1G90A

Nmr solution structure of outer membrane protein a transmembrane domain: 10 conformers
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
176
structure length
176
Chain Sequence
APKDNTWYTGAKLGFSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDFLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVFRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQFTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords OUTER MEMBRANE PROTEIN A
publication title Structure of outer membrane protein A transmembrane domain by NMR spectroscopy
pubmed doi rcsb
source organism Escherichia coli
total genus 50
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2000-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01389 OmpA_membrane OmpA-like transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1g90A00
1QJPA 1THQA 2JMMA 2ERVA 4RLCA 3C5OA 1QJ9A 2M07A 1BXWA 1G90A 2N2LA 1ORMA 1P4TA 2LHFA 2M06A 1Q9GA 3GP6A 2N2MA 3G7GA 2K0LA 1QJ8A 3QRCA 2MHLA 1MM4A 1MM5A 1Q9FA 2GE4A 2X27X 4PUXA 2F1VA 2F1TA 2MNHA 3QRAA
chains in the Genus database with same CATH superfamily
1PRNA 4AYID 1HXUA 4FZNA 3BRYA 4QQ1A 4AYDC 3AA7B 2ERVA 3C5OA 3PGUA 4D64A 4AKRA 4KR8A 3FYXA 3KZIO 1GFOA 5G26A 3WI4A 3HOEA 3KVDD 4K3CA 1GFQA 2YNKA 5G38A 5ADXL 1G90A 2Y7SA 4B61A 2ODJA 5T5FA 4G75A 3POXA 5KAIO 2M06A 1IZNA 2KZ7A 2QTKA 3LK41 4F4BA 4AFKA 2R4PA 4N75A 3DWOX 4UB8O 2XE2A 2R4OA 3T0SA 4C69X 4E1TA 5AFUL 2LFUA 5D5DA 5DL5A 3AA1A 4BUMX 3VZTX 2FGQX 4FT6A 2R89A 2X27X 3T24A 4O4UA 4FZMA 4RJWA 4RL9A 1E54A 3VZUX 2WVPA 7PRNA 2J4UP 3QRAA 3AA7A 2JQYA 5ADXK 3V8UA 5FVNA 3LK2B 3PRNA 1T1LA 1THQA 3UAQA 5B66O 2JMMA 2J1NA 2KC0A 4CTDA 4AYMC 3TZGA 3AA6B 2XMXA 1HXTA 1BT9A 4D65A 2ZFGA 3HOLA 5AFUK 1HXXA 3LK3A 4C00A 2W81C 1ZHTA 4O49A 3O0EA 4GHBA 4UB6O 3SY7A 2PORA 4LSEA 3JCUO 4PJ0O 4K3BA 4N58A 3EMNX 4N74A 4O3WA 2R4LA 3BS0A 3GP6A 4FRTA 4GCSA 4XNKA 3PQUA 3AA0A 3AAAB 3POUA 1GFMA 5TISO 5E79O 4AYNA 2XTQA 1MM4A 3SZDA 5GTHO 1MPFA 2XE1A 5DL7A 2XTRA 4PUXA 2R4NA 4N59A 4FMSA 4JCHA 3DA3A 2F1TA 5DL8A 1BH3A 3VE2A 4FRXA 5G39A 