1G90A

Nmr solution structure of outer membrane protein a transmembrane domain: 10 conformers
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
176
structure length
176
Chain Sequence
b'APKDNTWYTGAKLGFSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDFLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVFRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQFTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN A
publication title Structure of outer membrane protein A transmembrane domain by NMR spectroscopy
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 50
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2000-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01389 OmpA_membrane OmpA-like transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1g90A00
2M06A 3GP6A 2X27X 2F1VA 3G7GA 2ERVA 1Q9FA 1THQA 2MHLA 1QJ8A 3QRCA 2F1TA 2MNHA 1P4TA 3QRAA 2JMMA 1QJ9A 2LHFA 1QJPA 1MM5A 1MM4A 1ORMA 4RLCA 1BXWA 1G90A 3C5OA 2M07A 4PUXA 2N2LA 2GE4A 2N2MA 2K0LA 1Q9GA
chains in the Genus database with same CATH superfamily
3A2SX 4O4UA 2M06A 3GP6A 2R8AA 2WVPA 2Y0LA 3AA0A 1ZHXA 3AA6A 5DL6A 4GCSA 3LK2B 4O3YA 5AFUL 2IWVA 3QRCA 4KR8A 5KAFO 4AFKA 2WJRA 3LK2A 3VY9X 2J4UP 3SYBA 3AAEB 4LSFA 4CTDA 1BT9A 5AFUK 3K19A 1MM4A 2W80C 3POUA 1ORMA 3EMNX 1GFMA 3AAEA 2AXTO 4FRXA 2LFUA 4AKRB 4AUIA 2XE1A 3A0BO 2M07A 4O49A 4PUXA 2J1NA 2N2LA 4GHBA 4FZMA 3DA4A 5G26A 5T5FA 4C00A 4AKRA 4K3BA 2Y2XA 5E79O 5EE2A 3POXA 3UPGA 4FESA 3LK41 4RLBA 2XTQA 2R88A 4F4BA 3LK3A 2F1VA 1OPFA 1ZHZA 3PRNA 4IL6O 4E1SA 2ERVA 5DL7A 3NJTA 1HXTA 3DZMA 1GFOA 1T16A 2MHLA 2R4NA 5B66O 4XNLA 5H2FO 1IZNB 3NSGA 3TZGA 2Y0KA 2R4LA 4FT6A 1QJPA 2JMMA 2LHFA 3PGUA 4B61A 4JFBA 2KC0A 4FQEA 1IZNA 5DL5A 3AAAB 3PQSA 2YPVA 2Y7SA 3T0SA 2F1CX 1E54A 3WI5A 4PR7A 3T20A 2N2MA 3AAAA 3KVDD 3FYXA 4N74A 3V8UA 5IYUA 1H6S1 4FUVA 5B5EO 3VE1A 2PORA 4RJWA 4N59A 5GV0A 3HOEA 1Q9GA 2JQYA 1ZHWA 3DWOX 2R4PA 5PRNA 3BRZA 2K4TA 2X27X 2ZLDA 4K3CA 2FGRA 1BH3A 4GF4A 3VY8X 2R89A 3PF1A 2XE5A 3SZVA 7PRNA 4N75A 1Q9FA 1THQA 2XE2A 