3HW9A

Cation selective pathway of ompf porin revealed by anomalous x-ray diffraction
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
340
structure length
339
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein F
publication title Cation-selective pathway of OmpF porin revealed by anomalous X-ray diffraction.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein, ion transport
total genus 89
structure length 339
sequence length 340
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3hw9A00
4RJWA 5DL7A 3SY7A 8PRNA 2Y0LA 2XE2A 2XE5A 2ZLDA 1BH3A 4KR8A 2PORA 3POUA 3VZUX 3FYXA 3POQA 4FRTA 4AUIA 3NSGA 1OSMA 3O0EA 3SY9A 3EMNX 1PHOA 1GFQA 4BUMX 1GFNA 4D5UA 4LSFA 4FSPA 3WI4A 3UU2A 5FVNA 1OPFA 3SZVA 2FGQX 1PRNA 3T20A 7PRNA 4GCQA 2J1NA 4GCSA 1H6S1 2Y0HA 2ZFGA 4FRXA 5DL8A 4RJXA 2J4UP 1BT9A 4KRAA 5DL5A 1HXUA 1GFOA 1GFMA 4JFBA 2K4TA 4D64A 4C69X 4FOZA 3POXA 3T24A 2ODJA 4LSEA 4GCPA 3VY8X 2PRNA 3UPGA 3SYSA 5DL6A 3SZDA 1HXTA 3VZWX 1E54A 3HWBA 4LSIA 4LSHA 6PRNA 3PRNA 2QTKA 4FT6A 2OMFA 4KR4A 2O4VA 3WI5A 5PRNA 3A2SX 3K19A 3JTYA 3VZTX 5JDPA 1MPFA 2Y2XA 1GFPA 4D65A 2XE3A 2FGRA 4FSOA 2XE1A 3T0SA 3VY9X 2XG6A 2Y0KA 3SYBA 4FMSA 3HW9A 1HXXA 3PORA
chains in the Genus database with same CATH superfamily
4RJWA 5DL7A 4CTDA 3SY7A 2WJQA 4O3YA 2MNHA 4O3ZA 8PRNA 1Q9GA 3LK41 3AA6B 3PQSA 5ADXK 1G90A 5G26A 2Y0LA 4QQ1A 3TZGA 2KC0A 3AAEA 2XE2A 2XE5A 4O49A 2ZLDA 4UB6O 4AZLA 2KZ7B 3PORA 1S5LO 5AFUL 2JQYA 1BH3A 2JMMA 4U9CA 3JCUO 4B61A 4KR8A 5D5DA 4K3CA 2PORA 1BXWA 3POUA 4G75A 3VZUX 3DWNA 3FYXA 3DA4A 4O4UA 5T5FA 3LK3A 1ORMA 2R4PA 3POQA 4FRTA 3G7GA 4PJ0O 4AYID 3PGSA 4AUIA 4G76A 1T1LA 3NSGA 1OSMA 3HOLA 3O0EA 3SY9A 2YPVA 3EMNX 4Z3TA 1PHOA 1GFQA 3AA1A 3LK2A 4RL9A 2Y7SA 3RBHA 1GFNA 4BUMX 4D5UA 2N2MA 4LSFA 4FSPA 5GTHO 2F1TA 3AAAB 3WI4A 2R89A 3UU2A 4AKMA 5FVNA 1OPFA 3SZVA 2FGQX 4AKRA 4C4VA 1PRNA 5E79O 3HOEA 3PF1A 3PQUA 4N74A 5GTIO 3T20A 1IZNB 2WVPA 2WJRA 3KZIO 4GCQA 3VE2A 7PRNA 3C5OA 5H2FO 5AFUK 2J1NA 4AYNA 2ERVA 2XMXA 4GCSA 3AA6A 4AFKA 1H6S1 2KXPA 3V8UA 2Y0HA 2ZFGA 5G39A 4FRXA 3AAEB 5DL8A 5KAIO 4XNKA 4RLBA 5TISO 2KZ7A 4RJXA 2J4UP 1BT9A 3AA7A 4E1TA 2X9KA 5ADXL 4GHBA 4KRAA 5DL5A 3GP6A 4GF4A 4RLCA 2M07A 1HXUA 3DZMA 5EE2A 2W81C 5G3AA 