3HW9A

Cation selective pathway of ompf porin revealed by anomalous x-ray diffraction
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
340
structure length
339
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, ion transport
molecule keywords Outer membrane protein F
publication title Cation-selective pathway of OmpF porin revealed by anomalous X-ray diffraction.
pubmed doi rcsb
source organism Escherichia coli
total genus 89
structure length 339
sequence length 340
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3hw9A00
3A2SX 4FT6A 1HXTA 1H6S1 1BH3A 4GCSA 3WI5A 4RJWA 3PRNA 1PHOA 4D65A 1PRNA 2Y0LA 4RJXA 4D5UA 3VZWX 2J1NA 3HWBA 1GFOA 2PRNA 3NSGA 1HXXA 7PRNA 3VY8X 3SY7A 3T24A 4AUIA 2ZLDA 2J4UP 4FRXA 3SYBA 3T20A 1OSMA 6PRNA 4KR8A 1OPFA 2XG6A 1BT9A 4D64A 3FYXA 1HXUA 3POXA 1MPFA 4KR4A 5PRNA 3SZVA 4JFBA 5JDPA 1GFPA 3SY9A 3UPGA 1E54A 4LSFA 4FSPA 3WI4A 3O0EA 8PRNA 4LSIA 3VY9X 4C69X 3SYSA 3POQA 2O4VA 3SZDA 4BUMX 4GCPA 1GFNA 4KRAA 3UU2A 3VZUX 1GFQA 2OMFA 4FOZA 5DL6A 2QTKA 3EMNX 3T0SA 2XE1A 2PORA 3VZTX 2ZFGA 4GCQA 2XE5A 4FRTA 4LSHA 1GFMA 2Y0KA 3HW9A 2K4TA 2FGRA 3PORA 4FMSA 3JTYA 5DL5A 2Y0HA 4FSOA 5DL7A 3POUA 5FVNA 5DL8A 4LSEA 2FGQX 2XE3A 2Y2XA 2XE2A 2ODJA 3K19A
chains in the Genus database with same CATH superfamily
3A2SX 2KXPA 2KZ7A 4FT6A 1HXTA 4CTDA 4AKRB 4O3ZA 2AXTO 1H6S1 1T1LA 1BH3A 3DZMA 5ADXK 2MNHA 4GCSA 4U9CA 4E1TA 5E79O 3WI5A 5IYUA 3BRZA 4RJWA 4G75A 1MM5A 3LK3B 5B66O 1IZNB 1ZHXA 1QJPA 4AYEC 3PRNA 1PHOA 4D65A 3AA0A 1PRNA 1Q9GA 3HOLA 2Y0LA 3JCUO 4Z3TA 4B61A 3VE2A 4RJXA 3LK2A 4O49A 4D5UA 4N59A 2F1VA 5T5FA 3WU2O 4C00A 1P4TA 2JQYA 3VZWX 2J1NA 3A0HO 3HWBA 5H2FO 3AA6B 1GFOA 3NJTA 2PRNA 3NSGA 1T16A 1HXXA 4N58A 4PR7A 2W80C 3BS0A 5GTHO 1BXWA 7PRNA 3AAEA 4O3XB 1QJ8A 2R4PA 2X9KA 4GHBA 2R4LA 2ERVA 3VY8X 3GP6A 4AYMC 2R4NA 3SY7A 3T24A 4AUIA 2ZLDA 4G76A 4O4XA 2J4UP 4UB8O 4FRXA 3SYBA 3BRYA 3T20A 4AKMA 1OSMA 1ZHWA 3LK2B 3PQUA 3AAAA 4IL6O 4JCHA 6PRNA 2KDYA 3LK41 4KR8A 1OPFA 2XG6A 1BT9A 5G38A 3UAQA 2MHLA 3DWOX 1ZHTA 3FYXA 1HXUA 3POXA 2F1CX 4FUVA 4D64A 3AA7A 3QRCA 1MPFA 4KR4A 3HOEA 5PRNA 3SZVA 4AYID 4GF4A 4JFBA 4F4BA 2KXPB 1S5LO 2KZ7B 2R89A 3PF1A 4O3YA 5D5DA 1GFPA 5G26A 4UB6O 3V8UA 3DA4A 5JDPA 3SY9A 3UPGA 2JMMA 