1G90A

Nmr solution structure of outer membrane protein a transmembrane domain: 10 conformers
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
176
structure length
176
Chain Sequence
APKDNTWYTGAKLGFSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDFLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVFRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQFTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of outer membrane protein A transmembrane domain by NMR spectroscopy
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords OUTER MEMBRANE PROTEIN A
total genus 50
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2000-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01389 OmpA_membrane OmpA-like transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1g90A00
1G90A 4RLCA 1MM4A 2N2LA 1QJ9A 2MNHA 2JMMA 2ERVA 2F1TA 2K0LA 1THQA 3G7GA 1P4TA 2M07A 3C5OA 2GE4A 1MM5A 2F1VA 3QRCA 2MHLA 1QJPA 4PUXA 1Q9FA 2LHFA 2M06A 2N2MA 1ORMA 3GP6A 1Q9GA 3QRAA 1BXWA 2X27X 1QJ8A
chains in the Genus database with same CATH superfamily
1GFQA 2R4LA 2R89A 4GCPA 4FRTA 4RLCA 4Z3TA 4AKMA 3SZDA 2F1CX 5DL5A 4AKRA 2ERVA 4G75A 5GTIO 2R4PA 3VE1A 2AXTO 1THQA 4XNLA 3KVDD 4PJ0O 5T5FA 3G7GA 4G76A 3HWBA 4FZMA 3T24A 1HXTA 3C5OA 2R8AA 2Y7SA 3AA1A 3PQUA 1ZHTA 4FUVA 3KZIO 1ZHYA 3PQSA 3SYBA 2Y2XA 3WI5A 3EMNX 2ZFGA 1Q9FA 4AYNA 4B61A 4RJWA 3UU2A 2N2MA 2XE3A 3DWNA 8PRNA 2KC0A 2XE2A 3O0EA 1BH3A 4FESA 2W81C 4N58A 4KR4A 1BXWA 3VY9X 2XE5A 5G39A 3AAAA 2R88A 5ADXK 2JQYA 1GFMA 1QJ9A 2MNHA 1YS5A 4KRAA 4O3ZA 4XNKA 2JMMA 2IWVA 4AYEC 1H6S1 3RBHA 3UPGA 3POXA 3PRNA 4N75A 2J1NA 4C4VB 4O3XB 1IZNB 1HXXA 5E79O 1ZHWA 2F1TA 3SY9A 5ADXL 4O3YA 3WI4A 3POUA 4D65A 1GFNA 3AAEA 4E1SA 3DZMA 4AUIA 3AA7B 4N74A 5IYUA 3T20A 2Y0LA 1MM5A 4FSPA 1ZHXA 4O3WA 3LK2B 4GCSA 5FVNA 3WU2O 4UB8O 3AA6B 3VY8X 3AAEB 4CTDA 3T0SA 4O4XA 4LSIA 4LSHA 2M06A 2KDYA 4AYID 3AAAB 1IZNA 3AA7A 3DWOX 3NJTA 1Q9GA 3PGSA 4JFBA 2ODJA 2XTQA 4FSOA 4PR7A 3BRZA 5DL8A 4AFKA 4D5UA 1BT9A 1E54A 3JCUO 5D5DA 3SZVA 2N2LA 3LK41 2WVPA 