1G90A

Nmr solution structure of outer membrane protein a transmembrane domain: 10 conformers
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
176
structure length
176
Chain Sequence
APKDNTWYTGAKLGFSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDFLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVFRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQFTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN A
publication title Structure of outer membrane protein A transmembrane domain by NMR spectroscopy
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 50
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2000-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01389 OmpA_membrane OmpA-like transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1g90A00
2GE4A 2F1VA 3C5OA 1MM4A 2MNHA 4RLCA 2F1TA 1Q9GA 1ORMA 1THQA 2LHFA 1QJ8A 1QJ9A 2X27X 2N2MA 1BXWA 3G7GA 2M06A 1QJPA 1G90A 4PUXA 2K0LA 3GP6A 2ERVA 3QRAA 3QRCA 2MHLA 1P4TA 2JMMA 1MM5A 2N2LA 2M07A 1Q9FA
chains in the Genus database with same CATH superfamily
2WJRA 4KR8A 3LK2A 1GFNA 4FQEA 3AA0B 4QQ1A 4GCPA 3KVDD 5TISO 4O3ZA 5DL5A 1ZHTA 2ZLDA 4FUVA 2Y0KA 3VE1A 4CTDA 4E1SA 2F1TA 1MPFA 1Q9GA 4RJWA 1GFQA 4AFKA 4O3YA 4C4VB 3KZIO 4LSIA 3PQSA 1THQA 1ZHWA 5D5DA 2W81C 3UAQA 3AA6A 2Y2XA 4FZMA 7PRNA 3AAEA 3AA1A 2Y0LA 2KXPB 2WJQA 1BXWA 3G7GA 4FESA 2Y7SA 4GHBA 3DA4A 3HWBA 1QJPA 4LSHA 2PRNA 4GCQA 5DL6A 1OPFA 2R4LA 5E79O 1T16A 4PJ0O 4AKRA 4C00A 2J4UP 2J1NA 2KDYA 4IL6O 5AFUL 2KZ7A 2K0LA 2R88A 4FRXA 1PHOA 1HXUA 3QRCA 3WI4A 4N75A 2XG6A 2ZFGA 3AA0A 5PRNA 3UPGA 3SZVA 5EE2A 2R4NA 4AKMA 3HOLA 4RL9A 1T1LA 4FSPA 4C4VA 4O49A 3VZTX 4AZLA 4N58A 3POQA 3DWNA 1HXXA 2MNHA 4K3CA 4PR7A 5KAIO 3LK3B 3VZWX 3BRZA 2R4OA 3A0BO 3AAAB 5DL7A 1GFOA 2KXPA 3LK41 3BS0A 3VZUX 5T5FA 4F4BA 4K3BA 1QJ8A 1QJ9A 4N74A 4O3XB 1GFMA 2R89A 5G3AA 1H6S1 4LSFA 4FZNA 2M06A 2XE1A 3SZDA 1HXTA 2O4VA 4FSOA 2IWWA 5KAFO 4PUXA 2XE2A 3POXA 2ODJA 4AYID 1GFPA 3QRAA 4O3WA 3RBHA 3K19A 2AXTO 2MHLA 1P4TA 3DA3A 4LSEA 5ADXK 4GCSA 3PRNA 1MM5A 