1T1LA

Crystal structure of the long-chain fatty acid transporter fadl
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
421
structure length
421
Chain Sequence
AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the long-chain fatty acid transporter FadL.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid transport
molecule keywords Long-chain fatty acid transport protein
total genus 102
structure length 421
sequence length 421
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 1t1lA00
1T1LA 2R4OA 2R4PA 3PF1A 2R89A 3BRZA 2R88A 2R4NA 3DWNA 3PGRA 2R4LA 3PGUA 3DWOX 2R8AA 3PGSA 3BRYA 3BS0A 1T16A
chains in the Genus database with same CATH superfamily
4AZLA 3UPGA 2M07A 2YNKA 3LK3B 4D65A 3VZWX 1PHOA 4AKRA 3BRYA 4C69X 3SY7A 2K0LA 1G90A 3POQA 1BT9A 3HOEA 4JCHA 2ODJA 2Y0LA 4KR4A 5EE2A 7PRNA 4BUMX 2R88A 3DZMA 2LFUA 4PR7A 5T5FA 2M06A 3PGSA 3PRNA 3RBHA 5KAFO 4AUIA 4FRXA 3T20A 3T24A 4XNLA 2R4PA 4GF4A 3UU2A 2X27X 2R89A 3HOLA 4FRTA 3LK42 4O49A 5FVNA 3PQSA 4LSFA 2R4LA 2X9KA 2W81C 1HXUA 1HXXA 2KZ7A 1PRNA 4GCSA 2ERVA 2IWWA 3PORA 3SY9A 2MNHA 4B61A 3TZGA 3AAAA 2R4NA 1QJPA 3WI5A 4AYDC 5AFUK 4XNKA 5GTHO 1MM5A 3A0HO 2XTQA 3A2SX 3BS0A 2MHLA 3DWOX 4AYID 1BH3A 1E54A 4O4XA 4C00A 2XTRA 4FZNA 1YS5A 2XE3A 4C4VB 4IL6O 3SYBA 2KC0A 3AA0B 3PQUA 4LSIA 1IZNA 3AA7A 1OSMA 1QJ8A 2IWVA 1GFOA 4K3BA 4K3CA 5PRNA 4AYNA 5B66O 3GP6A 5IYUA 3VZTX 2KXPA 3AAEB 3JTYA 4RLCA 4Z3TA 4O4UA 5D5DA 1GFQA 4AKMA 1ORMA 3LK41 2JMMA 4GCQA 4RL9A 2O4VA 3VZUX 4UB8O 3QRCA 4O3YA 3HWBA 2XE1A 2OMFA 4PJ0O 2R8AA 2PRNA 4FT6A 4CTDA 4LSEA 1S5LO 1GFPA 2R4OA 4N75A 2PORA 2F1CX 3PF1A 4FOZA 4PUXA 2J1NA 1MM4A 3SZDA 3NSGA 3C5OA 4FZMA 1Q9FA 4U9CA 1ZHWA 2KDYA 4N58A 2XMXA 3VE2A 2N2LA 2XE2A 5GV0A 4GHBA 5ADXL 2N2MA 3A0BO 3AAAB 1H6S1 2Y2XA 3DA3A 3POUA 1THQA 3DWNA 4GCPA 3LK3A 3NJTA 3KZIO 3WI4A 1P4TA 2QTKA 2J4UP 3AA6A 3VY8X 1Q9GA 5DL7A 4RJWA 3O0EA 3K19A 2Y0KA 4RJXA 1GFNA 3PGUA 4LSHA 4G75A 3T0SA 3G7GA 4FESA 5H2FO 4O3XB 5DL5A 2WVPA 3AA0A 3SYSA 3HW9A 2YPVA 3LK2A 4N59A 3AA7B 4KRAA 2ZFGA 2W80C 4O3ZA 4O3WA 5G3AA 3SZVA 4D5UA 