3HW9A

Cation selective pathway of ompf porin revealed by anomalous x-ray diffraction
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
340
structure length
339
Chain Sequence
b'AEIYNKDGNKVDLYGKAVGLHYFSKGGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein F
publication title Cation-selective pathway of OmpF porin revealed by anomalous X-ray diffraction.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein, ion transport
total genus 89
structure length 339
sequence length 340
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3hw9A00
3SYBA 4FMSA 2PORA 3HWBA 3VY8X 3SYSA 3UU2A 3POXA 4BUMX 2Y0HA 2XE1A 1GFMA 4D5UA 1HXTA 4FT6A 3SZVA 1GFNA 2Y2XA 5DL6A 4D64A 3VZTX 1GFQA 2QTKA 4D65A 4LSEA 4GCSA 3SY7A 3FYXA 3VZUX 2FGQX 2OMFA 2FGRA 5FVNA 2Y0KA 1GFOA 4FSPA 3SY9A 3A2SX 2O4VA 6PRNA 3K19A 1PRNA 7PRNA 3EMNX 2XE5A 1OPFA 3PORA 3O0EA 5DL7A 2J4UP 1OSMA 4FRTA 5DL8A 4LSHA 1E54A 3PRNA 2Y0LA 5PRNA 5JDPA 3T20A 1BH3A 4KR4A 1HXXA 3POQA 1HXUA 3T0SA 4RJXA 3HW9A 3VY9X 2ZFGA 4C69X 4JFBA 4FOZA 2ODJA 3POUA 2XE2A 4LSFA 1MPFA 4GCPA 3WI5A 4RJWA 1H6S1 4KR8A 4GCQA 3SZDA 1GFPA 3NSGA 2K4TA 3T24A 3UPGA 8PRNA 4AUIA 5DL5A 2ZLDA 1BT9A 1PHOA 3JTYA 2XG6A 4LSIA 4FRXA 2J1NA 2PRNA 2XE3A 3WI4A 4KRAA 3VZWX 4FSOA
chains in the Genus database with same CATH superfamily
2ERVA 3SYBA 3WU2O 4FMSA 4AYDC 4PJ0O 3NJTA 3PF1A 5GTIO 4CTDA 3AAAB 4QQ1A 2PORA 4AYNA 2KDYA 2IWWA 5ADXL 3HWBA 5B5EO 3LK3A 4AYEC 1T16A 3AAAA 3SYSA 3UU2A 3VY8X 3BRZA 3DA4A 3HOLA 4XNKA 4AKRB 3POXA 1Q9GA 2IWVA 2Y0HA 4IL6O 2XE1A 1GFMA 3A0HO 4O3XB 4BUMX 5ADXK 3KZIO 1IZNB 4D5UA 1YS5A 1HXTA 2KXPB 2LFUA 4FT6A 4UB6O 2R89A 2JMMA 3LK41 2WVPA 4O49A 2KXPA 5G39A 2KZ7B 4UB8O 1GFNA 3SZVA 2Y2XA 3G7GA 5H2FO 5DL6A 2R4LA 5KAIO 2R4PA 3BRYA 4D64A 1ORMA 2R4NA 3VZTX 2KZ7A 1GFQA 4U9CA 3PGUA 2QTKA 4D65A 3AA6B 4FZMA 4LSEA 4FZNA 5EE2A 4GCSA 1Q9FA 2GE4A 5IYUA 1THQA 1ZHYA 3LK2B 3SY7A 3FYXA 4FESA 3AA6A 4N59A 3LK3B 3BS0A 4XNLA 5G26A 3VZUX 2FGQX 2N2LA 2OMFA 3LK2A 1MM5A 3QRCA 2FGRA 4FZLA 5FVNA 2F1CX 5GTHO 2Y0KA 4G76A 4FQEA 2R4OA 4PUXA 1GFOA 4FSPA 3DA3A 3JCUO 3A2SX 2O4VA 4K3BA 3SY9A 6PRNA 2XTQA 3K19A 4O3ZA 1PRNA 7PRNA 2KC0A 2X9KA 2XE5A 1OPFA 3AA0B 3EMNX 3C5OA 3O0EA 3PORA 2XTRA 3PQSA 5DL7A 4B61A 2J4UP 2MHLA 5G3AA 2K0LA 