3LK42 1E54A 2WVPA 3C5OA 3KVDD 5KAIO 4O4UA 3PGRA 2Y7SA 3TZGA 1ZHYA 3KZIO 4LSFA 4RL9A 2M07A 4AKRA 4AYDC 4FSPA 5AFUL 3WI4A 1ORMA 2R4OA 3QRAA 3O0EA 4O3WA 3AA0B 8PRNA 4LSIA 4AFKA 4RLBA 3VY9X 3LK3A 1IZNA 2R88A 4N75A 5EE2A 4K3BA 2WJRA 3A0BO 1ZHZA 4PJ0O 4QQ1A 2W81C 3DWNA 3PGSA 4C69X 5AFUK 1G90A 3SYSA 2YPVA 3POQA 2O4VA 3AA1A 4C4VB 3SZDA 2K0LA 1YS5A 2WJQA 2XTQA 4GCPA 3PQSA 4BUMX 1GFNA 2XTRA 4KRAA 4FZMA 1MM4A 3UU2A 4XNKA 3VZUX 1GFQA 5GV0A 2OMFA 3AAEB 4FQEA 4FOZA 2N2MA 3AA6A 5DL6A 5B5EO 2QTKA 3EMNX 3T0SA 2IWVA 2XE1A 2PORA 3G7GA 3VZTX 1Q9FA 4FESA 4RLCA 2F1TA 2GE4A 4E1SA 2ZFGA 3AAAB 2XE5A 4FRTA 4GCQA 4LSHA 4FZNA 1GFMA 2Y0KA 3HW9A 2IWWA 4AZLA 2N2LA 2K4TA 3PGUA 4AYNA 2LFUA 5KAFO 2M06A 3AA1B 4N74A 2FGRA 2LHFA 2YNKA 3PORA 3AA7B 4PUXA 5G39A 5GTIO 2XMXA 2KC0A 4FMSA 4FZLA 3JTYA 5DL5A 2Y0HA 2R8AA 4FSOA 5DL7A 3POUA 1THQA 5FVNA 5DL8A 5TISO 4LSEA 4K3CA 4C4VA 3DA3A 1QJ9A 5ADXL 2X27X 2FGQX 3VE1A 2XE3A 4XNLA 5G3AA 2Y2XA 2XE2A 2ODJA 3K19A 3RBHA
chains in the Genus database with same CATH topology
3A2SX 2KXPA 2KZ7A 4FT6A 1HXTA 4AKRB 4O3ZA 1H6S1 1BH3A 5ADXK 2MNHA 4GCSA 4U9CA 4E1TA 3WI5A 5IYUA 4RJWA 4G75A 1MM5A 3LK3B 1IZNB 1ZHXA 1QJPA 4AYEC 3PRNA 1PHOA 4D65A 3AA0A 1PRNA 1Q9GA 3HOLA 2Y0LA 4Z3TA 4B61A 3VE2A 4RJXA 3LK2A 4O49A 4D5UA 4N59A 2F1VA 5T5FA 1P4TA 3VZWX 2J1NA 3HWBA 3AA6B 1GFOA 4N58A 2PRNA 3NSGA 1HXXA 2W80C 1BXWA 7PRNA 3AAEA 4O3XB 1QJ8A 4GHBA 2ERVA 3VY8X 3GP6A 4AYMC 3SY7A 3T24A 4AUIA 2ZLDA 4G76A 4O4XA 2J4UP 4FRXA 3SYBA 3T20A 4AKMA 1OSMA 1ZHWA 3LK2B 3PQUA 3AAAA 4JCHA 6PRNA 2KDYA 3LK41 4KR8A 1OPFA 2XG6A 1BT9A 3UAQA 2MHLA 4D64A 1ZHTA 3FYXA 1HXUA 3POXA 4FUVA 3AA7A 3QRCA 1MPFA 4KR4A 3HOEA 5PRNA 3SZVA 4AYID 4GF4A 4JFBA 4F4BA 2KXPB 2KZ7B 5D5DA 4O3YA 5G26A 3V8UA 1GFPA 5JDPA 3DA4A 3SY9A 3UPGA 2JMMA 3LK42 1E54A 3C5OA 3KVDD 4O4UA 2Y7SA 3TZGA 1ZHYA 4LSFA 4RL9A 4AKRA 2M07A 4AYDC 5AFUL 4FSPA 3WI4A 1ORMA 3QRAA 3O0EA 4O3WA 3AA0B 8PRNA 4LSIA 4AFKA 4RLBA 3VY9X 3LK3A 1IZNA 5EE2A 4QQ1A 1ZHZA 5AFUK 2W81C 4C69X 3SYSA 2YPVA 3POQA 2O4VA 3AA1A 1G90A 3SZDA 2K0LA 1YS5A 2XTQA 4GCPA 4BUMX 3PQSA 1GFNA 2XTRA 4KRAA 4FZMA 1MM4A 3UU2A 4XNKA 3VZUX 1GFQA 5GV0A 2OMFA 3AAEB 4FOZA 2N2MA 3AA6A 5DL6A 2QTKA 3EMNX 3T0SA 2XE1A 2PORA 3G7GA 3VZTX 1Q9FA 4FESA 4RLCA 2F1TA 2GE4A 