3HOEA

Crystal structure of surface lipoprotein
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
242
structure length
242
Chain Sequence
EPALGYVVKVPVSSFENKKVDISDIEVITNGNLDDVPYKANSSKYNYPDIKTKDSSLQYVRSGYVIDGEHSGSNEKGYVYYKGNSPAKELPVNQLLTYTGSWDFTSNANLNNEEGRPNYLNDDYYTKFIGKRVGLVSGDAKPAKHKYTSQFEVDFATKKMTGKLSDKEKTIYTVNADIRGNRFTGAATASDKNKGKGESYNFFSADSQSLEGGFYGPKAEEMAGKFVANDKSLFAVFSAKHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the bacterial transferrin receptor: the structure of transferrin-binding protein B from Actinobacillus pleuropneumoniae.
pubmed doi rcsb
source organism Actinobacillus pleuropneumoniae
molecule tags Transport protein
molecule keywords TbpB
total genus 61
structure length 242
sequence length 242
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 3hoeA01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 3hoeA02
2LFUA 3HOEA 4AYEC 4Z3TA 3KVDD 4AYMC 4AYNA 3HOLA 4O3XB 2KC0A 4O4UA 4AYDC 4QQ1A 5T5FA 3VE1A 2W80C 4AYID 2W81C 4O49A 4O3ZA 2YPVA 3VE2A 4U9CA 5EE2A 3V8UA 3UAQA 4O3WA 2Y7SA 1YS5A 2KDYA 3PQSA 4O3YA 3PQUA 4O4XA
chains in the Genus database with same CATH superfamily
2IZJA 5H9NA 3RSWA 4UB6O 4KCAA 4BBOA 2WJQA 1SWOA 2HZQA 3S5VA 2OMFA 2KD2A 3ELXA 3C76X 3FR2A 2NP1A 1MM4A 3NJTA 2QO4A 1HMRA 2BT9A 4YKOA 3BDRA 2JN3A 3APWA 5BVSA 4KT5A 2GE4A 2Y2XA 5H9LA 2KXPB 1O8VA 4LZUA 1K3BA 1ZNEA 1SWAA 4LKTA 3VZTX 4D65A 5IO6A 2OL7A 2AVIA 1RBPA 5F6BA 3WI5A 2IWWA 1N4JA 4Z2PA 4Z2VA 2F01A 2JQYA 2I5ZO 4KR8A 1N9YA 4ORWA 3U03A 4F4BA 2OFAA 5FFHA 4ARHA 2AH7X 3VE2A 1LIDA 1VWHB 1MVGA 2WSJA 1KZXA 4BOEA 2XSTA 2G8CO 1KT4A 4JO6A 5L8IA 4FZLA 1N0SA 2IZFB 4GJVA 2RTOB 2J4UP 2FS7A 2YG2A 3CKFA 5CSEA 1YWAA 3FIQA 4AZQA 2F09A 2X34A 3PECA 1HY2A 4O4UA 3KFHA 4I6SA 4AW8A 1GGLA 1WUBA 3BRNA 4EXZA 1B4MA 4HFOA 3UEXA 5FQ6E 3JTYA 4D6AA 1DFVA 2Q2PA 2IZCB 5BVTA 1S7DA 3VPJE 3SY9A 4LSFA 1YIVA 2BSZA 4NYQA 3T1DA 4FBRA 2QOMA 4ALOA 4DQ4A 1GT1A 4E1SA 2RTBB 4ZHDA 1VWMB 1OEKA 1SWLA 4JGLA 1W6FA 2QM9A 1D3SA 4FZNA 2XTQA 3KZIO 5TISO 5ADXL 1GXAA 4GKCA 2F1VA 5T5FA 1OPAA 1RLBE 2ACPX 3WZPA 3ZUIA 5H9KA 4QZUA 3PORA 2ZSCA 1HXZA 3POQA 4ID2A 3D97A 1OBQA 1GX8A 5IO7A 5FQ8E 2OVEA 3F6ZB 1SWFA 1KOIA 1QFVA 4G76A 1ERXA 3CQRA 2PI3O 2E4JA 4BX7A 4C4VB 4C5PA 5HTEA 1ZHZA 1XKIA 2ACOA 2FKJA 4AKRB 1QJ8A 2N2MA 4ODDA 1NBXA 1SXWA 5FENA 1SY3A 1MEPA 3PGSA 4EKVA 4ES7A 1LIBA 1JYDA 2FT9A 4O3ZA 3LV4A 4M7MA 3VGWA 1BM5A 5LJHA 3LK2A 3DSZA 4GRJA 4EQAC 1E00A 5F7GA 4NP1A 3MVFA 2ZFGA 3B2LA 3VE1A 3AA0B 5DG4A 3RDUA 3ZI8A 1JIWI 3RWXA 2GJ5A 3KZAA 3AA1B 5IRAA 3ZW0B 1VWNB 1GFMA 1ZNDA 2A5CA 3L4RA 4GGTA 4XMCA 3RDXA 2M07A 5K06A 4MISA 4NV8A 4RL9A 3NADA 1X8QA 3FEKA 1RAVA 2XTRA 1VWLB 4HWMA 3RY2A 1IZNB 4U8UO 3BS0A 4XMFA 4YCHA 4GDZA 2RN4A 5D5DA 2JW1A 3OE3A 1LUQA 2Y7SA 3WVMA 1TVQA 3JCUO 1A57A 2FGRA 5LKEA 2ASNX 4IB7A 3VG4A 3RY1A 1G7NA 3AA7A 3TGAA 4ORYA 5EZ2A 4TKJA 1BSOA 3WZNA 1SWRA 2O4VA 4TQ2A 1E54A 1A2DA 1BSYA 2AT3X 5LKFA 5B11O 1UYOX 4GETA 3FW5A 1Y9TA 3KFFA 4AYHA 1VWFB 3P6EA 1ZNHA 1YWBA 2DJGA 1NQMA 2RTLA 3FR5A 5EEDA 2ANSA 2W80C 1B56A 3DZMA 4XMEA 1KZWA 2MHDA 4YBPA 3BSZE 3HWDA 3WJDA 5GV0A 1FENA 1Y9LA 5DL6A 1A18A 1VWJB 3UEWA 1IKJA 1T0VA 5IRUA 4ORUA 1SWGA 3AA6B 4YVBA 4ZHCA 2QO5A 1JMZA 1GX3A 5HA0A 1FDQA 2WQAE 4B61A 4YCEA 1ZHYA 4AYNA 1SWHA 2KC0A 1RXHA 3MX7A 4HPCA 3NX2A 4A1YA 4AYDC 1ORMA 2POAA 3AA1A 1PBOA 4TNNA 1THQA 1NQNA 1SWJA 5IRWA 4CDEA 3NQKA 1VWIB 5IXGA 2RTQB 3FYXA 1QJPA 1SXYA 1VWCB 3BU9A 1SWPA 1GKAB 4ORSA 4CK4A 1MM9A 4CPIA 4B55A 5HZ8A 4QAEA 1YS5A 4FRTA 3BU1A 4O9SA 1SWNA 4C00A 1E2TA 3FA7A 1LNMA 3NSGA 1SWQA 4ZHGA 2JU7A 2BHVA 4TKBA 8PRNA 2PORA 5EDBA 1ZNKA 1GFNA 4JNJA 1EALA 3QQ2A 3AAAA 5BYPA 2JOZA 5JD2A 2RTPB 4NNTA 4AZRA 2GTLM 2EU7X 2QMIA 3IFBA 3RE6A 3D9WA 4MVIA 3MBTA 1W5RA 2JU8A 4BCSA 5B66O 3P6DA 3EM0A 4N75A 4AYEC 3JSQA 4HPDA 4I95A 2R74A 5B5EO 2R4NA 2AT8X 4FSOA 4QYNA 2W2BA 5B2AO 2IZBA 4RUUA 3P6GA 1NP1A 1ACDA 1AQBA 1EPAA 1IFBA 3LK42 1T68X 2IZKA 1VWBB 1MX8A 1SLGB 1ZNGA 4CDCA 2RTIB 2C1QA 2RTGB 4K3CA 2DM5A 1JJUA 1RSTB 4YDAA 3O19A 2XE1A 3P02A 2CBSA 2BS6A 3FDCA 1AVEA 1EW3A 3SZJA 3WYQA 1T16A 1AVDA 2WEWA 1RXKA 1X71A 2KT4B 4I9RA 3GAQA 1N43A 1GT5A 4OMWA 4AUIA 3PRNA 3WYPA 5H2FO 3FENA 1HXLA 4FBOA 3VZUX 5CE4A 4D5UA 3BY0A 1VWPB 2OF8A 4YGGA 2X9KA 4WFUA 4IRWA 1EI5A 4Y0QA 2BLGA 4AKMA 3HW9A 3SYBA 1STPA 4ALBA 4YGHA 2JU3A 1GM6A 1MDCA 1OBPA 6PRNA 5B10O 1W4TA 4UU3A 2WWPA 3KFIA 1VWOB 2IZEB 3CQNA 3QRAA 1SY1A 1SWTA 3WZQA 3UAQA 1ZHWA 2ODJA 1X8UA 3I17A 4PUXA 4O3XB 3A2SX 5HA1A 5HZ5A 4GCQA 3CBCA 5HZ9A 3P6FA 4AZOA 3STMX 2JMBA 3AAAB 1OSPO 2G7BA 1KXOA 4QNIA 2HKDA 2A5BA 1Y55X 4U8UM 1S2PA 1X89A 4AYMC 1SLFB 5KIDA 4BX5A 3K19A 4O4OA 5D4AA 5LJCA 4EDEA 1MPFA 2KZ7B 4BX7B 2MO5A 2KXPA 4U8UN 1ERBA 2X27X 3PQSA 4ORXA 3SY7A 3MG5A 3ZWEA 3FLLA 4MVLA 5KHPA 2HMBA 3JQOA 4OKAA 2M06A 3VHMA 1G5WA 4Z27A 5ADXK 3TGCA 1KT3A 2W81C 2R88A 4GE1A 3LK2B 4Y59A 3CKGA 1CJ5A 4CDFA 1EQDA 1QQSA 4FBVA 4ZHFA 2XG6A 5LJKA 1CBSA 3C5OA 1RSUB 3AKNA 4Z6JA 1HMTA 2OF9A 1NDJA 2Q39A 4K19A 1I9HA 5IYUA 1HN2A 4OS0A 1LICA 1HBQA 4PR7A 2BC3A 2IZHB 4ZCBA 2FWVA 2CM4A 3NP1A 4KC8A 3APVA 3WJBA 1S44A 3MM0A 4KIIA 1LELA 2IFBA 1LIEA 1JMXA 4IMOA 2PRNA 3A0BO 3FMZA 3PPTA 4YKMA 1A3YA 4N58A 1HMSA 3EBKA 2AT5X 3PGUA 3BS2A 4U3QA 3PQUA 1EUOA 5E79O 2JMMA 4MEEA 5L8NA 