3AAEB 3VY8X 5DL6A 2XE3A 3AA6A 5B5EO 1YS5A 4FSPA 4GF4A 5EE2A 4PR7A 4GCPA 4O4XA 3DA4A 2Y0LA 2KDYA 4FUVA 4IL6O 1S5LO 2OMFA 3A0BO 2M07A 4RLCA 4C4VB 4LSIA 5GTIO 3WU2O 3HW9A 3SZVA 4AUIA 1ZHYA 3DWNA 1ZHXA 4KR4A 3UPGA 3VY9X 3AAAA 4G76A 5H2FO 3SYBA 3WI5A 1Q9GA 3LK42 4O3XB 1ZHWA 1PHOA 2N2MA 2XG6A 4LSHA 4E1SA 3SYSA 1IZNB 3A0HO 3PGRA 2WJRA 3PF1A 1QJ8A 1GFPA 3POQA 3QRCA 4XNLA 4AZLA 5IYUA 2KXPB 2MHLA 3AAEA 3BRZA 4FZLA 4D5UA 2Y0KA 3RBHA 3LK2A 2MNHA 4RLBA 2Y0HA 4KRAA 4LSFA 4U9CA 2YPVA 5G3AA 4C4VA 1QJPA 5GV0A 5KAFO 4JFBA 3PGSA 4GCQA 1OPFA 2XE5A 2Y2XA 3UU2A 4AYEC 1QJ9A 3VE1A 4FQEA 3HWBA 2FGRA 3PORA 4FOZA 3VZWX 3SY9A 1GFNA 1T16A 1BXWA 2X9KA 2ZLDA 4FSOA 4O3YA 4O3ZA 4AKRB 4Z3TA 6PRNA 3T20A 2N2LA 1ORMA 3LK3B 1P4TA 3JTYA 2LHFA 2K4TA 3PQSA 1ZHZA 2R8AA 2KXPA 2PRNA 3G7GA 2W80C 2K0LA 2IWVA 2O4VA 2R88A 5PRNA 4AKMA 8PRNA 3NJTA 3A2SX 1OSMA 2WJQA 2KZ7B 3AA0B 2IWWA 4FESA 1MM5A 4RJXA 1Q9FA 2GE4A 1H6S1 3K19A 3DZMA 5JDPA 2F1CX 2F1VA 3NSGA 2AXTO 3AA1B
chains in the Genus database with same CATH topology
1PRNA 4AYID 1HXUA 4FZNA 4QQ1A 4AYDC 3AA7B 2ERVA 3C5OA 4D64A 4AKRA 4KR8A 3FYXA 1GFOA 5G26A 3WI4A 3HOEA 3KVDD 1GFQA 2YNKA 5ADXL 1G90A 2Y7SA 4B61A 2ODJA 5T5FA 4G75A 3POXA 2M06A 1IZNA 2KZ7A 2QTKA 3LK41 4F4BA 4AFKA 4C69X 2XE2A 5AFUL 3T0SA 4E1TA 2LFUA 5D5DA 5DL5A 3AA1A 4BUMX 3VZTX 2FGQX 4FT6A 3T24A 2X27X 4O4UA 4FZMA 4RJWA 4RL9A 1E54A 3VZUX 7PRNA 2J4UP 3QRAA 3AA7A 5ADXK 3V8UA 5FVNA 3LK2B 3PRNA 1THQA 3UAQA 2JMMA 2J1NA 2KC0A 4AYMC 3TZGA 3AA6B 2XMXA 1HXTA 1BT9A 4D65A 2ZFGA 3HOLA 5AFUK 1HXXA 3LK3A 2W81C 1ZHTA 4O49A 3O0EA 4GHBA 3SY7A 2PORA 4LSEA 4N58A 3EMNX 4O3WA 3GP6A 4FRTA 4GCSA 4XNKA 3PQUA 3AA0A 3AAAB 3POUA 1GFMA 4AYNA 2XTQA 1MM4A 3SZDA 1MPFA 2XE1A 5DL7A 2XTRA 4PUXA 4N59A 4FMSA 4JCHA 3DA3A 2F1TA 5DL8A 1BH3A 3VE2A 4FRXA 3VY8X 3AAEB 5DL6A 2XE3A 3AA6A 1YS5A 4FSPA 4GF4A 5EE2A 4GCPA 4O4XA 3DA4A 2Y0LA 2KDYA 4FUVA 4RLCA 2OMFA 2M07A 4LSIA 3HW9A 3SZVA 4AUIA 1ZHYA 1ZHXA 4KR4A 3UPGA 3VY9X 3AAAA 4G76A 3SYBA 3WI5A 1Q9GA 3LK42 4O3XB 1ZHWA 1PHOA 2N2MA 2XG6A 4LSHA 4E1SA 3SYSA 1IZNB 4XNLA 3POQA 5IYUA 