1GFOA 1GFMA 3LK3B 3NJTA 5B66O 2W80C 2N2LA 4FZLA 4JFBA 2K4TA 4D64A 4C69X 2GE4A 4FOZA 3POXA 1QJPA 3AA0B 3T24A 2ODJA 4LSEA 5KAFO 2R4OA 4GCPA 4FZNA 1P4TA 3VY8X 4AYEC 4FESA 2PRNA 1MM4A 2R4NA 3AA1B 3BRYA 3LK2B 3SYSA 2R8AA 3BRZA 4E1SA 4AYDC 2K0LA 2R88A 3UPGA 5GV0A 4IL6O 2YNKA 3DA3A 2XTRA 3PGRA 4O4XA 2LHFA 4O3WA 1HXTA 5DL6A 2LFUA 1E54A 3SZDA 3VZWX 3HWBA 4C00A 4FZMA 4LSIA 2IWWA 1QJ8A 2F1CX 4LSHA 2AXTO 4N75A 4F4BA 1Q9FA 6PRNA 3PRNA 1QJ9A 3A0HO 2QTKA 3KVDD 3LK42 3A0BO 1MM5A 2OMFA 2XTQA 3QRCA 4FT6A 1ZHXA 2O4VA 4KR4A 2F1VA 2KXPB 3A2SX 3K19A 5PRNA 3WI5A 1YS5A 4JCHA 3JTYA 4FUVA 4N58A 4PUXA 3QRAA 3VZTX 4AYMC 5JDPA 1ZHTA 1MPFA 4N59A 2Y2XA 4PR7A 1GFPA 1THQA 3BS0A 3DWOX 2IWVA 2M06A 3AA7B 2R4LA 5B5EO 4D65A 5IYUA 2XE3A 1ZHWA 2KDYA 3PGUA 5G38A 2FGRA 3UAQA 1T16A 2MHLA 3VE1A 3WU2O 4FSOA 4UB8O 2XE1A 1ZHYA 1ZHZA 4K3BA 4FQEA 4XNLA 3T0SA 4O3XB 3AAAA 2X27X 3VY9X 2XG6A 2Y0KA 3AA0A 3SYBA 4FMSA 4AKRB 4C4VB 3HW9A 1HXXA 1IZNA
chains in the Genus database with same CATH topology
4RJWA 5DL7A 3SY7A 4O3YA 2MNHA 4O3ZA 8PRNA 1Q9GA 3LK41 3AA6B 3PQSA 5ADXK 5G26A 2Y0LA 4QQ1A 3TZGA 2KC0A 3AAEA 2XE2A 2XE5A 4O49A 2ZLDA 4AZLA 2KZ7B 3PORA 5AFUL 1BH3A 2JMMA 4U9CA 4B61A 4KR8A 5D5DA 2PORA 1BXWA 3POUA 4G75A 3VZUX 3FYXA 4O4UA 3DA4A 5T5FA 3LK3A 1ORMA 3POQA 4FRTA 3G7GA 4AYID 4AUIA 4G76A 3NSGA 1OSMA 3HOLA 3O0EA 3SY9A 2YPVA 3EMNX 4Z3TA 1PHOA 1GFQA 3AA1A 3LK2A 4RL9A 2Y7SA 4BUMX 1GFNA 4D5UA 2N2MA 4LSFA 4FSPA 2F1TA 3AAAB 3WI4A 3UU2A 4AKMA 5FVNA 1OPFA 3SZVA 2FGQX 4AKRA 1PRNA 3HOEA 3PQUA 3T20A 1IZNB 3VE2A 4GCQA 7PRNA 3C5OA 5AFUK 2J1NA 4AYNA 2ERVA 2XMXA 4GCSA 3AA6A 4AFKA 1H6S1 2KXPA 3V8UA 2Y0HA 2ZFGA 4FRXA 3AAEB 5DL8A 4XNKA 4RLBA 2KZ7A 4RJXA 2J4UP 1BT9A 3AA7A 4E1TA 5ADXL 4GHBA 4KRAA 5DL5A 3GP6A 4GF4A 4RLCA 2M07A 1HXUA 5EE2A 2W81C 1GFOA 1GFMA 3LK3B 2W80C 2N2LA 4FZLA 4JFBA 2K4TA 4D64A 4C69X 2GE4A 4FOZA 3POXA 1QJPA 3AA0B 3T24A 2ODJA 4LSEA 4GCPA 4FZNA 1P4TA 3VY8X 4AYEC 4FESA 2PRNA 1MM4A 3AA1B 3LK2B 4E1SA 3SYSA 3UPGA 4AYDC 2K0LA 5GV0A 2YNKA 3DA3A 2XTRA 4O4XA 4O3WA 2LHFA 5DL6A 1HXTA 3SZDA 2LFUA 1E54A 3VZWX 3HWBA 4FZMA 4LSIA 1QJ8A 4LSHA 4F4BA 1G90A 1Q9FA 6PRNA 3PRNA 1QJ9A 3LK42 2QTKA 3KVDD 4FT6A 1MM5A 2OMFA 2XTQA 3QRCA 4KR4A 1ZHXA 2O4VA 3RBHA 2F1VA 2KXPB 3A2SX 3K19A 