4IL6O 1SXXA 2Y0LA 2Y0HA 3PH5A 4GU8A 4L3RA 1PMPA 2P8GA 3DWOX 1VPRA 4I3BA 3ZUOA 1MK5A 4ML7B 5C0NA 4KH8A 2FHLA 1CBQA 2A2UA 3SZVA 1BLRA 2UYWA 4LZVA 2KTSA 1NC9A 3DTQA 3EYCA 1OEJA 3EC5A 1WBIA 3HWEA 2AF5A 2L68A 1XCAA 1BT9A 1UZ2X 2RTHB 3SAOA 3TZSA 1HQQA 5DL5A 3AEHA 2NNDA 1FELA 3TGBA 3TF6A 4IB9A 1JBHA 4JHQA 1SWUA 3WXQA 1U17A 4IBAA 5HZ6A 2OVAA 4GCSA 1SWCA 2YPVA 3HTYA 2FHNX 2LB6A 5G38A 2LA7A 2OY8A 2WUTA 4GGRA 1VWQB 3RDSA 4NW4A 2W2FA 3VZWX 2CZTA 4HPAA 1KGLA 4FUVA 4R0BA 4WBKA 2MNHA 4LQZA 1SRJA 3VG2A 2WVPA 1PBYA 4OEMA 1QG5A 2OY1O 1HXTA 3T24A 4D64A 1MOYA 1IJ8A 1IIUA 1SA8A 1SXUA 2RTMA 3DA4A 3STNA 2X55A 4YH0A 4PSQA 2FLJA 1D2UA 5EDCA 2LHFA 1SRGA 2JGSA 2I5VO 4GNWA 5EE2A 1CBIA 3Q34A 1SWSA 1PTSA 2IZDB 2RTFB 2AT0X 1KT5A 4PJ0O 3RKGA 2N2LA 4MVEA 5FAZA 3UU2A 4FQEA 2GTLO 4CTDA 1SRFA 3T2WA 3NQ3A 5CYBA 1HQPA 1QY2A 5L3YA 2FKGA 2NNQA 4ZH9A 2C4IA 1N7YA 2RQ0A 4GD9A 3SYSA 1VWEB 1JJJA 2Q9SA 3HWGA 3O2YA 1SWBA 3APUA 2X8SA 2Z4IA 1EPBA 5H9AA 3T6LA 4JFBA 1PM1X 2VFBA 4I60A 4GH7A 3LK41 2FS6A 2IZIA 3H3IA 4BGFA 4XMHA 4YFQA 4Y0RA 4JCHA 2FR2A 3SZHA 4QGWA 4QYPA 1OSMA 3NPOA 1P4TA 2UZ2A 1VWAB 3G7GA 2GTFX 4CPFA 5LJDA 4CPHB 2LKKA 1CBRA 3QKGA 1X8NA 1ML7A 4GGZA 2R8AA 3BRYA 4AZLA 4O4XA 1KQWA 3APXA 3B2IA 4Y5DA 3AUMO 4FZMA 1Z24A 1VWDB 1DC9A 3PDFA 1E02A 4O49A 1UYNX 2IZGB 1DV9A 3T6FA 5GTHO 2OFRX 1OBUA 1G90A 3I0AA 3FA9A 3WZOA 4ON1A 4QQ1A 4I3DA 3VHHA 4NLJA 4GF4A 3UPGA 3VG6A 2MHLA 1GT3A 4ZGFA 5H8TA 4COTA 2IZLB 1GFQA 2OVDA 2ALLX 4RLBA 3WJFA 1KL3A 5KAIO 1Y52X 1VYFA 3PK2A 3D4RA 2RA6A 4FQBB 1GT4A 4Y0PA 3FR4A 4AYID 2RTKA 3LK3A 5LJEA 4YDBA 3NQ9A 3VU1A 3OJYC 3Q6LA 5D48A 2Y3FA 1YWCA 1TOWA 4XMDA 4ZJ0A 3DWNA 1QY1A 1AELA 4MIRA 4CDDA 3FIDA 3RBYA 1BXWA 2Y32A 5FQ7E 1SWDA 1MX7A 4UB8O 3POXA 2X56A 3D96A 1LFOA 4Z3TA 1VYGA 4FSPA 1EXSA 4KR4A 4LSEA 3K3LA 1YUPA 2OL8O 3S26A 5GTIO 3EMMA 4QZTA 5K68A 2F1CX 5KICA 1BSQA 5EEEA 4TJZA 1PEEA 3AA0A 5AJCA 1NGLA 5K67A 1HXXA 1IKEA 3B2HA 2F1TA 3CMPA 3VY8X 3AA6A 5DL8A 3PGRA 4YMYA 3QRCA 5IO5A 1SRHA 1SY2A 4Z2OA 4NLIA 4G75A 2FR3A 2X4MA 2L5PA 4AZNA 3EW1A 1SWKA 2FGQX 2RTRB 2OVSA 3AAEB 2RTEB 3WJCA 4CPEA 3LTWA 3ZW0A 1O1UA 5HTDA 4RJXA 1KL5A 1SLDB 2G78A 1VWKB 3SOTA 1U0XA 2R73A 1MM5A 1H91A 1DZMA 1SMPI 2A0AA 4IMNA 1LDOA 4C69X 5LJGA 1FEMA 4YFRA 5G39A 3FW4A 3RDQA 5AJBA 2GC9A 2K23A 2IZAA 1HBPA 4RLCA 2LFUA 3PF1A 3HWFA 3DA3A 1GX9A 4N74A 2YMSA 1R0UA 4N7DA 3VHIA 3RDMA 2NNEA 3C77X 3VG7A 1AB0A 3OD9A 1B0OA 4ZHHA 5JDPA 4O4SA 1BRQA 3PP6A 1DZJA 4BX5B 1LDQA 2MM3A 2Z4HA 1BEBA 5HZQA 3CWKA 2MF6A 3UEVA 5HCCC 2RTDB 4KRAA 3SZIA 1ZRYA 4A60A 3FYFA 2XE5A 4Y0SA 3GE2A 3SLOA 2R4PA 3VY9X 1OPFA 5AQ6A 2RTNB 3AKMA 1BWYA 2M4LA 1I4UA 3BRZA 5HBSA 2RCQA 1LIFA 3FA6A 4BX6B 1SRIA 1YWDA 1Q9FA 1PRNA 3WI4A 4BX6A 4EFGA 4IB8A 1GFOA 1JV4A 2ZAIA 2LBVA 1B8EA 5AFUK 3E3CA 2R89A 1TOUA 2QOSC 2AXTO 1UREA 3KQ0A 5F58A 4FRXA 2FRSA 2OY7A 2Y3EA 5FVNA 1Q9GA 3RDOA 2GTLN 3AA7B 4O3YA 1MUPA 1T8VA 1JZUA 1LCZA 1O1VA 2FGSA 4DNEA 2FTBA 1TXLA 4U46A 3WOVA 1X8PA 2AT6X 4KC7A 4CPHA 4I9SA 1H6S1 2BS5A 1DZPA 4U9CA 4TLJA 4CV7A 3ZQ3A 2OL6O 3RZYA 1STRB 2RD7C 3CBSA 4OS3A 5DL7A 2X8FA 1NP4A 1BBPA 3KVNA 4IAXA 1LKEA 2F73A 1VWRB 4AZPA 4K3BA 3T2XA 5HCDC 1TW4A 4L1NA 2A2GA 2K62A 4AFKA 3F9DA 2QTKA 3JS1A 4OS8A 2DJFA 3ZW1B 1LF7A 5EPQA 3BX7A 3WJGA 4GDAA 4PJ2A 3RBHA 3KFGA 3OBLA 3V8UA 4O3WA 1K24A 1SREA 2KDYA 2R4LA 5BVQA 3VG5A 2HLVA 4ZGUA 3O22A 1OPBA 4RUNA 3KVDD 1ICMA 2Q2MA 4XNKA 1KT6A 1QY0A 5B27A 2WJRA 4GCPA 4NV7A 2Y0KA 4OMXA 3O0EA 5KAFO 4DCBA 4AZMA 4A1HA 3HK1A 1IW2A 3EMNX 4WFVA 1GKAA 1BJ7A 1I05A 4TKHA 1Y0GA 3C78X 1KT7A 1E06A 3X00A 2HZRA 3NX1A 4FESA 5AFUL 4EEJA 1N9MA 1I04A 5D45A 4ZH6A 4YBUA 2KTDA 2XE2A 3FA8A 2CAMA 2WEXA 4FT6A 1L6MA 3NR3A 1HXUA 1QABE 2MJIA 2VFCA 3TZGA 3VG3A 5F1EA 3WU2O 2XKLA 1SWEA 3N91A 3BX8A 5L8OA 4BJ8A 4YFPA 2AL0X 5DPQA 3P24A 1STSB 5HCEC 2KZ7A 2WQ9A 1FJ1E 4FGIB 2XE3A 2X45A 1YP6A 2PY1A 3T0SA 5F2BA 3HOEA 2ERVA 3F8AA 3SLJA 2LFOA 3ZW1A 3T20A 1GFPA 2WPUA 2LBAA 4M6SA 5B29A 4Z28A 3U9PC 5G3AA 4INNA 2ZAGA 2W2AA 4UU2A 3FEPA 4I3CA 2G5LA 2VDFA 2A3FX 3P6CA 1JQPA 3UEUA 3LK3B 2CZUA 1SY0A 3B2KA 2MWHA 1SLEB 3EBWA 1FE3A 3ZZVA 4ORRA 1PHOA 5JR8A 4C4VA 2QCBA 3BLGA 2HYSA 3EW2A 3FELA 2OYBO 2XMXA 1ZHTA 2HNXA 2C1SA 4QGVA 4MVKA 4N7CA 2AMMX 2OFBA 4IAWA 1IZNA 5G26A 1S5LO 3HWBA 2RCTA 1LCVA 4BUMX 1QFTA 4DQ3A 5LJBA 2K4TA 2OY5O 2IWVA 1X8OA 4GHBA 1ZNLA 4NNSA 4GUZA 2X46A 1E5PA 1FTPA 2OFMX 4QRLA 1DF8A 1I78A 4CSBA 1DF3A 4GJSA 4HPBA 1AVGI 2WR6A 1LCWA 2R4OA 3WBGA 3CR6A 4OELA 5D8JA 1Y53X 2RTJA 1BRPA 2A8GA 3G7XA 4NYRA 5CHKA 1DZKA 1JYJA 4GNYA 1LPJA 2AKQA 3LHNA 4LSHA 1KFFA 3B2JA 5F6ZA 3STKA 1ADLA 5B3MO 4IB6A 4D6BA 4FOZA 2X32A 1CRBA 1EIOA 4N59A 2X8TA 2RTCB 1EIIA 3AAEA 1ICNA 3SZDA 2G79A 1IFCA 2N93A 5PRNA 1U18A 5HAEA 2R56A 2ZLDA 3POUA 3NBXX 4LKPA 4ZR2A 2Q4NA 3S5XA 3PEDA 2O62A 2J1NA 4E1TA 1OEEA 1QWDA 4ZFXA 4QGXA 5B5GA 3P6HA 1YP7A 2QO6A 1QJ9A 3PH6A 1ALBA 4A8ZA 1I06A 4XMGA 4BVMA 3HOLA 3ZW2A 2OZQA 1BH3A 3RE5A 4BQUA 4RJWA 7PRNA 4YGZA 4GZVA 1VYOA 5HWZA 3ELZA 4GK9A 1JJXA 2CBRA 3HPEA 5B5FA 1P6PA 2GH7A 3WJEA 2A13A 2K0LA 3S60A 2L67A 3U0DA 1KQXA 1KL4A 3IA8A 4WHIA 2KW1A 1G74A 1VWGB 5D47A 1G85A 2L9CA 2RTAA 3GP6A 4FMSA 4AKRA 4IABA 4XNLA 3SLTA 4LSIA 2CM9A 3D95A 1RXJA 2YNKA 1T1LA 1ZHXA 3A0HO 5AEOA
chains in the Genus database with same CATH topology