3PGRA 4GCPA 5D5DA 4AYNA 2FGQX 3A0HO 4D65A 3DA3A 8PRNA 4PJ0O 4O3ZA 3O0EA 2O4VA 3KZIO 3HWBA 4RL9A 3SY7A 1P4TA 3SY9A 1QJ9A 2W81C 4UB8O 3WU2O 3LK42 4RLCA 5DL8A 4E1TA 3HW9A 3JTYA 4O3XB 2OMFA 1GFQA 1G90A 3C5OA 1HXUA 3UU2A 2XE3A 3SYSA 4AYMC 1ZHYA 2KZ7B 1S5LO 4D5UA 3VZUX 3BRYA 4LSEA 4LSHA 4AYDC 3AA6B 3AA0B 4N58A 4JCHA 2XMXA 2KZ7A 1PHOA 3HOLA 4C69X 3AA1B 4UB6O 4QQ1A 5JDPA 4GCQA 1GFPA 3RBHA 4XNKA 3G7GA 4G75A 3BS0A 5G38A 2YNKA 2XTRA 5TISO 4AYEC 4Z3TA 3AA1A 4O4XA 1YS5A 5FVNA 3SZDA 2KXPB 2QTKA 3AA7B 3POQA 1QJ8A 4KR4A 4BUMX 2PRNA 2F1TA 4FMSA 4D64A 3JCUO 2MNHA 3PORA 1PRNA 2IWWA 3PQUA 3DWNA 4AKMA 2KXPA 3QRAA 3AA7A 1MM5A 1T1LA 5KAIO 2XG6A 1MPFA 4FSOA 5G39A 3T24A 4AZLA 2X9KA 4O3WA 5G3AA 4RJXA 1ZHTA 1BXWA 4FZNA 1GFNA 4FRTA 6PRNA 1OSMA 4C4VB 3PGSA 3UAQA 4G76A 3VZWX 4FZLA 5ADXL 5GTHO 3VE2A 2GE4A 2ZFGA 3WI4A 2K0LA 3LK3B 4KRAA 2Y0HA 4FOZA 2WJQA 4AYID 4C4VA 2KDYA 4FSPA 4LSIA 1HXXA 2R4OA 5GTIO 2ODJA 5ADXK 4U9CA 3VZTX
chains in the Genus database with same CATH topology
3A2SX 4O4UA 2M06A 3GP6A 5DL6A 2Y0LA 3AA0A 1ZHXA 3AA6A 4GCSA 3LK2B 4O3YA 5AFUL 3QRCA 4KR8A 4AFKA 3LK2A 3VY9X 2J4UP 3SYBA 3AAEB 4LSFA 5AFUK 1BT9A 3K19A 1MM4A 2W80C 3POUA 1ORMA 3EMNX 1GFMA 3AAEA 4FRXA 2LFUA 4AKRB 4AUIA 2XE1A 2M07A 4O49A 4PUXA 2J1NA 2N2LA 4GHBA 4FZMA 3DA4A 5G26A 5T5FA 4AKRA 2Y2XA 5EE2A 3POXA 3UPGA 4FESA 3LK41 4RLBA 2XTQA 4F4BA 3LK3A 2F1VA 1OPFA 1ZHZA 3PRNA 4E1SA 2ERVA 5DL7A 1HXTA 1GFOA 2MHLA 4XNLA 1IZNB 3NSGA 3TZGA 2Y0KA 4FT6A 1QJPA 2JMMA 2LHFA 4B61A 4JFBA 2KC0A 5DL5A 1IZNA 3AAAB 3PQSA 2YPVA 2Y7SA 3T0SA 1E54A 3WI5A 3T20A 2N2MA 3AAAA 3KVDD 3FYXA 3V8UA 5IYUA 1H6S1 4FUVA 3VE1A 2PORA 4RJWA 4N59A 5GV0A 3HOEA 1Q9GA 1ZHWA 5PRNA 2K4TA 2X27X 2ZLDA 2FGRA 1BH3A 4GF4A 3VY8X 2XE5A 3SZVA 7PRNA 1Q9FA 2XE2A 1THQA 4GCPA 5D5DA 4AYNA 4D65A 2FGQX 3DA3A 8PRNA 4O3ZA 3O0EA 2O4VA 3HWBA 4RL9A 3SY7A 1P4TA 3SY9A 1QJ9A 2W81C 3LK42 4RLCA 5DL8A 4E1TA 3HW9A 3JTYA 4O3XB 2OMFA 1GFQA 1G90A 3C5OA 1HXUA 3UU2A 2XE3A 3SYSA 4AYMC 1ZHYA 2KZ7B 4D5UA 3VZUX 4LSEA 4LSHA 4AYDC 3AA6B 3AA0B 4N58A 4JCHA 2XMXA 2KZ7A 1PHOA 3HOLA 