2X9KA

Structure of a e.coli porin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
278
structure length
278
Chain Sequence
RNDWHFNIGAMYEIENVEGYGEDMDGLAEPSVYFNAANGPWRIALAYYQEGPVDYSAGKRGTWFDRPELEVHYQFLENDDFSFGLTGGFRNYGYHYVDEPGKDTANMQRWKIAPDWDVKLTDDLRFNGWLSMYKFANDLNTTGYADTRVETETGLQYTFNETVALRVNYYLERGFNMDDSRNNGEFSTQEIRAYLPLTLGNHSVTPYTRIGLDRWSNWDWQDDIEREGADFNRVGLFYGYDFQNGLSVSLEYAFEWQDADEGDSDKFHYAGVGVNYSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords OUTER MEMBRANE PROTEIN G
publication title Correlation between the Ompg Secondary Structure and its Ph-Dependent Alterations Monitored by Ftir.
pubmed doi rcsb
source organism Escherichia coli
total genus 70
structure length 278
sequence length 278
ec nomenclature
pdb deposition date 2010-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09381 Porin_OmpG Outer membrane protein G (OmpG)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.40 Mainly Beta Beta Barrel Porin monomeric porin ompg 2x9kA00
2IWVA 4CTDA 2WVPA 2WJRA 4FQEA 2WJQA 2JQYA 2X9KA 4PR7A 2F1CX 2IWWA
chains in the Genus database with same CATH superfamily
1GFQA 2MNHA 2AXTO 4FSPA 1H6S1 1T1LA 1QJ8A 3KVDD 3VY9X 4GHBA 1P4TA 2FGRA 3BRZA 4KRAA 5FVNA 2R4OA 2IWWA 1BT9A 3POQA 4LSIA 4O3YA 2XE1A 4FZNA 2OMFA 4QQ1A 3BRYA 1OSMA 4FRXA 5T5FA 4G75A 1HXXA 5IYUA 2R4PA 2ZLDA 3AA6A 2N2MA 4N59A 3O0EA 1ZHTA 3AA0B 5B66O 3AA0A 1ORMA 1Q9GA 4FZLA 4AFKA 5AFUK 4XNKA 3T20A 3G7GA 4PUXA 3T24A 1PHOA 4D64A 5ADXK 2K4TA 1QJ9A 2W81C 5H2FO 4O3WA 3WU2O 4GF4A 5G38A 2KC0A 3QRAA 3POXA 4PR7A 3SZVA 4N74A 1ZHYA 5KAFO 3WI4A 2X27X 4PJ0O 4UB8O 2Y0LA 3PQUA 2R4LA 3A2SX 4GCQA 4RL9A 3LK42 4O4UA 4E1SA 5GV0A 1IZNA 5D5DA 4C4VA 1E54A 3PGRA 3GP6A 1MPFA 2LHFA 3AA7B 3AA7A 3DZMA 4LSHA 3JCUO 3TZGA 4AUIA 2KZ7B 1G90A 2KZ7A 3POUA 4N58A 4O3ZA 2IWVA 3T0SA 4LSFA 3AA6B 3DWOX 4G76A 4N75A 2WVPA 3LK3B 3LK3A 3EMNX 3PQSA 4FUVA 3BS0A 4K3BA 3VE2A 2X9KA 3UU2A 2XE5A 1MM4A 5AFUL 5ADXL 2W80C 2JMMA 1ZHXA 3WI5A 4O3XB 1T16A 4CTDA 4O4XA 2FGQX 2QTKA 1MM5A 4O49A 2R89A 2R88A 4AYDC 3RBHA 4C69X 4FT6A 4AKRB 2MHLA 4AKRA 3SZDA 2F1TA 1QJPA 1Q9FA 3NSGA 4JCHA 4RJWA 2Y0KA 5E79O 2KDYA 4AYNA 2M07A 1BXWA 