3AA0A 3AA1A 1OSMA 4FRTA 3A0BO 4E1TA 3LK42 4N58A 2WJQA 5DL8A 4LSHA 1E54A 3PRNA 5GV0A 4K3CA 2Y0LA 4AYID 1T1LA 2YNKA 5B66O 5PRNA 4C4VB 4O3YA 5JDPA 3T20A 1BH3A 4RL9A 4KR4A 4O3WA 4C4VA 5AFUL 4RLCA 1HXXA 1ZHWA 3POQA 1HXUA 3T0SA 4RJXA 3HW9A 3VY9X 2ZFGA 4C69X 4F4BA 4JFBA 4C00A 2R8AA 3UAQA 3GP6A 5D5DA 4AKRA 4FOZA 2M06A 1ZHXA 2W80C 3PQUA 2ODJA 3DWOX 2F1VA 3PGRA 3POUA 2XE2A 4PR7A 4AZLA 1G90A 1QJ9A 5G38A 4LSFA 1MPFA 4GCPA 4N75A 4N74A 3WI5A 4AFKA 3AA1B 1MM4A 4GF4A 4RLBA 4E1SA 3DWNA 3QRAA 3VE2A 4RJWA 1QJPA 3AA7B 2Y7SA 1QJ8A 1S5LO 2F1TA 3HOEA 1H6S1 4O4UA 3AAEA 2M07A 3AA7A 3KVDD 5KAFO 5T5FA 4KR8A 4GCQA 3SZDA 4AYMC 1ZHTA 3DZMA 1GFPA 3NSGA 2K4TA 4JCHA 3T24A 3PGSA 2N2MA 2MNHA 3UPGA 2AXTO 3RBHA 1ZHZA 2JQYA 8PRNA 5E79O 4AUIA 4G75A 3VE1A 5DL5A 2ZLDA 5TISO 5AFUK 1BT9A 2WJRA 1IZNA 1PHOA 4O4XA 1BXWA 3JTYA 2XG6A 4LSIA 4FRXA 2YPVA 1P4TA 2XMXA 2J1NA 4FUVA 2PRNA 2LHFA 4GHBA 3V8UA 2R88A 2XE3A 3TZGA 3AAEB 3WI4A 4KRAA 4AKMA 4Z3TA 3VZWX 4FSOA 2X27X 2W81C
chains in the Genus database with same CATH topology
2ERVA 3SYBA 4FMSA 4AYDC 3AAAB 4QQ1A 2PORA 4AYNA 2KDYA 5ADXL 3HWBA 3LK3A 4AYEC 3AAAA 3VY8X 3SYSA 3UU2A 3DA4A 4XNKA 3HOLA 4AKRB 3POXA 1Q9GA 4O3XB 2Y0HA 4BUMX 2XE1A 1GFMA 5ADXK 1IZNB 4D5UA 1YS5A 1HXTA 2KXPB 2LFUA 4FT6A 2JMMA 3LK41 4O49A 2KXPA 2KZ7B 3SZVA 1GFNA 2Y2XA 3G7GA 5DL6A 4D64A 1ORMA 3VZTX 2KZ7A 1GFQA 4U9CA 2QTKA 4D65A 3AA6B 4FZMA 4LSEA 4FZNA 5EE2A 4GCSA 1Q9FA 2GE4A 5IYUA 1THQA 1ZHYA 3LK2B 3SY7A 3FYXA 4FESA 3AA6A 4N59A 3LK3B 4XNLA 5G26A 3VZUX 2FGQX 2N2LA 2OMFA 3LK2A 1MM5A 3QRCA 2FGRA 4FZLA 5FVNA 2Y0KA 4G76A 4PUXA 1GFOA 4FSPA 3DA3A 3SY9A 3A2SX 2O4VA 6PRNA 2XTQA 3K19A 4O3ZA 1PRNA 7PRNA 2KC0A 3EMNX 2XE5A 1OPFA 3AA0B 3O0EA 3C5OA 3PORA 3PQSA 2XTRA 5DL7A 4B61A 2J4UP 2MHLA 2K0LA 3AA0A 3AA1A 1OSMA 4FRTA 4E1TA 3LK42 4N58A 5DL8A 4LSHA 1E54A 3PRNA 5GV0A 2Y0LA 4AYID 2YNKA 5PRNA 4O3YA 5JDPA 3T20A 1BH3A 4RL9A 4KR4A 4O3WA 5AFUL 4RLCA 1HXXA 1ZHWA 3POQA 1HXUA 3T0SA 4RJXA 3HW9A 3VY9X 2ZFGA 4C69X 4F4BA 4JFBA 3UAQA 3GP6A 5D5DA 4AKRA 4FOZA 2M06A 1ZHXA 2W80C 3PQUA 2ODJA 3POUA 2F1VA 2XE2A 4AZLA 1G90A 1QJ9A 4AFKA 4LSFA 1MPFA 4GCPA 3WI5A 3AA1B 1MM4A 4GF4A 4RLBA 4E1SA 3QRAA 3VE2A 4RJWA 1QJPA 3AA7B 2Y7SA 1QJ8A 2F1TA 3HOEA 1H6S1 4O4UA 3AAEA 2M07A 3AA7A 3KVDD 