1MUPA 1T8VA 5H9NA 3RSWA 1O1VA 1JZUA 3FA7A 4D64A 1LNMA 3NSGA 2FTBA 4KCAA 4ZHGA 1TXLA 3WOVA 1X8PA 1IIUA 1SA8A 1SXUA 3DA4A 2AT6X 3STNA 2JU7A 4KC7A 2BHVA 4YH0A 4TKBA 4PSQA 2HZQA 3S5VA 4I9SA 1H6S1 2FLJA 1D2UA 5EDCA 2PORA 5EDBA 8PRNA 1ZNKA 2LHFA 2OMFA 2BS5A 1GFNA 1EALA 1DZPA 4GNWA 4U9CA 2KD2A 3ELXA 5EE2A 1CBIA 3C76X 3FR2A 5BYPA 2NP1A 3AAAA 1MM4A 2JOZA 2QO4A 4NNTA 4TLJA 4CV7A 3ZQ3A 1HMRA 2AT0X 3RZYA 2BT9A 4YKOA 1KT5A 2RD7C 4AZRA 2GTLM 3BDRA 3CBSA 2JN3A 4OS3A 5DL7A 3APWA 5BVSA 4KT5A 2GE4A 3RKGA 2X8FA 2N2LA 4MVEA 2EU7X 5FAZA 3UU2A 2QMIA 3IFBA 2Y2XA 2GTLO 1NP4A 5H9LA 2KXPB 1BBPA 4IAXA 1O8VA 4LZUA 4MVIA 1LKEA 1ZNEA 3MBTA 2F73A 4AZPA 5HCDC 1TW4A 3NQ3A 5CYBA 1HQPA 4LKTA 3VZTX 1QY2A 4L1NA 2JU8A 2A2GA 4D65A 5IO6A 2K62A 4AFKA 2NNQA 4ZH9A 1RBPA 3F9DA 3P6DA 5F6BA 3WI5A 3EM0A 2RQ0A 2QTKA 4AYEC 3JS1A 3JSQA 4OS8A 4HPDA 4I95A 1JJJA 3SYSA 2Q9SA 2R74A 3HWGA 2AT8X 4KR8A 3O2YA 4ORWA 4FSOA 3U03A 4QYNA 1LF7A 3ZW1B 3APUA 2X8SA 2W2BA 3BX7A 5EPQA 4F4BA 2Z4IA 1EPBA 4RUUA 3WJGA 3P6GA 1NP1A 1ACDA 5FFHA 5H9AA 1AQBA 1EPAA 4ARHA 1IFBA 4JFBA 4PJ2A 1PM1X 3LK42 2AH7X 1T68X 3VE2A 3RBHA 1LIDA 3KFGA 3OBLA 4GH7A 3V8UA 2FS6A 4O3WA 3LK41 3H3IA 2KDYA 1MX8A 1ZNGA 5BVQA 1MVGA 4XMHA 2WSJA 1KZXA 4YFQA 4Y0RA 4JCHA 3VG5A 2HLVA 4ZGUA 3O22A 1OPBA 4RUNA 4BOEA 1ICMA 3KVDD 2Q2MA 2XSTA 4XNKA 2FR2A 1KT6A 2DM5A 1QY0A 5B27A 4QGWA 1KT4A 4GCPA 4QYPA 5L8IA 2Y0KA 4FZLA 4OMXA 3O0EA 1OSMA 4AZMA 3NPOA 4YDAA 3O19A 4A1HA 1P4TA 1N0SA 3HK1A 1IW2A 2XE1A 3EMNX 4WFVA 1GKAA 1I05A 1BJ7A 3P02A 4TKHA 3G7GA 2CBSA 2BS6A 3C78X 2GTFX 1KT7A 2J4UP 1E06A 5LJDA 2FS7A 1EW3A 2LKKA 1CBRA 2YG2A 3QKGA 1X8NA 1ML7A 2HZRA 1YWAA 3FIQA 2WEWA 3NX1A 4FESA 4AZLA 4O4XA 5AFUL 4EEJA 1KQWA 1X71A 2KT4B 3APXA 3B2IA 4I9RA 4AZQA 3GAQA 2F09A 4FZMA 1I04A 1Z24A 3PECA 5D45A 4O4UA 3KFHA 1GT5A 4YBUA 4ZH6A 1DC9A 4OMWA 4AUIA 3PRNA 4I6SA 4AW8A 2KTDA 1E02A 1GGLA 3BRNA 2XE2A 4EXZA 1B4MA 3FA8A 4O49A 1DV9A 4HFOA 3UEXA 5FQ6E 2WEXA 3JTYA 4D6AA 3FENA 4FT6A 1L6MA 3NR3A 1HXUA 1QABE 2MJIA 1DFVA 3TZGA 2Q2PA 2OFRX 1OBUA 3VG3A 5BVTA 5F1EA 1G90A 4FBOA 3VZUX 3I0AA 3FA9A 2XKLA 1S7DA 5CE4A 4D5UA 3VPJE 3BY0A 4ON1A 4YGGA 3N91A 3BX8A 4QQ1A 5L8OA 4I3DA 4WFUA 3SY9A 4LSFA 1YIVA 4NLJA 4YFPA 2AL0X 5DPQA 1EI5A 3P24A 4NYQA 4Y0QA 2BLGA 3T1DA 4FBRA 5HCEC 3HW9A 4ALOA 2WQ9A 1GT1A 4FGIB 4DQ4A 4ZHDA 2KZ7A 4GF4A 3SYBA 2XE3A 1OEKA 2X45A 4ALBA 3VG6A 4JGLA 3UPGA 2MHLA 1GT3A 4YGHA 1YP6A 4ZGFA 2JU3A 2PY1A 2QM9A 1D3SA 5H8TA 1GM6A 1MDCA 4COTA 1OBPA 2OVDA 1GFQA 3T0SA 4FZNA 2ALLX 2XTQA 3HOEA 6PRNA 4RLBA 2ERVA 3WJFA 5ADXL 3F8AA 2LFOA 1VYFA 1GXAA 4GKCA 3ZW1A 3D4RA 4UU3A 3T20A 2RA6A 4FQBB 2F1VA 5T5FA 1GFPA 1OPAA 1RLBE 2ACPX 2LBAA 1GT4A 2WWPA 3KFIA 3CQNA 3FR4A 4M6SA 4Y0PA 4AYID 3ZUIA 5H9KA 3LK3A 5B29A 5LJEA 1SY1A 4QZUA 4YDBA 3PORA 3QRAA 3U9PC 3NQ9A 3UAQA 3VU1A 3OJYC 3Q6LA 4INNA 2ZAGA 1ZHWA 5D48A 2W2AA 3POQA 4UU2A 2ODJA 1YWCA 3FEPA 1TOWA 1X8UA 3I17A 3D97A 4I3CA 4ID2A 4XMDA 4ZJ0A 1OBQA 4PUXA 1GX8A 1QY1A 4O3XB 5IO7A 5FQ8E 2OVEA 3F6ZB 1AELA 2A3FX 3P6CA 1KOIA 3UEUA 4MIRA 3A2SX 5HA1A 5HZ5A 1QFVA 4GCQA 4G76A 3LK3B 1ERXA 2CZUA 3CQRA 1SY0A 3RBYA 2E4JA 3B2KA 1BXWA 2MWHA 3CBCA 3EBWA 5FQ7E 1MX7A 5HZ9A 3POXA 1FE3A 3P6FA 4AZOA 3STMX 2JMBA 3D96A 3ZZVA 3AAAB 1LFOA 2G7BA 1KXOA 5HTEA 1ZHZA 4QNIA 4Z3TA 4ORRA 1PHOA 5JR8A 1XKIA 2ACOA 1VYGA 4U8UM 3BLGA 4AKRB 1QJ8A 1S2PA 2N2MA 1X89A 2HYSA 4ODDA 4AYMC 4FSPA 5KIDA 3FELA 3K19A 1EXSA 1SXWA 4KR4A 4O4OA 5FENA 4LSEA 5D4AA 1SY3A 3K3LA 5LJCA 1YUPA 4EDEA 4ES7A 1LIBA 1MPFA 2XMXA 1ZHTA 2KZ7B 1JYDA 3S26A 2FT9A 2HNXA 4QGVA 4O3ZA 3EMMA 2MO5A 4MVKA 4QZTA 2KXPA 3LV4A 4N7CA 4M7MA 4U8UN 2AMMX 1ERBA 1BM5A 2X27X 4IAWA 1IZNA 5KICA 5G26A 5LJHA 3PQSA 4ORXA 3SY7A 3HWBA 1BSQA 2RCTA 3LK2A 3ZWEA 3DSZA 3FLLA 4MVLA 4BUMX 1QFTA 4GRJA 4DQ3A 5LJBA 5EEEA 4TJZA 4EQAC 5KHPA 2HMBA 1PEEA 1E00A 3JQOA 5F7GA 4NP1A 2K4TA 3MVFA 2M06A 3AA0A 1X8OA 5AJCA 1ZNLA 4NNSA 4GHBA 1NGLA 2X46A 1E5PA 2ZFGA 1G5WA 1FTPA 5ADXK 3B2LA 2OFMX 3VE1A 5DG4A 1HXXA 3AA0B 4QRLA 3ZI8A 1IKEA 1JIWI 3B2HA 1KT3A 3RWXA 3TGCA 2F1TA 3CMPA 2W81C 3VY8X 3AA6A 4CSBA 4GE1A 2GJ5A 3KZAA 1DF3A 3AA1B 3LK2B 5DL8A 4HPBA 4YMYA 3QRCA 3ZW0B 5IO5A 1AVGI 1CJ5A 1EQDA 1QQSA 1SY2A 2WR6A 4FBVA 1GFMA 4ZHFA 4NLIA 1ZNDA 3L4RA 4G75A 4XMCA 2M07A 5K06A 4MISA 4RL9A 2FR3A 2XG6A 3WBGA 3NADA 1X8QA 3FEKA 3CR6A 2XTRA 5LJKA 1CBSA 4HWMA 5D8JA 3C5OA 2L5PA 4AZNA 1IZNB 4U8UO 2FGQX 3AKNA 1BRPA 1HMTA 4XMFA 4YCHA 2OVSA 4GDZA 2Q39A 4K19A 3AAEB 5IYUA 1HN2A 3G7XA 2RN4A 5D5DA 4OS0A 3WJCA 1LICA 1HBQA 2JW1A 4NYRA 3ZW0A 1O1UA 3OE3A 5HTDA 4RJXA 2Y7SA 4ZCBA 3WVMA 1TVQA 2FWVA 2G78A 1DZKA 1JYJA 2CM4A 3NP1A 1A57A 2FGRA 5LKEA 4GNYA 2ASNX 4IB7A 4KC8A 3SOTA 3APVA 3VG4A 1LPJA 1U0XA 2R73A 3WJBA 1H91A 1G7NA 1DZMA 1S44A 2AKQA 1SMPI 4KIIA 1MM5A 3AA7A 3TGAA 3LHNA 4LSHA 2A0AA 4ORYA 5EZ2A 2IFBA 1LIEA 3B2JA 4TKJA 4IMNA 4IMOA 5F6ZA 1BSOA 3STKA 4C69X 2PRNA 3FMZA 5LJGA 3PPTA 4YKMA 2O4VA 4TQ2A 1ADLA 1A3YA 1FEMA 4N58A 4IB6A 1E54A 4YFRA 1HMSA 3EBKA 4D6BA 1A2DA 3FW4A 1BSYA 4FOZA 2AT3X 2AT5X 5LKFA 5AJBA 1CRBA 2GC9A 2K23A 3BS2A 4U3QA 1EIOA 3PQUA 1EUOA 1HBPA 4GETA 4RLCA 2LFUA 2JMMA 4N59A 2X8TA 5L8NA 3FW5A 1EIIA 3AAEA 1SXXA 1Y9TA 1ICNA 3KFFA 2G79A 4AYHA 3SZDA 3HWFA 2Y0LA 1IFCA 3P6EA 2Y0HA 2N93A 3DA3A 1GX9A 1ZNHA 1YWBA 5PRNA 1U18A 5HAEA 2R56A 3FR5A 