2X9KA

Structure of a e.coli porin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
278
structure length
278
Chain Sequence
RNDWHFNIGAMYEIENVEGYGEDMDGLAEPSVYFNAANGPWRIALAYYQEGPVDYSAGKRGTWFDRPELEVHYQFLENDDFSFGLTGGFRNYGYHYVDEPGKDTANMQRWKIAPDWDVKLTDDLRFNGWLSMYKFANDLNTTGYADTRVETETGLQYTFNETVALRVNYYLERGFNMDDSRNNGEFSTQEIRAYLPLTLGNHSVTPYTRIGLDRWSNWDWQDDIEREGADFNRVGLFYGYDFQNGLSVSLEYAFEWQDADEGDSDKFHYAGVGVNYSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN G
publication title Correlation between the Ompg Secondary Structure and its Ph-Dependent Alterations Monitored by Ftir.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 70
structure length 278
sequence length 278
ec nomenclature
pdb deposition date 2010-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09381 Porin_OmpG Outer membrane protein G (OmpG)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.40 Mainly Beta Beta Barrel Porin monomeric porin ompg 2x9kA00
2X9KA 4FQEA 2F1CX 2WJQA 2IWVA 2WVPA 2IWWA 4PR7A 4CTDA 2JQYA 2WJRA
chains in the Genus database with same CATH superfamily
3VY9X 4AZLA 2K0LA 4XNLA 8PRNA 4D65A 5JDPA 3HOLA 3SYSA 3T0SA 3VE1A 2LFUA 3AA7B 4N75A 2XE2A 3WI4A 5ADXK 4LSHA 2IWVA 4UB8O 3HOEA 4GF4A 4Z3TA 4O3XB 3AA1A 1GFOA 4BUMX 1IZNB 2FGRA 2XTRA 3QRAA 2PRNA 2R4OA 1Q9FA 2R88A 2Y7SA 1E54A 3A0BO 5DL5A 4JCHA 4AUIA 3LK3B 5TISO 1OSMA 5AFUL 4O4XA 1OPFA 1BH3A 2MNHA 1THQA 1YS5A 2J1NA 2XTQA 5DL6A 4G75A 1ORMA 5EE2A 3RBHA 4E1TA 4FT6A 5GTHO 2JMMA 4O3YA 4RL9A 4FRXA 2WJQA 4GHBA 2XE5A 4FZMA 2IWWA 3PF1A 3AAAB 4PUXA 1ZHYA 1ZHWA 3T20A 4FSPA 1T1LA 4C4VB 2R4NA 3NJTA 1HXXA 2W80C 5G3AA 3POQA 3PGSA 4LSEA 4RLBA 1IZNA 3TZGA 3T24A 4AYID 4FQEA 1QJ8A 2F1CX 2O4VA 6PRNA 5IYUA 2F1VA 2KDYA 2KZ7B 5KAFO 3SYBA 5E79O 5ADXL 4N58A 5PRNA 3WI5A 2JQYA 4E1SA 2ZLDA 2R89A 5H2FO 3PORA 3AA0B 4AKRA 2R8AA 4AYNA 4FOZA 3DA3A 3POUA 1GFPA 3AAEA 1GFQA 3BRZA 3PRNA 4IL6O 5FVNA 4C00A 4AYEC 3AA6A 3LK2B 3LK41 3A0HO 3LK42 4QQ1A 4AYMC 2YPVA 1G90A 2Y2XA 2XE3A 2ERVA 3BS0A 4KRAA 4U9CA 3PQUA 2GE4A 2N2LA 4RJWA 5DL7A 1PHOA 2PORA 5G39A 3SZDA 4C69X 4D5UA 4C4VA 3JTYA 3AA7A 1H6S1 3VZUX 1HXTA 3DA4A 5KAIO 4FRTA 4JFBA 