3HW9A

Cation selective pathway of ompf porin revealed by anomalous x-ray diffraction
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
340
structure length
339
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cation-selective pathway of OmpF porin revealed by anomalous X-ray diffraction.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein, ion transport
molecule keywords Outer membrane protein F
total genus 89
structure length 339
sequence length 340
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3hw9A00
3POQA 3PORA 3POUA 2PORA 1H6S1 4RJXA 4GCQA 4LSIA 3T0SA 3JTYA 3VY8X 1GFOA 3UU2A 4FRTA 4LSFA 3POXA 2FGQX 8PRNA 1PHOA 2J4UP 4D65A 3SY9A 1E54A 4GCSA 5JDPA 3VY9X 3T24A 3T20A 5DL6A 3SYBA 3EMNX 4JFBA 3SZDA 3A2SX 1MPFA 1HXXA 3UPGA 1OSMA 4FRXA 4D64A 1HXUA 3HW9A 5DL8A 1GFNA 2XG6A 1GFMA 4FSOA 4RJWA 3SZVA 5DL5A 2ZFGA 3SYSA 3NSGA 2O4VA 2XE2A 1PRNA 4FSPA 2Y2XA 3FYXA 1BH3A 4FMSA 2PRNA 1GFQA 4FOZA 5DL7A 3HWBA 3VZWX 2XE5A 4D5UA 2FGRA 4LSHA 4LSEA 2XE1A 5PRNA 2ZLDA 4BUMX 2OMFA 4FT6A 2ODJA 4AUIA 5FVNA 2QTKA 3VZTX 1OPFA 6PRNA 4GCPA 3WI4A 3VZUX 2XE3A 3O0EA 7PRNA 1HXTA 2Y0HA 2J1NA 2Y0KA 4KRAA 4C69X 1GFPA 3WI5A 4KR4A 1BT9A 3SY7A 3K19A 2K4TA 4KR8A 3PRNA 2Y0LA
chains in the Genus database with same CATH superfamily
4AFKA 2YPVA 4AYMC 5EE2A 2R4OA 3POQA 5H2FO 3PORA 2X27X 3DWNA 4O3WA 3POUA 4AKRA 2LHFA 4K3BA 2PORA 4O49A 1H6S1 4RJXA 4GCQA 4LSIA 3T0SA 3JTYA 3VY8X 3PGRA 1GFOA 4XNLA 3UU2A 1THQA 3BRZA 3PGUA 4FRTA 5GTHO 1T16A 5GV0A 4UB6O 3AAAB 4AYEC 4LSFA 3POXA 2FGQX 3LK2B 4O4XA 8PRNA 1PHOA 1QJ9A 2J4UP 4D65A 2R4LA 4UB8O 3JCUO 3NJTA 3AAEB 3SY9A 1E54A 3KZIO 1ZHWA 1IZNA 4GCSA 4U9CA 3AA7A 5GTIO 5JDPA 3PGSA 1T1LA 4O3XB 2WJQA 3VY9X 3T24A 3PF1A 4RL9A 5TISO 3QRCA 3AA0A 1IZNB 4CTDA 2F1VA 4GHBA 2KDYA 3AA6A 3T20A 2JMMA 5AFUL 3LK3B 5DL6A 3DZMA 3SYBA 3EMNX 4JFBA 2K0LA 2F1CX 3A0BO 4N74A 3SZDA 3A2SX 1MPFA 2LFUA 3GP6A 3VE2A 1HXXA 3C5OA 4FUVA 1OSMA 1MM4A 4FRXA 3UPGA 3AA1B 4D64A 1Q9FA 1HXUA 1ZHZA 2YNKA 3HW9A 1Q9GA 5DL8A 2N2LA 3RBHA 1GFNA 4JCHA 2XG6A 3BS0A 3LK41 2XTQA 3DA3A 4RLBA 1GFMA 3A0HO 4FSOA 4RJWA 5DL5A 3SZVA 2XMXA 2ZFGA 3WU2O 5B66O 3SYSA 4O3YA 3NSGA 4RLCA 1S5LO 2O4VA 2XE2A 3PQUA 5G39A 1PRNA 4FSPA 2Y2XA 3DWOX 5B5EO 5KAIO 2R8AA 2R88A 