5GTHO 2KZ7B 2ZLDA 3FYXA 4E1TA 4RJXA 2Y0HA 3AA1B 4LSEA 2W80C 5KAFO 3A0HO 1OPFA 1PHOA 4C69X 5G26A 2WJQA 3TZGA 1T1LA 2PRNA 3BRYA 5DL6A 5AFUK 3POQA 2R4OA 2XMXA 2FGRA 1P4TA 2YPVA 2IWWA 3JTYA 2KZ7A 2GE4A 4AYDC 4FQEA 2F1VA 2YNKA 4LSFA 2KXPA 2LFUA 2MHLA 2XTRA 3PF1A 2R4NA 3BS0A 4K3CA 4O49A 1GFOA 3UAQA 3LK3B 3SY7A 2KXPB 3AA0A 4FZLA 2LHFA 4C4VA 5G3AA 1T16A 1MPFA 2WJRA 3DA3A 2J4UP 1ORMA 4RLBA 3VE2A 3QRAA 3PGRA 1HXUA 4O4UA 5B5EO 3PGUA 6PRNA 3LK2A 4D64A 5JDPA 4QQ1A 3HOEA 1G90A 1MM4A 2FGQX 3VZTX 4U9CA 3AA0B 5B66O 5H2FO 5DL7A 1OSMA 5G38A 4AZLA 4GHBA 2Y0KA 4K3BA 2K4TA 4UB6O 3SYSA 4IL6O 2K0LA 2OMFA 4FRXA 5EE2A 4AYMC 3A2SX 3HOLA 3HW9A 4FZNA 4GF4A 5KAIO 4C00A 3A0BO 4FMSA 3V8UA 2M07A 2XG6A 4N59A 3QRCA 5AFUL 4KR8A 4AKRB 1GFPA 3AA6A 2PORA 5GV0A 1ZHZA 4JCHA 1QJPA 4FT6A 4FOZA 4RL9A 4PUXA 1S5LO 3LK3A 3VZWX 5PRNA 3DA4A 3K19A 3LK42 3GP6A 2X9KA 3NSGA 5TISO 4BUMX 7PRNA 3VZUX 4GCQA 2QTKA 2XE1A 4F4BA 2O4VA 1PRNA 3PORA 2X27X 1QJ8A
chains in the Genus database with same CATH topology
1GFQA 4RLCA 4GCPA 4Z3TA 4FRTA 4AKMA 3SZDA 5DL5A 4AKRA 2ERVA 4G75A 3VE1A 4XNLA 1THQA 5T5FA 3KVDD 3G7GA 4G76A 3HWBA 4FZMA 3T24A 1HXTA 3C5OA 2Y7SA 3AA1A 3PQUA 1ZHTA 4FUVA 1ZHYA 3PQSA 3SYBA 2Y2XA 3WI5A 3EMNX 2ZFGA 1Q9FA 4AYNA 4B61A 4RJWA 3UU2A 2N2MA 2XE3A 8PRNA 2KC0A 2XE2A 3O0EA 1BH3A 4FESA 2W81C 4N58A 4KR4A 1BXWA 3VY9X 2XE5A 3AAAA 5ADXL 5ADXK 4O3ZA 1GFMA 1QJ9A 2MNHA 1YS5A 4KRAA 4XNKA 4AYEC 2JMMA 1H6S1 3RBHA 3UPGA 3POXA 3PRNA 2J1NA 4O3XB 1IZNB 1HXXA 3SY9A 1ZHWA 2F1TA 4O3YA 3WI4A 3POUA 4D65A 1GFNA 3AAEA 4E1SA 4AUIA 3AA7B 5IYUA 3T20A 2Y0LA 1MM5A 4FSPA 1ZHXA 4O3WA 3LK2B 4GCSA 5FVNA 3AA6B 3VY8X 3AAEB 3T0SA 4O4XA 4LSIA 4LSHA 2M06A 2KDYA 4AYID 3AAAB 1IZNA 3AA7A 3VE2A 4JFBA 1Q9GA 2ODJA 2XTQA 4FSOA 5DL8A 4AFKA 4D5UA 1BT9A 1E54A 5D5DA 3SZVA 2N2LA 3LK41 2KZ7B 2ZLDA 3FYXA 4E1TA 4RJXA 2Y0HA 3AA1B 4LSEA 2W80C 1OPFA 1PHOA 4C69X 5G26A 3TZGA 2PRNA 5DL6A 5AFUK 3POQA 2XMXA 2FGRA 1P4TA 2YPVA 3JTYA 2KZ7A 2GE4A 4AYDC 2F1VA 2YNKA 4LSFA 2KXPA 2LFUA 2MHLA 2XTRA 3V8UA 4O49A 3UAQA 1GFOA 3LK3B 3SY7A 2KXPB 3AA0A 4FZLA 