2KC0A 4FMSA 2YNKA 2M07A 4C69X 3PQUA 3AAAA 3HOEA 3EMNX 3WU2O 5H2FO 5ADXL 2YPVA 3VE2A 3FYXA 2F1VA 5GTHO 1MM4A 5IYUA 2F1CX 2XMXA 3HW9A 2IWVA 3DWOX 4XNKA 4AYEC 1BH3A 2K4TA 3AA7B 4G76A 4KRAA 1IZNB 3SYBA 2OMFA 3T0SA 1ORMA 4B61A 4XNLA 4O4UA 4GF4A 4JCHA 2XE3A 2X27X 2XE5A 5G38A 4UB6O 4D5UA 4RJXA 1PRNA 2N2MA 4G75A 5JDPA 2XTQA 3POUA 3A0HO 5GTIO 5DL8A 8PRNA 2R8AA 4FZLA 3LK42 4Z3TA 4AYDC 3DZMA 4AYMC 3O0EA 2XTRA 3BRYA 2FGRA 2ERVA 3JTYA 3PF1A 4BUMX 3WI5A 3PORA 3PGSA 3T24A 4JFBA 5B5EO 3AA7A 3LK3A 1YS5A 1IZNA 4UB8O 3V8UA 3SYSA 2GE4A 1E54A 1ZHZA 3C5OA 6PRNA 4U9CA 4N59A 3VY8X 3VY9X 2PORA 2Y0HA 3SY9A 3NJTA 5GV0A 2X9KA 4RLCA 4AUIA 3PGUA 5G26A 3UU2A 1BT9A 2FGQX 4AYNA 5G39A 5B66O 3LK2B 2LHFA 1S5LO 3NSGA 2WVPA 2R4PA 4FOZA 5AFUK 1ZHXA 3JCUO 1G90A 4FRTA 5FVNA 3TZGA 3AA6B 4FT6A 1OSMA 2W80C 3SY7A 4E1TA 3AAEB 3AA1B 3GP6A 4D65A 1ZHYA 2LFUA 2QTKA 2JMMA 3A2SX 3PGRA 2JQYA 4O4XA 2N2LA 4AKRB 4KR4A 3T20A 1Q9FA 4D64A 4RLBA 2KZ7B
chains in the Genus database with same CATH topology
4KR8A 3LK2A 1GFNA 3AA0B 4QQ1A 4GCPA 3KVDD 4O3ZA 5DL5A 1ZHTA 2ZLDA 4FUVA 2Y0KA 3VE1A 4E1SA 6PRNA 2F1TA 1MPFA 1Q9GA 4RJWA 1GFQA 4AFKA 4O3YA 4LSIA 3PQSA 1THQA 1ZHWA 5D5DA 3UAQA 3AA6A 2Y2XA 4FZMA 7PRNA 3AAEA 3AA1A 2Y0LA 2KXPB 4FESA 1BXWA 3G7GA 4GHBA 2Y7SA 4LSHA 3DA4A 3HWBA 1QJPA 4LSFA 2PRNA 4GCQA 5DL6A 1OPFA 4AKRA 2J4UP 2J1NA 2KDYA 5AFUL 2KZ7A 2K0LA 4FRXA 1PHOA 1HXUA 3QRCA 3WI4A 2XG6A 2ZFGA 3AA0A 5PRNA 3UPGA 3SZVA 5EE2A 4AKMA 3HOLA 4RL9A 4FSPA 4O49A 3VZTX 4AZLA 4N58A 3POQA 1HXXA 2MNHA 3LK3B 3VZWX 3AAAB 5DL7A 1GFOA 2KXPA 3LK41 3VZUX 5T5FA 4F4BA 1QJ8A 1QJ9A 4O3XB 1GFMA 1H6S1 4FZNA 2M06A 2XE1A 3SZDA 1HXTA 2O4VA 4FSOA 4PUXA 2XE2A 3POXA 2ODJA 4AYID 1GFPA 3QRAA 4O3WA 3RBHA 3K19A 2MHLA 4LSEA 1P4TA 3DA3A 5ADXK 4GCSA 3PRNA 1MM5A 2KC0A 4FMSA 2YNKA 2M07A 4C69X 3PQUA 3AAAA 3HOEA 3EMNX 5ADXL 2YPVA 3VE2A 3FYXA 2F1VA 1MM4A 5IYUA 2XMXA 3HW9A 4XNKA 4AYEC 1BH3A 2K4TA 3AA7B 4G76A 4KRAA 1IZNB 3SYBA 2OMFA 3T0SA 1ORMA 4B61A 4XNLA 4O4UA 4GF4A 4JCHA 2XE3A 2X27X 2XE5A 4D5UA 4RJXA 1PRNA 2N2MA 4G75A 5JDPA 2XTQA 3POUA 8PRNA 