C;  1EIO A;  1SLE B;  3BU9 A;  3JS1 A;  4YMY A;  1KGL A;  1Y9T A;  3K3L A;  3VU1 A;  4YFP A;  1VWM B;  1Y53 X;  3RZY A;  3AA0 A;  4ZGU A;  3RKG A;  1LCV A;  1QFT A;  1AB0 A;  2FS7 A;  1DZK A;  4LQZ A;  1QY0 A;  2BC3 A;  4RUN A;  2JU8 A;  4BX7 A;  2Y0H A;  4HPC A;  5AJB A;  3PPT A;  2RTF B;  1SLG B;  1UYN X;  4UB6 O;  2MO5 A;  1GKA B;  2WSJ A;  2MJI A;  2O4V A;  1OSP O;  4IMN A;  4BX6 B;  2AT0 X;  2MNH A;  3EW1 A;  2M06 A;  1VWR B;  1GFM A;  1HMR A;  1A57 A;  1N43 A;  4FBO A;  5JR8 A;  3NP1 A;  4MIS A;  1U0X A;  2X27 X;  1UZ2 X;  2OMF A;  1PTS A;  1VWB B;  3HW9 A;  2VFB A;  2Y32 A;  5LJB A;  3TZG A;  5BVT A;  2OL8 O;  4I3C A;  3APX A;  1BRP A;  3FA7 A;  5IO7 A;  1Z24 A;  4XME A;  4WBK A;  3CBS A;  1VWE B;  2RTC B;  4EDE A;  4AZL A;  1OEK A;  4UU2 A;  3PH5 A;  2XE2 A;  1KOI A;  4BQU A;  3NBX X;  2YG2 A;  2X8S A;  3TF6 A;  4ZHH A;  2X9K A;  4ARH A;  1EAL A;  4FQB B;  3P6G A;  3AKN A;  1THQ A;  3VG6 A;  2A3F X;  3KFF A;  5F7G A;  2QMI A;  4NLJ A;  4ON1 A;  4ODD A;  1KT5 A;  1DF8 A;  1P6P A;  5IO5 A;  2O62 A;  5HCE C;  5GV0 A;  2LKK A;  3VG7 A;  4YCE A;  4IB6 A;  2BHV A;  3ELZ A;  2UYW A;  3ZW0 B;  1BSY A;  1B8E A;  1G7N A;  3RDM A;  2Y0K A;  4EXZ A;  5HZ5 A;  1T0V A;  3PGS A;  3SOT A;  1SXW A;  5AQ6 A;  5FQ8 E;  1GT5 A;  2WEX A;  3AKM A;  1JZU A;  5CSE A;  5D5D A;  3AAA A;  1KZX A;  4FBV A;  3WJF A;  2LFU A;  3P6C A;  1YUP A;  2KDY A;  3WVM A;  4ES7 A;  3STK A;  1IIU A;  3SZD A;  1ZNL A;  3APU A;  4I9R A;  4BCS A;  1GX3 A;  3T20 A;  2X8F A;  2MWH A;  2Y7S A;  4GNW A;  1HQP A;  5H9N A;  5PRN A;  5ADX K;  3S60 A;  2RTP B;  1TW4 A;  1GT1 A;  3AUM O;  1I4U A;  2HYS A;  3D4R A;  3C76 X;  3ZW1 B;  1NP1 A;  3VG3 A;  3NQ3 A;  2F1C X;  2F09 A;  5BYP A;  5LJK A;  4KT5 A;  1JV4 A;  1NDJ A;  2RTR B;  1LIE A;  1D2U A;  4ID2 A;  3RBH A;  1H91 A;  4FSP A;  4A60 A;  2WJQ A;  2XTR A;  2BS6 A;  1MM4 A;  1HBQ A;  5CE4 A;  2K62 A;  5EDB A;  1S5L O;  4YFR A;  1OPB A;  3KZA A;  4Z2P A;  1G74 A;  4ZJ0 A;  1GX8 A;  1ZNK A;  4COT A;  4DCB A;  4NP1 A;  1IFC A;  4AYM C;  3Q6L A;  2Z4I A;  5GTH O;  3OE3 A;  5G39 A;  3HWG A;  1X8Q A;  2OZQ A;  1O1U A;  3VZW X;  3C78 X;  1BJ7 A;  3FEP A;  1FE3 A;  1GFQ A;  1ADL A;  1JIW I;  4N7D A;  2KT4 B;  1VWP B;  