5PRNA 3WI5A 1YS5A 4JCHA 3JTYA 4FUVA 4N58A 4PUXA 3QRAA 3VZTX 4AYMC 5JDPA 1ZHTA 1MPFA 4N59A 2Y2XA 1GFPA 1THQA 2M06A 3AA7B 4D65A 5IYUA 2XE3A 1ZHWA 2KDYA 3VE1A 3UAQA 2FGRA 2MHLA 4FSOA 2XE1A 1ZHYA 1ZHZA 4XNLA 3T0SA 4O3XB 3AAAA 2X27X 3VY9X 2XG6A 2Y0KA 3AA0A 3SYBA 4FMSA 4AKRB 3HW9A 1HXXA 1IZNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RJW A;  5DL7 A;  3SY7 A;  8PRN A;  2Y0L A;  2XE2 A;  2XE5 A;  2ZLD A;  1BH3 A;  4KR8 A;  2POR A;  3POU A;  3VZU X;  3FYX A;  3POQ A;  4FRT A;  4AUI A;  3NSG A;  1OSM A;  3O0E A;  3SY9 A;  3EMN X;  1PHO A;  1GFQ A;  4BUM X;  1GFN A;  4D5U A;  4LSF A;  4FSP A;  3WI4 A;  3UU2 A;  5FVN A;  1OPF A;  3SZV A;  2FGQ X;  1PRN A;  3T20 A;  7PRN A;  4GCQ A;  2J1N A;  4GCS A;  1H6S 1;  2Y0H A;  2ZFG A;  4FRX A;  5DL8 A;  4RJX A;  2J4U P;  1BT9 A;  4KRA A;  5DL5 A;  1HXU A;  1GFO A;  1GFM A;  4JFB A;  2K4T A;  4D64 A;  4C69 X;  4FOZ A;  3POX A;  3T24 A;  2ODJ A;  4LSE A;  4GCP A;  3VY8 X;  2PRN A;  3UPG A;  3SYS A;  5DL6 A;  3SZD A;  1HXT A;  3VZW X;  1E54 A;  3HWB A;  4LSI A;  4LSH A;  6PRN A;  3PRN A;  2QTK A;  4FT6 A;  2OMF A;  4KR4 A;  2O4V A;  3WI5 A;  5PRN A;  3A2S X;  3K19 A;  3JTY A;  3VZT X;  5JDP A;  1MPF A;  2Y2X A;  1GFP A;  4D65 A;  2XE3 A;  2FGR A;  4FSO A;  2XE1 A;  3T0S A;  3VY9 X;  2XG6 A;  2Y0K A;  3SYB A;  4FMS A;  3HW9 A;  1HXX A;  3POR A; 
#chains in the Genus database with same CATH topology
 4RJW A;  5DL7 A;  4CTD A;  3SY7 A;  2WJQ A;  4O3Y A;  2MNH A;  4O3Z A;  8PRN A;  1Q9G A;  3LK4 1;  3AA6 B;  3PQS A;  5ADX K;  1G90 A;  5G26 A;  2Y0L A;  4QQ1 A;  3TZG A;  2KC0 A;  3AAE A;  2XE2 A;  2XE5 A;  4O49 A;  2ZLD A;  4UB6 O;  4AZL A;  2KZ7 B;  3POR A;  1S5L O;  5AFU L;  2JQY A;  1BH3 A;  2JMM A;  4U9C A;  3JCU O;  4B61 A;  4KR8 A;  5D5D A;  4K3C A;  2POR A;  1BXW A;  3POU A;  4G75 A;  3VZU X;  3DWN A;  3FYX A;  3DA4 A;  4O4U A;  5T5F A;  3LK3 A;  1ORM A;  2R4P A;  3POQ A;  4FRT A;  3G7G A;  4PJ0 O;  4AYI D;  3PGS A;  4AUI A;  4G76 A;  1T1L A;  3NSG A;  1OSM A;  3HOL A;  3O0E A;  3SY9 A;  2YPV A;  3EMN X;  4Z3T A;  1PHO A;  1GFQ A;  3AA1 A;  3LK2 A;  4RL9 A;  2Y7S A;  3RBH A;  1GFN A;  4BUM X;  4D5U A;  2N2M A;  4LSF A;  4FSP A;  5GTH O;  2F1T A;  3AAA B;  3WI4 