5DL8A 4FZLA 3LK42 2KZ7B 4Z3TA 4AYDC 4AYMC 3O0EA 2XTRA 2FGRA 2ERVA 3JTYA 4BUMX 3WI5A 3PORA 3T24A 4JFBA 3AA7A 3LK3A 1YS5A 1IZNA 3V8UA 3SYSA 2GE4A 1E54A 1ZHZA 3C5OA 4U9CA 4N59A 3VY8X 3VY9X 2PORA 2Y0HA 3SY9A 5GV0A 4RLCA 4AUIA 5G26A 3UU2A 1BT9A 2FGQX 4AYNA 3LK2B 2LHFA 3NSGA 5AFUK 4FOZA 1ZHXA 1G90A 4FRTA 5FVNA 3TZGA 3AA6B 4FT6A 1OSMA 2W80C 3SY7A 4E1TA 3AAEB 3AA1B 3GP6A 4D65A 1ZHYA 2LFUA 2QTKA 2JMMA 3A2SX 4AKRB 4O4XA 2N2LA 4KR4A 3T20A 1Q9FA 4D64A 4RLBA 2W81C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GE4 A;  2F1V A;  3C5O A;  1MM4 A;  2MNH A;  4RLC A;  2F1T A;  1Q9G A;  1ORM A;  1THQ A;  2LHF A;  1QJ8 A;  1QJ9 A;  2X27 X;  2N2M A;  1BXW A;  3G7G A;  2M06 A;  1QJP A;  1G90 A;  4PUX A;  2K0L A;  3GP6 A;  2ERV A;  3QRA A;  3QRC A;  2MHL A;  1P4T A;  2JMM A;  1MM5 A;  2N2L A;  2M07 A;  1Q9F A; 
#chains in the Genus database with same CATH topology
 2WJR A;  4KR8 A;  3LK2 A;  1GFN A;  4FQE A;  3AA0 B;  4QQ1 A;  4GCP A;  3KVD D;  5TIS O;  4O3Z A;  5DL5 A;  1ZHT A;  2ZLD A;  4FUV A;  2Y0K A;  3VE1 A;  4CTD A;  4E1S A;  2F1T A;  1MPF A;  1Q9G A;  4RJW A;  1GFQ A;  4AFK A;  4O3Y A;  4C4V B;  3KZI O;  4LSI A;  3PQS A;  1THQ A;  1ZHW A;  5D5D A;  2W81 C;  3UAQ A;  3AA6 A;  2Y2X A;  4FZM A;  7PRN A;  3AAE A;  3AA1 A;  2Y0L A;  2KXP B;  2WJQ A;  1BXW A;  3G7G A;  4FES A;  2Y7S A;  4GHB A;  3DA4 A;  3HWB A;  1QJP A;  4LSH A;  2PRN A;  4GCQ A;  5DL6 A;  1OPF A;  2R4L A;  5E79 O;  1T16 A;  4PJ0 O;  4AKR A;  4C00 A;  2J4U P;  2J1N A;  2KDY A;  4IL6 O;  5AFU L;  2KZ7 A;  2K0L A;  2R88 A;  4FRX A;  1PHO A;  1HXU A;  3QRC A;  3WI4 A;  4N75 A;  2XG6 A;  2ZFG A;  3AA0 A;  5PRN A;  3UPG A;  3SZV A;  5EE2 A;  2R4N A;  4AKM A;  3HOL A;  4RL9 A;  1T1L A;  4FSP A;  4C4V A;  4O49 A;  3VZT X;  4AZL A;  4N58 A;  3POQ A;  3DWN A;  1HXX A;  2MNH A;  4K3C A;  4PR7 A;  5KAI O;  3LK3 B;  3VZW X;  3BRZ A;  2R4O A;  3A0B O;  3AAA B;  5DL7 A;  1GFO A;  2KXP A;  3LK4 1;  3BS0 A;  3VZU X;  5T5F A;  4F4B A;  4K3B A;  1QJ8 A;  1QJ9 A;  4N74 A;  4O3X B;  1GFM A;  2R89 A;  5G3A