5T5FA 4KR8A 4GCQA 3SZDA 4AYMC 1ZHTA 1GFPA 3NSGA 2K4TA 4JCHA 3T24A 2N2MA 2MNHA 3UPGA 3RBHA 1ZHZA 8PRNA 4AUIA 4G75A 3VE1A 5DL5A 2ZLDA 5AFUK 1BT9A 1IZNA 1PHOA 4O4XA 1BXWA 3JTYA 2XG6A 4LSIA 4FRXA 2YPVA 1P4TA 2XMXA 2J1NA 4FUVA 2PRNA 2LHFA 4GHBA 3V8UA 2XE3A 3TZGA 3AAEB 3WI4A 4KRAA 4AKMA 4Z3TA 3VZWX 4FSOA 2X27X 2W81C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SYB A;  4FMS A;  2POR A;  3HWB A;  3VY8 X;  3SYS A;  3UU2 A;  3POX A;  4BUM X;  2Y0H A;  2XE1 A;  1GFM A;  4D5U A;  1HXT A;  4FT6 A;  3SZV A;  1GFN A;  2Y2X A;  5DL6 A;  4D64 A;  3VZT X;  1GFQ A;  2QTK A;  4D65 A;  4LSE A;  4GCS A;  3SY7 A;  3FYX A;  3VZU X;  2FGQ X;  2OMF A;  2FGR A;  5FVN A;  2Y0K A;  1GFO A;  4FSP A;  3SY9 A;  3A2S X;  2O4V A;  6PRN A;  3K19 A;  1PRN A;  7PRN A;  3EMN X;  2XE5 A;  1OPF A;  3POR A;  3O0E A;  5DL7 A;  2J4U P;  1OSM A;  4FRT A;  5DL8 A;  4LSH A;  1E54 A;  3PRN A;  2Y0L A;  5PRN A;  5JDP A;  3T20 A;  1BH3 A;  4KR4 A;  1HXX A;  3POQ A;  1HXU A;  3T0S A;  4RJX A;  3HW9 A;  3VY9 X;  2ZFG A;  4C69 X;  4JFB A;  4FOZ A;  2ODJ A;  3POU A;  2XE2 A;  4LSF A;  1MPF A;  4GCP A;  3WI5 A;  4RJW A;  1H6S 1;  4KR8 A;  4GCQ A;  3SZD A;  1GFP A;  3NSG A;  2K4T A;  3T24 A;  3UPG A;  8PRN A;  4AUI A;  5DL5 A;  2ZLD A;  1BT9 A;  1PHO A;  3JTY A;  2XG6 A;  4LSI A;  4FRX A;  2J1N A;  2PRN A;  2XE3 A;  3WI4 A;  4KRA A;  3VZW X;  4FSO A; 
#chains in the Genus database with same CATH topology
 2ERV A;  3SYB A;  3WU2 O;  4FMS A;  4AYD C;  4PJ0 O;  3NJT A;  3PF1 A;  5GTI O;  4CTD A;  3AAA B;  4QQ1 A;  2POR A;  4AYN A;  2KDY A;  2IWW A;  5ADX L;  3HWB A;  5B5E O;  3LK3 A;  4AYE C;  1T16 A;  3AAA A;  3SYS A;  3UU2 A;  3VY8 X;  3BRZ A;  3DA4 A;  3HOL A;  4XNK A;  4AKR B;  3POX A;  1Q9G A;  2IWV A;  2Y0H A;  4IL6 O;  2XE1 A;  1GFM A;  3A0H O;  4O3X B;  4BUM X;  5ADX K;  3KZI O;  1IZN B;  4D5U A;  1YS5 A;  1HXT A;  2KXP B;  2LFU A;  4FT6 A;  4UB6 O;  2R89 A;  2JMM A;  3LK4 1;  2WVP A;  4O49 A;  2KXP A;  5G39 A;  2KZ7 B;  4UB8 O;  1GFN A;  3SZV A;  2Y2X A;  3G7G A;  5H2F O;  5DL6 A;  2R4L A;  5KAI O;  2R4P A;  3BRY A;  4D64 A;  1ORM A;  2R4N A;  3VZT X;  2KZ7 A;  1GFQ A;  4U9C A;  3PGU A;  2QTK A;  4D65 A;  3AA6 B;  4FZM A;  4LSE A;  4FZN A;  5EE2 