4N58A 5G3AA 5D5DA 1ZHXA 4G75A 1QJPA 3FYXA 5T5FA 1BH3A 2R4PA 4G76A 4GF4A 3KVDD 5AFUK 4FMSA 3LK2A 2PRNA 1GFQA 4E1TA 3AAAA 4FOZA 2F1TA 5DL7A 2ERVA 3HWBA 2WJRA 3VZWX 1ZHTA 4C4VB 4AYID 2IWVA 2KXPA 2XE5A 5E79O 3LK3A 4FESA 5G26A 2MHLA 2IWWA 4D5UA 2FGRA 3G7GA 4LSHA 4N59A 4LSEA 2XE1A 4IL6O 2KXPB 2R4NA 3AA0B 5PRNA 3VE1A 4C4VA 2M07A 2ZLDA 4BUMX 2OMFA 4FT6A 2KZ7B 2ODJA 4AUIA 4AYDC 1BXWA 2GE4A 4PUXA 3UAQA 5IYUA 5FVNA 2MNHA 2X9KA 5KAFO 3HOLA 2QTKA 3BRYA 3VZTX 1OPFA 3AAEA 2KC0A 2KZ7A 6PRNA 3V8UA 3AA1A 3HOEA 3DA4A 4C00A 4GCPA 1MM5A 4XNKA 3VZUX 2N2MA 3WI4A 2XE3A 2W80C 3O0EA 2W81C 4FZNA 4PR7A 3TZGA 1G90A 5G38A 2M06A 2R89A 3PQSA 7PRNA 1HXTA 2Y0HA 2J1NA 2Y0KA 1YS5A 3AA6B 4KRAA 4O4UA 4FQEA 4AKRB 2Y7SA 4AYNA 4C69X 1QJ8A 5ADXK 1ZHYA 5ADXL 1GFPA 2JQYA 3WI5A 4E1SA 4KR4A 1BT9A 4K3CA 3SY7A 3LK42 1P4TA 2K4TA 3K19A 4KR8A 3AA7B 4B61A 4AKMA 4FZMA 4QQ1A 2AXTO 2XTRA 4N75A 4O3ZA 4PJ0O 4F4BA 3PRNA 2Y0LA 4AZLA 4FZLA 4Z3TA 3QRAA 1ORMA 2WVPA
chains in the Genus database with same CATH topology
4AFKA 2YPVA 4AYMC 5EE2A 3POQA 3PORA 2X27X 4O3WA 3POUA 4AKRA 2LHFA 2PORA 4O49A 1H6S1 4RJXA 4GCQA 4LSIA 3T0SA 3JTYA 3VY8X 1GFOA 4XNLA 3UU2A 1THQA 4FRTA 3AAAB 4AYEC 4LSFA 3POXA 2FGQX 3LK2B 4O4XA 8PRNA 1PHOA 1QJ9A 2J4UP 4D65A 3SY9A 3AAEB 1E54A 4GCSA 1ZHWA 1IZNA 4U9CA 5JDPA 3AA7A 4O3XB 3VY9X 3T24A 4RL9A 3QRCA 3AA0A 1IZNB 2F1VA 4GHBA 2KDYA 3AA6A 3T20A 2JMMA 5AFUL 3LK3B 5DL6A 3SYBA 3EMNX 4JFBA 2K0LA 3SZDA 3A2SX 1MPFA 2LFUA 3GP6A 3VE2A 1HXXA 3C5OA 4FUVA 1OSMA 1MM4A 4FRXA 3UPGA 3AA1B 4D64A 1Q9FA 1HXUA 1ZHZA 2YNKA 3HW9A 1Q9GA 5DL8A 2N2LA 3RBHA 1GFNA 4JCHA 2XG6A 3LK41 2XTQA 3DA3A 4RLBA 1GFMA 4FSOA 4RJWA 3SZVA 5DL5A 2XMXA 2ZFGA 3SYSA 4O3YA 3NSGA 4RLCA 3PQUA 2O4VA 2XE2A 1PRNA 4FSPA 2Y2XA 4N58A 5T5FA 5D5DA 1ZHXA 4G75A 1QJPA 3FYXA 1BH3A 4G76A 4GF4A 3KVDD 5AFUK 4FMSA 3LK2A 2PRNA 1GFQA 4E1TA 3AAAA 4FOZA 2F1TA 5DL7A 2ERVA 3HWBA 3VZWX 1ZHTA 4AYID 2KXPA 2XE5A 5G26A 3LK3A 4FESA 2MHLA 4D5UA 2FGRA 3G7GA 4LSHA 4N59A 4LSEA 2XE1A 2KXPB 3AA0B 5PRNA 3VE1A 2M07A 2ZLDA 4BUMX 2OMFA 4FT6A 2KZ7B 2ODJA 4AUIA 4AYDC 1BXWA 2GE4A 4PUXA 3UAQA 5IYUA 5FVNA 2MNHA 3HOLA 2QTKA 3VZTX 1OPFA 3AAEA 2KC0A 2KZ7A 6PRNA 3V8UA 3AA1A 3HOEA 3DA4A 4GCPA 1MM5A 4XNKA 3VZUX 2N2MA 3WI4A 2XE3A 2W80C 3O0EA 