4TLJ A;  4PJ2 A;  4AZO A;  4CTD A;  1I9H A;  4YDA A;  5TIS O;  3TGC A;  1JMZ A;  4JHQ A;  1FTP A;  5AEO A;  1SRH A;  2IFB A;  3EBW A;  3AA1 A;  3ZW2 A;  1DFV A;  2AT6 X;  5B10 O;  3U9P C;  2LHF A;  3POQ A;  1KL3 A;  3WU2 O;  1DC9 A;  4F4B A;  1U18 A;  5F2B A;  2GH7 A;  2FLJ A;  5FQ6 E;  3MM0 A;  3UU2 A;  2J4U P;  2A2G A;  4FZM A;  3VG2 A;  2E4J A;  7PRN A;  1VYG A;  1SY2 A;  4GE1 A;  1SRI A;  1STS B;  4HFO A;  1SWP A;  4FGI B;  3T2W A;  3FYF A;  3PEC A;  3SLT A;  3UEW A;  3CR6 A;  2JMM A;  3BSZ E;  1ALB A;  1JQP A;  4RJW A;  2CAM A;  5HA1 A;  3BRN A;  3SYB A;  3CMP A;  3FIQ A;  1DZJ A;  4B55 A;  3HWB A;  2OVS A;  1OPF A;  1VWI B;  4IAW A;  3B2J A;  1KL5 A;  1E02 A;  3RY2 A;  5D47 A;  1I06 A;  4Z28 A;  1OEE A;  1T8V A;  1SWG A;  2DJG A;  1IKJ A;  2IZJ A;  4IBA A;  2A5B A;  4CPH B;  5LKF A;  2AXT O;  4B61 A;  4L1N A;  2G7B A;  3PED A;  2OFM X;  1SWC A;  2JU3 A;  5G3A A;  2POA A;  2ACP X;  3BS0 A;  1XKI A;  4Z2O A;  4CDF A;  1MK5 A;  5KAF O;  4I3D A;  3EYC A;  1A18 A;  2F73 A;  2X56 A;  3PDF A;  3CWK A;  3CBC A;  4JGL A;  1RXH A;  3B2K A;  3VY9 X;  5FAZ A;  2G5L A;  4XNK A;  3HPE A;  3WOV A;  3DA4 A;  3NSG A;  3D96 A;  4KR8 A;  2Y2X A;  4ORU A;  1YWA A;  1R0U A;  4PJ0 O;  1IKE A;  1ZHX A;  2KC0 A;  2XE5 A;  1GM6 A;  5B5G A;  1BSQ A;  4AW8 A;  1VWJ B;  1HBP A;  4FRX A;  2JW1 A;  4NNS A;  1QY2 A;  4QGV A;  4FUV A;  2ALL X;  4M7M A;  2LBA A;  1T1L A;  2OF8 A;  1G85 A;  1VWG B;  2OFA A;  2KTD A;  2HZR A;  4GZV A;  3D9W A;  3KZI O;  4A1Y A;  3CKG A;  2XG6 A;  1BLR A;  1SRF A;  4KC7 A;  4HPB A;  4IAB A;  3V8U A;  1G90 A;  5EEE A;  4O4O A;  2AF5 A;  1SWS A;  3RY1 A;  4ALB A;  3LK3 A;  4TQ2 A;  3T0S A;  5HTD A;  1BEB A;  5HZ6 A;  2C1Q A;  1X8U A;  2BLG A;  1OSM A;  3Q34 A;  4KR4 A;  4IMO A;  3FEN A;  2JQY A;  1Y52 X;  1STR B;  2RN4 A;  5B5E O;  2CM9 A;  3WJC A;  3ZUO A;  1VWC B;  4Z2V A;  2A8G A;  3KVN A;  2WVP A;  1ZHW A;  3AA7 A;  3OD9 A;  1ZHT A;  4ZHF A;  4ZGF A;  3ZI8 A;  5B11 O;  1E00 A;  3LK2 A;  4Y0R A;  3AAA B;  4HWM A;  2OYB O;  2GE4 A;  2FR3 A;  2J1N A;  3A0H O;  1QY1 A;  3WJB A;  3GP6 A;  5C0N A;  2I5Z O;  1LKE A;  3FW5 A;  1AVG I;  3DZM A;  2IZG B;  4OS8 A;  4FZN A;  5B5F A;  4Z27 A;  2RTN B;  4O9S A;  4FZL A;  