3PH5A 2YMSA 1R0UA 4GU8A 5EEDA 2ZLDA 3POUA 2ANSA 4N7DA 2W80C 3NBXX 4L3RA 1PMPA 2P8GA 1B56A 1VPRA 4XMEA 4LKPA 4I3BA 4ZR2A 2Q4NA 3ZUOA 3S5XA 1KZWA 3PEDA 2NNEA 2O62A 3C77X 3VG7A 2J1NA 4E1TA 1AB0A 1OEEA 1QWDA 2MHDA 4ML7B 5C0NA 4ZFXA 4QGXA 4KH8A 3P6HA 1CBQA 1YP7A 3OD9A 2QO6A 3BSZE 2A2UA 4YBPA 1QJ9A 3SZVA 4AKMA 3PH6A 1ALBA 3HWDA 1I06A 3WJDA 4XMGA 4A8ZA 1FENA 1BLRA 4BVMA 5GV0A 4LZVA 2KTSA 3HOLA 1B0OA 3DTQA 4ZHHA 3EYCA 1Y9LA 3ZW2A 1A18A 2OZQA 1BH3A 1OEJA 5DL6A 5JDPA 4O4SA 1BRQA 3PP6A 1DZJA 3HWEA 3UEWA 2L68A 1XCAA 1BT9A 1IKJA 1T0VA 4BQUA 4RJWA 1UZ2X 4ORUA 7PRNA 3AA6B 4YGZA 2MM3A 2Z4HA 1BEBA 5HZQA 3CWKA 4GZVA 3SAOA 4ZHCA 3TZSA 3UEVA 2QO5A 5HWZA 3ELZA 4GK9A 1JJXA 5DL5A 5HCCC 2CBRA 4KRAA 2NNDA 5HA0A 1FDQA 2WQAE 1FELA 4B61A 1ZRYA 4A60A 3TGBA 1P6PA 3TF6A 4YCEA 4IB9A 3FYFA 1ZHYA 1JBHA 4AYNA 2XE5A 2KC0A 3MX7A 4Y0SA 3GE2A 4HPCA 3WJEA 3NX2A 2A13A 4A1YA 4AYDC 3VY9X 3WXQA 1ORMA 1OPFA 2POAA 3AA1A 2K0LA 1U17A 5AQ6A 3AKMA 1PBOA 2M4LA 4IBAA 1I4UA 2L67A 4TNNA 3S60A 5HZ6A 3U0DA 1BWYA 1THQA 1KQXA 3IA8A 5HBSA 2OVAA 4WHIA 4GCSA 2RCQA 2YPVA 2KW1A 3HTYA 1G74A 4E1SA 1LIFA 2LB6A 3FA6A 5D47A 1G85A 2LA7A 2L9CA 3GP6A 4FMSA 1YWDA 4AKRA 2WUTA 1Q9FA 4IABA 1PRNA 3NQKA 3WI4A 4EFGA 4IB8A 1GFOA 1JV4A 4NW4A 2W2FA 2ZAIA 1B8EA 2LBVA 3E3CA 3FYXA 2CZTA 4XNLA 3VZWX 5AFUK 1TOUA 2QOSC 1QJPA 1SXYA 4HPAA 1UREA 1KGLA 4FUVA 3KQ0A 4R0BA 4WBKA 5F58A 2MNHA 4FRXA 4LSIA 2CM9A 2FRSA 3BU9A 4LQZA 5FVNA 3D95A 1Q9GA 1GKAB 4ORSA 3VG2A 4CK4A 5HZ8A 2YNKA 2GTLN 4QAEA 1ZHXA 1YS5A 4FRTA 1QG5A 3AA7B 3BU1A 5AEOA 4O3YA 1HXTA 3T24A 4O9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LFU A;  3HOE A;  4AYE C;  4Z3T A;  3KVD D;  4AYM C;  4AYN A;  3HOL A;  4O3X B;  2KC0 A;  4O4U A;  4AYD C;  4QQ1 A;  5T5F A;  3VE1 A;  2W80 C;  4AYI D;  2W81 C;  4O49 A;  4O3Z A;  2YPV A;  3VE2 A;  4U9C A;  5EE2 A;  3V8U A;  3UAQ A;  4O3W A;  2Y7S A;  1YS5 A;  2KDY A;  3PQS A;  4O3Y A;  3PQU A;  4O4X A; 
#chains in the Genus database with same CATH topology
 2IZJ A;  5H9N A;  3RSW A;  4UB6 O;  4KCA A;  4BBO A;  2WJQ A;  1SWO A;  2HZQ A;  3S5V A;  2OMF A;  2KD2 A;  3ELX A;  3C76 X;  3FR2 A;  2NP1 A;  1MM4 A;  3NJT A;  2QO4 A;  1HMR A;  2BT9 A;  4YKO A;  3BDR A;  2JN3 A;  3APW A;  5BVS A;  4KT5 A;  2GE4 A;  2Y2X A;  5H9L A;  2KXP B;  1O8V A;  4LZU A;  1K3B A;  1ZNE A;  1SWA A;  4LKT A;  3VZT X;  4D65 A;  5IO6 A;  2OL7 A;  2AVI A;  1RBP A;  5F6B A;  3WI5 A;  2IWW A;  1N4J A;  4Z2P A;  4Z2V A;  2F01 A;  2JQY A;  2I5Z O;  4KR8 A;  1N9Y A;  4ORW A;  3U03 A;  4F4B A;  2OFA A;  5FFH A;  4ARH A;  2AH7 X;  3VE2 A;  1LID A;  1VWH B;  1MVG A;  2WSJ A;  1KZX A;  4BOE A;  2XST A;  2G8C O;  1KT4 A;  4JO6 A;  5L8I A;  4FZL A;  1N0S A;  2IZF B;  4GJV A;  2RTO B;  2J4U P;  2FS7 A;  2YG2 A;  3CKF A;  5CSE A;  1YWA A;  3FIQ A;  4AZQ A;  2F09 A;  2X34 A;  3PEC A;  1HY2 A;  4O4U A;  3KFH A;  4I6S A;  4AW8 A;  1GGL A;  1WUB A;  3BRN A;  4EXZ A;  1B4M A;  4HFO A;  3UEX A;  5FQ6 E;  3JTY A;  4D6A A;  1DFV A;  2Q2P A;  2IZC B;  5BVT A;  1S7D A;  3VPJ E;  3SY9 A;  4LSF A;  1YIV A;  2BSZ A;  4NYQ A;  3T1D A;  4FBR A;  2QOM A;  4ALO A;  4DQ4 A;  1GT1 A;  4E1S A;  2RTB B;  4ZHD A;  1VWM B;  1OEK A;  1SWL A;  4JGL A;  1W6F A;  2QM9 A;  1D3S A;  4FZN A;  2XTQ A;  3KZI O;  5TIS O;  5ADX L;  1GXA A;  4GKC A;  2F1V A;  5T5F A;  1OPA A;  1RLB E;  2ACP X;  3WZP A;  3ZUI A;  5H9K A;  4QZU A;  3POR A;  2ZSC A;  1HXZ A;  3POQ A;  4ID2 A;  3D97 A;  1OBQ A;  1GX8 A;  5IO7 A;  5FQ8 E;  2OVE A;  3F6Z B;  1SWF A;  1KOI A;  1QFV A;  4G76 A;  1ERX A;  3CQR A;  2PI3 O;  2E4J A;  4BX7 A;  4C4V B;  4C5P A;  5HTE A;  1ZHZ A;  1XKI A;  2ACO A;  2FKJ A;  4AKR B;  1QJ8 A;  2N2M A;  4ODD A;  1NBX A;  1SXW A;  5FEN A;  1SY3 A;  1MEP A;  3PGS A;  4EKV A;  4ES7 A;  1LIB A;  1JYD A;  2FT9 A;  4O3Z A;  3LV4 A;  4M7M A;  3VGW A;  1BM5 A;  5LJH A;  3LK2 A;  3DSZ A;  4GRJ A;  4EQA C;  1E00 A;  5F7G A;  4NP1 A;  3MVF A;  2ZFG A;  3B2L A;  3VE1 A;  3AA0 B;  5DG4 A;  3RDU A;  3ZI8 A;  1JIW I;  3RWX A;  2GJ5 A;  3KZA A;  3AA1 B;  5IRA A;  3ZW0 B;  1VWN B;  1GFM A;  1ZND A;  2A5C A;  3L4R A;  4GGT A;  4XMC A;  3RDX A;  2M07 A;  5K06 A;  4MIS A;  4NV8 A;  4RL9 A;  3NAD A;  1X8Q A;  3FEK A;  1RAV A;  2XTR A;  1VWL B;  4HWM A;  3RY2 A;  1IZN B;  4U8U O;  3BS0 A;  4XMF A;  4YCH A;  4GDZ A;  2RN4 A;  5D5D A;  2JW1 A;  3OE3 A;  1LUQ A;  2Y7S A;  3WVM A;  1TVQ A;  3JCU O;  1A57 A;  2FGR A;  5LKE A;  2ASN X;  4IB7 A;  3VG4 A;  3RY1 A;  1G7N A;  3AA7 A;  3TGA A;  4ORY A;  5EZ2 A;  4TKJ A;  1BSO A;  3WZN A;  1SWR A;  2O4V A;  4TQ2 A;  1E54 A;  1A2D A;  1BSY A;  2AT3 X;  5LKF A;  5B11 O;  1UYO X;  4GET A;  3FW5 A;  1Y9T A;  3KFF A;  4AYH A;  1VWF B;  3P6E A;  1ZNH A;  1YWB A;  2DJG A;  1NQM A;  2RTL A;  3FR5 A;  5EED A;  2ANS A;  2W80 C;  1B56 A;  3DZM A;  4XME A;  1KZW A;  2MHD A;  4YBP A;  3BSZ E;  3HWD A;  3WJD A;  5GV0 A;  1FEN A;  1Y9L A;  5DL6 A;  1A18 A;  1VWJ B;  3UEW A;  1IKJ A;  1T0V A;  5IRU A;  4ORU A;  1SWG A;  3AA6 B;  4YVB A;  4ZHC A;  2QO5 A;  1JMZ A;  1GX3 A;  5HA0 A;  1FDQ A;  2WQA E;  4B61 A;  4YCE A;  1ZHY A;  4AYN A;  1SWH A;  2KC0 A;  1RXH A;  3MX7 A;  4HPC A;  3NX2 A;  4A1Y A;  4AYD C;  1ORM A;  2POA A;  3AA1 A;  