3PGRA 1ZHZA 2GE4A 1T1LA 3LK2B 3AAEA 4UB6O 2F1TA 4JFBA 5DL6A 1GFMA 1OPFA 5G26A 5KAIO 4AFKA 8PRNA 3FYXA 2Y0HA 4FZLA 4D64A 2WJQA 5G38A 3AA1B 4FMSA 4AYMC 3VY9X 3V8UA 3BRZA 3QRAA 1BXWA 4FUVA 4G76A 5AFUL 5DL8A 2ZLDA 4FSOA 4KR8A 4RLBA 5TISO 2LHFA 1MPFA 2XE5A 4C4VA 3EMNX 1ZHXA 5E79O 1ZHTA 4FSPA 2AXTO 2WJRA 5B5EO 2KZ7B 1QJ9A 3JCUO 6PRNA 3KVDD 3DA4A 4AKRB 4QQ1A 3WU2O 4N74A 4E1TA 3POXA 2K4TA 1HXTA 2F1VA 3UAQA 3AA6B 2FGRA 5G39A 3VE1A 4F4BA 2JQYA 2KXPB 5JDPA 3AA1A 4FQEA 5GTIO 1T16A 4E1SA 4AYEC 1ZHYA 2FGQX 5ADXK 2Y7SA 2XG6A 1IZNB
chains in the Genus database with same CATH topology
1T1LA 2R4OA 2R4PA 3PF1A 2R89A 3BRZA 2R88A 2R4NA 3DWNA 3PGRA 2R4LA 3PGUA 3DWOX 2R8AA 3PGSA 3BRYA 3BS0A 1T16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T1L A;  2R4O A;  2R4P A;  3PF1 A;  2R89 A;  3BRZ A;  2R88 A;  2R4N A;  3DWN A;  3PGR A;  2R4L A;  3PGU A;  3DWO X;  2R8A A;  3PGS A;  3BRY A;  3BS0 A;  1T16 A; 
#chains in the Genus database with same CATH topology
 4AZL A;  3UPG A;  2M07 A;  2YNK A;  3LK3 B;  4D65 A;  3VZW X;  1PHO A;  4AKR A;  3BRY A;  4C69 X;  3SY7 A;  2K0L A;  1G90 A;  3POQ A;  1BT9 A;  3HOE A;  4JCH A;  2ODJ A;  2Y0L A;  4KR4 A;  5EE2 A;  7PRN A;  4BUM X;  2R88 A;  3DZM A;  2LFU A;  4PR7 A;  5T5F A;  2M06 A;  3PGS A;  3PRN A;  3RBH A;  5KAF O;  4AUI A;  4FRX A;  3T20 A;  3T24 A;  4XNL A;  2R4P A;  4GF4 A;  3UU2 A;  2X27 X;  2R89 A;  3HOL A;  4FRT A;  3LK4 2;  4O49 A;  5FVN A;  3PQS A;  4LSF A;  2R4L A;  2X9K A;  2W81 C;  1HXU A;  1HXX A;  2KZ7 A;  1PRN A;  4GCS A;  2ERV A;  2IWW A;  3POR A;  3SY9 A;  2MNH A;  4B61 A;  3TZG A;  3AAA A;  2R4N A;  1QJP A;  3WI5 A;  4AYD C;  5AFU K;  4XNK A;  5GTH O;  1MM5 A;  3A0H O;  2XTQ A;  3A2S X;  3BS0 A;  2MHL A;  3DWO X;  4AYI D;  1BH3 A;  1E54 A;  4O4X A;  4C00 A;  2XTR A;  4FZN A;  1YS5 A;  2XE3 A;  4C4V B;  4IL6 O;  3SYB A;  2KC0 A;  3AA0 B;  3PQU A;  4LSI A;  1IZN A;  3AA7 A;  1OSM A;  1QJ8 A;  2IWV A;  1GFO A;  4K3B A;  4K3C A;  5PRN A;  4AYN A;  5B66 O;  3GP6 A;  5IYU A;  3VZT X;  2KXP A;  3AAE B;  3JTY A;  4RLC