4NYQ A;  1SWQ A;  1ZHZ A;  4UB8 O;  4AYE C;  2OY5 O;  1QQS A;  3B2L A;  3BS2 A;  5KHP A;  3UEU A;  2AH7 X;  4AKR A;  1DZM A;  5H9L A;  2F01 A;  3NPO A;  2GTF X;  1URE A;  3JTY A;  1FEN A;  1SRG A;  3VHM A;  4AFK A;  1P4T A;  3BX8 A;  1O1V A;  5K67 A;  2CM4 A;  2ODJ A;  3E3C A;  3LV4 A;  4PR7 A;  1SWO A;  2Z4H A;  1N9Y A;  4DQ3 A;  2G79 A;  5EDC A;  3P6F A;  5HBS A;  4ZHG A;  4DNE A;  3AA6 A;  5GTI O;  1PEE A;  2QO4 A;  3S5X A;  5FVN A;  1BRQ A;  3A0B O;  4YBU A;  3VG4 A;  5HCC C;  3LHN A;  2R4P A;  3NX2 A;  5B27 A;  1X8P A;  2KW1 A;  2CBS A;  4NLI A;  2QO5 A;  1ERB A;  2YNK A;  1SXX A;  4YCH A;  1NBX A;  1I78 A;  3B2I A;  2AKQ A;  4C69 X;  4EKV A;  2Y3E A;  3NR3 A;  2WQA E;  1SMP I;  1SLF B;  2RTO B;  3P02 A;  2QO6 A;  1JBH A;  3WI5 A;  3KQ0 A;  4IB8 A;  3BLG A;  2DJF A;  2MM3 A;  1VWQ B;  4XMF A;  1SWB A;  3AA1 B;  2HLV A;  1A3Y A;  5HTE A;  3NJT A;  3UEX A;  2IZL B;  3BX7 A;  4XNL A;  3FEK A;  1RXJ A;  1GX9 A;  3DWO X;  4CDD A;  3EMN X;  4YKM A;  4CPE A;  2R88 A;  4YDB A;  1TOU A;  2IWW A;  3MBT A;  3HK1 A;  1OEJ A;  2Q2M A;  5IXG A;  1UYO X;  2M07 A;  1SLD B;  2KZ7 A;  3RWX A;  2R4L A;  3S26 A;  1SY3 A;  4BJ8 A;  4AZN A;  1T68 X;  3ZUI A;  3HWE A;  1BT9 A;  4QZT A;  4KH8 A;  3RSW A;  5IRU A;  8PRN A;  3FYX A;  2RCT A;  3POX A;  3OBL A;  3PH6 A;  2VFC A;  3B2H A;  5ADX L;  1SA8 A;  2JGS A;  1ACD A;  1HXT A;  4ZR2 A;  1LIF A;  3C5O A;  2GTL O;  4M6S A;  4FMS A;  1SXU A;  1AEL A;  1E06 A;  1RAV A;  4AYI D;  4FT6 A;  2R89 A;  2QTK A;  4HPD A;  2VDF A;  4GGR A;  4OS3 A;  4AZM A;  4NYR A;  1GXA A;  2CZT A;  1KZW A;  2FHL A;  4O3Z A;  2IZA A;  3EW2 A;  1LDQ A;  2OY7 A;  2IZB A;  1SWK A;  1GKA A;  1Q9F A;  1I05 A;  4XMH A;  3WZQ A;  2FGQ X;  3BRY A;  5IRW A;  5DL7 A;  1SWN A;  4FRT A;  4BX6 A;  1AVE A;  1ZNH A;  4TJZ A;  1JJU A;  5G26 A;  5DL8 A;  4EEJ A;  3I17 A;  4A8Z A;  3APW A;  4UU3 A;  3RBY A;  4Y59 A;  5AFU K;  1BXW A;  3WJE A;  3JCU O;  2OL7 A;  4BX5 A;  3RE6 A;  2ZAG A;  2F1T A;  4O4U A;  4TNN A;  4QYN A;  1CBI A;  1LID A;  4CPI A;  4ML7 B;  1PM1 X;  2R73 A;  5EPQ A;  5IRA A;  1VWL B;  1EPB A;  4QZU A;  2QCB A;  3P24 A;  5KID A;  4QRL A;  3QKG A;  5HAE A;  5L8O A;  4GU8 A;  3SZJ A;  4RLC A;  3RDU A;  1IJ8 A;  3SYS