1PBO A;  4TNN A;  1THQ A;  1NQN A;  1SWJ A;  5IRW A;  4CDE A;  3NQK A;  1VWI B;  5IXG A;  2RTQ B;  3FYX A;  1QJP A;  1SXY A;  1VWC B;  3BU9 A;  1SWP A;  1GKA B;  4ORS A;  4CK4 A;  1MM9 A;  4CPI A;  4B55 A;  5HZ8 A;  4QAE A;  1YS5 A;  4FRT A;  3BU1 A;  4O9S A;  1SWN A;  4C00 A;  1E2T A;  3FA7 A;  1LNM A;  3NSG A;  1SWQ A;  4ZHG A;  2JU7 A;  2BHV A;  4TKB A;  8PRN A;  2POR A;  5EDB A;  1ZNK A;  1GFN A;  4JNJ A;  1EAL A;  3QQ2 A;  3AAA A;  5BYP A;  2JOZ A;  5JD2 A;  2RTP B;  4NNT A;  4AZR A;  2GTL M;  2EU7 X;  2QMI A;  3IFB A;  3RE6 A;  3D9W A;  4MVI A;  3MBT A;  1W5R A;  2JU8 A;  4BCS A;  5B66 O;  3P6D A;  3EM0 A;  4N75 A;  4AYE C;  3JSQ A;  4HPD A;  4I95 A;  2R74 A;  5B5E O;  2R4N A;  2AT8 X;  4FSO A;  4QYN A;  2W2B A;  5B2A O;  2IZB A;  4RUU A;  3P6G A;  1NP1 A;  1ACD A;  1AQB A;  1EPA A;  1IFB A;  3LK4 2;  1T68 X;  2IZK A;  1VWB B;  1MX8 A;  1SLG B;  1ZNG A;  4CDC A;  2RTI B;  2C1Q A;  2RTG B;  4K3C A;  2DM5 A;  1JJU A;  1RST B;  4YDA A;  3O19 A;  2XE1 A;  3P02 A;  2CBS A;  2BS6 A;  3FDC A;  1AVE A;  1EW3 A;  3SZJ A;  3WYQ A;  1T16 A;  1AVD A;  2WEW A;  1RXK A;  1X71 A;  2KT4 B;  4I9R A;  3GAQ A;  1N43 A;  1GT5 A;  4OMW A;  4AUI A;  3PRN A;  3WYP A;  5H2F O;  3FEN A;  1HXL A;  4FBO A;  3VZU X;  5CE4 A;  4D5U A;  3BY0 A;  1VWP B;  2OF8 A;  4YGG A;  2X9K A;  4WFU A;  4IRW A;  1EI5 A;  4Y0Q A;  2BLG A;  4AKM A;  3HW9 A;  3SYB A;  1STP A;  4ALB A;  4YGH A;  2JU3 A;  1GM6 A;  1MDC A;  1OBP A;  6PRN A;  5B10 O;  1W4T A;  4UU3 A;  2WWP A;  3KFI A;  1VWO B;  2IZE B;  3CQN A;  3QRA A;  1SY1 A;  1SWT A;  3WZQ A;  3UAQ A;  1ZHW A;  2ODJ A;  1X8U A;  3I17 A;  4PUX A;  4O3X B;  3A2S X;  5HA1 A;  5HZ5 A;  4GCQ A;  3CBC A;  5HZ9 A;  3P6F A;  4AZO A;  3STM X;  2JMB A;  3AAA B;  1OSP O;  2G7B A;  1KXO A;  4QNI A;  2HKD A;  2A5B A;  1Y55 X;  4U8U M;  1S2P A;  1X89 A;  4AYM C;  1SLF B;  5KID A;  4BX5 A;  3K19 A;  4O4O A;  5D4A A;  5LJC A;  4EDE A;  1MPF A;  2KZ7 B;  4BX7 B;  2MO5 A;  2KXP A;  4U8U N;  1ERB A;  2X27 X;  3PQS A;  4ORX A;  3SY7 A;  3MG5 A;  3ZWE A;  3FLL A;  4MVL A;  5KHP A;  2HMB A;  3JQO A;  4OKA A;  2M06 A;  3VHM A;  1G5W A;  4Z27 A;  5ADX K;  3TGC A;  1KT3 A;  2W81 C;  2R88 A;  4GE1 A;  3LK2 B;  4Y59 A;  3CKG A;  1CJ5 A;  4CDF A;  1EQD A;  1QQS A;  4FBV A;  4ZHF A;  2XG6 A;  5LJK A;  1CBS A;  3C5O A;  1RSU B;  3AKN A;  4Z6J A;  1HMT A;  2OF9 A;  1NDJ A;  2Q39 A;  4K19 A;  1I9H A;  5IYU A;  1HN2 A;  4OS0 A;  1LIC A;  1HBQ A;  4PR7 A;  2BC3 A;  2IZH B;  4ZCB A;  2FWV A;  2CM4 A;  3NP1 A;  4KC8 A;  3APV A;  3WJB A;  1S44 A;  3MM0 A;  4KII A;  1LEL A;  2IFB A;  1LIE A;  1JMX A;  4IMO A;  2PRN A;  3A0B O;  3FMZ A;  3PPT A;  4YKM A;  1A3Y A;  4N58 A;  1HMS A;  3EBK A;  2AT5 X;  3PGU A;  3BS2 A;  4U3Q A;  3PQU A;  1EUO A;  5E79 O;  2JMM A;  4MEE A;  5L8N A;  4IL6 O;  1SXX A;  2Y0L A;  2Y0H A;  3PH5 A;  4GU8 A;  4L3R A;  1PMP A;  2P8G A;  3DWO X;  1VPR A;  4I3B A;  3ZUO A;  1MK5 A;  4ML7 B;  5C0N A;  4KH8 A;  2FHL A;  1CBQ A;  2A2U A;  3SZV A;  1BLR A;  2UYW A;  4LZV A;  2KTS A;  1NC9 A;  3DTQ A;  3EYC A;  1OEJ A;  3EC5 A;  1WBI A;  3HWE A;  2AF5 A;  2L68 A;  1XCA A;  1BT9 A;  1UZ2 X;  2RTH B;  3SAO A;  3TZS A;  1HQQ A;  5DL5 A;  3AEH A;  2NND A;  1FEL A;  3TGB A;  3TF6 A;  4IB9 A;  1JBH A;  4JHQ A;  1SWU A;  3WXQ A;  1U17 A;  4IBA A;  5HZ6 A;  2OVA A;  4GCS A;  1SWC A;  2YPV A;  3HTY A;  2FHN X;  2LB6 A;  5G38 A;  2LA7 A;  2OY8 A;  2WUT A;  4GGR A;  1VWQ B;  3RDS A;  4NW4 A;  2W2F A;  3VZW X;  2CZT A;  4HPA A;  1KGL A;  4FUV A;  4R0B A;  4WBK A;  2MNH A;  4LQZ A;  1SRJ A;  3VG2 A;  2WVP A;  1PBY A;  4OEM A;  1QG5 A;  2OY1 O;  1HXT A;  3T24 A;  4D64 A;  1MOY A;  1IJ8 A;  1IIU A;  1SA8 A;  1SXU A;  2RTM A;  3DA4 A;  3STN A;  2X55 A;  4YH0 A;  4PSQ A;  2FLJ A;  1D2U A;  5EDC A;  2LHF A;  1SRG A;  2JGS A;  2I5V O;  4GNW A;  5EE2 A;  1CBI A;  3Q34 A;  1SWS A;  1PTS A;  2IZD B;  2RTF B;  2AT0 X;  1KT5 A;  4PJ0 O;  3RKG A;  2N2L A;  4MVE A;  5FAZ A;  3UU2 A;  4FQE A;  2GTL O;  4CTD A;  1SRF A;  3T2W A;  3NQ3 A;  5CYB A;  1HQP A;  1QY2 A;  5L3Y A;  2FKG A;  2NNQ A;  4ZH9 A;  2C4I A;  1N7Y A;  2RQ0 A;  4GD9 A;  3SYS A;  1VWE B;  1JJJ A;  2Q9S A;  3HWG A;  3O2Y A;  1SWB A;  3APU A;  2X8S A;  2Z4I A;  1EPB A;  5H9A A;  3T6L A;  4JFB A;  1PM1 X;  2VFB A;  4I60 A;  4GH7 A;  3LK4 1;  2FS6 A;  2IZI A;  3H3I A;  4BGF A;  4XMH A;  4YFQ A;  4Y0R A;  4JCH A;  2FR2 A;  3SZH A;  4QGW A;  4QYP A;  1OSM A;  3NPO A;  1P4T A;  2UZ2 A;  1VWA B;  3G7G A;  2GTF X;  4CPF A;  5LJD A;  4CPH B;  2LKK A;  1CBR A;  3QKG A;  1X8N A;  1ML7 A;  4GGZ A;  2R8A A;  3BRY A;  4AZL A;  4O4X A;  1KQW A;  3APX A;  3B2I A;  4Y5D A;  3AUM O;  4FZM A;  1Z24 A;  1VWD B;  1DC9 A;  3PDF A;  1E02 A;  4O49 A;  1UYN X;  2IZG B;  1DV9 A;  3T6F A;  5GTH O;  2OFR X;  1OBU A;  1G90 A;  3I0A A;  3FA9 A;  3WZO A;  4ON1 A;  4QQ1 A;  4I3D A;  3VHH A;  4NLJ A;  4GF4 A;  3UPG A;  3VG6 A;  2MHL A;  1GT3 A;  4ZGF A;  5H8T A;  4COT A;  2IZL B;  1GFQ A;  2OVD A;  2ALL X;  4RLB A;  3WJF A;  1KL3 A;  5KAI O;  1Y52 X;  1VYF A;  3PK2 A;  3D4R A;  2RA6 A;  4FQB B;  1GT4 A;  4Y0P A;  3FR4 A;  4AYI D;  2RTK A;  3LK3 A;  5LJE A;  4YDB A;  3NQ9 