2LHFA 1MPFA 3DA3A 2J4UP 1ORMA 4RLBA 3QRAA 4O4UA 1HXUA 6PRNA 3LK2A 4D64A 5JDPA 4QQ1A 3HOEA 1G90A 1MM4A 2FGQX 3VZTX 4U9CA 3AA0B 5DL7A 1OSMA 4AZLA 4GHBA 2Y0KA 3SYSA 2K4TA 2K0LA 2OMFA 4FRXA 5EE2A 4AYMC 3A2SX 3HOLA 3HW9A 4FZNA 4GF4A 4FMSA 2M07A 2XG6A 4N59A 3QRCA 5AFUL 4KR8A 4AKRB 1GFPA 3AA6A 2PORA 5GV0A 1ZHZA 4JCHA 1QJPA 4FT6A 4FOZA 4RL9A 4PUXA 3LK3A 3VZWX 5PRNA 3DA4A 3K19A 3LK42 3GP6A 3NSGA 4BUMX 7PRNA 3VZUX 4GCQA 2QTKA 2XE1A 4F4BA 2O4VA 1PRNA 3PORA 2X27X 1QJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G90 A;  4RLC A;  1MM4 A;  2N2L A;  1QJ9 A;  2MNH A;  2JMM A;  2ERV A;  2F1T A;  2K0L A;  1THQ A;  3G7G A;  1P4T A;  2M07 A;  3C5O A;  2GE4 A;  1MM5 A;  2F1V A;  3QRC A;  2MHL A;  1QJP A;  4PUX A;  1Q9F A;  2LHF A;  2M06 A;  2N2M A;  1ORM A;  3GP6 A;  1Q9G A;  3QRA A;  1BXW A;  2X27 X;  1QJ8 A; 
#chains in the Genus database with same CATH topology
 1GFQ A;  2R4L A;  2R89 A;  4GCP A;  4FRT A;  4RLC A;  4Z3T A;  4AKM A;  3SZD A;  2F1C X;  5DL5 A;  4AKR A;  2ERV A;  4G75 A;  5GTI O;  2R4P A;  3VE1 A;  2AXT O;  1THQ A;  4XNL A;  3KVD D;  4PJ0 O;  5T5F A;  3G7G A;  4G76 A;  3HWB A;  4FZM A;  3T24 A;  1HXT A;  3C5O A;  2R8A A;  2Y7S A;  3AA1 A;  3PQU A;  1ZHT A;  4FUV A;  3KZI O;  1ZHY A;  3PQS A;  3SYB A;  2Y2X A;  3WI5 A;  3EMN X;  2ZFG A;  1Q9F A;  4AYN A;  4B61 A;  4RJW A;  3UU2 A;  2N2M A;  2XE3 A;  3DWN A;  8PRN A;  2KC0 A;  2XE2 A;  3O0E A;  1BH3 A;  4FES A;  2W81 C;  4N58 A;  4KR4 A;  1BXW A;  3VY9 X;  2XE5 A;  5G39 A;  3AAA A;  2R88 A;  5ADX K;  2JQY A;  1GFM A;  1QJ9 A;  2MNH A;  1YS5 A;  4KRA A;  4O3Z A;  4XNK A;  2JMM A;  2IWV A;  4AYE C;  1H6S 1;  3RBH A;  3UPG A;  3POX A;  3PRN A;  4N75 A;  2J1N A;  4C4V B;  4O3X B;  1IZN B;  1HXX A;  5E79 O;  1ZHW A;  2F1T A;  3SY9 A;  5ADX L;  4O3Y A;  3WI4 A;  3POU A;  4D65 A;  1GFN A;  3AAE A;  4E1S A;  3DZM A;  4AUI A;  3AA7 B;  4N74 A;  5IYU A;  3T20 A;  2Y0L A;  1MM5 A;  4FSP A;  1ZHX A;  4O3W A;  3LK2 B;  4GCS A;  5FVN A;  3WU2 O;  4UB8 O;  3AA6 B;  3VY8 X;  3AAE B;  4CTD A;  3T0S A;  