1QJ8A 1GFPA 3QRCA 4AZLA 2KXPB 2MHLA 3AAEA 4FZLA 4D5UA 2Y0KA 3RBHA 3LK2A 2MNHA 4RLBA 2Y0HA 4KRAA 4LSFA 4U9CA 2YPVA 1QJPA 5GV0A 4JFBA 4GCQA 1OPFA 2XE5A 2Y2XA 3UU2A 4AYEC 1QJ9A 3VE1A 3HWBA 2FGRA 4FOZA 3VZWX 3SY9A 1GFNA 1BXWA 2ZLDA 4O3YA 4FSOA 4O3ZA 4AKRB 4Z3TA 6PRNA 3T20A 2N2LA 1ORMA 3LK3B 1P4TA 3JTYA 2LHFA 2K4TA 3PQSA 1ZHZA 2KXPA 2PRNA 3G7GA 2W80C 2K0LA 2O4VA 5PRNA 4AKMA 8PRNA 3A2SX 1OSMA 3AA0B 2KZ7B 4FESA 1MM5A 4RJXA 1Q9FA 2GE4A 1H6S1 3K19A 5JDPA 2F1VA 3NSGA 3PORA 3AA1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QJP A;  1THQ A;  2JMM A;  2ERV A;  4RLC A;  3C5O A;  1QJ9 A;  2M07 A;  1BXW A;  1G90 A;  2N2L A;  1ORM A;  1P4T A;  2LHF A;  2M06 A;  1Q9G A;  3GP6 A;  2N2M A;  3G7G A;  2K0L A;  1QJ8 A;  3QRC A;  2MHL A;  1MM4 A;  1MM5 A;  1Q9F A;  2GE4 A;  2X27 X;  4PUX A;  2F1V A;  2F1T A;  2MNH A;  3QRA A; 
#chains in the Genus database with same CATH topology
 1PRN A;  4AYI D;  1HXU A;  4FZN A;  3BRY A;  4QQ1 A;  4AYD C;  3AA7 B;  2ERV A;  3C5O A;  3PGU A;  4D64 A;  4AKR A;  4KR8 A;  3FYX A;  3KZI O;  1GFO A;  5G26 A;  3WI4 A;  3HOE A;  3KVD D;  4K3C A;  1GFQ A;  2YNK A;  5G38 A;  5ADX L;  1G90 A;  2Y7S A;  4B61 A;  2ODJ A;  5T5F A;  4G75 A;  3POX A;  5KAI O;  2M06 A;  1IZN A;  2KZ7 A;  2QTK A;  3LK4 1;  4F4B A;  4AFK A;  2R4P A;  4N75 A;  3DWO X;  4UB8 O;  2XE2 A;  2R4O A;  3T0S A;  4C69 X;  4E1T A;  5AFU L;  2LFU A;  5D5D A;  5DL5 A;  3AA1 A;  4BUM X;  3VZT X;  2FGQ X;  4FT6 A;  2R89 A;  2X27 X;  3T24 A;  4O4U A;  4FZM A;  4RJW A;  4RL9 A;  1E54 A;  3VZU X;  2WVP A;  7PRN A;  2J4U P;  3QRA A;  3AA7 A;  2JQY A;  5ADX K;  3V8U A;  5FVN A;  3LK2 B;  3PRN A;  1T1L A;  1THQ A;  3UAQ A;  5B66 O;  2JMM A;  2J1N A;  2KC0 A;  4CTD A;  4AYM C;  3TZG A;  3AA6 B;  2XMX A;  1HXT A;  1BT9 A;  4D65 A;  2ZFG A;  3HOL A;  5AFU K;  1HXX A;  3LK3 A;  4C00 A;  2W81 C;  1ZHT A;  4O49 A;  3O0E A;  4GHB A;  4UB6 O;  3SY7 A;  2POR A;  4LSE A;  3JCU O;  4PJ0 O;  4K3B A;  4N58 A;  3EMN X;  4N74 A;  4O3W A;  2R4L A;  3BS0 A;  3GP6 A;  4FRT A;  4GCS A;  4XNK A;  