A;  3VU1 A;  3OJY C;  3Q6L A;  5D48 A;  2Y3F A;  1YWC A;  1TOW A;  4XMD A;  4ZJ0 A;  3DWN A;  1QY1 A;  1AEL A;  4MIR A;  4CDD A;  3FID A;  3RBY A;  1BXW A;  2Y32 A;  5FQ7 E;  1SWD A;  1MX7 A;  4UB8 O;  3POX A;  2X56 A;  3D96 A;  1LFO A;  4Z3T A;  1VYG A;  4FSP A;  1EXS A;  4KR4 A;  4LSE A;  3K3L A;  1YUP A;  2OL8 O;  3S26 A;  5GTI O;  3EMM A;  4QZT A;  5K68 A;  2F1C X;  5KIC A;  1BSQ A;  5EEE A;  4TJZ A;  1PEE A;  3AA0 A;  5AJC A;  1NGL A;  5K67 A;  1HXX A;  1IKE A;  3B2H A;  2F1T A;  3CMP A;  3VY8 X;  3AA6 A;  5DL8 A;  3PGR A;  4YMY A;  3QRC A;  5IO5 A;  1SRH A;  1SY2 A;  4Z2O A;  4NLI A;  4G75 A;  2FR3 A;  2X4M A;  2L5P A;  4AZN A;  3EW1 A;  1SWK A;  2FGQ X;  2RTR B;  2OVS A;  3AAE B;  2RTE B;  3WJC A;  4CPE A;  3LTW A;  3ZW0 A;  1O1U A;  5HTD A;  4RJX A;  1KL5 A;  1SLD B;  2G78 A;  1VWK B;  3SOT A;  1U0X A;  2R73 A;  1MM5 A;  1H91 A;  1DZM A;  1SMP I;  2A0A A;  4IMN A;  1LDO A;  4C69 X;  5LJG A;  1FEM A;  4YFR A;  5G39 A;  3FW4 A;  3RDQ A;  5AJB A;  2GC9 A;  2K23 A;  2IZA A;  1HBP A;  4RLC A;  2LFU A;  3PF1 A;  3HWF A;  3DA3 A;  1GX9 A;  4N74 A;  2YMS A;  1R0U A;  4N7D A;  3VHI A;  3RDM A;  2NNE A;  3C77 X;  3VG7 A;  1AB0 A;  3OD9 A;  1B0O A;  4ZHH A;  5JDP A;  4O4S A;  1BRQ A;  3PP6 A;  1DZJ A;  4BX5 B;  1LDQ A;  2MM3 A;  2Z4H A;  1BEB A;  5HZQ A;  3CWK A;  2MF6 A;  3UEV A;  5HCC C;  2RTD B;  4KRA A;  3SZI A;  1ZRY A;  4A60 A;  3FYF A;  2XE5 A;  4Y0S A;  3GE2 A;  3SLO A;  2R4P A;  3VY9 X;  1OPF A;  5AQ6 A;  2RTN B;  3AKM A;  1BWY A;  2M4L A;  1I4U A;  3BRZ A;  5HBS A;  2RCQ A;  1LIF A;  3FA6 A;  4BX6 B;  1SRI A;  1YWD A;  1Q9F A;  1PRN A;  3WI4 A;  4BX6 A;  4EFG A;  4IB8 A;  1GFO A;  1JV4 A;  2ZAI A;  2LBV A;  1B8E A;  5AFU K;  3E3C A;  2R89 A;  1TOU A;  2QOS C;  2AXT O;  1URE A;  3KQ0 A;  5F58 A;  4FRX A;  2FRS A;  2OY7 A;  2Y3E A;  5FVN A;  1Q9G A;  3RDO A;  2GTL N;  3AA7 B;  4O3Y A;  1MUP A;  1T8V A;  1JZU A;  1LCZ A;  1O1V A;  2FGS A;  4DNE A;  2FTB A;  1TXL A;  4U46 A;  3WOV A;  1X8P A;  2AT6 X;  4KC7 A;  4CPH A;  4I9S A;  1H6S 1;  2BS5 A;  1DZP A;  4U9C A;  4TLJ A;  4CV7 A;  3ZQ3 A;  2OL6 O;  3RZY A;  1STR B;  2RD7 C;  3CBS A;  4OS3 A;  5DL7 A;  2X8F A;  1NP4 A;  1BBP A;  3KVN A;  4IAX A;  1LKE A;  2F73 A;  1VWR B;  4AZP A;  4K3B A;  3T2X A;  5HCD C;  1TW4 A;  4L1N A;  2A2G A;  2K62 A;  4AFK A;  3F9D A;  2QTK A;  3JS1 A;  4OS8 A;  2DJF A;  3ZW1 B;  1LF7 A;  5EPQ A;  3BX7 A;  3WJG A;  4GDA A;  4PJ2 A;  3RBH A;  3KFG A;  3OBL A;  3V8U A;  4O3W A;  1K24 A;  1SRE A;  2KDY A;  2R4L A;  5BVQ A;  3VG5 A;  2HLV A;  4ZGU A;  3O22 A;  1OPB A;  4RUN A;  3KVD D;  1ICM A;  2Q2M A;  4XNK A;  1KT6 A;  1QY0 A;  5B27 A;  2WJR A;  4GCP A;  4NV7 A;  2Y0K A;  4OMX A;  3O0E A;  5KAF O;  4DCB A;  4AZM A;  4A1H A;  3HK1 A;  1IW2 A;  3EMN X;  4WFV A;  1GKA A;  1BJ7 A;  1I05 A;  4TKH A;  1Y0G A;  3C78 X;  1KT7 A;  1E06 A;  3X00 A;  2HZR A;  3NX1 A;  4FES A;  5AFU L;  4EEJ A;  1N9M A;  1I04 A;  5D45 A;  4ZH6 A;  4YBU A;  2KTD A;  2XE2 A;  3FA8 A;  2CAM A;  2WEX A;  4FT6 A;  1L6M A;  3NR3 A;  1HXU A;  1QAB E;  2MJI A;  2VFC A;  3TZG A;  3VG3 A;  5F1E A;  3WU2 O;  2XKL A;  1SWE A;  3N91 A;  3BX8 A;  5L8O A;  4BJ8 A;  4YFP A;  2AL0 X;  5DPQ A;  3P24 A;  1STS B;  5HCE C;  2KZ7 A;  2WQ9 A;  1FJ1 E;  4FGI B;  2XE3 A;  2X45 A;  1YP6 A;  2PY1 A;  3T0S A;  5F2B A;  3HOE A;  2ERV A;  3F8A A;  3SLJ A;  2LFO A;  3ZW1 A;  3T20 A;  1GFP A;  2WPU A;  2LBA A;  4M6S A;  5B29 A;  4Z28 A;  3U9P C;  5G3A A;  4INN A;  2ZAG A;  2W2A A;  4UU2 A;  3FEP A;  4I3C A;  2G5L A;  2VDF A;  2A3F X;  3P6C A;  1JQP A;  3UEU A;  3LK3 B;  2CZU A;  1SY0 A;  3B2K A;  2MWH A;  1SLE B;  3EBW A;  1FE3 A;  3ZZV A;  4ORR A;  1PHO A;  5JR8 A;  4C4V A;  2QCB A;  3BLG A;  2HYS A;  3EW2 A;  3FEL A;  2OYB O;  2XMX A;  1ZHT A;  2HNX A;  2C1S A;  4QGV A;  4MVK A;  4N7C A;  2AMM X;  2OFB A;  4IAW A;  1IZN A;  5G26 A;  1S5L O;  3HWB A;  2RCT A;  1LCV A;  4BUM X;  1QFT A;  4DQ3 A;  5LJB A;  2K4T A;  2OY5 O;  2IWV A;  1X8O A;  4GHB A;  1ZNL A;  4NNS A;  4GUZ A;  2X46 A;  1E5P A;  1FTP A;  2OFM X;  4QRL A;  1DF8 A;  1I78 A;  4CSB A;  1DF3 A;  4GJS A;  4HPB A;  1AVG I;  2WR6 A;  1LCW A;  2R4O A;  3WBG A;  3CR6 A;  4OEL A;  5D8J A;  1Y53 X;  2RTJ A;  1BRP A;  2A8G A;  3G7X A;  4NYR A;  5CHK A;  1DZK A;  1JYJ A;  4GNY A;  1LPJ A;  2AKQ A;  3LHN A;  4LSH A;  1KFF A;  3B2J A;  5F6Z A;  3STK A;  1ADL A;  5B3M O;  4IB6 A;  4D6B A;  4FOZ A;  2X32 A;  1CRB A;  1EIO A;  4N59 A;  2X8T A;  2RTC B;  1EII A;  3AAE A;  1ICN A;  3SZD A;  2G79 A;  1IFC A;  2N93 A;  5PRN A;  1U18 A;  5HAE A;  2R56 A;  2ZLD A;  3POU A;  3NBX X;  4LKP A;  4ZR2 A;  2Q4N A;  3S5X A;  3PED A;  2O62 A;  2J1N A;  4E1T A;  1OEE A;  1QWD A;  4ZFX A;  4QGX A;  5B5G A;  3P6H A;  1YP7 A;  2QO6 A;  1QJ9 A;  3PH6 A;  1ALB A;  4A8Z A;  1I06 A;  4XMG A;  4BVM A;  3HOL A;  3ZW2 A;  2OZQ A;  1BH3 A;  3RE5 A;  4BQU A;  4RJW A;  7PRN A;  4YGZ A;  4GZV A;  1VYO A;  5HWZ A;  3ELZ A;  4GK9 A;  1JJX A;  2CBR A;  3HPE A;  5B5F A;  1P6P A;  2GH7 A;  3WJE A;  2A13 A;  2K0L A;  3S60 A;  2L67 A;  3U0D A;  1KQX A;  1KL4 A;  3IA8 A;  4WHI A;  2KW1 A;  1G74 A;  1VWG B;  5D47 A;  1G85 A;  2L9C A;  2RTA A;  3GP6 A;  4FMS A;  4AKR A;  4IAB A;  4XNL A;  3SLT A;  4LSI A;  2CM9 A;  3D95 A;  1RXJ A;  2YNK A;  1T1L A;  1ZHX A;  3A0H O;  5AEO A; 
