1T1LA

Crystal structure of the long-chain fatty acid transporter fadl
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
421
structure length
421
Chain Sequence
AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Long-chain fatty acid transport protein
publication title Crystal structure of the long-chain fatty acid transporter FadL.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid transport
total genus 102
structure length 421
sequence length 421
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 1t1lA00
3DWNA 1T16A 2R89A 3PGUA 2R88A 3PF1A 2R8AA 3BRZA 3PGSA 1T1LA 2R4OA 3DWOX 2R4PA 3BRYA 3PGRA 2R4NA 2R4LA 3BS0A
chains in the Genus database with same CATH superfamily
4Z3TA 4C4VA 5G26A 2MNHA 3SY7A 4C00A 5AFUL 2WVPA 2JMMA 4FRTA 3JTYA 3FYXA 4KRAA 3DA3A 3AAEB 3POXA 3EMNX 3T0SA 2KDYA 3DZMA 3SYBA 2KC0A 3RBHA 4D5UA 3LK2A 2LFUA 3AA1B 3WU2O 2KXPA 1MM4A 3HOEA 3WI4A 2M07A 4QQ1A 5G38A 4GCPA 7PRNA 3NSGA 1ZHWA 2O4VA 4AUIA 3V8UA 3AA6A 3O0EA 2XE3A 3AA7B 2AXTO 3QRAA 2ZLDA 5B66O 4KR8A 4XNKA 2F1VA 4D64A 2PRNA 3A2SX 4C4VB 3BRZA 3HWBA 3G7GA 4FESA 4AYEC 5FVNA 3HOLA 2Y7SA 3SZDA 1MM5A 2F1TA 4N75A 4IL6O 4FT6A 2OMFA 3VY9X 2YNKA 2Y0KA 5GTIO 2Y2XA 1QJ9A 1ORMA 1ZHYA 3PF1A 4GCSA 2KZ7A 3LK2B 3WI5A 4AKMA 3PRNA 5DL7A 1BT9A 3A0BO 2KXPB 3AAAA 3DWNA 1HXTA 3JCUO 1ZHXA 1GFPA 3UAQA 3VE1A 4N74A 4RJXA 3AA0A 3LK41 1IZNA 1GFOA 3POUA 4JCHA 1E54A 3DWOX 4PJ0O 2XTRA 4O3YA 1HXUA 2XTQA 3AA6B 2K4TA 3VZUX 3PORA 4PR7A 4FRXA 2XMXA 5TISO 2MHLA 4K3CA 3SZVA 5H2FO 2R4OA 1S5LO 1MPFA 1HXXA 5DL5A 3POQA 1OSMA 4FSPA 4O4XA 1T16A 4AKRA 5ADXK 1GFQA 2QTKA 4RLCA 4UB8O 4FMSA 4BUMX 5D5DA 2KZ7B 2YPVA 4AFKA 2W80C 3BRYA 4UB6O 4F4BA 4N58A 1G90A 2R89A 4FZMA 3T24A 1Q9GA 5ADXL 3AA0B 1GFNA 2WJRA 1IZNB 4PUXA 4XNLA 4AYNA 5B5EO 3QRCA 5G39A 2XE5A 4AZLA 4FOZA 3SY9A 4JFBA 4O4UA 3PGSA 4RLBA 5PRNA 3NJTA 4G76A 4D65A 5KAFO 4B61A 2FGRA 2X9KA 3BS0A 1P4TA 4LSFA 4AYDC 4CTDA 4O3XB 2ERVA 4AKRB 4KR4A 3AA1A 1ZHZA 3T20A 3C5OA 4LSEA 3VZTX 2R4NA 4O3WA 5GV0A 4AYID 1BH3A 5DL8A 2LHFA 5KAIO 2J4UP 4GCQA 3PGUA 2XE1A 2N2MA 4RL9A 2R4PA 3PGRA 