2W81C 4FZNA 3TZGA 5GV0A 1G90A 2M06A 3PQSA 7PRNA 1HXTA 2Y0HA 2J1NA 2Y0KA 1YS5A 3AA6B 4KRAA 4O4UA 4AKRB 4AYNA 2Y7SA 4C69X 1QJ8A 5ADXK 1ZHYA 5ADXL 1GFPA 3WI5A 4E1SA 4KR4A 1BT9A 3SY7A 3LK42 1P4TA 2K4TA 3K19A 4KR8A 3AA7B 4B61A 4AKMA 4FZMA 4QQ1A 2XTRA 4O3ZA 4F4BA 3PRNA 2Y0LA 4AZLA 4FZLA 4Z3TA 3QRAA 1ORMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3POQ A;  3POR A;  3POU A;  2POR A;  1H6S 1;  4RJX A;  4GCQ A;  4LSI A;  3T0S A;  3JTY A;  3VY8 X;  1GFO A;  3UU2 A;  4FRT A;  4LSF A;  3POX A;  2FGQ X;  8PRN A;  1PHO A;  2J4U P;  4D65 A;  3SY9 A;  1E54 A;  4GCS A;  5JDP A;  3VY9 X;  3T24 A;  3T20 A;  5DL6 A;  3SYB A;  3EMN X;  4JFB A;  3SZD A;  3A2S X;  1MPF A;  1HXX A;  3UPG A;  1OSM A;  4FRX A;  4D64 A;  1HXU A;  3HW9 A;  5DL8 A;  1GFN A;  2XG6 A;  1GFM A;  4FSO A;  4RJW A;  3SZV A;  5DL5 A;  2ZFG A;  3SYS A;  3NSG A;  2O4V A;  2XE2 A;  1PRN A;  4FSP A;  2Y2X A;  3FYX A;  1BH3 A;  4FMS A;  2PRN A;  1GFQ A;  4FOZ A;  5DL7 A;  3HWB A;  3VZW X;  2XE5 A;  4D5U A;  2FGR A;  4LSH A;  4LSE A;  2XE1 A;  5PRN A;  2ZLD A;  4BUM X;  2OMF A;  4FT6 A;  2ODJ A;  4AUI A;  5FVN A;  2QTK A;  3VZT X;  1OPF A;  6PRN A;  4GCP A;  3WI4 A;  3VZU X;  2XE3 A;  3O0E A;  7PRN A;  1HXT A;  2Y0H A;  2J1N A;  2Y0K A;  4KRA A;  4C69 X;  1GFP A;  3WI5 A;  4KR4 A;  1BT9 A;  3SY7 A;  3K19 A;  2K4T A;  4KR8 A;  3PRN A;  2Y0L A; 
#chains in the Genus database with same CATH topology
 4AFK A;  2YPV A;  4AYM C;  5EE2 A;  2R4O A;  3POQ A;  5H2F O;  3POR A;  2X27 X;  3DWN A;  4O3W A;  3POU A;  4AKR A;  2LHF A;  4K3B A;  2POR A;  4O49 A;  1H6S 1;  4RJX A;  4GCQ A;  4LSI A;  3T0S A;  3JTY A;  3VY8 X;  3PGR A;  1GFO A;  4XNL A;  3UU2 A;  1THQ A;  3BRZ A;  3PGU A;  4FRT A;  5GTH O;  1T16 A;  5GV0 A;  4UB6 O;  3AAA B;  4AYE C;  4LSF A;  3POX A;  2FGQ X;  3LK2 B;  4O4X A;  8PRN A;  1PHO A;  1QJ9 A;  2J4U P;  4D65 A;  2R4L A;  4UB8 O;  3JCU O;  3NJT A;  3AAE B;  3SY9 A;  1E54 A;  3KZI O;  1ZHW A;  1IZN A;  4GCS A;  4U9C A;  3AA7 A;  5GTI O;  5JDP A;  3PGS A;  1T1L A;  4O3X B;  2WJQ A;  3VY9 X;  3T24 A;  3PF1 A;  4RL9 A;  5TIS O;  3QRC A;  3AA0 A;  1IZN B;  4CTD A;  2F1V A;  4GHB A;  2KDY A;  3AA6 A;  3T20 A;  2JMM A;  5AFU L;  3LK3 B;  5DL6 A;  3DZM