4C69X 3AA1B 4QQ1A 5JDPA 4GCQA 1GFPA 3RBHA 4XNKA 3G7GA 4G75A 2YNKA 2XTRA 4AYEC 4Z3TA 3AA1A 4O4XA 1YS5A 5FVNA 3SZDA 2KXPB 2QTKA 3AA7B 3POQA 1QJ8A 4KR4A 4BUMX 2PRNA 2F1TA 4FMSA 4D64A 3PORA 2MNHA 1PRNA 3PQUA 4AKMA 2KXPA 3QRAA 3AA7A 1MM5A 3T24A 2XG6A 1MPFA 4FSOA 4AZLA 4O3WA 4RJXA 1ZHTA 1BXWA 4FZNA 1GFNA 4FRTA 6PRNA 1OSMA 3VZWX 3UAQA 4G76A 4FZLA 5ADXL 3VE2A 2GE4A 2ZFGA 3WI4A 2K0LA 3LK3B 4KRAA 2Y0HA 4FOZA 4AYID 2KDYA 4FSPA 4LSIA 1HXXA 5ADXK 2ODJA 4U9CA 3VZTX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M06 A;  3GP6 A;  2X27 X;  2F1V A;  3G7G A;  2ERV A;  1Q9F A;  1THQ A;  2MHL A;  1QJ8 A;  3QRC A;  2F1T A;  2MNH A;  1P4T A;  3QRA A;  2JMM A;  1QJ9 A;  2LHF A;  1QJP A;  1MM5 A;  1MM4 A;  1ORM A;  4RLC A;  1BXW A;  1G90 A;  3C5O A;  2M07 A;  4PUX A;  2N2L A;  2GE4 A;  2N2M A;  2K0L A;  1Q9G A; 
#chains in the Genus database with same CATH topology
 3A2S X;  4O4U A;  2M06 A;  3GP6 A;  2R8A A;  2WVP A;  2Y0L A;  3AA0 A;  1ZHX A;  3AA6 A;  5DL6 A;  4GCS A;  3LK2 B;  4O3Y A;  5AFU L;  2IWV A;  3QRC A;  4KR8 A;  5KAF O;  4AFK A;  2WJR A;  3LK2 A;  3VY9 X;  2J4U P;  3SYB A;  3AAE B;  4LSF A;  4CTD A;  1BT9 A;  5AFU K;  3K19 A;  1MM4 A;  2W80 C;  3POU A;  1ORM A;  3EMN X;  1GFM A;  3AAE A;  2AXT O;  4FRX A;  2LFU A;  4AKR B;  4AUI A;  2XE1 A;  3A0B O;  2M07 A;  4O49 A;  4PUX A;  2J1N A;  2N2L A;  4GHB A;  4FZM A;  3DA4 A;  5G26 A;  5T5F A;  4C00 A;  4AKR A;  4K3B A;  2Y2X A;  5E79 O;  5EE2 A;  3POX A;  3UPG A;  4FES A;  3LK4 1;  4RLB A;  2XTQ A;  2R88 A;  4F4B A;  3LK3 A;  2F1V A;  1OPF A;  1ZHZ A;  3PRN A;  4IL6 O;  4E1S A;  2ERV A;  5DL7 A;  3NJT A;  1HXT A;  3DZM A;  1GFO A;  1T16 A;  2MHL A;  2R4N A;  5B66 O;  4XNL A;  5H2F O;  1IZN B;  3NSG A;  3TZG A;  2Y0K A;  2R4L A;  4FT6 A;  1QJP A;  2JMM A;  2LHF A;  3PGU A;  4B61 A;  4JFB A;  2KC0 A;  4FQE A;  1IZN A;  5DL5 A;  3AAA B;  3PQS A;  2YPV A;  2Y7S A;  3T0S A;  2F1C X;  1E54 A;  3WI5 A;  4PR7 A;  3T20 A;  2N2M A;  3AAA A;  3KVD D;  3FYX A;  4N74 A;  3V8U A;  5IYU A;  1H6S 1;  4FUV A;  5B5E