A;  3VGW A;  4LKT A;  1SWJ A;  4GKC A;  4QGX A;  3PRN A;  2OL6 O;  2BS5 A;  2NP1 A;  1PBY A;  3UAQ A;  2GC9 A;  3JSQ A;  2MHD A;  2HKD A;  1O8V A;  4U9C A;  2K4T A;  2AT8 X;  4O3Y A;  1SXY A;  4CK4 A;  3SLO A;  4NV7 A;  4RL9 A;  4GCP A;  3ELX A;  3PF1 A;  2Q2P A;  2R4N A;  2HMB A;  3JQO A;  1WUB A;  2PI3 O;  2AT3 X;  1VWO B;  1SWA A;  2NNQ A;  5D45 A;  1KXO A;  4Z6J A;  3O0E A;  2W80 C;  4MEE A;  1Q9G A;  2Q39 A;  2FRS A;  1NGL A;  1HMT A;  3LK2 B;  4E1S A;  2PRN A;  1MPF A;  1N9M A;  1GFP A;  1VWD B;  1MDC A;  3WYQ A;  4LSE A;  2WJR A;  3K19 A;  2QM9 A;  1MX8 A;  1TXL A;  3AA0 B;  1GT3 A;  2RTM A;  4GDZ A;  2RTH B;  2RA6 A;  3KFG A;  3T24 A;  1S7D A;  4O3W A;  4N58 A;  1NC9 A;  4Y5D A;  3S5V A;  3STM X;  4R0B A;  1CJ5 A;  4N7C A;  1ERX A;  1NP4 A;  4Y0S A;  2C4I A;  1Y0G A;  5JDP A;  4BX7 B;  3EM0 A;  3O22 A;  1S2P A;  1B4M A;  2N2L A;  1QJ9 A;  2ANS A;  2RTL A;  2F1V A;  5HZ8 A;  5L8I A;  2NNE A;  2XTQ A;  3QRC A;  4U8U M;  4LSH A;  3KFI A;  1EPA A;  1ICN A;  2OY8 A;  3KVD D; 
#chains in the Genus database with same CATH homology
 3SY7 A;  4O9S A;  3SOT A;  4WHI A;  1SXW A;  5AQ6 A;  4FZL A;  4NYQ A;  3P6E A;  5FQ8 E;  1GT5 A;  5HWZ A;  5L8N A;  1ZHZ A;  2ZFG A;  2WEX A;  3AKM A;  4MVE A;  4QNI A;  4XMG A;  1JZU A;  1ZHY A;  5D5D A;  2FS6 A;  3AAA A;  3KFH A;  1RBP A;  1KZX A;  4AYE C;  1EII A;  3U0D A;  4FBV A;  5HZ9 A;  1G5W A;  1S44 A;  3WJF A;  1KT3 A;  4I9S A;  3P6C A;  2LFU A;  1QQS A;  1YP7 A;  1L6M A;  1YUP A;  2KDY A;  3WVM A;  3ZW0 A;  3B2L A;  3BS2 A;  3BU1 A;  5EE2 A;  1A2D A;  3D97 A;  4GET A;  4U8U O;  5KHP A;  3AA6 B;  1IZN B;  1HN2 A;  3DTQ A;  4JFB A;  4ES7 A;  3UEU A;  2AH7 X;  2X46 A;  5H9K A;  2NND A;  1YWD A;  1E54 A;  3STK A;  1IIU A;  4AKR A;  4I3B A;  3POU A;  1DZM A;  5H9L A;  3SZV A;  3SZD A;  3NPO A;  5DL5 A;  2GTF X;  1TVQ A;  1Y9L A;  1URE A;  5FEN A;  1ZNL A;  1I04 A;  3APU A;  3JTY A;  4AYN A;  4I9R A;  1FEN A;  1JYD A;  3LK3 B;  3T20 A;  2X8F A;  2MWH A;  2Y7S A;  4GNW A;  4AFK A;  1HQP A;  5H9N A;  1P4T A;  5PRN A;  5ADX K;  3S60 A;  4MVK A;  1TW4 A;  3BX8 A;  3F8A A;  4YH0 A;  1GT1 A;  1EUO A;  1O1V A;  2L67 A;  3FA6 A;  4E1T A;  2XST A;  1VPR A;  1QAB E;  1I4U A;  3HOE A;  2CM4 