4O4X A;  4LSI A;  4LSH A;  2M06 A;  2KDY A;  4AYI D;  3AAA B;  1IZN A;  3AA7 A;  3DWO X;  3NJT A;  1Q9G A;  3PGS A;  4JFB A;  2ODJ A;  2XTQ A;  4FSO A;  4PR7 A;  3BRZ A;  5DL8 A;  4AFK A;  4D5U A;  1BT9 A;  1E54 A;  3JCU O;  5D5D A;  3SZV A;  2N2L A;  3LK4 1;  2WVP A;  5GTH O;  2KZ7 B;  2ZLD A;  3FYX A;  4E1T A;  4RJX A;  2Y0H A;  3AA1 B;  4LSE A;  2W80 C;  5KAF O;  3A0H O;  1OPF A;  1PHO A;  4C69 X;  5G26 A;  2WJQ A;  3TZG A;  1T1L A;  2PRN A;  3BRY A;  5DL6 A;  5AFU K;  3POQ A;  2R4O A;  2XMX A;  2FGR A;  1P4T A;  2YPV A;  2IWW A;  3JTY A;  2KZ7 A;  2GE4 A;  4AYD C;  4FQE A;  2F1V A;  2YNK A;  4LSF A;  2KXP A;  2LFU A;  2MHL A;  2XTR A;  3PF1 A;  2R4N A;  3BS0 A;  4K3C A;  4O49 A;  1GFO A;  3UAQ A;  3LK3 B;  3SY7 A;  2KXP B;  3AA0 A;  4FZL A;  2LHF A;  4C4V A;  5G3A A;  1T16 A;  1MPF A;  2WJR A;  3DA3 A;  2J4U P;  1ORM A;  4RLB A;  3VE2 A;  3QRA A;  3PGR A;  1HXU A;  4O4U A;  5B5E O;  3PGU A;  6PRN A;  3LK2 A;  4D64 A;  5JDP A;  4QQ1 A;  3HOE A;  1G90 A;  1MM4 A;  2FGQ X;  3VZT X;  4U9C A;  3AA0 B;  5B66 O;  5H2F O;  5DL7 A;  1OSM A;  5G38 A;  4AZL A;  4GHB A;  2Y0K A;  4K3B A;  2K4T A;  4UB6 O;  3SYS A;  4IL6 O;  2K0L A;  2OMF A;  4FRX A;  5EE2 A;  4AYM C;  3A2S X;  3HOL A;  3HW9 A;  4FZN A;  4GF4 A;  5KAI O;  4C00 A;  3A0B O;  4FMS A;  3V8U A;  2M07 A;  2XG6 A;  4N59 A;  3QRC A;  5AFU L;  4KR8 A;  4AKR B;  1GFP A;  3AA6 A;  2POR A;  5GV0 A;  1ZHZ A;  4JCH A;  1QJP A;  4FT6 A;  4FOZ A;  4RL9 A;  4PUX A;  1S5L O;  3LK3 A;  3VZW X;  5PRN A;  3DA4 A;  3K19 A;  3LK4 2;  3GP6 A;  2X9K A;  3NSG A;  5TIS O;  4BUM X;  7PRN A;  3VZU X;  4GCQ A;  2QTK A;  2XE1 A;  4F4B A;  2O4V A;  1PRN A;  3POR A;  2X27 X;  1QJ8 A; 
#chains in the Genus database with same CATH homology