3EMNX 4K3CA 4D64A 5AFUK 3UAQA 4N74A 3AA1B 3HW9A 2WJRA 3DWOX 3QRCA 2K4TA 1MM4A 2AXTO 4RLCA 3KZIO 2KC0A 3PGUA 3DWNA 1HXUA 3GP6A 1Q9GA 2KXPB 3C5OA 4PR7A 3DZMA 2YNKA 3HWBA 3LK3A 4FSOA 4G76A 3BRYA 2MHLA 3AA0A 3JCUO 5T5FA 2OMFA 5G38A 4FUVA 3VE2A 3SZVA 4AKMA 3G7GA 5B5EO 3UPGA 3VZTX 3VY8X 5G26A 3WU2O 2M07A 3POXA 3VZWX 4AYDC 4N59A 2F1TA 3LK2A 4GCPA 4FESA 4KR8A 1BT9A 3NSGA 4LSFA 1GFMA 2X9KA 4O4UA 1MM5A 3UU2A 2Y0LA 5DL8A 3K19A 1ZHXA 1S5LO 3SY7A 4O3ZA 3O0EA 4O3WA 3SY9A 4AFKA 1MPFA 2ZFGA 2R4LA 1QJ9A 1T16A 3AAAA 4XNKA 3PGRA 1ZHZA 2QTKA 3PQSA 5D5DA 3V8UA 2N2MA 4GCSA 4F4BA 7PRNA 4GCQA 2X27X 3FYXA 2WVPA 4PJ0O 1ZHTA 3KVDD 2FGQX 2Y0KA 1GFNA 2W81C 2XE1A 5B66O 4K3BA 3A2SX 4RJXA 2KXPA 1BXWA 2KZ7A 5GV0A 4FMSA 2ODJA 4KR4A 5GTIO 2LHFA 2XG6A 4B61A 2J4UP 4CTDA 4UB6O 4LSIA 4O49A 2XMXA 4AKRB 2Y0HA 4FZNA 1QJPA 3AAEB 1PRNA 2M06A 1P4TA 2R4PA 4FZLA 3AA6B
chains in the Genus database with same CATH topology
2X9KA 4FQEA 2F1CX 2WJQA 2IWVA 2WVPA 2IWWA 4PR7A 4CTDA 2JQYA 2WJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X9K A;  4FQE A;  2F1C X;  2WJQ A;  2IWV A;  2WVP A;  2IWW A;  4PR7 A;  4CTD A;  2JQY A;  2WJR A; 
#chains in the Genus database with same CATH topology
 3VY9 X;  4AZL A;  2K0L A;  4XNL A;  8PRN A;  4D65 A;  5JDP A;  3HOL A;  3SYS A;  3T0S A;  3VE1 A;  2LFU A;  3AA7 B;  4N75 A;  2XE2 A;  3WI4 A;  5ADX K;  4LSH A;  2IWV A;  4UB8 O;  3HOE A;  4GF4 A;  4Z3T A;  4O3X B;  3AA1 A;  1GFO A;  4BUM X;  1IZN B;  2FGR A;  2XTR A;  3QRA A;  2PRN A;  2R4O A;  1Q9F A;  2R88 A;  2Y7S A;  1E54 A;  3A0B O;  5DL5 A;  4JCH A;  4AUI A;  3LK3 B;  5TIS O;  1OSM A;  5AFU L;  4O4X A;  1OPF A;  1BH3 A;  2MNH A;  1THQ A;  1YS5 A;  2J1N A;  2XTQ A;  5DL6 A;  4G75 A;  1ORM A;  5EE2 A;  3RBH A;  4E1T A;  4FT6 A;  5GTH O;  2JMM A;  4O3Y A;  4RL9 A;  4FRX A;  2WJQ A;  4GHB A;  2XE5 A;  4FZM A;  2IWW A;  3PF1 A;  3AAA B;  4PUX A;  1ZHY A;  1ZHW A;  3T20 A;  4FSP A;  1T1L A;  4C4V B;  2R4N A;  3NJT A;  1HXX A;  2W80 C;  5G3A A;  3POQ A;  3PGS A;  4LSE A;  4RLB A;  1IZN A;  3TZG A;  3T24 A;  4AYI D;  4FQE A;  1QJ8 A;  2F1C X;  2O4V A;  6PRN A;  5IYU A;  2F1V A;  2KDY