A;  2HYS A;  1KT6 A;  1GFN A;  2ODJ A;  4ZHD A;  3FLL A;  3D4R A;  1EI5 A;  3E3C A;  3LV4 A;  3C76 X;  1CBR A;  3ZW1 B;  1NP1 A;  3VG3 A;  3NQ3 A;  2FWV A;  1H6S 1;  2Z4H A;  4A1H A;  3F6Z B;  4DQ3 A;  2G79 A;  5EDC A;  3P6H A;  3P6F A;  2HZQ A;  5HBS A;  4FOZ A;  4ZHG A;  2W81 C;  2F09 A;  4FSO A;  5BYP A;  3AA6 A;  5LJK A;  1IZN A;  4KT5 A;  1JV4 A;  1PEE A;  2QO4 A;  3OJY C;  3AA7 B;  3S5X A;  1LIE A;  1D2U A;  4ID2 A;  5FVN A;  3RBH A;  1H91 A;  1BRQ A;  4FSP A;  4A60 A;  5DG4 A;  4AYH A;  4YBU A;  1X71 A;  2AMM X;  5KIC A;  4YBP A;  2XTR A;  3VG4 A;  2BS6 A;  3P6D A;  1MM4 A;  1MM5 A;  2FGR A;  1HBQ A;  1JYJ A;  4AZR A;  1IFB A;  3LHN A;  5HCC C;  3LK4 2;  4K19 A;  4WFV A;  3NX2 A;  5B27 A;  1X8P A;  2K62 A;  2KW1 A;  3CQN A;  1SY0 A;  3MX7 A;  4QAE A;  5EDB A;  5K06 A;  1JJX A;  4ZCB A;  2Y0L A;  5F1E A;  4ZFX A;  2G78 A;  1CBS A;  4YFR A;  1OPB A;  3PQU A;  2ACO A;  5LJG A;  2CBS A;  3KZA A;  1HMS A;  4NLI A;  2LBV A;  2QO5 A;  1ERB A;  2YNK A;  1SXX A;  3ZW1 A;  4O4X A;  4YCH A;  5BVS A;  5LJE A;  4D64 A;  4KC8 A;  1G74 A;  2XE1 A;  2Q4N A;  4ZJ0 A;  1GX8 A;  2GJ5 A;  2DM5 A;  3B2I A;  2AKQ A;  4FES A;  5LJH A;  4C69 X;  4Z3T A;  1QWD A;  1ZNK A;  4COT A;  1ORM A;  4NP1 A;  3TZS A;  3NR3 A;  2WQA E;  1IFC A;  4ZH6 A;  1BWY A;  4AYM C;  4QYP A;  4D65 A;  2W2F A;  1LNM A;  2JOZ A;  4FBR A;  3Q6L A;  1SMP I;  5LKE A;  2Z4I A;  2KXP B;  6PRN A;  5LJD A;  1EW3 A;  3L4R A;  3OE3 A;  2YPV A;  2A2U A;  3N91 A;  4RJX A;  1U17 A;  2ZAI A;  3WJD A;  3P02 A;  5D4A A;  4IB7 A;  2QO6 A;  3FEL A;  4LSI A;  3NAD A;  1JBH A;  3WI5 A;  3KQ0 A;  4IB8 A;  1YWC A;  3BLG A;  4KRA A;  4IAX A;  5HCD C;  3HWG A;  2MM3 A;  4ORR A;  1X8Q A;  4XMF A;  1LIC A;  2MHL A;  2OZQ A;  3AA1 B;  2KZ7 B;  3SY9 A;  1O1U A;  2HLV A;  3VZW X;  1XCA A;  3C78 X;  3AAE B;  2JU7 A;  1BJ7 A;  3FR2 A;  3FEP A;  3STN A;  1FE3 A;  3G7G A;  1A3Y A;  5HTE A;  1ICM A;  2XE3 A;  4AKR B;  1GFQ A;  4IB9 A;  3UEX A;  1ADL A;  3BX7 A;  5B29 A;  4XNL A;  3FEK A;  3PP6 A;  3TGB A;  1GX9 A;  1OBU A;  1JIW I;  3O2Y A;  3HWF A;  3A2S X;  3EMN X;  4YKM A;  4N7D A;  1LIB A;  3HWD A;  1GFO A;  4AZQ A;  2KXP A;  2KT4 B;  4FMS A;  2JMB A;  2WEW A;  4TLJ A;  4PJ2 A;  1TOU