1T1LA

Crystal structure of the long-chain fatty acid transporter fadl
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
421
structure length
421
Chain Sequence
AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the long-chain fatty acid transporter FadL.
pubmed doi rcsb
molecule keywords Long-chain fatty acid transport protein
molecule tags Lipid transport
source organism Escherichia coli
total genus 102
structure length 421
sequence length 421
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 1t1lA00
2R4LA 2R4NA 3PGUA 3PGSA 2R4PA 2R8AA 3BRYA 1T1LA 2R4OA 3BS0A 3PGRA 3DWOX 2R88A 3BRZA 3PF1A 2R89A 1T16A 3DWNA
chains in the Genus database with same CATH superfamily
3DA4A 4LSFA 2MNHA 4RLBA 2KXPA 3T0SA 2XG6A 4FRXA 4O49A 1GFQA 4FMSA 5DL7A 5B66O 2XE3A 4FZLA 4G75A 1HXTA 3VZUX 4N58A 2F1CX 4AYID 4AKRB 4AYMC 4C00A 4E1TA 5JDPA 3A2SX 5G26A 2O4VA 3AAEB 2R88A 5PRNA 1ZHXA 5E79O 4D5UA 4O4XA 1OSMA 1MM4A 2YNKA 3PORA 2QTKA 2XE2A 2KZ7B 4BUMX 5EE2A 3PQSA 5KAIO 4RLCA 4FRTA 3VE2A 1ZHWA 1THQA 3SYBA 3LK41 4GCSA 4KR4A 3PGRA 1QJ8A 3SY9A 3QRAA 4XNKA 3JCUO 4FUVA 1IZNA 2Y7SA 3T24A 2R4OA 3BS0A 4GHBA 3SY7A 4KRAA 4KR8A 1HXUA 2K0LA 3VZWX 2R89A 3T20A 1GFNA 1Q9GA 3DWNA 3PQUA 3VY9X 4Z3TA 1ORMA 4PJ0O 4PR7A 4D65A 5H2FO 3AA1A 4AFKA 4UB8O 2JQYA 3V8UA 7PRNA 3LK42 4RJWA 3GP6A 2R4LA 3PRNA 4K3CA 5AFUL 3AA6A 3A0BO 3AA0A 3C5OA 2R8AA 3BRYA 3HWBA 1ZHZA 3O0EA 5DL8A 4O4UA 4AYDC 4RL9A 1BH3A 4F4BA 2ODJA 2KXPB 3K19A 4O3XB 5G39A 3HOLA 4QQ1A 4D64A 5IYUA 2ERVA 1S5LO 2Y0HA 5G3AA 3DZMA 3AA6B 3AA7A 4GCPA 3AA0B 4JFBA 4GF4A 1ZHTA 2LFUA 3BRZA 4JCHA 2XTRA 1QJ9A 2WVPA 4LSIA 2K4TA 3KZIO 1GFMA 3PGSA 4N75A 3WI4A 4AUIA 4UB6O 4AZLA 6PRNA 4FQEA 4FZNA 3G7GA 3AA7B 2J4UP 4C4VA 4K3BA 8PRNA 1E54A 5DL6A 5T5FA 3RBHA 1PHOA 5AFUK 2W81C 3DWOX 1IZNB 5KAFO 2FGRA 2GE4A 2X27X 2AXTO 3FYXA 2PORA 1BT9A 2KDYA 2ZFGA 1GFPA 3DA3A 3POXA 4G76A 4PUXA 4XNLA 2XE5A 4GCQA 3KVDD 4LSEA 2YPVA 4C4VB 2XTQA 4FESA 3LK3A 2XE1A 3VZTX 2XMXA 1H6S1 3AA1B 2F1TA 3QRCA 1GFOA 2J1NA 2R4NA 1BXWA 2MHLA 3A0HO 3PGUA 4N74A 2WJQA 3SZVA 1G90A 2OMFA 4AKMA 5B5EO 