A;  3SYB A;  3EMN X;  4JFB A;  2K0L A;  2F1C X;  3A0B O;  4N74 A;  3SZD A;  3A2S X;  1MPF A;  2LFU A;  3GP6 A;  3VE2 A;  1HXX A;  3C5O A;  4FUV A;  1OSM A;  1MM4 A;  4FRX A;  3UPG A;  3AA1 B;  4D64 A;  1Q9F A;  1HXU A;  1ZHZ A;  2YNK A;  3HW9 A;  1Q9G A;  5DL8 A;  2N2L A;  3RBH A;  1GFN A;  4JCH A;  2XG6 A;  3BS0 A;  3LK4 1;  2XTQ A;  3DA3 A;  4RLB A;  1GFM A;  3A0H O;  4FSO A;  4RJW A;  5DL5 A;  3SZV A;  2XMX A;  2ZFG A;  3WU2 O;  5B66 O;  3SYS A;  4O3Y A;  3NSG A;  4RLC A;  1S5L O;  2O4V A;  2XE2 A;  3PQU A;  5G39 A;  1PRN A;  4FSP A;  2Y2X A;  3DWO X;  5B5E O;  5KAI O;  2R8A A;  2R88 A;  4N58 A;  5G3A A;  5D5D A;  1ZHX A;  4G75 A;  1QJP A;  3FYX A;  5T5F A;  1BH3 A;  2R4P A;  4G76 A;  4GF4 A;  3KVD D;  5AFU K;  4FMS A;  3LK2 A;  2PRN A;  1GFQ A;  4E1T A;  3AAA A;  4FOZ A;  2F1T A;  5DL7 A;  2ERV A;  3HWB A;  2WJR A;  3VZW X;  1ZHT A;  4C4V B;  4AYI D;  2IWV A;  2KXP A;  2XE5 A;  5E79 O;  3LK3 A;  4FES A;  5G26 A;  2MHL A;  2IWW A;  4D5U A;  2FGR A;  3G7G A;  4LSH A;  4N59 A;  4LSE A;  2XE1 A;  4IL6 O;  2KXP B;  2R4N A;  3AA0 B;  5PRN A;  3VE1 A;  4C4V A;  2M07 A;  2ZLD A;  4BUM X;  2OMF A;  4FT6 A;  2KZ7 B;  2ODJ A;  4AUI A;  4AYD C;  1BXW A;  2GE4 A;  4PUX A;  3UAQ A;  5IYU A;  5FVN A;  2MNH A;  2X9K A;  5KAF O;  3HOL A;  2QTK A;  3BRY A;  3VZT X;  1OPF A;  3AAE A;  2KC0 A;  2KZ7 A;  6PRN A;  3V8U A;  3AA1 A;  3HOE A;  3DA4 A;  4C00 A;  4GCP A;  1MM5 A;  4XNK A;  3VZU X;  2N2M A;  3WI4 A;  2XE3 A;  2W80 C;  3O0E A;  2W81 C;  4FZN A;  4PR7 A;  3TZG A;  1G90 A;  5G38 A;  2M06 A;  2R89 A;  3PQS A;  7PRN A;  1HXT A;  2Y0H A;  2J1N A;  2Y0K A;  1YS5 A;  3AA6 B;  4KRA A;  4O4U A;  4FQE A;  4AKR B;  2Y7S A;  4AYN A;  4C69 X;  1QJ8 A;  5ADX K;  1ZHY A;  5ADX L;  1GFP A;  2JQY A;  3WI5 A;  4E1S A;  4KR4 A;  1BT9 A;  4K3C A;  3SY7 A;  3LK4 2;  1P4T A;  2K4T A;  3K19 A;  4KR8 A;  3AA7 B;  4B61 A;  4AKM A;  4FZM A;  4QQ1 A;  2AXT O;  2XTR A;  4N75 A;  4O3Z A;  4PJ0 O;  4F4B A;  3PRN A;  2Y0L A;  4AZL A;  4FZL A;  4Z3T A;  3QRA A;  1ORM A;  2WVP A; 
#chains in the Genus database with same CATH homology