A;  4YDB A;  3VE2 A;  4AZO A;  2Q9S A;  3MBT A;  3MVF A;  3HK1 A;  4RUU A;  4U8U N;  1OEJ A;  1X8N A;  4AKM A;  3O19 A;  4YDA A;  1RLB E;  2Q2M A;  4MIR A;  3TGC A;  1X89 A;  1FTP A;  3F9D A;  5AEO A;  5F6B A;  2IFB A;  3FMZ A;  2M07 A;  3EBW A;  1OPA A;  2CZU A;  3AA1 A;  2KZ7 A;  3RWX A;  3ZW2 A;  4YFQ A;  3AAE A;  1DFV A;  2AT6 X;  1CRB A;  2FTB A;  1E5P A;  4D6B A;  4DQ4 A;  3S26 A;  5D48 A;  3VE1 A;  3U9P C;  4GHB A;  1SY3 A;  3FA8 A;  2LHF A;  4OS0 A;  1KT4 A;  4KII A;  3POQ A;  4AZN A;  1LPJ A;  1T68 X;  1DC9 A;  3ZUI A;  3BDR A;  1U18 A;  3HWE A;  4YGH A;  4F4B A;  2RCQ A;  1BT9 A;  5FQ6 E;  2FLJ A;  3UU2 A;  2J4U P;  5FFH A;  5DL6 A;  3PQS A;  2A2G A;  4PSQ A;  4QZT A;  4FZM A;  4EFG A;  4KH8 A;  4NNT A;  3WXQ A;  3RSW A;  8PRN A;  3GE2 A;  2E4J A;  3VG2 A;  3FYX A;  1KT7 A;  3VZT X;  4OMW A;  1HXX A;  2RCT A;  4O4S A;  4GCQ A;  7PRN A;  1KQX A;  2L68 A;  1VYG A;  3OBL A;  4TKJ A;  1BH3 A;  3PH6 A;  3POX A;  1SY2 A;  2YMS A;  4GF4 A;  2N93 A;  2XMX A;  3B2H A;  5ADX L;  1SA8 A;  2ASN X;  2L5P A;  2PY1 A;  4GE1 A;  3VZU X;  4RLB A;  2OVD A;  1AQB A;  4ORY A;  1HXU A;  4Y0Q A;  1ACD A;  1HXT A;  4HFO A;  4ZR2 A;  1LIF A;  2A13 A;  4FGI B;  4HPA A;  2GTL O;  3FYF A;  3HTY A;  4M6S A;  1SXU A;  1VYF A;  2KTS A;  3PEC A;  3VG5 A;  3BY0 A;  3FA9 A;  3H3I A;  1AEL A;  1E06 A;  1YP6 A;  4TKB A;  1YWB A;  4AYI D;  3UEW A;  5IYU A;  4FT6 A;  2EU7 X;  3TGA A;  2QTK A;  3CR6 A;  4D5U A;  4HPD A;  4MVL A;  4XMC A;  2ERV A;  2JMM A;  4YGG A;  4AYD C;  3BSZ E;  1ALB A;  3EBK A;  3UPG A;  1EQD A;  1QJP A;  4GH7 A;  3APV A;  3SAO A;  1BM5 A;  4RJW A;  1PMP A;  5HA1 A;  4OS3 A;  4AZM A;  2JN3 A;  3G7X A;  3BRN A;  3SYB A;  3CMP A;  4NYR A;  1GXA A;  3FIQ A;  1DZJ A;  3HWB A;  2LB6 A;  2OVS A;  1OPF A;  2CZT A;  3B2J A;  4IAW A;  1KZW A;  4O3Z A;  1E02 A;  5D47 A;  5F58 A;  4CV7 A;  1I06 A;  2HNX A;  5HA0 A;  1GKA A;  2K23 A;  2KD2 A;  1MX7 A;  1OEE A;  4NW4 A;  5AJC A;  1SY1 A;  1T8V A;  5CYB A;  4AZP A;  1Q9F A;  3LK4 1;  1I05 A;  5LJC A;  5IO6 A;  1IKJ A;  4XMH A;  2FGQ X;  4IBA A;  4MVI A;  5DL7 A;  1ML7 A;  4FRT A;  5EED A;  5LKF A;  1ZRY A;  4B61 A;  4D6A A;  3I0A A;  2G7B A;  4L1N A;  4U3Q A;  4BUM X;  3GAQ A;  2P8G A;  