3PQU A;  3AA0 A;  3AAA B;  3POU A;  1GFM A;  5TIS O;  5E79 O;  4AYN A;  2XTQ A;  1MM4 A;  3SZD A;  5GTH O;  1MPF A;  2XE1 A;  5DL7 A;  2XTR A;  4PUX A;  2R4N A;  4N59 A;  4FMS A;  4JCH A;  3DA3 A;  2F1T A;  5DL8 A;  1BH3 A;  3VE2 A;  4FRX A;  5G39 A;  3AAE B;  3VY8 X;  5DL6 A;  2XE3 A;  3AA6 A;  5B5E O;  1YS5 A;  4FSP A;  4GF4 A;  5EE2 A;  4PR7 A;  4GCP A;  4O4X A;  3DA4 A;  2Y0L A;  2KDY A;  4FUV A;  4IL6 O;  1S5L O;  2OMF A;  3A0B O;  2M07 A;  4RLC A;  4C4V B;  4LSI A;  5GTI O;  3WU2 O;  3HW9 A;  3SZV A;  4AUI A;  1ZHY A;  3DWN A;  1ZHX A;  4KR4 A;  3UPG A;  3VY9 X;  3AAA A;  4G76 A;  5H2F O;  3SYB A;  3WI5 A;  1Q9G A;  3LK4 2;  4O3X B;  1ZHW A;  1PHO A;  2N2M A;  2XG6 A;  4LSH A;  4E1S A;  3SYS A;  1IZN B;  3A0H O;  3PGR A;  2WJR A;  3PF1 A;  1QJ8 A;  1GFP A;  3POQ A;  3QRC A;  4XNL A;  4AZL A;  5IYU A;  2KXP B;  2MHL A;  3AAE A;  3BRZ A;  4FZL A;  4D5U A;  2Y0K A;  3RBH A;  3LK2 A;  2MNH A;  4RLB A;  2Y0H A;  4KRA A;  4LSF A;  4U9C A;  2YPV A;  5G3A A;  4C4V A;  1QJP A;  5GV0 A;  5KAF O;  4JFB A;  3PGS A;  4GCQ A;  1OPF A;  2XE5 A;  2Y2X A;  3UU2 A;  4AYE C;  1QJ9 A;  3VE1 A;  4FQE A;  3HWB A;  2FGR A;  3POR A;  4FOZ A;  3VZW X;  3SY9 A;  1GFN A;  1T16 A;  1BXW A;  2X9K A;  2ZLD A;  4FSO A;  4O3Y A;  4O3Z A;  4AKR B;  4Z3T A;  6PRN A;  3T20 A;  2N2L A;  1ORM A;  3LK3 B;  1P4T A;  3JTY A;  2LHF A;  2K4T A;  3PQS A;  1ZHZ A;  2R8A A;  2KXP A;  2PRN A;  3G7G A;  2W80 C;  2K0L A;  2IWV A;  2O4V A;  2R88 A;  5PRN A;  4AKM A;  8PRN A;  3NJT A;  3A2S X;  1OSM A;  2WJQ A;  2KZ7 B;  3AA0 B;  2IWW A;  4FES A;  1MM5 A;  4RJX A;  1Q9F A;  2GE4 A;  1H6S 1;  3K19 A;  3DZM A;  5JDP A;  2F1C X;  2F1V A;  3NSG A;  2AXT O;  3AA1 B; 
#chains in the Genus database with same CATH homology