#chains in the Genus database with same CATH homology
 1MUP A;  1T8V A;  5H9N A;  3RSW A;  1O1V A;  1JZU A;  3FA7 A;  4D64 A;  1LNM A;  3NSG A;  2FTB A;  4KCA A;  4ZHG A;  1TXL A;  3WOV A;  1X8P A;  1IIU A;  1SA8 A;  1SXU A;  3DA4 A;  2AT6 X;  3STN A;  2JU7 A;  4KC7 A;  2BHV A;  4YH0 A;  4TKB A;  4PSQ A;  2HZQ A;  3S5V A;  4I9S A;  1H6S 1;  2FLJ A;  1D2U A;  5EDC A;  2POR A;  5EDB A;  8PRN A;  1ZNK A;  2LHF A;  2OMF A;  2BS5 A;  1GFN A;  1EAL A;  1DZP A;  4GNW A;  4U9C A;  2KD2 A;  3ELX A;  5EE2 A;  1CBI A;  3C76 X;  3FR2 A;  5BYP A;  2NP1 A;  3AAA A;  1MM4 A;  2JOZ A;  2QO4 A;  4NNT A;  4TLJ A;  4CV7 A;  3ZQ3 A;  1HMR A;  2AT0 X;  3RZY A;  2BT9 A;  4YKO A;  1KT5 A;  2RD7 C;  4AZR A;  2GTL M;  3BDR A;  3CBS A;  2JN3 A;  4OS3 A;  5DL7 A;  3APW A;  5BVS A;  4KT5 A;  2GE4 A;  3RKG A;  2X8F A;  2N2L A;  4MVE A;  2EU7 X;  5FAZ A;  3UU2 A;  2QMI A;  3IFB A;  2Y2X A;  2GTL O;  1NP4 A;  5H9L A;  2KXP B;  1BBP A;  4IAX A;  1O8V A;  4LZU A;  4MVI A;  1LKE A;  1ZNE A;  3MBT A;  2F73 A;  4AZP A;  5HCD C;  1TW4 A;  3NQ3 A;  5CYB A;  1HQP A;  4LKT A;  3VZT X;  1QY2 A;  4L1N A;  2JU8 A;  2A2G A;  4D65 A;  5IO6 A;  2K62 A;  4AFK A;  2NNQ A;  4ZH9 A;  1RBP A;  3F9D A;  3P6D A;  5F6B A;  3WI5 A;  3EM0 A;  2RQ0 A;  2QTK A;  4AYE C;  3JS1 A;  3JSQ A;  4OS8 A;  4HPD A;  4I95 A;  1JJJ A;  3SYS A;  2Q9S A;  2R74 A;  3HWG A;  2AT8 X;  4KR8 A;  3O2Y A;  4ORW A;  4FSO A;  3U03 A;  4QYN A;  1LF7 A;  3ZW1 B;  3APU A;  2X8S A;  2W2B A;  3BX7 A;  5EPQ A;  4F4B A;  2Z4I A;  1EPB A;  4RUU A;  3WJG A;  3P6G A;  1NP1 A;  1ACD A;  5FFH A;  5H9A A;  1AQB A;  1EPA A;  4ARH A;  1IFB A;  4JFB A;  4PJ2 A;  1PM1 X;  3LK4 2;  2AH7 X;  1T68 X;  3VE2 A;  3RBH A;  1LID A;  3KFG A;  3OBL A;  4GH7 A;  3V8U A;  2FS6 A;  4O3W A;  3LK4 1;  3H3I A;  2KDY A;  1MX8 A;  1ZNG A;  5BVQ A;  1MVG A;  4XMH A;  2WSJ A;  1KZX A;  4YFQ A;  4Y0R A;  4JCH A;  3VG5 A;  2HLV A;  4ZGU A;  3O22 A;  1OPB A;  4RUN A;  4BOE A;  1ICM A;  3KVD D;  2Q2M A;  2XST A;  4XNK A;  2FR2 A;  1KT6 A;  2DM5 A;  1QY0 A;  5B27 A;  4QGW A;  1KT4 A;  4GCP A;  4QYP A;  5L8I A;  2Y0K A;  4FZL A;  4OMX A;  3O0E A;  1OSM A;  4AZM A;  3NPO A;  4YDA A;  3O19 A;  4A1H A;  1P4T A;  1N0S A;  3HK1 A;  1IW2 A;  2XE1 A;  3EMN X;  4WFV A;  1GKA A;  1I05 A;  1BJ7 A;  3P02 A;  4TKH A;  3G7G A;  2CBS A;  2BS6 A;  3C78 X;  2GTF X;  1KT7 A;  2J4U P;  1E06 A;  5LJD A;  2FS7 A;  1EW3 A;  2LKK A;  1CBR A;  2YG2 A;  3QKG A;  1X8N A;  1ML7 A;  2HZR A;  1YWA A;  3FIQ A;  2WEW A;  3NX1 A;  4FES A;  4AZL A;  4O4X A;  5AFU L;  4EEJ A;  1KQW A;  1X71 A;  2KT4 B;  3APX A;  3B2I A;  4I9R A;  4AZQ A;  3GAQ A;  2F09 A;  4FZM A;  1I04 A;  1Z24 A;  3PEC A;  5D45 A;  4O4U A;  3KFH A;  1GT5 A;  4YBU A;  4ZH6 A;  1DC9 A;  4OMW A;  4AUI A;  3PRN A;  4I6S A;  4AW8 A;  2KTD A;  1E02 A;  1GGL A;  3BRN A;  2XE2 A;  4EXZ A;  1B4M A;  3FA8 A;  4O49 A;  1DV9 A;  4HFO A;  3UEX A;  5FQ6 E;  2WEX A;  3JTY A;  4D6A A;  3FEN A;  4FT6 A;  1L6M A;  3NR3 A;  1HXU A;  1QAB E;  2MJI A;  1DFV A;  3TZG A;  2Q2P A;  2OFR X;  1OBU A;  3VG3 A;  5BVT A;  5F1E A;  1G90 A;  4FBO A;  3VZU X;  3I0A A;  3FA9 A;  2XKL A;  1S7D A;  5CE4 A;  4D5U A;  3VPJ E;  3BY0 A;  4ON1 A;  4YGG A;  3N91 A;  3BX8 A;  4QQ1 A;  5L8O A;  4I3D A;  4WFU A;  3SY9 A;  4LSF A;  1YIV A;  4NLJ A;  4YFP A;  2AL0 X;  5DPQ A;  1EI5 A;  3P24 A;  4NYQ A;  4Y0Q A;  2BLG A;  3T1D A;  4FBR A;  5HCE C;  3HW9 A;  4ALO A;  2WQ9 A;  1GT1 A;  4FGI B;  4DQ4 A;  4ZHD A;  2KZ7 A;  4GF4 A;  3SYB A;  2XE3 A;  1OEK A;  2X45 A;  4ALB A;  3VG6 A;  4JGL A;  3UPG A;  2MHL A;  1GT3 A;  4YGH A;  1YP6 A;  4ZGF A;  2JU3 A;  2PY1 A;  2QM9 A;  1D3S A;  5H8T A;  1GM6 A;  1MDC A;  4COT A;  1OBP A;  2OVD A;  1GFQ A;  3T0S A;  4FZN A;  2ALL X;  2XTQ A;  3HOE A;  6PRN A;  4RLB A;  2ERV A;  3WJF A;  5ADX L;  3F8A A;  2LFO A;  1VYF A;  1GXA A;  4GKC A;  3ZW1 A;  3D4R A;  4UU3 A;  3T20 A;  2RA6 A;  4FQB B;  2F1V A;  5T5F A;  1GFP A;  1OPA A;  1RLB E;  2ACP X;  2LBA A;  1GT4 A;  2WWP A;  3KFI A;  3CQN A;  3FR4 A;  4M6S A;  4Y0P A;  4AYI D;  3ZUI A;  5H9K A;  3LK3 A;  5B29 A;  5LJE A;  1SY1 A;  4QZU A;  4YDB A;  3POR A;  3QRA A;  3U9P C;  3NQ9 A;  3UAQ A;  3VU1 A;  3OJY C;  3Q6L A;  4INN A;  2ZAG A;  1ZHW A;  5D48 A;  2W2A A;  3POQ A;  4UU2 A;  2ODJ A;  1YWC A;  3FEP A;  1TOW A;  1X8U A;  3I17 A;  3D97 A;  4I3C A;  4ID2 A;  4XMD A;  4ZJ0 A;  1OBQ A;  4PUX A;  1GX8 A;  1QY1 A;  4O3X B;  5IO7 A;  5FQ8 E;  2OVE A;  3F6Z B;  1AEL A;  2A3F X;  3P6C A;  1KOI A;  3UEU A;  4MIR A;  3A2S X;  5HA1 A;  5HZ5 A;  1QFV A;  4GCQ A;  4G76 A;  3LK3 B;  1ERX A;  2CZU A;  3CQR A;  1SY0 A;  3RBY A;  2E4J A;  3B2K A;  1BXW A;  2MWH A;  3CBC A;  3EBW A;  5FQ7 E;  1MX7 A;  5HZ9 A;  3POX A;  1FE3 A;  3P6F A;  4AZO A;  3STM X;  2JMB A;  3D96 A;  3ZZV A;  3AAA B;  1LFO A;  2G7B A;  1KXO A;  5HTE A;  1ZHZ A;  4QNI A;  4Z3T A;  4ORR A;  1PHO A;  5JR8 A;  1XKI A;  2ACO A;  1VYG A;  4U8U M;  3BLG A;  4AKR B;  1QJ8 A;  1S2P A;  2N2M A;  1X89 A;  2HYS A;  4ODD A;  4AYM C;  