 4AFK A;  2YPV A;  4AYM C;  5EE2 A;  3POQ A;  3POR A;  2X27 X;  4O3W A;  3POU A;  4AKR A;  2LHF A;  2POR A;  4O49 A;  1H6S 1;  4RJX A;  4GCQ A;  4LSI A;  3T0S A;  3JTY A;  3VY8 X;  1GFO A;  4XNL A;  3UU2 A;  1THQ A;  4FRT A;  3AAA B;  4AYE C;  4LSF A;  3POX A;  2FGQ X;  3LK2 B;  4O4X A;  8PRN A;  1PHO A;  1QJ9 A;  2J4U P;  4D65 A;  3SY9 A;  3AAE B;  1E54 A;  4GCS A;  1ZHW A;  1IZN A;  4U9C A;  5JDP A;  3AA7 A;  4O3X B;  3VY9 X;  3T24 A;  4RL9 A;  3QRC A;  3AA0 A;  1IZN B;  2F1V A;  4GHB A;  2KDY A;  3AA6 A;  3T20 A;  2JMM A;  5AFU L;  3LK3 B;  5DL6 A;  3SYB A;  3EMN X;  4JFB A;  2K0L A;  3SZD A;  3A2S X;  1MPF A;  2LFU A;  3GP6 A;  3VE2 A;  1HXX A;  3C5O A;  4FUV A;  1OSM A;  1MM4 A;  4FRX A;  3UPG A;  3AA1 B;  4D64 A;  1Q9F A;  1HXU A;  1ZHZ A;  2YNK A;  3HW9 A;  1Q9G A;  5DL8 A;  2N2L A;  3RBH A;  1GFN A;  4JCH A;  2XG6 A;  3LK4 1;  2XTQ A;  3DA3 A;  4RLB A;  1GFM A;  4FSO A;  4RJW A;  3SZV A;  5DL5 A;  2XMX A;  2ZFG A;  3SYS A;  4O3Y A;  3NSG A;  4RLC A;  3PQU A;  2O4V A;  2XE2 A;  1PRN A;  4FSP A;  2Y2X A;  4N58 A;  5T5F A;  5D5D A;  1ZHX A;  4G75 A;  1QJP A;  3FYX A;  1BH3 A;  4G76 A;  4GF4 A;  3KVD D;  5AFU K;  4FMS A;  3LK2 A;  2PRN A;  1GFQ A;  4E1T A;  3AAA A;  4FOZ A;  2F1T A;  5DL7 A;  2ERV A;  3HWB A;  3VZW X;  1ZHT A;  4AYI D;  2KXP A;  2XE5 A;  5G26 A;  3LK3 A;  4FES A;  2MHL A;  4D5U A;  2FGR A;  3G7G A;  4LSH A;  4N59 A;  4LSE A;  2XE1 A;  2KXP B;  3AA0 B;  5PRN A;  3VE1 A;  2M07 A;  2ZLD A;  4BUM X;  2OMF A;  4FT6 A;  2KZ7 B;  2ODJ A;  4AUI A;  4AYD C;  1BXW A;  2GE4 A;  4PUX A;  3UAQ A;  5IYU A;  5FVN A;  2MNH A;  3HOL A;  2QTK A;  3VZT X;  1OPF A;  3AAE A;  2KC0 A;  2KZ7 A;  6PRN A;  3V8U A;  3AA1 A;  3HOE A;  3DA4 A;  4GCP A;  1MM5 A;  4XNK A;  3VZU X;  2N2M A;  3WI4 A;  2XE3 A;  2W80 C;  3O0E A;  2W81 C;  4FZN A;  3TZG A;  5GV0 A;  1G90 A;  2M06 A;  3PQS A;  7PRN A;  1HXT A;  2Y0H A;  2J1N A;  2Y0K A;  1YS5 A;  3AA6 B;  4KRA A;  4O4U A;  4AKR B;  4AYN A;  2Y7S A;  4C69 X;  1QJ8 A;  5ADX K;  1ZHY A;  5ADX L;  1GFP A;  3WI5 A;  4E1S A;  4KR4 A;  1BT9 A;  3SY7 A;  3LK4 2;  1P4T A;  2K4T A;  3K19 A;  4KR8 A;  3AA7 B;  4B61 A;  4AKM A;  4FZM A;  4QQ1 A;  2XTR A;  4O3Z A;  4F4B A;  3PRN A;  2Y0L A;  4AZL A;  4FZL A;  4Z3T A;  3QRA A;  1ORM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...