O;  3VE1 A;  2POR A;  4RJW A;  4N59 A;  5GV0 A;  3HOE A;  1Q9G A;  2JQY A;  1ZHW A;  3DWO X;  2R4P A;  5PRN A;  3BRZ A;  2K4T A;  2X27 X;  2ZLD A;  4K3C A;  2FGR A;  1BH3 A;  4GF4 A;  3VY8 X;  2R89 A;  3PF1 A;  2XE5 A;  3SZV A;  7PRN A;  4N75 A;  1Q9F A;  1THQ A;  2XE2 A;  3PGR A;  4GCP A;  5D5D A;  4AYN A;  2FGQ X;  3A0H O;  4D65 A;  3DA3 A;  8PRN A;  4PJ0 O;  4O3Z A;  3O0E A;  2O4V A;  3KZI O;  3HWB A;  4RL9 A;  3SY7 A;  1P4T A;  3SY9 A;  1QJ9 A;  2W81 C;  4UB8 O;  3WU2 O;  3LK4 2;  4RLC A;  5DL8 A;  4E1T A;  3HW9 A;  3JTY A;  4O3X B;  2OMF A;  1GFQ A;  1G90 A;  3C5O A;  1HXU A;  3UU2 A;  2XE3 A;  3SYS A;  4AYM C;  1ZHY A;  2KZ7 B;  1S5L O;  4D5U A;  3VZU X;  3BRY A;  4LSE A;  4LSH A;  4AYD C;  3AA6 B;  3AA0 B;  4N58 A;  4JCH A;  2XMX A;  2KZ7 A;  1PHO A;  3HOL A;  4C69 X;  3AA1 B;  4UB6 O;  4QQ1 A;  5JDP A;  4GCQ A;  1GFP A;  3RBH A;  4XNK A;  3G7G A;  4G75 A;  3BS0 A;  5G38 A;  2YNK A;  2XTR A;  5TIS O;  4AYE C;  4Z3T A;  3AA1 A;  4O4X A;  1YS5 A;  5FVN A;  3SZD A;  2KXP B;  2QTK A;  3AA7 B;  3POQ A;  1QJ8 A;  4KR4 A;  4BUM X;  2PRN A;  2F1T A;  4FMS A;  4D64 A;  3JCU O;  2MNH A;  3POR A;  1PRN A;  2IWW A;  3PQU A;  3DWN A;  4AKM A;  2KXP A;  3QRA A;  3AA7 A;  1MM5 A;  1T1L A;  5KAI O;  2XG6 A;  1MPF A;  4FSO A;  5G39 A;  3T24 A;  4AZL A;  2X9K A;  4O3W A;  5G3A A;  4RJX A;  1ZHT A;  1BXW A;  4FZN A;  1GFN A;  4FRT A;  6PRN A;  1OSM A;  4C4V B;  3PGS A;  3UAQ A;  4G76 A;  3VZW X;  4FZL A;  5ADX L;  5GTH O;  3VE2 A;  2GE4 A;  2ZFG A;  3WI4 A;  2K0L A;  3LK3 B;  4KRA A;  2Y0H A;  4FOZ A;  2WJQ A;  4AYI D;  4C4V A;  2KDY A;  4FSP A;  4LSI A;  1HXX A;  2R4O A;  5GTI O;  2ODJ A;  5ADX K;  4U9C A;  3VZT X; 
#chains in the Genus database with same CATH homology