A;  2R89 A;  3UU2 A;  4AKM A;  5FVN A;  1OPF A;  3SZV A;  2FGQ X;  4AKR A;  4C4V A;  1PRN A;  5E79 O;  3HOE A;  3PF1 A;  3PQU A;  4N74 A;  5GTI O;  3T20 A;  1IZN B;  2WVP A;  2WJR A;  3KZI O;  4GCQ A;  3VE2 A;  7PRN A;  3C5O A;  5H2F O;  5AFU K;  2J1N A;  4AYN A;  2ERV A;  2XMX A;  4GCS A;  3AA6 A;  4AFK A;  1H6S 1;  2KXP A;  3V8U A;  2Y0H A;  2ZFG A;  5G39 A;  4FRX A;  3AAE B;  5DL8 A;  5KAI O;  4XNK A;  4RLB A;  5TIS O;  2KZ7 A;  4RJX A;  2J4U P;  1BT9 A;  3AA7 A;  4E1T A;  2X9K A;  5ADX L;  4GHB A;  4KRA A;  5DL5 A;  3GP6 A;  4GF4 A;  4RLC A;  2M07 A;  1HXU A;  3DZM A;  5EE2 A;  2W81 C;  5G3A A;  1GFO A;  1GFM A;  3LK3 B;  3NJT A;  5B66 O;  2W80 C;  2N2L A;  4FZL A;  4JFB A;  2K4T A;  4D64 A;  4C69 X;  2GE4 A;  4FOZ A;  3POX A;  1QJP A;  3AA0 B;  3T24 A;  2ODJ A;  4LSE A;  5KAF O;  2R4O A;  4GCP A;  4FZN A;  1P4T A;  3VY8 X;  4AYE C;  4FES A;  2PRN A;  1MM4 A;  2R4N A;  3AA1 B;  3BRY A;  3LK2 B;  3SYS A;  2R8A A;  3BRZ A;  4E1S A;  4AYD C;  2K0L A;  2R88 A;  3UPG A;  5GV0 A;  4IL6 O;  2YNK A;  3DA3 A;  2XTR A;  3PGR A;  4O4X A;  2LHF A;  4O3W A;  1HXT A;  5DL6 A;  2LFU A;  1E54 A;  3SZD A;  3VZW X;  3HWB A;  4C00 A;  4FZM A;  4LSI A;  2IWW A;  1QJ8 A;  2F1C X;  4LSH A;  2AXT O;  4N75 A;  4F4B A;  1Q9F A;  6PRN A;  3PRN A;  1QJ9 A;  3A0H O;  2QTK A;  3KVD D;  3LK4 2;  3A0B O;  1MM5 A;  2OMF A;  2XTQ A;  3QRC A;  4FT6 A;  1ZHX A;  2O4V A;  4KR4 A;  2F1V A;  2KXP B;  3A2S X;  3K19 A;  5PRN A;  3WI5 A;  1YS5 A;  4JCH A;  3JTY A;  4FUV A;  4N58 A;  4PUX A;  3QRA A;  3VZT X;  4AYM C;  5JDP A;  1ZHT A;  1MPF A;  4N59 A;  2Y2X A;  4PR7 A;  1GFP A;  1THQ A;  3BS0 A;  3DWO X;  2IWV A;  2M06 A;  3AA7 B;  2R4L A;  5B5E O;  4D65 A;  5IYU A;  2XE3 A;  1ZHW A;  2KDY A;  3PGU A;  5G38 A;  2FGR A;  3UAQ A;  1T16 A;  2MHL A;  3VE1 A;  3WU2 O;  4FSO A;  4UB8 O;  2XE1 A;  1ZHY A;  1ZHZ A;  4K3B A;  4FQE A;  4XNL A;  3T0S A;  4O3X B;  3AAA A;  2X27 X;  3VY9 X;  2XG6 A;  2Y0K A;  3AA0 A;  3SYB A;  4FMS A;  4AKR B;  4C4V B;  3HW9 A;  1HXX A;  1IZN A; 
#chains in the Genus database with same CATH homology