4E1SA 3POQA 4CTDA 3AAAA 4B61A 2M06A 2PRNA 5D5DA 5ADXL 4O3ZA 4FOZA 4LSHA 2N2LA 2X9KA 4AKRA 3EMNX 3LK2A 2JMMA 4FSOA 4RJXA 3UPGA 3AAEA 3NJTA 1HXXA 1MPFA 3AAAB 1PRNA 1T1LA 4AYEC 3HOEA 2KZ7A 2LHFA 1OPFA 4O3YA 4C69X 5GV0A 3LK2B 2KC0A 1YS5A 2R4PA 3UU2A 5G38A 3WU2O 4FSPA 5GTHO 2N2MA 3WI5A 2F1VA 3POUA 2IWWA 1T16A 3NSGA 3VY8X 1ZHYA 5FVNA 2W80C 1QJPA 2ZLDA 1Q9FA 3UAQA 5GTIO 2Y0KA 5ADXK 2IWVA 2M07A 4FZMA 4O3WA 5TISO 2Y2XA 3SZDA 3HW9A 2FGQX 3LK3B 4N59A 4IL6O 3TZGA 5DL5A 4U9CA 3SYSA 2WJRA 3VE1A 4FT6A 3JTYA 3PF1A 4AYNA 2Y0LA 1MM5A 1P4TA
chains in the Genus database with same CATH topology
2R4LA 2R4NA 3PGUA 3PGSA 2R4PA 2R8AA 3BRYA 1T1LA 2R4OA 3BS0A 3PGRA 3DWOX 2R88A 3BRZA 3PF1A 2R89A 1T16A 3DWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4L A;  2R4N A;  3PGU A;  3PGS A;  2R4P A;  2R8A A;  3BRY A;  1T1L A;  2R4O A;  3BS0 A;  3PGR A;  3DWO X;  2R88 A;  3BRZ A;  3PF1 A;  2R89 A;  1T16 A;  3DWN A; 
#chains in the Genus database with same CATH topology
 3DA4 A;  4LSF A;  2MNH A;  4RLB A;  2KXP A;  3T0S A;  2XG6 A;  4FRX A;  4O49 A;  1GFQ A;  4FMS A;  5DL7 A;  5B66 O;  2XE3 A;  4FZL A;  4G75 A;  1HXT A;  3VZU X;  4N58 A;  2F1C X;  4AYI D;  4AKR B;  4AYM C;  4C00 A;  4E1T A;  5JDP A;  3A2S X;  5G26 A;  2O4V A;  3AAE B;  2R88 A;  5PRN A;  1ZHX A;  5E79 O;  4D5U A;  4O4X A;  1OSM A;  1MM4 A;  2YNK A;  3POR A;  2QTK A;  2XE2 A;  2KZ7 B;  4BUM X;  5EE2 A;  3PQS A;  5KAI O;  4RLC A;  4FRT A;  3VE2 A;  1ZHW A;  1THQ A;  3SYB A;  3LK4 1;  4GCS A;  4KR4 A;  3PGR A;  1QJ8 A;  3SY9 A;  3QRA A;  4XNK A;  3JCU O;  4FUV A;  1IZN A;  2Y7S A;  3T24 A;  2R4O A;  3BS0 A;  4GHB A;  3SY7 A;  4KRA A;  4KR8 A;  1HXU A;  2K0L A;  3VZW X;  2R89 A;  3T20 A;  1GFN A;  1Q9G A;  3DWN A;  3PQU A;  3VY9 X;  4Z3T A;  1ORM A;  4PJ0 O;  4PR7 A;  4D65 A;  5H2F O;  3AA1 A;  4AFK A;  4UB8 O;  2JQY A;  3V8U A;  7PRN A;  3LK4 2;  4RJW A;  3GP6 A;  2R4L A;  3PRN A;  4K3C A;  5AFU L;  3AA6 A;  3A0B O;  3AA0 A;  3C5O A;  2R8A A;  3BRY A;  3HWB A;  1ZHZ A;  3O0E A;  5DL8 A;  4O4U A;  4AYD C;  4RL9 A;  