1ZNH A;  3PED A;  4ZHC A;  2X45 A;  2OFM X;  4LKP A;  4TJZ A;  4YGZ A;  2JU3 A;  2WR6 A;  5G26 A;  2POA A;  2ACP X;  2XKL A;  2LA7 A;  2W2B A;  2M4L A;  3D95 A;  2LFO A;  3FR5 A;  5CE4 A;  5DL8 A;  2BT9 A;  4KCA A;  2RQ0 A;  2AT5 X;  4I95 A;  1XKI A;  1MUP A;  3CQR A;  1QJ8 A;  4EEJ A;  3I17 A;  4A8Z A;  4O49 A;  3WBG A;  3ZZV A;  3APW A;  3FR4 A;  3U03 A;  4UU3 A;  1JJJ A;  3RBY A;  1BBP A;  1DZP A;  2RD7 C;  3EYC A;  4I3D A;  1BXW A;  1A18 A;  4GCS A;  4JCH A;  1LF7 A;  5AFU K;  2A0A A;  3WJE A;  3VPJ E;  2F73 A;  4N59 A;  3CWK A;  2WUT A;  3CBC A;  4JGL A;  1FEM A;  2R74 A;  3B2K A;  3DSZ A;  5FAZ A;  4EQA C;  3VY9 X;  1EIO A;  1MVG A;  2ZAG A;  2F1T A;  4O4U A;  1QFV A;  4XNK A;  1ZNE A;  4TNN A;  3WOV A;  3BU9 A;  4YMY A;  3JS1 A;  1OBP A;  4QYN A;  1KGL A;  1Y9T A;  1CBI A;  1LID A;  4TKH A;  1QG5 A;  2X8T A;  3K3L A;  3VU1 A;  4ML7 B;  3DA4 A;  1PM1 X;  4QQ1 A;  3D96 A;  2R73 A;  4YFP A;  3NSG A;  4KR8 A;  3T24 A;  2Y2X A;  4ORU A;  5EPQ A;  1EPB A;  3RZY A;  4ORX A;  1YWA A;  3AA0 A;  4QZU A;  4ZGU A;  3P24 A;  3RKG A;  5KID A;  1R0U A;  1QFT A;  1IKE A;  4QRL A;  1B56 A;  1ZHX A;  3QKG A;  5HAE A;  5L8O A;  3WJG A;  4GU8 A;  4ZH9 A;  1PHO A;  4L3R A;  4ORW A;  4RLC A;  1AB0 A;  3C5O A;  2KC0 A;  2XE5 A;  1GM6 A;  3SYS A;  2R56 A;  4LKT A;  4CSB A;  2GTL M;  1BSQ A;  4GKC A;  2FS7 A;  1FDQ A;  1GT4 A;  4AW8 A;  1HBP A;  4FRX A;  2JW1 A;  1DZK A;  4QGX A;  4LQZ A;  3PRN A;  2BS5 A;  1QY0 A;  4NNS A;  2NP1 A;  3UAQ A;  2GC9 A;  4RUN A;  2JU8 A;  1QY2 A;  3JSQ A;  2Y0H A;  4HPC A;  2MHD A;  5FQ7 E;  2GTL N;  5AJB A;  4QGV A;  3PPT A;  1O8V A;  3C77 X;  1DF3 A;  2ALL X;  4FUV A;  2FT9 A;  4U9C A;  2K4T A;  2AT8 X;  4M7M A;  2LBA A;  4WFU A;  5H8T A;  4BOE A;  4O3Y A;  1SXY A;  1G85 A;  1N0S A;  2MO5 A;  4CK4 A;  3VY8 X;  1GKA B;  1IW2 A;  3WI4 A;  2WSJ A;  2MJI A;  2O4V A;  2KTD A;  2HZR A;  4GZV A;  4LSF A;  4O3X B;  4IMN A;  3IFB A;  3DA3 A;  1B0O A;  4RL9 A;  4A1Y A;  2AT0 X;  4ORS A;  4ALO A;  1DV9 A;  2MNH A;  4GCP A;  3ELX A;  4GRJ A;  4G75 A;  2M06 A;  2Q2P A;  1KQW A;  1GFM A;  2XG6 A;  2HMB A;  3JQO A;  1BLR A;  4LZV A;  1X8O A;  1HMR A;  4KC7 A;  4HPB A;  3NQ9 A;  2OVA A;  4FBO A;  1A57 A;  1ZNG A;  5JR8 