4E1SA 2ZFGA 3AAAB 2XE5A 4FRTA 4GCQA 4LSHA 4FZNA 1GFMA 2Y0KA 3HW9A 4AZLA 2N2LA 2K4TA 4AYNA 2LFUA 2M06A 3AA1B 2FGRA 2LHFA 2YNKA 3PORA 3AA7B 4PUXA 2XMXA 2KC0A 4FMSA 4FZLA 3JTYA 5DL5A 2Y0HA 4FSOA 5DL7A 3POUA 1THQA 5FVNA 5DL8A 4LSEA 5ADXL 3DA3A 1QJ9A 2X27X 2FGQX 3VE1A 2XE3A 4XNLA 2Y2XA 2XE2A 2ODJA 3K19A 3RBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A2S X;  4FT6 A;  1HXT A;  1H6S 1;  1BH3 A;  4GCS A;  3WI5 A;  4RJW A;  3PRN A;  1PHO A;  4D65 A;  1PRN A;  2Y0L A;  4RJX A;  4D5U A;  3VZW X;  2J1N A;  3HWB A;  1GFO A;  2PRN A;  3NSG A;  1HXX A;  7PRN A;  3VY8 X;  3SY7 A;  3T24 A;  4AUI A;  2ZLD A;  2J4U P;  4FRX A;  3SYB A;  3T20 A;  1OSM A;  6PRN A;  4KR8 A;  1OPF A;  2XG6 A;  1BT9 A;  4D64 A;  3FYX A;  1HXU A;  3POX A;  1MPF A;  4KR4 A;  5PRN A;  3SZV A;  4JFB A;  5JDP A;  1GFP A;  3SY9 A;  3UPG A;  1E54 A;  4LSF A;  4FSP A;  3WI4 A;  3O0E A;  8PRN A;  4LSI A;  3VY9 X;  4C69 X;  3SYS A;  3POQ A;  2O4V A;  3SZD A;  4BUM X;  4GCP A;  1GFN A;  4KRA A;  3UU2 A;  3VZU X;  1GFQ A;  2OMF A;  4FOZ A;  5DL6 A;  2QTK A;  3EMN X;  3T0S A;  2XE1 A;  2POR A;  3VZT X;  2ZFG A;  4GCQ A;  2XE5 A;  4FRT A;  4LSH A;  1GFM A;  2Y0K A;  3HW9 A;  2K4T A;  2FGR A;  3POR A;  4FMS A;  3JTY A;  5DL5 A;  2Y0H A;  4FSO A;  5DL7 A;  3POU A;  5FVN A;  5DL8 A;  4LSE A;  2FGQ X;  2XE3 A;  2Y2X A;  2XE2 A;  2ODJ A;  3K19 A; 
#chains in the Genus database with same CATH topology
 3A2S X;  2KXP A;  2KZ7 A;  4FT6 A;  1HXT A;  4CTD A;  4AKR B;  4O3Z A;  2AXT O;  1H6S 1;  1T1L A;  1BH3 A;  3DZM A;  5ADX K;  2MNH A;  4GCS A;  4U9C A;  4E1T A;  5E79 O;  3WI5 A;  5IYU A;  3BRZ A;  4RJW A;  4G75 A;  1MM5 A;  3LK3 B;  5B66 O;  1IZN B;  1ZHX A;  1QJP A;  4AYE C;  3PRN A;  1PHO A;  4D65 A;  3AA0 A;  1PRN A;  1Q9G A;  3HOL A;  2Y0L A;  3JCU O;  4Z3T A;  4B61 A;  3VE2 A;  4RJX A;  3LK2 A;  4O49 A;  4D5U A;  4N59 A;  2F1V A;  5T5F A;  3WU2 O;  4C00 A;  1P4T A;  2JQY A;  3VZW X;  2J1N A;  3A0H O;  3HWB A;  5H2F O;  3AA6 B;  1GFO A;  3NJT A;  2PRN A;  3NSG A;  1T16 A;  1HXX A;  4N58 A;  4PR7 A;  2W80 C;  3BS0 A;  5GTH O;  1BXW A;  7PRN A;  3AAE A;  4O3X B;  1QJ8 A;  2R4P A;  2X9K A;  4GHB A;  2R4L A;  2ERV A;  3VY8 X;  3GP6 A;  4AYM C;  2R4N A;  