A;  1H6S 1;  4LSF A;  4FZN A;  2M06 A;  2XE1 A;  3SZD A;  1HXT A;  2O4V A;  4FSO A;  2IWW A;  5KAF O;  4PUX A;  2XE2 A;  3POX A;  2ODJ A;  4AYI D;  1GFP A;  3QRA A;  4O3W A;  3RBH A;  3K19 A;  2AXT O;  2MHL A;  1P4T A;  3DA3 A;  4LSE A;  5ADX K;  4GCS A;  3PRN A;  1MM5 A;  2KC0 A;  4FMS A;  2YNK A;  2M07 A;  4C69 X;  3PQU A;  3AAA A;  3HOE A;  3EMN X;  3WU2 O;  5H2F O;  5ADX L;  2YPV A;  3VE2 A;  3FYX A;  2F1V A;  5GTH O;  1MM4 A;  5IYU A;  2F1C X;  2XMX A;  3HW9 A;  2IWV A;  3DWO X;  4XNK A;  4AYE C;  1BH3 A;  2K4T A;  3AA7 B;  4G76 A;  4KRA A;  1IZN B;  3SYB A;  2OMF A;  3T0S A;  1ORM A;  4B61 A;  4XNL A;  4O4U A;  4GF4 A;  4JCH A;  2XE3 A;  2X27 X;  2XE5 A;  5G38 A;  4UB6 O;  4D5U A;  4RJX A;  1PRN A;  2N2M A;  4G75 A;  5JDP A;  2XTQ A;  3POU A;  3A0H O;  5GTI O;  5DL8 A;  8PRN A;  2R8A A;  4FZL A;  3LK4 2;  4Z3T A;  4AYD C;  3DZM A;  4AYM C;  3O0E A;  2XTR A;  3BRY A;  2FGR A;  2ERV A;  3JTY A;  3PF1 A;  4BUM X;  3WI5 A;  3POR A;  3PGS A;  3T24 A;  4JFB A;  5B5E O;  3AA7 A;  3LK3 A;  1YS5 A;  1IZN A;  4UB8 O;  3V8U A;  3SYS A;  2GE4 A;  1E54 A;  1ZHZ A;  3C5O A;  6PRN A;  4U9C A;  4N59 A;  3VY8 X;  3VY9 X;  2POR A;  2Y0H A;  3SY9 A;  3NJT A;  5GV0 A;  2X9K A;  4RLC A;  4AUI A;  3PGU A;  5G26 A;  3UU2 A;  1BT9 A;  2FGQ X;  4AYN A;  5G39 A;  5B66 O;  3LK2 B;  2LHF A;  1S5L O;  3NSG A;  2WVP A;  2R4P A;  4FOZ A;  5AFU K;  1ZHX A;  3JCU O;  1G90 A;  4FRT A;  5FVN A;  3TZG A;  3AA6 B;  4FT6 A;  1OSM A;  2W80 C;  3SY7 A;  4E1T A;  3AAE B;  3AA1 B;  3GP6 A;  4D65 A;  1ZHY A;  2LFU A;  2QTK A;  2JMM A;  3A2S X;  3PGR A;  2JQY A;  4O4X A;  2N2L A;  4AKR B;  4KR4 A;  3T20 A;  1Q9F A;  4D64 A;  4RLB A;  2KZ7 B; 
#chains in the Genus database with same CATH homology