3NJTA 2F1VA 4K3CA 3SY7A 2Y2XA 1IZNB 4LSEA 4JFBA 4AYID 4AZLA 4C00A 4C4VB 2WJRA 2KXPA 7PRNA 5DL6A 4U9CA 4E1TA 3HW9A 4KR4A 2R4NA 5DL8A 4FESA 3KZIO 3VE1A 1GFNA 2Y7SA 2LFUA 2J1NA 2XG6A 5EE2A 2PRNA 3AA1B 3AA1A 4RLBA 2ERVA 3AAAB 4AYEC 2ODJA 3AAAA 4XNLA 4FRTA 3FYXA 1BH3A 3VZWX 4GCPA 3DWNA 2ZFGA 1GFMA 5GTHO 4GCSA 3LK2B 4Z3TA 3LK2A 3VZUX 6PRNA 4AYMC 2XMXA 3C5OA 5G39A 4D65A 2YNKA 3UAQA 4BUMX 2YPVA 4FMSA 1PRNA 2O4VA 4RJXA 3VZTX 2GE4A 3HWBA 1GFPA 4FZMA 2XE2A 1YS5A 3PF1A 1S5LO 5DL7A 2WJQA 4B61A 3PGUA 5JDPA 2PORA 3HOLA 1GFOA 4FOZA 1HXTA 3LK41 5GTIO 2XTQA 5KAIO 2XE3A 3A0BO 3V8UA 4FQEA 2KXPB 4FSOA 5G26A 2XTRA 4D5UA 3SYSA 3VY8X 3A0HO 3DA3A 2J4UP 1ZHZA 3PGSA 2K0LA 4UB6O 3SY9A 5B5EO 1ZHWA 2M06A 2N2LA 5DL5A 5TISO 3SYBA 5G3AA 3PRNA 1THQA 3K19A 1HXUA 4KR8A 4RLCA 8PRNA 3PORA 4F4BA 4AKMA 4IL6O 3AAEB 3AAEA 5PRNA 3QRCA 3HOEA 2JQYA 2R8AA 2Y0HA 3UPGA 3JTYA 2F1CX 3DA4A 1OPFA
chains in the Genus database with same CATH topology
2IWVA 4CTDA 2WVPA 2WJRA 4FQEA 2WJQA 2JQYA 2X9KA 4PR7A 2F1CX 2IWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IWV A;  4CTD A;  2WVP A;  2WJR A;  4FQE A;  2WJQ A;  2JQY A;  2X9K A;  4PR7 A;  2F1C X;  2IWW A; 
#chains in the Genus database with same CATH topology
 1GFQ A;  2MNH A;  2AXT O;  4FSP A;  1H6S 1;  1T1L A;  1QJ8 A;  3KVD D;  3VY9 X;  4GHB A;  1P4T A;  2FGR A;  3BRZ A;  4KRA A;  5FVN A;  2R4O A;  2IWW A;  1BT9 A;  3POQ A;  4LSI A;  4O3Y A;  2XE1 A;  4FZN A;  2OMF A;  4QQ1 A;  3BRY A;  1OSM A;  4FRX A;  5T5F A;  4G75 A;  1HXX A;  5IYU A;  2R4P A;  2ZLD A;  3AA6 A;  2N2M A;  4N59 A;  3O0E A;  1ZHT A;  3AA0 B;  5B66 O;  3AA0 A;  1ORM A;  1Q9G A;  4FZL A;  4AFK A;  5AFU K;  4XNK A;  3T20 A;  3G7G A;  4PUX A;  3T24 A;  1PHO A;  4D64 A;  5ADX K;  2K4T A;  1QJ9 A;  2W81 C;  5H2F O;  4O3W A;  3WU2 O;  4GF4 A;  5G38 A;  2KC0 A;  3QRA A;  3POX A;  4PR7 A;  3SZV A;  4N74 A;  1ZHY A;  5KAF O;  3WI4 A;  2X27 X;  4PJ0 O;  4UB8 O;  2Y0L A;  3PQU A;  2R4L A;  3A2S X;  4GCQ A;  4RL9 A;  3LK4 2;  4O4U A;  4E1S A;  5GV0 A;  1IZN A;  5D5D A;  4C4V A;  1E54 A;  3PGR A;  3GP6 A;  1MPF A;  2LHF A;  3AA7 B;  3AA7 A;  3DZM A;  4LSH A;  3JCU O;  3TZG