3SY7 A;  3T24 A;  4AUI A;  2ZLD A;  4G76 A;  4O4X A;  2J4U P;  4UB8 O;  4FRX A;  3SYB A;  3BRY A;  3T20 A;  4AKM A;  1OSM A;  1ZHW A;  3LK2 B;  3PQU A;  3AAA A;  4IL6 O;  4JCH A;  6PRN A;  2KDY A;  3LK4 1;  4KR8 A;  1OPF A;  2XG6 A;  1BT9 A;  5G38 A;  3UAQ A;  2MHL A;  3DWO X;  1ZHT A;  3FYX A;  1HXU A;  3POX A;  2F1C X;  4FUV A;  4D64 A;  3AA7 A;  3QRC A;  1MPF A;  4KR4 A;  3HOE A;  5PRN A;  3SZV A;  4AYI D;  4GF4 A;  4JFB A;  4F4B A;  2KXP B;  1S5L O;  2KZ7 B;  2R89 A;  3PF1 A;  4O3Y A;  5D5D A;  1GFP A;  5G26 A;  4UB6 O;  3V8U A;  3DA4 A;  5JDP A;  3SY9 A;  3UPG A;  2JMM A;  3LK4 2;  1E54 A;  2WVP A;  3C5O A;  3KVD D;  5KAI O;  4O4U A;  3PGR A;  2Y7S A;  3TZG A;  1ZHY A;  3KZI O;  4LSF A;  4RL9 A;  2M07 A;  4AKR A;  4AYD C;  4FSP A;  5AFU L;  3WI4 A;  1ORM A;  2R4O A;  3QRA A;  3O0E A;  4O3W A;  3AA0 B;  8PRN A;  4LSI A;  4AFK A;  4RLB A;  3VY9 X;  3LK3 A;  1IZN A;  2R88 A;  4N75 A;  5EE2 A;  4K3B A;  2WJR A;  3A0B O;  1ZHZ A;  4PJ0 O;  4QQ1 A;  2W81 C;  3DWN A;  3PGS A;  4C69 X;  5AFU K;  1G90 A;  3SYS A;  2YPV A;  3POQ A;  2O4V A;  3AA1 A;  4C4V B;  3SZD A;  2K0L A;  1YS5 A;  2WJQ A;  2XTQ A;  4GCP A;  3PQS A;  4BUM X;  1GFN A;  2XTR A;  4KRA A;  4FZM A;  1MM4 A;  3UU2 A;  4XNK A;  3VZU X;  1GFQ A;  5GV0 A;  2OMF A;  3AAE B;  4FQE A;  4FOZ A;  2N2M A;  3AA6 A;  5DL6 A;  5B5E O;  2QTK A;  3EMN X;  3T0S A;  2IWV A;  2XE1 A;  2POR A;  3G7G A;  3VZT X;  1Q9F A;  4FES A;  4RLC A;  2F1T A;  2GE4 A;  4E1S A;  2ZFG A;  3AAA B;  2XE5 A;  4FRT A;  4GCQ A;  4LSH A;  4FZN A;  1GFM A;  2Y0K A;  3HW9 A;  2IWW A;  4AZL A;  2N2L A;  2K4T A;  3PGU A;  4AYN A;  2LFU A;  5KAF O;  2M06 A;  3AA1 B;  4N74 A;  2FGR A;  2LHF A;  2YNK A;  3POR A;  3AA7 B;  4PUX A;  5G39 A;  5GTI O;  2XMX A;  2KC0 A;  4FMS A;  4FZL A;  3JTY A;  5DL5 A;  2Y0H A;  2R8A A;  4FSO A;  5DL7 A;  3POU A;  1THQ A;  5FVN A;  5DL8 A;  5TIS O;  4LSE A;  4K3C A;  4C4V A;  3DA3 A;  1QJ9 A;  5ADX L;  2X27 X;  2FGQ X;  3VE1 A;  2XE3 A;  4XNL A;  5G3A A;  2Y2X A;  2XE2 A;  2ODJ A;  3K19 A;  3RBH A; 
#chains in the Genus database with same CATH homology