 4RJW A;  5DL7 A;  3SY7 A;  4O3Y A;  2MNH A;  4O3Z A;  8PRN A;  1Q9G A;  3LK4 1;  3AA6 B;  3PQS A;  5ADX K;  5G26 A;  2Y0L A;  4QQ1 A;  3TZG A;  2KC0 A;  3AAE A;  2XE2 A;  2XE5 A;  4O49 A;  2ZLD A;  4AZL A;  2KZ7 B;  3POR A;  5AFU L;  1BH3 A;  2JMM A;  4U9C A;  4B61 A;  4KR8 A;  5D5D A;  2POR A;  1BXW A;  3POU A;  4G75 A;  3VZU X;  3FYX A;  4O4U A;  3DA4 A;  5T5F A;  3LK3 A;  1ORM A;  3POQ A;  4FRT A;  3G7G A;  4AYI D;  4AUI A;  4G76 A;  3NSG A;  1OSM A;  3HOL A;  3O0E A;  3SY9 A;  2YPV A;  3EMN X;  4Z3T A;  1PHO A;  1GFQ A;  3AA1 A;  3LK2 A;  4RL9 A;  2Y7S A;  4BUM X;  1GFN A;  4D5U A;  2N2M A;  4LSF A;  4FSP A;  2F1T A;  3AAA B;  3WI4 A;  3UU2 A;  4AKM A;  5FVN A;  1OPF A;  3SZV A;  2FGQ X;  4AKR A;  1PRN A;  3HOE A;  3PQU A;  3T20 A;  1IZN B;  3VE2 A;  4GCQ A;  7PRN A;  3C5O A;  5AFU K;  2J1N A;  4AYN A;  2ERV A;  2XMX A;  4GCS A;  3AA6 A;  4AFK A;  1H6S 1;  2KXP A;  3V8U A;  2Y0H A;  2ZFG A;  4FRX A;  3AAE B;  5DL8 A;  4XNK A;  4RLB A;  2KZ7 A;  4RJX A;  2J4U P;  1BT9 A;  3AA7 A;  4E1T A;  5ADX L;  4GHB A;  4KRA A;  5DL5 A;  3GP6 A;  4GF4 A;  4RLC A;  2M07 A;  1HXU A;  5EE2 A;  2W81 C;  1GFO A;  1GFM A;  3LK3 B;  2W80 C;  2N2L A;  4FZL A;  4JFB A;  2K4T A;  4D64 A;  4C69 X;  2GE4 A;  4FOZ A;  3POX A;  1QJP A;  3AA0 B;  3T24 A;  2ODJ A;  4LSE A;  4GCP A;  4FZN A;  1P4T A;  3VY8 X;  4AYE C;  4FES A;  2PRN A;  1MM4 A;  3AA1 B;  3LK2 B;  4E1S A;  3SYS A;  3UPG A;  4AYD C;  2K0L A;  5GV0 A;  2YNK A;  3DA3 A;  2XTR A;  4O4X A;  4O3W A;  2LHF A;  5DL6 A;  1HXT A;  3SZD A;  2LFU A;  1E54 A;  3VZW X;  3HWB A;  4FZM A;  4LSI A;  1QJ8 A;  4LSH A;  4F4B A;  1G90 A;  1Q9F A;  6PRN A;  3PRN A;  1QJ9 A;  3LK4 2;  2QTK A;  3KVD D;  4FT6 A;  1MM5 A;  2OMF A;  2XTQ A;  3QRC A;  4KR4 A;  1ZHX A;  2O4V A;  3RBH A;  2F1V A;  2KXP B;  3A2S X;  3K19 A;  5PRN A;  3WI5 A;  1YS5 A;  4JCH A;  3JTY A;  4FUV A;  4N58 A;  4PUX A;  3QRA A;  3VZT X;  4AYM C;  5JDP A;  1ZHT A;  1MPF A;  4N59 A;  2Y2X A;  1GFP A;  1THQ A;  2M06 A;  3AA7 B;  4D65 A;  5IYU A;  2XE3 A;  1ZHW A;  2KDY A;  3VE1 A;  3UAQ A;  2FGR A;  2MHL A;  4FSO A;  2XE1 A;  1ZHY A;  1ZHZ A;  4XNL A;  3T0S A;  4O3X B;  3AAA A;  2X27 X;  3VY9 X;  2XG6 A;  2Y0K A;  3AA0 A;  3SYB A;  4FMS A;  4AKR B;  3HW9 A;  1HXX A;  1IZN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...