3DA4A 2WJQA 2ZFGA 5GTHO 4LSHA 1ZHTA 3HW9A 5JDPA 3AAAB 4FSOA 3K19A 1BXWA 3LK3A 2XE2A 1Q9FA 2X27X 3KZIO 5T5FA 1T1LA 3UPGA 1QJ8A 6PRNA 2ODJA 2XG6A 3VE2A 2K0LA 3TZGA 2M06A 2F1CX 1GFMA 1OPFA 3A0HO 4FUVA 4FZNA 4O49A 5EE2A 3LK42 1PHOA 2IWVA 2PORA 2N2LA 2W81C 4O3ZA 3UU2A 4G75A 4E1TA 3SYSA 3AAEA 2JQYA 4GHBA 4RJWA 4FQEA 3PQSA 3VY8X 3VZWX 4N59A 2FGQX 5DL6A 2R88A 4E1SA 4LSIA 5IYUA 2Y0HA 1YS5A 1QJPA 2R8AA 2R4LA 4FZLA 2GE4A 2Y0LA 4AYMC 1H6S1 5G3AA 4K3BA 8PRNA 3KVDD 2IWWA 2J1NA 1PRNA 3LK3B 5E79O 5AFUK 4U9CA 4GF4A 3AA7A 4C69X 3GP6A 1THQA 3PQUA
chains in the Genus database with same CATH topology
3DWNA 1T16A 2R89A 3PGUA 2R88A 3PF1A 2R8AA 3BRZA 3PGSA 1T1LA 2R4OA 3DWOX 2R4PA 3BRYA 3PGRA 2R4NA 2R4LA 3BS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWN A;  1T16 A;  2R89 A;  3PGU A;  2R88 A;  3PF1 A;  2R8A A;  3BRZ A;  3PGS A;  1T1L A;  2R4O A;  3DWO X;  2R4P A;  3BRY A;  3PGR A;  2R4N A;  2R4L A;  3BS0 A; 
#chains in the Genus database with same CATH topology
 4Z3T A;  4C4V A;  5G26 A;  2MNH A;  3SY7 A;  4C00 A;  5AFU L;  2WVP A;  2JMM A;  4FRT A;  3JTY A;  3FYX A;  4KRA A;  3DA3 A;  3AAE B;  3POX A;  3EMN X;  3T0S A;  2KDY A;  3DZM A;  3SYB A;  2KC0 A;  3RBH A;  4D5U A;  3LK2 A;  2LFU A;  3AA1 B;  3WU2 O;  2KXP A;  1MM4 A;  3HOE A;  3WI4 A;  2M07 A;  4QQ1 A;  5G38 A;  4GCP A;  7PRN A;  3NSG A;  1ZHW A;  2O4V A;  4AUI A;  3V8U A;  3AA6 A;  3O0E A;  2XE3 A;  3AA7 B;  2AXT O;  3QRA A;  2ZLD A;  5B66 O;  4KR8 A;  4XNK A;  2F1V A;  4D64 A;  2PRN A;  3A2S X;  4C4V B;  3BRZ A;  3HWB A;  3G7G A;  4FES A;  4AYE C;  5FVN A;  3HOL A;  2Y7S A;  3SZD A;  1MM5 A;  2F1T A;  4N75 A;  4IL6 O;  4FT6 A;  2OMF A;  3VY9 X;  2YNK A;  2Y0K A;  5GTI O;  2Y2X A;  1QJ9 A;  1ORM A;  1ZHY A;  3PF1 A;  4GCS A;  2KZ7 A;  3LK2 B;  3WI5 A;  4AKM A;  3PRN A;  5DL7 A;  1BT9 A;  3A0B O;  2KXP B;  3AAA A;  3DWN A;  1HXT A;  3JCU O;  1ZHX A;  1GFP A;  3UAQ A;  3VE1 A;  4N74 A;  4RJX A;  3AA0 A;  3LK4 1;  1IZN A;  1GFO A;  3POU A;  4JCH A;  1E54 A;  3DWO X;  4PJ0 O;  2XTR A;  4O3Y A;  1HXU A;  2XTQ A;  