A;  4GCS A;  1Q9F A;  2GE4 A;  5IYU A;  1THQ A;  1ZHY A;  3LK2 B;  3SY7 A;  3FYX A;  4FES A;  3AA6 A;  4N59 A;  3LK3 B;  3BS0 A;  4XNL A;  5G26 A;  3VZU X;  2FGQ X;  2N2L A;  2OMF A;  3LK2 A;  1MM5 A;  3QRC A;  2FGR A;  4FZL A;  5FVN A;  2F1C X;  5GTH O;  2Y0K A;  4G76 A;  4FQE A;  2R4O A;  4PUX A;  1GFO A;  4FSP A;  3DA3 A;  3JCU O;  3A2S X;  2O4V A;  4K3B A;  3SY9 A;  6PRN A;  2XTQ A;  3K19 A;  4O3Z A;  1PRN A;  7PRN A;  2KC0 A;  2X9K A;  2XE5 A;  1OPF A;  3AA0 B;  3EMN X;  3C5O A;  3O0E A;  3POR A;  2XTR A;  3PQS A;  5DL7 A;  4B61 A;  2J4U P;  2MHL A;  5G3A A;  2K0L A;  3AA0 A;  3AA1 A;  1OSM A;  4FRT A;  3A0B O;  4E1T A;  3LK4 2;  4N58 A;  2WJQ A;  5DL8 A;  4LSH A;  1E54 A;  3PRN A;  5GV0 A;  4K3C A;  2Y0L A;  4AYI D;  1T1L A;  2YNK A;  5B66 O;  5PRN A;  4C4V B;  4O3Y A;  5JDP A;  3T20 A;  1BH3 A;  4RL9 A;  4KR4 A;  4O3W A;  4C4V A;  5AFU L;  4RLC A;  1HXX A;  1ZHW A;  3POQ A;  1HXU A;  3T0S A;  4RJX A;  3HW9 A;  3VY9 X;  2ZFG A;  4C69 X;  4F4B A;  4JFB A;  4C00 A;  2R8A A;  3UAQ A;  3GP6 A;  5D5D A;  4AKR A;  4FOZ A;  2M06 A;  1ZHX A;  2W80 C;  3PQU A;  2ODJ A;  3DWO X;  2F1V A;  3PGR A;  3POU A;  2XE2 A;  4PR7 A;  4AZL A;  1G90 A;  1QJ9 A;  5G38 A;  4LSF A;  1MPF A;  4GCP A;  4N75 A;  4N74 A;  3WI5 A;  4AFK A;  3AA1 B;  1MM4 A;  4GF4 A;  4RLB A;  4E1S A;  3DWN A;  3QRA A;  3VE2 A;  4RJW A;  1QJP A;  3AA7 B;  2Y7S A;  1QJ8 A;  1S5L O;  2F1T A;  3HOE A;  1H6S 1;  4O4U A;  3AAE A;  2M07 A;  3AA7 A;  3KVD D;  5KAF O;  5T5F A;  4KR8 A;  4GCQ A;  3SZD A;  4AYM C;  1ZHT A;  3DZM A;  1GFP A;  3NSG A;  2K4T A;  4JCH A;  3T24 A;  3PGS A;  2N2M A;  2MNH A;  3UPG A;  2AXT O;  3RBH A;  1ZHZ A;  2JQY A;  8PRN A;  5E79 O;  4AUI A;  4G75 A;  3VE1 A;  5DL5 A;  2ZLD A;  5TIS O;  5AFU K;  1BT9 A;  2WJR A;  1IZN A;  1PHO A;  4O4X A;  1BXW A;  3JTY A;  2XG6 A;  4LSI A;  4FRX A;  2YPV A;  1P4T A;  2XMX A;  2J1N A;  4FUV A;  2PRN A;  2LHF A;  4GHB A;  3V8U A;  2R88 A;  2XE3 A;  3TZG A;  3AAE B;  3WI4 A;  4KRA A;  4AKM A;  4Z3T A;  3VZW X;  4FSO A;  2X27 X;  2W81 C; 
#chains in the Genus database with same CATH homology