 1PRN A;  4AYI D;  1HXU A;  4FZN A;  4QQ1 A;  4AYD C;  3AA7 B;  2ERV A;  3C5O A;  4D64 A;  4AKR A;  4KR8 A;  3FYX A;  1GFO A;  5G26 A;  3WI4 A;  3HOE A;  3KVD D;  1GFQ A;  2YNK A;  5ADX L;  1G90 A;  2Y7S A;  4B61 A;  2ODJ A;  5T5F A;  4G75 A;  3POX A;  2M06 A;  1IZN A;  2KZ7 A;  2QTK A;  3LK4 1;  4F4B A;  4AFK A;  4C69 X;  2XE2 A;  5AFU L;  3T0S A;  4E1T A;  2LFU A;  5D5D A;  5DL5 A;  3AA1 A;  4BUM X;  3VZT X;  2FGQ X;  4FT6 A;  3T24 A;  2X27 X;  4O4U A;  4FZM A;  4RJW A;  4RL9 A;  1E54 A;  3VZU X;  7PRN A;  2J4U P;  3QRA A;  3AA7 A;  5ADX K;  3V8U A;  5FVN A;  3LK2 B;  3PRN A;  1THQ A;  3UAQ A;  2JMM A;  2J1N A;  2KC0 A;  4AYM C;  3TZG A;  3AA6 B;  2XMX A;  1HXT A;  1BT9 A;  4D65 A;  2ZFG A;  3HOL A;  5AFU K;  1HXX A;  3LK3 A;  2W81 C;  1ZHT A;  4O49 A;  3O0E A;  4GHB A;  3SY7 A;  2POR A;  4LSE A;  4N58 A;  3EMN X;  4O3W A;  3GP6 A;  4FRT A;  4GCS A;  4XNK A;  3PQU A;  3AA0 A;  3AAA B;  3POU A;  1GFM A;  4AYN A;  2XTQ A;  1MM4 A;  3SZD A;  1MPF A;  2XE1 A;  5DL7 A;  2XTR A;  4PUX A;  4N59 A;  4FMS A;  4JCH A;  3DA3 A;  2F1T A;  5DL8 A;  1BH3 A;  3VE2 A;  4FRX A;  3VY8 X;  3AAE B;  5DL6 A;  2XE3 A;  3AA6 A;  1YS5 A;  4FSP A;  4GF4 A;  5EE2 A;  4GCP A;  4O4X A;  3DA4 A;  2Y0L A;  2KDY A;  4FUV A;  4RLC A;  2OMF A;  2M07 A;  4LSI A;  3HW9 A;  3SZV A;  4AUI A;  1ZHY A;  1ZHX A;  4KR4 A;  3UPG A;  3VY9 X;  3AAA A;  4G76 A;  3SYB A;  3WI5 A;  1Q9G A;  3LK4 2;  4O3X B;  1ZHW A;  1PHO A;  2N2M A;  2XG6 A;  4LSH A;  4E1S A;  3SYS A;  1IZN B;  4XNL A;  3POQ A;  5IYU A;  1QJ8 A;  1GFP A;  3QRC A;  4AZL A;  2KXP B;  2MHL A;  3AAE A;  4FZL A;  4D5U A;  2Y0K A;  3RBH A;  3LK2 A;  2MNH A;  4RLB A;  2Y0H A;  4KRA A;  4LSF A;  4U9C A;  2YPV A;  1QJP A;  5GV0 A;  4JFB A;  4GCQ A;  1OPF A;  2XE5 A;  2Y2X A;  3UU2 A;  4AYE C;  1QJ9 A;  3VE1 A;  3HWB A;  2FGR A;  4FOZ A;  3VZW X;  3SY9 A;  1GFN A;  1BXW A;  2ZLD A;  4O3Y A;  4FSO A;  4O3Z A;  4AKR B;  4Z3T A;  6PRN A;  3T20 A;  2N2L A;  1ORM A;  3LK3 B;  1P4T A;  3JTY A;  2LHF A;  2K4T A;  3PQS A;  1ZHZ A;  2KXP A;  2PRN A;  3G7G A;  2W80 C;  2K0L A;  2O4V A;  5PRN A;  4AKM A;  8PRN A;  3A2S X;  1OSM A;  3AA0 B;  2KZ7 B;  4FES A;  1MM5 A;  4RJX A;  1Q9F A;  2GE4 A;  1H6S 1;  3K19 A;  5JDP A;  2F1V A;  3NSG A;  3POR A;  3AA1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...