 3A2S X;  2KXP A;  2KZ7 A;  4FT6 A;  1HXT A;  4AKR B;  4O3Z A;  1H6S 1;  1BH3 A;  5ADX K;  2MNH A;  4GCS A;  4U9C A;  4E1T A;  3WI5 A;  5IYU A;  4RJW A;  4G75 A;  1MM5 A;  3LK3 B;  1IZN B;  1ZHX A;  1QJP A;  4AYE C;  3PRN A;  1PHO A;  4D65 A;  3AA0 A;  1PRN A;  1Q9G A;  3HOL A;  2Y0L A;  4Z3T A;  4B61 A;  3VE2 A;  4RJX A;  3LK2 A;  4O49 A;  4D5U A;  4N59 A;  2F1V A;  5T5F A;  1P4T A;  3VZW X;  2J1N A;  3HWB A;  3AA6 B;  1GFO A;  4N58 A;  2PRN A;  3NSG A;  1HXX A;  2W80 C;  1BXW A;  7PRN A;  3AAE A;  4O3X B;  1QJ8 A;  4GHB A;  2ERV A;  3VY8 X;  3GP6 A;  4AYM C;  3SY7 A;  3T24 A;  4AUI A;  2ZLD A;  4G76 A;  4O4X A;  2J4U P;  4FRX A;  3SYB A;  3T20 A;  4AKM A;  1OSM A;  1ZHW A;  3LK2 B;  3PQU A;  3AAA A;  4JCH A;  6PRN A;  2KDY A;  3LK4 1;  4KR8 A;  1OPF A;  2XG6 A;  1BT9 A;  3UAQ A;  2MHL A;  4D64 A;  1ZHT A;  3FYX A;  1HXU A;  3POX A;  4FUV A;  3AA7 A;  3QRC A;  1MPF A;  4KR4 A;  3HOE A;  5PRN A;  3SZV A;  4AYI D;  4GF4 A;  4JFB A;  4F4B A;  2KXP B;  2KZ7 B;  5D5D A;  4O3Y A;  5G26 A;  3V8U A;  1GFP A;  5JDP A;  3DA4 A;  3SY9 A;  3UPG A;  2JMM A;  3LK4 2;  1E54 A;  3C5O A;  3KVD D;  4O4U A;  2Y7S A;  3TZG A;  1ZHY A;  4LSF A;  4RL9 A;  4AKR A;  2M07 A;  4AYD C;  5AFU L;  4FSP A;  3WI4 A;  1ORM A;  3QRA A;  3O0E A;  4O3W A;  3AA0 B;  8PRN A;  4LSI A;  4AFK A;  4RLB A;  3VY9 X;  3LK3 A;  1IZN A;  5EE2 A;  4QQ1 A;  1ZHZ A;  5AFU K;  2W81 C;  4C69 X;  3SYS A;  2YPV A;  3POQ A;  2O4V A;  3AA1 A;  1G90 A;  3SZD A;  2K0L A;  1YS5 A;  2XTQ A;  4GCP A;  4BUM X;  3PQS A;  1GFN A;  2XTR A;  4KRA A;  4FZM A;  1MM4 A;  3UU2 A;  4XNK A;  3VZU X;  1GFQ A;  5GV0 A;  2OMF A;  3AAE B;  4FOZ A;  2N2M A;  3AA6 A;  5DL6 A;  2QTK A;  3EMN X;  3T0S A;  2XE1 A;  2POR A;  3G7G A;  3VZT X;  1Q9F A;  4FES A;  4RLC A;  2F1T A;  2GE4 A;  4E1S A;  2ZFG A;  3AAA B;  2XE5 A;  4FRT A;  4GCQ A;  4LSH A;  4FZN A;  1GFM A;  2Y0K A;  3HW9 A;  4AZL A;  2N2L A;  2K4T A;  4AYN A;  2LFU A;  2M06 A;  3AA1 B;  2FGR A;  2LHF A;  2YNK A;  3POR A;  3AA7 B;  4PUX A;  2XMX A;  2KC0 A;  4FMS A;  4FZL A;  3JTY A;  5DL5 A;  2Y0H A;  4FSO A;  5DL7 A;  3POU A;  1THQ A;  5FVN A;  5DL8 A;  4LSE A;  5ADX L;  3DA3 A;  1QJ9 A;  2X27 X;  2FGQ X;  3VE1 A;  2XE3 A;  4XNL A;  2Y2X A;  2XE2 A;  2ODJ A;  3K19 A;  3RBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...