 2ERV A;  3SYB A;  4FMS A;  4AYD C;  3AAA B;  4QQ1 A;  2POR A;  4AYN A;  2KDY A;  5ADX L;  3HWB A;  3LK3 A;  4AYE C;  3AAA A;  3VY8 X;  3SYS A;  3UU2 A;  3DA4 A;  4XNK A;  3HOL A;  4AKR B;  3POX A;  1Q9G A;  4O3X B;  2Y0H A;  4BUM X;  2XE1 A;  1GFM A;  5ADX K;  1IZN B;  4D5U A;  1YS5 A;  1HXT A;  2KXP B;  2LFU A;  4FT6 A;  2JMM A;  3LK4 1;  4O49 A;  2KXP A;  2KZ7 B;  3SZV A;  1GFN A;  2Y2X A;  3G7G A;  5DL6 A;  4D64 A;  1ORM A;  3VZT X;  2KZ7 A;  1GFQ A;  4U9C A;  2QTK A;  4D65 A;  3AA6 B;  4FZM A;  4LSE A;  4FZN A;  5EE2 A;  4GCS A;  1Q9F A;  2GE4 A;  5IYU A;  1THQ A;  1ZHY A;  3LK2 B;  3SY7 A;  3FYX A;  4FES A;  3AA6 A;  4N59 A;  3LK3 B;  4XNL A;  5G26 A;  3VZU X;  2FGQ X;  2N2L A;  2OMF A;  3LK2 A;  1MM5 A;  3QRC A;  2FGR A;  4FZL A;  5FVN A;  2Y0K A;  4G76 A;  4PUX A;  1GFO A;  4FSP A;  3DA3 A;  3SY9 A;  3A2S X;  2O4V A;  6PRN A;  2XTQ A;  3K19 A;  4O3Z A;  1PRN A;  7PRN A;  2KC0 A;  3EMN X;  2XE5 A;  1OPF A;  3AA0 B;  3O0E A;  3C5O A;  3POR A;  3PQS A;  2XTR A;  5DL7 A;  4B61 A;  2J4U P;  2MHL A;  2K0L A;  3AA0 A;  3AA1 A;  1OSM A;  4FRT A;  4E1T A;  3LK4 2;  4N58 A;  5DL8 A;  4LSH A;  1E54 A;  3PRN A;  5GV0 A;  2Y0L A;  4AYI D;  2YNK A;  5PRN A;  4O3Y A;  5JDP A;  3T20 A;  1BH3 A;  4RL9 A;  4KR4 A;  4O3W A;  5AFU L;  4RLC A;  1HXX A;  1ZHW A;  3POQ A;  1HXU A;  3T0S A;  4RJX A;  3HW9 A;  3VY9 X;  2ZFG A;  4C69 X;  4F4B A;  4JFB A;  3UAQ A;  3GP6 A;  5D5D A;  4AKR A;  4FOZ A;  2M06 A;  1ZHX A;  2W80 C;  3PQU A;  2ODJ A;  3POU A;  2F1V A;  2XE2 A;  4AZL A;  1G90 A;  1QJ9 A;  4AFK A;  4LSF A;  1MPF A;  4GCP A;  3WI5 A;  3AA1 B;  1MM4 A;  4GF4 A;  4RLB A;  4E1S A;  3QRA A;  3VE2 A;  4RJW A;  1QJP A;  3AA7 B;  2Y7S A;  1QJ8 A;  2F1T A;  3HOE A;  1H6S 1;  4O4U A;  3AAE A;  2M07 A;  3AA7 A;  3KVD D;  5T5F A;  4KR8 A;  4GCQ A;  3SZD A;  4AYM C;  1ZHT A;  1GFP A;  3NSG A;  2K4T A;  4JCH A;  3T24 A;  2N2M A;  2MNH A;  3UPG A;  3RBH A;  1ZHZ A;  8PRN A;  4AUI A;  4G75 A;  3VE1 A;  5DL5 A;  2ZLD A;  5AFU K;  1BT9 A;  1IZN A;  1PHO A;  4O4X A;  1BXW A;  3JTY A;  2XG6 A;  4LSI A;  4FRX A;  2YPV A;  1P4T A;  2XMX A;  2J1N A;  4FUV A;  2PRN A;  2LHF A;  4GHB A;  3V8U A;  2XE3 A;  3TZG A;  3AAE B;  3WI4 A;  4KRA A;  4AKM A;  4Z3T A;  3VZW X;  4FSO A;  2X27 X;  2W81 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...