 3A2S X;  4O4U A;  2M06 A;  3GP6 A;  5DL6 A;  2Y0L A;  3AA0 A;  1ZHX A;  3AA6 A;  4GCS A;  3LK2 B;  4O3Y A;  5AFU L;  3QRC A;  4KR8 A;  4AFK A;  3LK2 A;  3VY9 X;  2J4U P;  3SYB A;  3AAE B;  4LSF A;  5AFU K;  1BT9 A;  3K19 A;  1MM4 A;  2W80 C;  3POU A;  1ORM A;  3EMN X;  1GFM A;  3AAE A;  4FRX A;  2LFU A;  4AKR B;  4AUI A;  2XE1 A;  2M07 A;  4O49 A;  4PUX A;  2J1N A;  2N2L A;  4GHB A;  4FZM A;  3DA4 A;  5G26 A;  5T5F A;  4AKR A;  2Y2X A;  5EE2 A;  3POX A;  3UPG A;  4FES A;  3LK4 1;  4RLB A;  2XTQ A;  4F4B A;  3LK3 A;  2F1V A;  1OPF A;  1ZHZ A;  3PRN A;  4E1S A;  2ERV A;  5DL7 A;  1HXT A;  1GFO A;  2MHL A;  4XNL A;  1IZN B;  3NSG A;  3TZG A;  2Y0K A;  4FT6 A;  1QJP A;  2JMM A;  2LHF A;  4B61 A;  4JFB A;  2KC0 A;  5DL5 A;  1IZN A;  3AAA B;  3PQS A;  2YPV A;  2Y7S A;  3T0S A;  1E54 A;  3WI5 A;  3T20 A;  2N2M A;  3AAA A;  3KVD D;  3FYX A;  3V8U A;  5IYU A;  1H6S 1;  4FUV A;  3VE1 A;  2POR A;  4RJW A;  4N59 A;  5GV0 A;  3HOE A;  1Q9G A;  1ZHW A;  5PRN A;  2K4T A;  2X27 X;  2ZLD A;  2FGR A;  1BH3 A;  4GF4 A;  3VY8 X;  2XE5 A;  3SZV A;  7PRN A;  1Q9F A;  2XE2 A;  1THQ A;  4GCP A;  5D5D A;  4AYN A;  4D65 A;  2FGQ X;  3DA3 A;  8PRN A;  4O3Z A;  3O0E A;  2O4V A;  3HWB A;  4RL9 A;  3SY7 A;  1P4T A;  3SY9 A;  1QJ9 A;  2W81 C;  3LK4 2;  4RLC A;  5DL8 A;  4E1T A;  3HW9 A;  3JTY A;  4O3X B;  2OMF A;  1GFQ A;  1G90 A;  3C5O A;  1HXU A;  3UU2 A;  2XE3 A;  3SYS A;  4AYM C;  1ZHY A;  2KZ7 B;  4D5U A;  3VZU X;  4LSE A;  4LSH A;  4AYD C;  3AA6 B;  3AA0 B;  4N58 A;  4JCH A;  2XMX A;  2KZ7 A;  1PHO A;  3HOL A;  4C69 X;  3AA1 B;  4QQ1 A;  5JDP A;  4GCQ A;  1GFP A;  3RBH A;  4XNK A;  3G7G A;  4G75 A;  2YNK A;  2XTR A;  4AYE C;  4Z3T A;  3AA1 A;  4O4X A;  1YS5 A;  5FVN A;  3SZD A;  2KXP B;  2QTK A;  3AA7 B;  3POQ A;  1QJ8 A;  4KR4 A;  4BUM X;  2PRN A;  2F1T A;  4FMS A;  4D64 A;  3POR A;  2MNH A;  1PRN A;  3PQU A;  4AKM A;  2KXP A;  3QRA A;  3AA7 A;  1MM5 A;  3T24 A;  2XG6 A;  1MPF A;  4FSO A;  4AZL A;  4O3W A;  4RJX A;  1ZHT A;  1BXW A;  4FZN A;  1GFN A;  4FRT A;  6PRN A;  1OSM A;  3VZW X;  3UAQ A;  4G76 A;  4FZL A;  5ADX L;  3VE2 A;  2GE4 A;  2ZFG A;  3WI4 A;  2K0L A;  3LK3 B;  4KRA A;  2Y0H A;  4FOZ A;  4AYI D;  2KDY A;  4FSP A;  4LSI A;  1HXX A;  5ADX K;  2ODJ A;  4U9C A;  3VZT X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...