3AA6 B;  2K4T A;  3VZU X;  3POR A;  4PR7 A;  4FRX A;  2XMX A;  5TIS O;  2MHL A;  4K3C A;  3SZV A;  5H2F O;  2R4O A;  1S5L O;  1MPF A;  1HXX A;  5DL5 A;  3POQ A;  1OSM A;  4FSP A;  4O4X A;  1T16 A;  4AKR A;  5ADX K;  1GFQ A;  2QTK A;  4RLC A;  4UB8 O;  4FMS A;  4BUM X;  5D5D A;  2KZ7 B;  2YPV A;  4AFK A;  2W80 C;  3BRY A;  4UB6 O;  4F4B A;  4N58 A;  1G90 A;  2R89 A;  4FZM A;  3T24 A;  1Q9G A;  5ADX L;  3AA0 B;  1GFN A;  2WJR A;  1IZN B;  4PUX A;  4XNL A;  4AYN A;  5B5E O;  3QRC A;  5G39 A;  2XE5 A;  4AZL A;  4FOZ A;  3SY9 A;  4JFB A;  4O4U A;  3PGS A;  4RLB A;  5PRN A;  3NJT A;  4G76 A;  4D65 A;  5KAF O;  4B61 A;  2FGR A;  2X9K A;  3BS0 A;  1P4T A;  4LSF A;  4AYD C;  4CTD A;  4O3X B;  2ERV A;  4AKR B;  4KR4 A;  3AA1 A;  1ZHZ A;  3T20 A;  3C5O A;  4LSE A;  3VZT X;  2R4N A;  4O3W A;  5GV0 A;  4AYI D;  1BH3 A;  5DL8 A;  2LHF A;  5KAI O;  2J4U P;  4GCQ A;  3PGU A;  2XE1 A;  2N2M A;  4RL9 A;  2R4P A;  3PGR A;  3DA4 A;  2WJQ A;  2ZFG A;  5GTH O;  4LSH A;  1ZHT A;  3HW9 A;  5JDP A;  3AAA B;  4FSO A;  3K19 A;  1BXW A;  3LK3 A;  2XE2 A;  1Q9F A;  2X27 X;  3KZI O;  5T5F A;  1T1L A;  3UPG A;  1QJ8 A;  6PRN A;  2ODJ A;  2XG6 A;  3VE2 A;  2K0L A;  3TZG A;  2M06 A;  2F1C X;  1GFM A;  1OPF A;  3A0H O;  4FUV A;  4FZN A;  4O49 A;  5EE2 A;  3LK4 2;  1PHO A;  2IWV A;  2POR A;  2N2L A;  2W81 C;  4O3Z A;  3UU2 A;  4G75 A;  4E1T A;  3SYS A;  3AAE A;  2JQY A;  4GHB A;  4RJW A;  4FQE A;  3PQS A;  3VY8 X;  3VZW X;  4N59 A;  2FGQ X;  5DL6 A;  2R88 A;  4E1S A;  4LSI A;  5IYU A;  2Y0H A;  1YS5 A;  1QJP A;  2R8A A;  2R4L A;  4FZL A;  2GE4 A;  2Y0L A;  4AYM C;  1H6S 1;  5G3A A;  4K3B A;  8PRN A;  3KVD D;  2IWW A;  2J1N A;  1PRN A;  3LK3 B;  5E79 O;  5AFU K;  4U9C A;  4GF4 A;  3AA7 A;  4C69 X;  3GP6 A;  1THQ A;  3PQU A; 
#chains in the Genus database with same CATH homology
 3DWN A;  1T16 A;  2R89 A;  3PGU A;  2R88 A;  3PF1 A;  2R8A A;  3BRZ A;  3PGS A;  1T1L A;  2R4O A;  3DWO X;  2R4P A;  3BRY A;  3PGR A;  2R4N A;  2R4L A;  3BS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...