1BH3 A;  4F4B A;  2ODJ A;  2KXP B;  3K19 A;  4O3X B;  5G39 A;  3HOL A;  4QQ1 A;  4D64 A;  5IYU A;  2ERV A;  1S5L O;  2Y0H A;  5G3A A;  3DZM A;  3AA6 B;  3AA7 A;  4GCP A;  3AA0 B;  4JFB A;  4GF4 A;  1ZHT A;  2LFU A;  3BRZ A;  4JCH A;  2XTR A;  1QJ9 A;  2WVP A;  4LSI A;  2K4T A;  3KZI O;  1GFM A;  3PGS A;  4N75 A;  3WI4 A;  4AUI A;  4UB6 O;  4AZL A;  6PRN A;  4FQE A;  4FZN A;  3G7G A;  3AA7 B;  2J4U P;  4C4V A;  4K3B A;  8PRN A;  1E54 A;  5DL6 A;  5T5F A;  3RBH A;  1PHO A;  5AFU K;  2W81 C;  3DWO X;  1IZN B;  5KAF O;  2FGR A;  2GE4 A;  2X27 X;  2AXT O;  3FYX A;  2POR A;  1BT9 A;  2KDY A;  2ZFG A;  1GFP A;  3DA3 A;  3POX A;  4G76 A;  4PUX A;  4XNL A;  2XE5 A;  4GCQ A;  3KVD D;  4LSE A;  2YPV A;  4C4V B;  2XTQ A;  4FES A;  3LK3 A;  2XE1 A;  3VZT X;  2XMX A;  1H6S 1;  3AA1 B;  2F1T A;  3QRC A;  1GFO A;  2J1N A;  2R4N A;  1BXW A;  2MHL A;  3A0H O;  3PGU A;  4N74 A;  2WJQ A;  3SZV A;  1G90 A;  2OMF A;  4AKM A;  5B5E O;  4E1S A;  3POQ A;  4CTD A;  3AAA A;  4B61 A;  2M06 A;  2PRN A;  5D5D A;  5ADX L;  4O3Z A;  4FOZ A;  4LSH A;  2N2L A;  2X9K A;  4AKR A;  3EMN X;  3LK2 A;  2JMM A;  4FSO A;  4RJX A;  3UPG A;  3AAE A;  3NJT A;  1HXX A;  1MPF A;  3AAA B;  1PRN A;  1T1L A;  4AYE C;  3HOE A;  2KZ7 A;  2LHF A;  1OPF A;  4O3Y A;  4C69 X;  5GV0 A;  3LK2 B;  2KC0 A;  1YS5 A;  2R4P A;  3UU2 A;  5G38 A;  3WU2 O;  4FSP A;  5GTH O;  2N2M A;  3WI5 A;  2F1V A;  3POU A;  2IWW A;  1T16 A;  3NSG A;  3VY8 X;  1ZHY A;  5FVN A;  2W80 C;  1QJP A;  2ZLD A;  1Q9F A;  3UAQ A;  5GTI O;  2Y0K A;  5ADX K;  2IWV A;  2M07 A;  4FZM A;  4O3W A;  5TIS O;  2Y2X A;  3SZD A;  3HW9 A;  2FGQ X;  3LK3 B;  4N59 A;  4IL6 O;  3TZG A;  5DL5 A;  4U9C A;  3SYS A;  2WJR A;  3VE1 A;  4FT6 A;  3JTY A;  3PF1 A;  4AYN A;  2Y0L A;  1MM5 A;  1P4T A; 
#chains in the Genus database with same CATH homology
 2R4L A;  2R4N A;  3PGU A;  3PGS A;  2R4P A;  2R8A A;  3BRY A;  1T1L A;  2R4O A;  3BS0 A;  3PGR A;  3DWO X;  2R88 A;  3BRZ A;  3PF1 A;  2R89 A;  1T16 A;  3DWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...