 4KR8 A;  3LK2 A;  1GFN A;  3AA0 B;  4QQ1 A;  4GCP A;  3KVD D;  4O3Z A;  5DL5 A;  1ZHT A;  2ZLD A;  4FUV A;  2Y0K A;  3VE1 A;  4E1S A;  6PRN A;  2F1T A;  1MPF A;  1Q9G A;  4RJW A;  1GFQ A;  4AFK A;  4O3Y A;  4LSI A;  3PQS A;  1THQ A;  1ZHW A;  5D5D A;  3UAQ A;  3AA6 A;  2Y2X A;  4FZM A;  7PRN A;  3AAE A;  3AA1 A;  2Y0L A;  2KXP B;  4FES A;  1BXW A;  3G7G A;  4GHB A;  2Y7S A;  4LSH A;  3DA4 A;  3HWB A;  1QJP A;  4LSF A;  2PRN A;  4GCQ A;  5DL6 A;  1OPF A;  4AKR A;  2J4U P;  2J1N A;  2KDY A;  5AFU L;  2KZ7 A;  2K0L A;  4FRX A;  1PHO A;  1HXU A;  3QRC A;  3WI4 A;  2XG6 A;  2ZFG A;  3AA0 A;  5PRN A;  3UPG A;  3SZV A;  5EE2 A;  4AKM A;  3HOL A;  4RL9 A;  4FSP A;  4O49 A;  3VZT X;  4AZL A;  4N58 A;  3POQ A;  1HXX A;  2MNH A;  3LK3 B;  3VZW X;  3AAA B;  5DL7 A;  1GFO A;  2KXP A;  3LK4 1;  3VZU X;  5T5F A;  4F4B A;  1QJ8 A;  1QJ9 A;  4O3X B;  1GFM A;  1H6S 1;  4FZN A;  2M06 A;  2XE1 A;  3SZD A;  1HXT A;  2O4V A;  4FSO A;  4PUX A;  2XE2 A;  3POX A;  2ODJ A;  4AYI D;  1GFP A;  3QRA A;  4O3W A;  3RBH A;  3K19 A;  2MHL A;  4LSE A;  1P4T A;  3DA3 A;  5ADX K;  4GCS A;  3PRN A;  1MM5 A;  2KC0 A;  4FMS A;  2YNK A;  2M07 A;  4C69 X;  3PQU A;  3AAA A;  3HOE A;  3EMN X;  5ADX L;  2YPV A;  3VE2 A;  3FYX A;  2F1V A;  1MM4 A;  5IYU A;  2XMX A;  3HW9 A;  4XNK A;  4AYE C;  1BH3 A;  2K4T A;  3AA7 B;  4G76 A;  4KRA A;  1IZN B;  3SYB A;  2OMF A;  3T0S A;  1ORM A;  4B61 A;  4XNL A;  4O4U A;  4GF4 A;  4JCH A;  2XE3 A;  2X27 X;  2XE5 A;  4D5U A;  4RJX A;  1PRN A;  2N2M A;  4G75 A;  5JDP A;  2XTQ A;  3POU A;  8PRN A;  5DL8 A;  4FZL A;  3LK4 2;  2KZ7 B;  4Z3T A;  4AYD C;  4AYM C;  3O0E A;  2XTR A;  2FGR A;  2ERV A;  3JTY A;  4BUM X;  3WI5 A;  3POR A;  3T24 A;  4JFB A;  3AA7 A;  3LK3 A;  1YS5 A;  1IZN A;  3V8U A;  3SYS A;  2GE4 A;  1E54 A;  1ZHZ A;  3C5O A;  4U9C A;  4N59 A;  3VY8 X;  3VY9 X;  2POR A;  2Y0H A;  3SY9 A;  5GV0 A;  4RLC A;  4AUI A;  5G26 A;  3UU2 A;  1BT9 A;  2FGQ X;  4AYN A;  3LK2 B;  2LHF A;  3NSG A;  5AFU K;  4FOZ A;  1ZHX A;  1G90 A;  4FRT A;  5FVN A;  3TZG A;  3AA6 B;  4FT6 A;  1OSM A;  2W80 C;  3SY7 A;  4E1T A;  3AAE B;  3AA1 B;  3GP6 A;  4D65 A;  1ZHY A;  2LFU A;  2QTK A;  2JMM A;  3A2S X;  4AKR B;  4O4X A;  2N2L A;  4KR4 A;  3T20 A;  1Q9F A;  4D64 A;  4RLB A;  2W81 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...