A;  2KZ7 B;  5KAF O;  3SYB A;  5E79 O;  5ADX L;  4N58 A;  5PRN A;  3WI5 A;  2JQY A;  4E1S A;  2ZLD A;  2R89 A;  5H2F O;  3POR A;  3AA0 B;  4AKR A;  2R8A A;  4AYN A;  4FOZ A;  3DA3 A;  3POU A;  1GFP A;  3AAE A;  1GFQ A;  3BRZ A;  3PRN A;  4IL6 O;  5FVN A;  4C00 A;  4AYE C;  3AA6 A;  3LK2 B;  3LK4 1;  3A0H O;  3LK4 2;  4QQ1 A;  4AYM C;  2YPV A;  1G90 A;  2Y2X A;  2XE3 A;  2ERV A;  3BS0 A;  4KRA A;  4U9C A;  3PQU A;  2GE4 A;  2N2L A;  4RJW A;  5DL7 A;  1PHO A;  2POR A;  5G39 A;  3SZD A;  4C69 X;  4D5U A;  4C4V A;  3JTY A;  3AA7 A;  1H6S 1;  3VZU X;  1HXT A;  3DA4 A;  5KAI O;  4FRT A;  4JFB A;  3EMN X;  4K3C A;  4D64 A;  5AFU K;  3UAQ A;  4N74 A;  3AA1 B;  3HW9 A;  2WJR A;  3DWO X;  3QRC A;  2K4T A;  1MM4 A;  2AXT O;  4RLC A;  3KZI O;  2KC0 A;  3PGU A;  3DWN A;  1HXU A;  3GP6 A;  1Q9G A;  2KXP B;  3C5O A;  4PR7 A;  3DZM A;  2YNK A;  3HWB A;  3LK3 A;  4FSO A;  4G76 A;  3BRY A;  2MHL A;  3AA0 A;  3JCU O;  5T5F A;  2OMF A;  5G38 A;  4FUV A;  3VE2 A;  3SZV A;  4AKM A;  3G7G A;  5B5E O;  3UPG A;  3VZT X;  3VY8 X;  5G26 A;  3WU2 O;  2M07 A;  3POX A;  3VZW X;  4AYD C;  4N59 A;  2F1T A;  3LK2 A;  4GCP A;  4FES A;  4KR8 A;  1BT9 A;  3NSG A;  4LSF A;  1GFM A;  2X9K A;  4O4U A;  1MM5 A;  3UU2 A;  2Y0L A;  5DL8 A;  3K19 A;  1ZHX A;  1S5L O;  3SY7 A;  4O3Z A;  3O0E A;  4O3W A;  3SY9 A;  4AFK A;  1MPF A;  2ZFG A;  2R4L A;  1QJ9 A;  1T16 A;  3AAA A;  4XNK A;  3PGR A;  1ZHZ A;  2QTK A;  3PQS A;  5D5D A;  3V8U A;  2N2M A;  4GCS A;  4F4B A;  7PRN A;  4GCQ A;  2X27 X;  3FYX A;  2WVP A;  4PJ0 O;  1ZHT A;  3KVD D;  2FGQ X;  2Y0K A;  1GFN A;  2W81 C;  2XE1 A;  5B66 O;  4K3B A;  3A2S X;  4RJX A;  2KXP A;  1BXW A;  2KZ7 A;  5GV0 A;  4FMS A;  2ODJ A;  4KR4 A;  5GTI O;  2LHF A;  2XG6 A;  4B61 A;  2J4U P;  4CTD A;  4UB6 O;  4LSI A;  4O49 A;  2XMX A;  4AKR B;  2Y0H A;  4FZN A;  1QJP A;  3AAE B;  1PRN A;  2M06 A;  1P4T A;  2R4P A;  4FZL A;  3AA6 B; 
#chains in the Genus database with same CATH homology
 2X9K A;  4FQE A;  2F1C X;  2WJQ A;  2IWV A;  2WVP A;  2IWW A;  4PR7 A;  4CTD A;  2JQY A;  2WJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...