 1GFQ A;  4RLC A;  4GCP A;  4Z3T A;  4FRT A;  4AKM A;  3SZD A;  5DL5 A;  4AKR A;  2ERV A;  4G75 A;  3VE1 A;  4XNL A;  1THQ A;  5T5F A;  3KVD D;  3G7G A;  4G76 A;  3HWB A;  4FZM A;  3T24 A;  1HXT A;  3C5O A;  2Y7S A;  3AA1 A;  3PQU A;  1ZHT A;  4FUV A;  1ZHY A;  3PQS A;  3SYB A;  2Y2X A;  3WI5 A;  3EMN X;  2ZFG A;  1Q9F A;  4AYN A;  4B61 A;  4RJW A;  3UU2 A;  2N2M A;  2XE3 A;  8PRN A;  2KC0 A;  2XE2 A;  3O0E A;  1BH3 A;  4FES A;  2W81 C;  4N58 A;  4KR4 A;  1BXW A;  3VY9 X;  2XE5 A;  3AAA A;  5ADX L;  5ADX K;  4O3Z A;  1GFM A;  1QJ9 A;  2MNH A;  1YS5 A;  4KRA A;  4XNK A;  4AYE C;  2JMM A;  1H6S 1;  3RBH A;  3UPG A;  3POX A;  3PRN A;  2J1N A;  4O3X B;  1IZN B;  1HXX A;  3SY9 A;  1ZHW A;  2F1T A;  4O3Y A;  3WI4 A;  3POU A;  4D65 A;  1GFN A;  3AAE A;  4E1S A;  4AUI A;  3AA7 B;  5IYU A;  3T20 A;  2Y0L A;  1MM5 A;  4FSP A;  1ZHX A;  4O3W A;  3LK2 B;  4GCS A;  5FVN A;  3AA6 B;  3VY8 X;  3AAE B;  3T0S A;  4O4X A;  4LSI A;  4LSH A;  2M06 A;  2KDY A;  4AYI D;  3AAA B;  1IZN A;  3AA7 A;  3VE2 A;  4JFB A;  1Q9G A;  2ODJ A;  2XTQ A;  4FSO A;  5DL8 A;  4AFK A;  4D5U A;  1BT9 A;  1E54 A;  5D5D A;  3SZV A;  2N2L A;  3LK4 1;  2KZ7 B;  2ZLD A;  3FYX A;  4E1T A;  4RJX A;  2Y0H A;  3AA1 B;  4LSE A;  2W80 C;  1OPF A;  1PHO A;  4C69 X;  5G26 A;  3TZG A;  2PRN A;  5DL6 A;  5AFU K;  3POQ A;  2XMX A;  2FGR A;  1P4T A;  2YPV A;  3JTY A;  2KZ7 A;  2GE4 A;  4AYD C;  2F1V A;  2YNK A;  4LSF A;  2KXP A;  2LFU A;  2MHL A;  2XTR A;  3V8U A;  4O49 A;  3UAQ A;  1GFO A;  3LK3 B;  3SY7 A;  2KXP B;  3AA0 A;  4FZL A;  2LHF A;  1MPF A;  3DA3 A;  2J4U P;  1ORM A;  4RLB A;  3QRA A;  4O4U A;  1HXU A;  6PRN A;  3LK2 A;  4D64 A;  5JDP A;  4QQ1 A;  3HOE A;  1G90 A;  1MM4 A;  2FGQ X;  3VZT X;  4U9C A;  3AA0 B;  5DL7 A;  1OSM A;  4AZL A;  4GHB A;  2Y0K A;  3SYS A;  2K4T A;  2K0L A;  2OMF A;  4FRX A;  5EE2 A;  4AYM C;  3A2S X;  3HOL A;  3HW9 A;  4FZN A;  4GF4 A;  4FMS A;  2M07 A;  2XG6 A;  4N59 A;  3QRC A;  5AFU L;  4KR8 A;  4AKR B;  1GFP A;  3AA6 A;  2POR A;  5GV0 A;  1ZHZ A;  4JCH A;  1QJP A;  4FT6 A;  4FOZ A;  4RL9 A;  4PUX A;  3LK3 A;  3VZW X;  5PRN A;  3DA4 A;  3K19 A;  3LK4 2;  3GP6 A;  3NSG A;  4BUM X;  7PRN A;  3VZU X;  4GCQ A;  2QTK A;  2XE1 A;  4F4B A;  2O4V A;  1PRN A;  3POR A;  2X27 X;  1QJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...