A;  4AUI A;  2KZ7 B;  1G90 A;  2KZ7 A;  3POU A;  4N58 A;  4O3Z A;  2IWV A;  3T0S A;  4LSF A;  3AA6 B;  3DWO X;  4G76 A;  4N75 A;  2WVP A;  3LK3 B;  3LK3 A;  3EMN X;  3PQS A;  4FUV A;  3BS0 A;  4K3B A;  3VE2 A;  2X9K A;  3UU2 A;  2XE5 A;  1MM4 A;  5AFU L;  5ADX L;  2W80 C;  2JMM A;  1ZHX A;  3WI5 A;  4O3X B;  1T16 A;  4CTD A;  4O4X A;  2FGQ X;  2QTK A;  1MM5 A;  4O49 A;  2R89 A;  2R88 A;  4AYD C;  3RBH A;  4C69 X;  4FT6 A;  4AKR B;  2MHL A;  4AKR A;  3SZD A;  2F1T A;  1QJP A;  1Q9F A;  3NSG A;  4JCH A;  4RJW A;  2Y0K A;  5E79 O;  2KDY A;  4AYN A;  2M07 A;  1BXW A;  3NJT A;  2F1V A;  4K3C A;  3SY7 A;  2Y2X A;  1IZN B;  4LSE A;  4JFB A;  4AYI D;  4AZL A;  4C00 A;  4C4V B;  2WJR A;  2KXP A;  7PRN A;  5DL6 A;  4U9C A;  4E1T A;  3HW9 A;  4KR4 A;  2R4N A;  5DL8 A;  4FES A;  3KZI O;  3VE1 A;  1GFN A;  2Y7S A;  2LFU A;  2J1N A;  2XG6 A;  5EE2 A;  2PRN A;  3AA1 B;  3AA1 A;  4RLB A;  2ERV A;  3AAA B;  4AYE C;  2ODJ A;  3AAA A;  4XNL A;  4FRT A;  3FYX A;  1BH3 A;  3VZW X;  4GCP A;  3DWN A;  2ZFG A;  1GFM A;  5GTH O;  4GCS A;  3LK2 B;  4Z3T A;  3LK2 A;  3VZU X;  6PRN A;  4AYM C;  2XMX A;  3C5O A;  5G39 A;  4D65 A;  2YNK A;  3UAQ A;  4BUM X;  2YPV A;  4FMS A;  1PRN A;  2O4V A;  4RJX A;  3VZT X;  2GE4 A;  3HWB A;  1GFP A;  4FZM A;  2XE2 A;  1YS5 A;  3PF1 A;  1S5L O;  5DL7 A;  2WJQ A;  4B61 A;  3PGU A;  5JDP A;  2POR A;  3HOL A;  1GFO A;  4FOZ A;  1HXT A;  3LK4 1;  5GTI O;  2XTQ A;  5KAI O;  2XE3 A;  3A0B O;  3V8U A;  4FQE A;  2KXP B;  4FSO A;  5G26 A;  2XTR A;  4D5U A;  3SYS A;  3VY8 X;  3A0H O;  3DA3 A;  2J4U P;  1ZHZ A;  3PGS A;  2K0L A;  4UB6 O;  3SY9 A;  5B5E O;  1ZHW A;  2M06 A;  2N2L A;  5DL5 A;  5TIS O;  3SYB A;  5G3A A;  3PRN A;  1THQ A;  3K19 A;  1HXU A;  4KR8 A;  4RLC A;  8PRN A;  3POR A;  4F4B A;  4AKM A;  4IL6 O;  3AAE B;  3AAE A;  5PRN A;  3QRC A;  3HOE A;  2JQY A;  2R8A A;  2Y0H A;  3UPG A;  3JTY A;  2F1C X;  3DA4 A;  1OPF A; 
#chains in the Genus database with same CATH homology
 2IWV A;  4CTD A;  2WVP A;  2WJR A;  4FQE A;  2WJQ A;  2JQY A;  2X9K A;  4PR7 A;  2F1C X;  2IWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...