A;  4Z3T A;  4O4U A;  5D5D A;  1GFQ A;  4AKM A;  1ORM A;  3LK4 1;  2JMM A;  4GCQ A;  4RL9 A;  2O4V A;  3VZU X;  4UB8 O;  3QRC A;  4O3Y A;  3HWB A;  2XE1 A;  2OMF A;  4PJ0 O;  2R8A A;  2PRN A;  4FT6 A;  4CTD A;  4LSE A;  1S5L O;  1GFP A;  2R4O A;  4N75 A;  2POR A;  2F1C X;  3PF1 A;  4FOZ A;  4PUX A;  2J1N A;  1MM4 A;  3SZD A;  3NSG A;  3C5O A;  4FZM A;  1Q9F A;  4U9C A;  1ZHW A;  2KDY A;  4N58 A;  2XMX A;  3VE2 A;  2N2L A;  2XE2 A;  5GV0 A;  4GHB A;  5ADX L;  2N2M A;  3A0B O;  3AAA B;  1H6S 1;  2Y2X A;  3DA3 A;  3POU A;  1THQ A;  3DWN A;  4GCP A;  3LK3 A;  3NJT A;  3KZI O;  3WI4 A;  1P4T A;  2QTK A;  2J4U P;  3AA6 A;  3VY8 X;  1Q9G A;  5DL7 A;  4RJW A;  3O0E A;  3K19 A;  2Y0K A;  4RJX A;  1GFN A;  3PGU A;  4LSH A;  4G75 A;  3T0S A;  3G7G A;  4FES A;  5H2F O;  4O3X B;  5DL5 A;  2WVP A;  3AA0 A;  3SYS A;  3HW9 A;  2YPV A;  3LK2 A;  4N59 A;  3AA7 B;  4KRA A;  2ZFG A;  2W80 C;  4O3Z A;  4O3W A;  5G3A A;  3SZV A;  4D5U A;  3PGR A;  1ZHZ A;  2GE4 A;  1T1L A;  3LK2 B;  3AAE A;  4UB6 O;  2F1T A;  4JFB A;  5DL6 A;  1GFM A;  1OPF A;  5G26 A;  5KAI O;  4AFK A;  8PRN A;  3FYX A;  2Y0H A;  4FZL A;  4D64 A;  2WJQ A;  5G38 A;  3AA1 B;  4FMS A;  4AYM C;  3VY9 X;  3V8U A;  3BRZ A;  3QRA A;  1BXW A;  4FUV A;  4G76 A;  5AFU L;  5DL8 A;  2ZLD A;  4FSO A;  4KR8 A;  4RLB A;  5TIS O;  2LHF A;  1MPF A;  2XE5 A;  4C4V A;  3EMN X;  1ZHX A;  5E79 O;  1ZHT A;  4FSP A;  2AXT O;  2WJR A;  5B5E O;  2KZ7 B;  1QJ9 A;  3JCU O;  6PRN A;  3KVD D;  3DA4 A;  4AKR B;  4QQ1 A;  3WU2 O;  4N74 A;  4E1T A;  3POX A;  2K4T A;  1HXT A;  2F1V A;  3UAQ A;  3AA6 B;  2FGR A;  5G39 A;  3VE1 A;  4F4B A;  2JQY A;  2KXP B;  5JDP A;  3AA1 A;  4FQE A;  5GTI O;  1T16 A;  4E1S A;  4AYE C;  1ZHY A;  2FGQ X;  5ADX K;  2Y7S A;  2XG6 A;  1IZN B; 
#chains in the Genus database with same CATH homology
 1T1L A;  2R4O A;  2R4P A;  3PF1 A;  2R89 A;  3BRZ A;  2R88 A;  2R4N A;  3DWN A;  3PGR A;  2R4L A;  3PGU A;  3DWO X;  2R8A A;  3PGS A;  3BRY A;  3BS0 A;  1T16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...