4FSP A;  5KID A;  3FEL A;  3K19 A;  1EXS A;  1SXW A;  4KR4 A;  4O4O A;  5FEN A;  4LSE A;  5D4A A;  1SY3 A;  3K3L A;  5LJC A;  1YUP A;  4EDE A;  4ES7 A;  1LIB A;  1MPF A;  2XMX A;  1ZHT A;  2KZ7 B;  1JYD A;  3S26 A;  2FT9 A;  2HNX A;  4QGV A;  4O3Z A;  3EMM A;  2MO5 A;  4MVK A;  4QZT A;  2KXP A;  3LV4 A;  4N7C A;  4M7M A;  4U8U N;  2AMM X;  1ERB A;  1BM5 A;  2X27 X;  4IAW A;  1IZN A;  5KIC A;  5G26 A;  5LJH A;  3PQS A;  4ORX A;  3SY7 A;  3HWB A;  1BSQ A;  2RCT A;  3LK2 A;  3ZWE A;  3DSZ A;  3FLL A;  4MVL A;  4BUM X;  1QFT A;  4GRJ A;  4DQ3 A;  5LJB A;  5EEE A;  4TJZ A;  4EQA C;  5KHP A;  2HMB A;  1PEE A;  1E00 A;  3JQO A;  5F7G A;  4NP1 A;  2K4T A;  3MVF A;  2M06 A;  3AA0 A;  1X8O A;  5AJC A;  1ZNL A;  4NNS A;  4GHB A;  1NGL A;  2X46 A;  1E5P A;  2ZFG A;  1G5W A;  1FTP A;  5ADX K;  3B2L A;  2OFM X;  3VE1 A;  5DG4 A;  1HXX A;  3AA0 B;  4QRL A;  3ZI8 A;  1IKE A;  1JIW I;  3B2H A;  1KT3 A;  3RWX A;  3TGC A;  2F1T A;  3CMP A;  2W81 C;  3VY8 X;  3AA6 A;  4CSB A;  4GE1 A;  2GJ5 A;  3KZA A;  1DF3 A;  3AA1 B;  3LK2 B;  5DL8 A;  4HPB A;  4YMY A;  3QRC A;  3ZW0 B;  5IO5 A;  1AVG I;  1CJ5 A;  1EQD A;  1QQS A;  1SY2 A;  2WR6 A;  4FBV A;  1GFM A;  4ZHF A;  4NLI A;  1ZND A;  3L4R A;  4G75 A;  4XMC A;  2M07 A;  5K06 A;  4MIS A;  4RL9 A;  2FR3 A;  2XG6 A;  3WBG A;  3NAD A;  1X8Q A;  3FEK A;  3CR6 A;  2XTR A;  5LJK A;  1CBS A;  4HWM A;  5D8J A;  3C5O A;  2L5P A;  4AZN A;  1IZN B;  4U8U O;  2FGQ X;  3AKN A;  1BRP A;  1HMT A;  4XMF A;  4YCH A;  2OVS A;  4GDZ A;  2Q39 A;  4K19 A;  3AAE B;  5IYU A;  1HN2 A;  3G7X A;  2RN4 A;  5D5D A;  4OS0 A;  3WJC A;  1LIC A;  1HBQ A;  2JW1 A;  4NYR A;  3ZW0 A;  1O1U A;  3OE3 A;  5HTD A;  4RJX A;  2Y7S A;  4ZCB A;  3WVM A;  1TVQ A;  2FWV A;  2G78 A;  1DZK A;  1JYJ A;  2CM4 A;  3NP1 A;  1A57 A;  2FGR A;  5LKE A;  4GNY A;  2ASN X;  4IB7 A;  4KC8 A;  3SOT A;  3APV A;  3VG4 A;  1LPJ A;  1U0X A;  2R73 A;  3WJB A;  1H91 A;  1G7N A;  1DZM A;  1S44 A;  2AKQ A;  1SMP I;  4KII A;  1MM5 A;  3AA7 A;  3TGA A;  3LHN A;  4LSH A;  2A0A A;  4ORY A;  5EZ2 A;  2IFB A;  1LIE A;  3B2J A;  4TKJ A;  4IMN A;  4IMO A;  5F6Z A;  1BSO A;  3STK A;  4C69 X;  2PRN A;  3FMZ A;  5LJG A;  3PPT A;  4YKM A;  2O4V A;  4TQ2 A;  1ADL A;  1A3Y A;  1FEM A;  4N58 A;  4IB6 A;  1E54 A;  4YFR A;  1HMS A;  3EBK A;  4D6B A;  1A2D A;  3FW4 A;  1BSY A;  4FOZ A;  2AT3 X;  2AT5 X;  5LKF A;  5AJB A;  1CRB A;  2GC9 A;  2K23 A;  3BS2 A;  4U3Q A;  1EIO A;  3PQU A;  1EUO A;  1HBP A;  4GET A;  4RLC A;  2LFU A;  2JMM A;  4N59 A;  2X8T A;  5L8N A;  3FW5 A;  1EII A;  3AAE A;  1SXX A;  1Y9T A;  1ICN A;  3KFF A;  2G79 A;  4AYH A;  3SZD A;  3HWF A;  2Y0L A;  1IFC A;  3P6E A;  2Y0H A;  2N93 A;  3DA3 A;  1GX9 A;  1ZNH A;  1YWB A;  5PRN A;  1U18 A;  5HAE A;  2R56 A;  3FR5 A;  3PH5 A;  2YMS A;  1R0U A;  4GU8 A;  5EED A;  2ZLD A;  3POU A;  2ANS A;  4N7D A;  2W80 C;  3NBX X;  4L3R A;  1PMP A;  2P8G A;  1B56 A;  1VPR A;  4XME A;  4LKP A;  4I3B A;  4ZR2 A;  2Q4N A;  3ZUO A;  3S5X A;  1KZW A;  3PED A;  2NNE A;  2O62 A;  3C77 X;  3VG7 A;  2J1N A;  4E1T A;  1AB0 A;  1OEE A;  1QWD A;  2MHD A;  4ML7 B;  5C0N A;  4ZFX A;  4QGX A;  4KH8 A;  3P6H A;  1CBQ A;  1YP7 A;  3OD9 A;  2QO6 A;  3BSZ E;  2A2U A;  4YBP A;  1QJ9 A;  3SZV A;  4AKM A;  3PH6 A;  1ALB A;  3HWD A;  1I06 A;  3WJD A;  4XMG A;  4A8Z A;  1FEN A;  1BLR A;  4BVM A;  5GV0 A;  4LZV A;  2KTS A;  3HOL A;  1B0O A;  3DTQ A;  4ZHH A;  3EYC A;  1Y9L A;  3ZW2 A;  1A18 A;  2OZQ A;  1BH3 A;  1OEJ A;  5DL6 A;  5JDP A;  4O4S A;  1BRQ A;  3PP6 A;  1DZJ A;  3HWE A;  3UEW A;  2L68 A;  1XCA A;  1BT9 A;  1IKJ A;  1T0V A;  4BQU A;  4RJW A;  1UZ2 X;  4ORU A;  7PRN A;  3AA6 B;  4YGZ A;  2MM3 A;  2Z4H A;  1BEB A;  5HZQ A;  3CWK A;  4GZV A;  3SAO A;  4ZHC A;  3TZS A;  3UEV A;  2QO5 A;  5HWZ A;  3ELZ A;  4GK9 A;  1JJX A;  5DL5 A;  5HCC C;  2CBR A;  4KRA A;  2NND A;  5HA0 A;  1FDQ A;  2WQA E;  1FEL A;  4B61 A;  1ZRY A;  4A60 A;  3TGB A;  1P6P A;  3TF6 A;  4YCE A;  4IB9 A;  3FYF A;  1ZHY A;  1JBH A;  4AYN A;  2XE5 A;  2KC0 A;  3MX7 A;  4Y0S A;  3GE2 A;  4HPC A;  3WJE A;  3NX2 A;  2A13 A;  4A1Y A;  4AYD C;  3VY9 X;  3WXQ A;  1ORM A;  1OPF A;  2POA A;  3AA1 A;  2K0L A;  1U17 A;  5AQ6 A;  3AKM A;  1PBO A;  2M4L A;  4IBA A;  1I4U A;  2L67 A;  4TNN A;  3S60 A;  5HZ6 A;  3U0D A;  1BWY A;  1THQ A;  1KQX A;  3IA8 A;  5HBS A;  2OVA A;  4WHI A;  4GCS A;  2RCQ A;  2YPV A;  2KW1 A;  3HTY A;  1G74 A;  4E1S A;  1LIF A;  2LB6 A;  3FA6 A;  5D47 A;  1G85 A;  2LA7 A;  2L9C A;  3GP6 A;  4FMS A;  1YWD A;  4AKR A;  2WUT A;  1Q9F A;  4IAB A;  1PRN A;  3NQK A;  3WI4 A;  4EFG A;  4IB8 A;  1GFO A;  1JV4 A;  4NW4 A;  2W2F A;  2ZAI A;  1B8E A;  2LBV A;  3E3C A;  3FYX A;  2CZT A;  4XNL A;  3VZW X;  5AFU K;  1TOU A;  2QOS C;  1QJP A;  1SXY A;  4HPA A;  1URE A;  1KGL A;  4FUV A;  3KQ0 A;  4R0B A;  4WBK A;  5F58 A;  2MNH A;  4FRX A;  4LSI A;  2CM9 A;  2FRS A;  3BU9 A;  4LQZ A;  5FVN A;  3D95 A;  1Q9G A;  1GKA B;  4ORS A;  3VG2 A;  4CK4 A;  5HZ8 A;  2YNK A;  2GTL N;  4QAE A;  1ZHX A;  1YS5 A;  4FRT A;  1QG5 A;  3AA7 B;  3BU1 A;  5AEO A;  4O3Y A;  1HXT A;  3T24 A;  4O9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...