A;  4LZU A;  3NP1 A;  2AT3 X;  4IAB A;  4MIS A;  5HZQ A;  1U0X A;  2X27 X;  3V8U A;  1G90 A;  1UZ2 X;  2NNQ A;  5EEE A;  4INN A;  5T5F A;  2OMF A;  3NX1 A;  4O4O A;  5EZ2 A;  2FR2 A;  5D45 A;  1PRN A;  1KXO A;  3O0E A;  2W80 C;  3HW9 A;  2W2A A;  1Q9G A;  5LJB A;  3TZG A;  2Q39 A;  5BVT A;  2FRS A;  4I3C A;  4ALB A;  4YKO A;  4GK9 A;  1NGL A;  1HMT A;  2QOS C;  3APX A;  4TQ2 A;  1GGL A;  2PRN A;  1BRP A;  3LK2 B;  3LK3 A;  4E1S A;  1EXS A;  3FA7 A;  5IO7 A;  1MPF A;  3T0S A;  1Z24 A;  4XME A;  3FW4 A;  4WBK A;  5HTD A;  1BEB A;  5HZ6 A;  3CBS A;  1D3S A;  2WQ9 A;  4EDE A;  1OEK A;  1X8U A;  4UU2 A;  1GFP A;  3PH5 A;  2BLG A;  5F6Z A;  1OSM A;  4AZL A;  3NQK A;  2POR A;  4KR4 A;  2OFR X;  1KOI A;  4IMO A;  2XE2 A;  4GNY A;  1MDC A;  4LSE A;  4BQU A;  3FEN A;  2N2M A;  3NBX X;  2AL0 X;  2YG2 A;  2X8S A;  4QGW A;  3K19 A;  2QM9 A;  3TF6 A;  1MX8 A;  4ZHH A;  5DPQ A;  1ZND A;  2RN4 A;  3EMM A;  1TXL A;  3AA0 B;  1GT3 A;  3UEV A;  4GDZ A;  2CM9 A;  4ARH A;  3WJC A;  1PBO A;  2RA6 A;  3ZUO A;  1YS5 A;  1EAL A;  4FQB B;  3KFG A;  3P6G A;  3AKN A;  4Y0P A;  4XMD A;  1S7D A;  3VG6 A;  3ZQ3 A;  1THQ A;  2A3F X;  3KFF A;  4O3W A;  3POR A;  5F7G A;  1ZHW A;  4N58 A;  3AA7 A;  1FEL A;  3OD9 A;  2QMI A;  4NLJ A;  3S5V A;  3STM X;  1ZHT A;  4ZHF A;  4ON1 A;  2WWP A;  4ODD A;  4ZGF A;  4R0B A;  1BSO A;  1KT5 A;  3ZI8 A;  1P6P A;  4AUI A;  5IO5 A;  1CJ5 A;  4N7C A;  2O62 A;  4BVM A;  2K0L A;  1E00 A;  5HCE C;  3LK2 A;  5AFU L;  2L9C A;  4Y0R A;  5GV0 A;  1ERX A;  2LKK A;  1NP4 A;  2CBR A;  4Y0S A;  3AAA B;  4G76 A;  4HWM A;  3HOL A;  2GE4 A;  2FR3 A;  2J1N A;  5JDP A;  5D8J A;  3EM0 A;  3VG7 A;  3O22 A;  1QY1 A;  1S2P A;  4IB6 A;  1TOW A;  2BHV A;  3ELZ A;  4YCE A;  3WJB A;  3ZWE A;  5C0N A;  3GP6 A;  1B4M A;  1LKE A;  2N2L A;  3ZW0 B;  1BSY A;  5BVQ A;  1QJ9 A;  3FW5 A;  3IA8 A;  1AVG I;  2ANS A;  1LFO A;  2OVE A;  1YIV A;  2F1V A;  1B8E A;  1CBQ A;  5HZ8 A;  4OS8 A;  5L8I A;  4FZN A;  2NNE A;  1G7N A;  4OMX A;  3T1D A;  4I6S A;  5H9A A;  2XTQ A;  3QRC A;  4U8U M;  4PUX A;  2Y0K A;  4LSH A;  3KFI A;  4EXZ A;  1EPA A;  2ZLD A;  1ICN A;  5HZ5 A;  3KVD D;  3QRA A;  1T0V A;  1OBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...